BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9821

Length=795
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010525385.1|  PREDICTED: alpha-galactosidase                     350   4e-115   Tarenaya hassleriana [spider flower]
ref|XP_009363810.1|  PREDICTED: alpha-galactosidase-like                347   3e-114   
emb|CDY27226.1|  BnaA09g35760D                                          346   9e-114   Brassica napus [oilseed rape]
ref|XP_009116328.1|  PREDICTED: alpha-galactosidase isoform X2          346   1e-113   Brassica rapa
ref|XP_009116327.1|  PREDICTED: alpha-galactosidase isoform X1          347   1e-113   Brassica rapa
ref|XP_008369354.1|  PREDICTED: alpha-galactosidase                     345   2e-113   Malus domestica [apple tree]
gb|KDO44285.1|  hypothetical protein CISIN_1g012852mg                   345   3e-113   Citrus sinensis [apfelsine]
emb|CDX72148.1|  BnaC08g27260D                                          343   1e-112   
ref|XP_006486193.1|  PREDICTED: alpha-galactosidase-like                344   1e-112   Citrus sinensis [apfelsine]
ref|XP_002876361.1|  hypothetical protein ARALYDRAFT_486071             343   1e-112   
gb|KHG01835.1|  Alpha-galactosidase                                     340   2e-111   Gossypium arboreum [tree cotton]
ref|XP_007218029.1|  hypothetical protein PRUPE_ppa005977mg             340   3e-111   
ref|XP_006292164.1|  hypothetical protein CARUB_v10018370mg             337   1e-110   
ref|XP_010252089.1|  PREDICTED: alpha-galactosidase isoform X1          338   1e-110   Nelumbo nucifera [Indian lotus]
ref|XP_010427449.1|  PREDICTED: alpha-galactosidase-like                338   2e-110   Camelina sativa [gold-of-pleasure]
gb|KFK34880.1|  hypothetical protein AALP_AA5G205400                    337   2e-110   Arabis alpina [alpine rockcress]
ref|XP_009763014.1|  PREDICTED: alpha-galactosidase-like                333   3e-110   Nicotiana sylvestris
ref|XP_008233873.1|  PREDICTED: alpha-galactosidase                     337   3e-110   Prunus mume [ume]
gb|KEH35559.1|  alpha-galactosidase-like protein                        337   4e-110   Medicago truncatula
gb|KJB72967.1|  hypothetical protein B456_011G207400                    336   4e-110   Gossypium raimondii
ref|NP_974447.1|  melibiase family protein                              336   5e-110   Arabidopsis thaliana [mouse-ear cress]
gb|KJB72966.1|  hypothetical protein B456_011G207400                    336   6e-110   Gossypium raimondii
ref|XP_009606912.1|  PREDICTED: alpha-galactosidase-like                336   9e-110   Nicotiana tomentosiformis
ref|XP_007011349.1|  Melibiase family protein isoform 1                 336   1e-109   
ref|XP_012091162.1|  PREDICTED: alpha-galactosidase 3                   335   1e-109   Jatropha curcas
emb|CAB87430.1|  alpha-galactosidase-like protein                       335   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191190.2|  melibiase family protein                              335   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504530.1|  PREDICTED: alpha-galactosidase-like                335   3e-109   Camelina sativa [gold-of-pleasure]
ref|XP_011076596.1|  PREDICTED: alpha-galactosidase-like                334   4e-109   Sesamum indicum [beniseed]
ref|XP_010937999.1|  PREDICTED: alpha-galactosidase isoform X4          331   5e-109   
gb|AFK44983.1|  unknown                                                 326   6e-109   Lotus japonicus
ref|XP_011010658.1|  PREDICTED: alpha-galactosidase                     333   1e-108   Populus euphratica
ref|XP_009802955.1|  PREDICTED: alpha-galactosidase-like                333   1e-108   Nicotiana sylvestris
ref|XP_010516236.1|  PREDICTED: alpha-galactosidase-like                333   2e-108   Camelina sativa [gold-of-pleasure]
ref|XP_011084838.1|  PREDICTED: alpha-galactosidase-like                332   2e-108   Sesamum indicum [beniseed]
ref|XP_010937998.1|  PREDICTED: alpha-galactosidase isoform X3          329   2e-108   
ref|XP_002520852.1|  alpha-galactosidase/alpha-n-acetylgalactosam...    329   4e-108   
ref|XP_010322133.1|  PREDICTED: alpha-galactosidase                     331   5e-108   Solanum lycopersicum
ref|XP_010937996.1|  PREDICTED: alpha-galactosidase isoform X1          331   5e-108   
ref|XP_006403000.1|  hypothetical protein EUTSA_v10005987mg             331   8e-108   Eutrema salsugineum [saltwater cress]
emb|CDP13918.1|  unnamed protein product                                330   9e-108   Coffea canephora [robusta coffee]
ref|XP_006581728.1|  PREDICTED: alpha-galactosidase-like                330   1e-107   Glycine max [soybeans]
ref|XP_006366118.1|  PREDICTED: alpha-galactosidase-like                330   1e-107   
gb|KHN25820.1|  Alpha-galactosidase                                     330   1e-107   Glycine soja [wild soybean]
ref|XP_010253117.1|  PREDICTED: alpha-galactosidase-like isoform X1     330   1e-107   Nelumbo nucifera [Indian lotus]
ref|XP_010253118.1|  PREDICTED: alpha-galactosidase-like isoform X2     328   2e-107   Nelumbo nucifera [Indian lotus]
ref|XP_008374730.1|  PREDICTED: alpha-galactosidase-like                329   5e-107   
ref|XP_010670635.1|  PREDICTED: alpha-galactosidase                     328   5e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004502844.1|  PREDICTED: alpha-galactosidase-like isoform X1     327   2e-106   Cicer arietinum [garbanzo]
gb|AAU86897.1|  glycosyl hydrolase family-like protein                  326   4e-106   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010067604.1|  PREDICTED: alpha-galactosidase-like                326   5e-106   Eucalyptus grandis [rose gum]
gb|EPS71460.1|  glycosyl hydrolase family-like protein                  325   7e-106   Genlisea aurea
ref|XP_007137622.1|  hypothetical protein PHAVU_009G142100g             326   8e-106   Phaseolus vulgaris [French bean]
emb|CAN75523.1|  hypothetical protein VITISV_043596                     326   8e-106   Vitis vinifera
ref|XP_002279730.1|  PREDICTED: alpha-galactosidase                     325   9e-106   Vitis vinifera
ref|XP_002325481.2|  hypothetical protein POPTR_0019s08450g             325   2e-105   Populus trichocarpa [western balsam poplar]
ref|XP_010103637.1|  hypothetical protein L484_011230                   324   2e-105   
ref|XP_008808316.1|  PREDICTED: alpha-galactosidase                     323   6e-105   Phoenix dactylifera
ref|XP_004307724.1|  PREDICTED: alpha-galactosidase 3                   323   7e-105   Fragaria vesca subsp. vesca
ref|XP_011076595.1|  PREDICTED: alpha-galactosidase-like                321   3e-104   Sesamum indicum [beniseed]
ref|XP_004502845.1|  PREDICTED: alpha-galactosidase-like isoform X2     320   1e-103   
ref|XP_008456938.1|  PREDICTED: alpha-galactosidase isoform X1          319   3e-103   Cucumis melo [Oriental melon]
gb|KGN50728.1|  hypothetical protein Csa_5G220910                       318   4e-103   Cucumis sativus [cucumbers]
ref|NP_001292680.1|  alpha-galactosidase 3 precursor                    318   6e-103   Cucumis sativus [cucumbers]
ref|XP_006843705.1|  PREDICTED: alpha-galactosidase 3                   316   3e-102   Amborella trichopoda
ref|XP_003562450.1|  PREDICTED: alpha-galactosidase                     313   4e-101   Brachypodium distachyon [annual false brome]
gb|AHA84202.1|  alpha-galactosidase-like protein                        312   1e-100   Phaseolus vulgaris [French bean]
dbj|BAJ95779.1|  predicted protein                                      312   2e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002461216.1|  hypothetical protein SORBIDRAFT_02g042960          311   2e-100   Sorghum bicolor [broomcorn]
ref|XP_006435888.1|  hypothetical protein CICLE_v10034010mg             301   7e-100   
ref|NP_001130661.1|  hypothetical protein precursor                     310   1e-99    Zea mays [maize]
ref|XP_009404674.1|  PREDICTED: alpha-galactosidase                     309   2e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001060639.1|  Os07g0679300                                       309   2e-99    
ref|XP_006658965.1|  PREDICTED: alpha-galactosidase-like                311   2e-99    
gb|EEC82687.1|  hypothetical protein OsI_27343                          306   4e-98    Oryza sativa Indica Group [Indian rice]
gb|EPS61200.1|  glycosyl hydrolase family-like protein                  302   2e-97    Genlisea aurea
ref|XP_004958697.1|  PREDICTED: alpha-galactosidase-like                303   6e-97    Setaria italica
gb|KJB72965.1|  hypothetical protein B456_011G207400                    295   5e-94    Gossypium raimondii
gb|KCW65766.1|  hypothetical protein EUGRSUZ_G03128                     293   2e-93    Eucalyptus grandis [rose gum]
gb|EAZ41098.1|  hypothetical protein OsJ_25590                          292   1e-92    Oryza sativa Japonica Group [Japonica rice]
tpg|DAA55548.1|  TPA: hypothetical protein ZEAMMB73_350257              289   5e-89    
gb|EMT18876.1|  Alpha-galactosidase                                     278   8e-88    
gb|ACU20662.1|  unknown                                                 267   7e-84    Glycine max [soybeans]
ref|XP_002986493.1|  hypothetical protein SELMODRAFT_446636             268   1e-83    
gb|AFK38956.1|  unknown                                                 260   2e-83    Lotus japonicus
ref|XP_002523047.1|  alpha-galactosidase/alpha-n-acetylgalactosam...    259   2e-83    
ref|XP_002964911.1|  hypothetical protein SELMODRAFT_83268              267   2e-83    
ref|XP_002459951.1|  hypothetical protein SORBIDRAFT_02g018600          261   6e-82    
ref|XP_002459949.1|  hypothetical protein SORBIDRAFT_02g018590          258   3e-81    
sp|Q42656.1|AGAL_COFAR  RecName: Full=Alpha-galactosidase; AltNam...    260   4e-81    Coffea arabica [arabica coffee]
emb|CAI47559.1|  alpha galactosidase                                    261   6e-81    Coffea arabica [arabica coffee]
emb|CAI47560.1|  alpha-galactosidase                                    259   1e-80    Coffea canephora [robusta coffee]
ref|XP_010909867.1|  PREDICTED: alpha-galactosidase isoform X2          257   2e-80    Elaeis guineensis
ref|XP_008800438.1|  PREDICTED: alpha-galactosidase                     259   3e-80    Phoenix dactylifera
ref|XP_010274959.1|  PREDICTED: alpha-galactosidase                     259   3e-80    Nelumbo nucifera [Indian lotus]
ref|XP_001755838.1|  predicted protein                                  258   5e-80    
gb|KCW65110.1|  hypothetical protein EUGRSUZ_G02615                     257   6e-80    Eucalyptus grandis [rose gum]
emb|CAA74160.1|  alpha-galactosidase                                    251   9e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW57929.1|  hypothetical protein EUGRSUZ_H00669                     253   1e-79    Eucalyptus grandis [rose gum]
ref|XP_010909866.1|  PREDICTED: alpha-galactosidase isoform X1          258   1e-79    Elaeis guineensis
gb|AEB98600.1|  alpha-galactosidase                                     257   3e-79    Nicotiana tabacum [American tobacco]
ref|XP_010067046.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-galact...    257   3e-79    Eucalyptus grandis [rose gum]
ref|XP_009605413.1|  PREDICTED: alpha-galactosidase                     256   4e-79    Nicotiana tomentosiformis
gb|KEH42878.1|  alpha-galactosidase-like protein                        256   4e-79    Medicago truncatula
ref|XP_003574116.1|  PREDICTED: alpha-galactosidase                     256   5e-79    Brachypodium distachyon [annual false brome]
ref|XP_009760245.1|  PREDICTED: alpha-galactosidase                     256   6e-79    Nicotiana sylvestris
gb|AEB98601.1|  alpha-galactosidase                                     256   7e-79    Nicotiana tabacum [American tobacco]
gb|KCW57928.1|  hypothetical protein EUGRSUZ_H00669                     253   7e-79    Eucalyptus grandis [rose gum]
ref|XP_009397580.1|  PREDICTED: alpha-galactosidase-like                255   7e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002314831.2|  hypothetical protein POPTR_0010s12820g             255   9e-79    
gb|ABK24468.1|  unknown                                                 254   1e-78    Picea sitchensis
ref|XP_011038765.1|  PREDICTED: alpha-galactosidase-like                255   1e-78    Populus euphratica
gb|ABK25009.1|  unknown                                                 254   2e-78    Picea sitchensis
ref|XP_004495485.1|  PREDICTED: alpha-galactosidase-like                254   2e-78    Cicer arietinum [garbanzo]
ref|XP_002271010.1|  PREDICTED: alpha-galactosidase-like                253   2e-78    Vitis vinifera
ref|XP_006372279.1|  hypothetical protein POPTR_0018s14920g             255   2e-78    Populus trichocarpa [western balsam poplar]
ref|XP_009402637.1|  PREDICTED: alpha-galactosidase-like                254   2e-78    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU20102.1|  hypothetical protein MIMGU_mgv1a0068852mg               246   2e-78    Erythranthe guttata [common monkey flower]
ref|XP_002268711.1|  PREDICTED: alpha-galactosidase                     254   2e-78    Vitis vinifera
emb|CBI35340.3|  unnamed protein product                                254   3e-78    Vitis vinifera
gb|KFK25204.1|  hypothetical protein AALP_AA8G080700                    253   5e-78    Arabis alpina [alpine rockcress]
ref|XP_011017548.1|  PREDICTED: alpha-galactosidase-like                253   1e-77    Populus euphratica
gb|KCW57925.1|  hypothetical protein EUGRSUZ_H00669                     253   1e-77    Eucalyptus grandis [rose gum]
gb|KCW57924.1|  hypothetical protein EUGRSUZ_H00669                     253   1e-77    Eucalyptus grandis [rose gum]
dbj|BAC66445.1|  alpha-galactosidase                                    253   2e-77    Helianthus annuus
gb|KCW57926.1|  hypothetical protein EUGRSUZ_H00669                     252   2e-77    Eucalyptus grandis [rose gum]
ref|XP_006478162.1|  PREDICTED: alpha-galactosidase-like                251   3e-77    Citrus sinensis [apfelsine]
emb|CAN66885.1|  hypothetical protein VITISV_000962                     251   3e-77    Vitis vinifera
gb|EYU22322.1|  hypothetical protein MIMGU_mgv1a007981mg                248   4e-77    Erythranthe guttata [common monkey flower]
ref|XP_006848642.1|  PREDICTED: alpha-galactosidase                     250   9e-77    Amborella trichopoda
gb|KEH42875.1|  alpha-galactosidase-like protein                        250   9e-77    Medicago truncatula
pdb|1UAS|A  Chain A, Crystal Structure Of Rice Alpha-Galactosidase      249   1e-76    Oryza sativa [red rice]
gb|KHN14744.1|  Alpha-galactosidase                                     248   1e-76    Glycine soja [wild soybean]
sp|P14749.1|AGAL_CYATE  RecName: Full=Alpha-galactosidase; AltNam...    250   1e-76    Cyamopsis tetragonoloba [cluster bean]
ref|XP_010546252.1|  PREDICTED: alpha-galactosidase                     249   1e-76    Tarenaya hassleriana [spider flower]
ref|XP_002467020.1|  hypothetical protein SORBIDRAFT_01g018400          250   2e-76    Sorghum bicolor [broomcorn]
ref|XP_002978044.1|  hypothetical protein SELMODRAFT_108242             249   2e-76    
gb|KEH27106.1|  alpha-galactosidase-like protein                        249   2e-76    Medicago truncatula
ref|XP_003535399.2|  PREDICTED: alpha-galactosidase-like                249   2e-76    Glycine max [soybeans]
ref|XP_004299748.1|  PREDICTED: alpha-galactosidase                     249   3e-76    Fragaria vesca subsp. vesca
gb|AIL28756.1|  alpha galactosidase isoform 2                           248   3e-76    Cocos nucifera
ref|NP_001064939.2|  Os10g0493600                                       249   3e-76    
gb|EYU22321.1|  hypothetical protein MIMGU_mgv1a007981mg                248   4e-76    Erythranthe guttata [common monkey flower]
gb|KJB69469.1|  hypothetical protein B456_011G025100                    249   4e-76    Gossypium raimondii
emb|CDX81098.1|  BnaC03g03520D                                          248   4e-76    
gb|ADE77708.1|  unknown                                                 248   5e-76    Picea sitchensis
ref|XP_006351522.1|  PREDICTED: alpha-galactosidase-like                248   6e-76    Solanum tuberosum [potatoes]
ref|XP_003574114.2|  PREDICTED: alpha-galactosidase                     248   6e-76    Brachypodium distachyon [annual false brome]
ref|XP_009402016.1|  PREDICTED: alpha-galactosidase-like                243   7e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003619801.1|  Alpha galactosidase                                248   8e-76    Medicago truncatula
ref|XP_006289400.1|  hypothetical protein CARUB_v10002899mg             246   8e-76    
gb|ACF80887.1|  unknown                                                 248   1e-75    Zea mays [maize]
tpg|DAA49499.1|  TPA: hypothetical protein ZEAMMB73_096407              248   1e-75    
ref|NP_001142381.1|  uncharacterized protein LOC100274554 precursor     248   1e-75    Zea mays [maize]
ref|XP_007152504.1|  hypothetical protein PHAVU_004G135800g             248   1e-75    Phaseolus vulgaris [French bean]
gb|KHN24471.1|  Alpha-galactosidase                                     245   1e-75    Glycine soja [wild soybean]
ref|XP_007036959.1|  Alpha-galactosidase 2 isoform 6                    243   2e-75    
ref|NP_001233971.1|  alpha-galactosidase precursor                      247   2e-75    
ref|XP_010100576.1|  hypothetical protein L484_012133                   246   2e-75    
gb|KHM99768.1|  Alpha-galactosidase                                     247   2e-75    Glycine soja [wild soybean]
emb|CDY44771.1|  BnaC02g01160D                                          246   2e-75    Brassica napus [oilseed rape]
ref|XP_009125726.1|  PREDICTED: alpha-galactosidase-like                246   2e-75    Brassica rapa
gb|AAA73964.1|  alpha-galactosidase                                     247   2e-75    Phaseolus vulgaris [French bean]
ref|XP_004982750.1|  PREDICTED: alpha-galactosidase-like isoform X2     247   2e-75    Setaria italica
gb|ABK24922.1|  unknown                                                 246   2e-75    Picea sitchensis
ref|XP_006661897.1|  PREDICTED: alpha-galactosidase-like                245   2e-75    Oryza brachyantha
ref|XP_002271908.2|  PREDICTED: alpha-galactosidase                     246   3e-75    Vitis vinifera
ref|NP_001235022.1|  alpha galactosidase precursor                      247   3e-75    Glycine max [soybeans]
ref|XP_006599670.1|  PREDICTED: alpha-galactosidase-like isoform X2     246   3e-75    
ref|XP_011072096.1|  PREDICTED: alpha-galactosidase                     246   4e-75    Sesamum indicum [beniseed]
gb|EMS47307.1|  Alpha-galactosidase                                     246   5e-75    Triticum urartu
ref|XP_003548276.1|  PREDICTED: alpha-galactosidase-like isoform X1     246   5e-75    Glycine max [soybeans]
ref|XP_009389232.1|  PREDICTED: alpha-galactosidase-like                245   5e-75    
ref|XP_009131060.1|  PREDICTED: alpha-galactosidase isoform X1          245   6e-75    Brassica rapa
emb|CDX78339.1|  BnaA03g02510D                                          244   7e-75    
gb|KEH27104.1|  alpha-galactosidase-like protein                        245   9e-75    Medicago truncatula
ref|XP_007025711.1|  Alpha-galactosidase 2                              245   1e-74    
ref|XP_009387196.1|  PREDICTED: alpha-galactosidase-like                238   1e-74    Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW76293.1|  hypothetical protein EUGRSUZ_D00664                     243   2e-74    Eucalyptus grandis [rose gum]
ref|XP_010025990.1|  PREDICTED: probable alpha-galactosidase A          254   2e-74    
ref|XP_003552322.1|  PREDICTED: alpha-galactosidase-like isoform X1     244   3e-74    Glycine max [soybeans]
ref|XP_007023252.1|  Alpha-galactosidase 2                              244   3e-74    
ref|NP_001031855.1|  alpha-galactosidase 2                              243   3e-74    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002966697.1|  hypothetical protein SELMODRAFT_86208              243   4e-74    
ref|XP_009333844.1|  PREDICTED: alpha-galactosidase-like isoform X3     243   4e-74    Pyrus x bretschneideri [bai li]
ref|XP_007036958.1|  Alpha-galactosidase isoform 5                      243   4e-74    
ref|NP_568193.1|  alpha-galactosidase 2                                 243   4e-74    Arabidopsis thaliana [mouse-ear cress]
gb|KHN05008.1|  Alpha-galactosidase                                     243   4e-74    Glycine soja [wild soybean]
ref|XP_007036955.1|  Alpha-galactosidase isoform 2                      243   4e-74    
ref|XP_010252090.1|  PREDICTED: alpha-galactosidase isoform X2          242   4e-74    Nelumbo nucifera [Indian lotus]
ref|XP_007036954.1|  Alpha-galactosidase isoform 1                      243   5e-74    
ref|XP_002525666.1|  alpha-galactosidase/alpha-n-acetylgalactosam...    243   5e-74    Ricinus communis
ref|XP_002873354.1|  alpha-galactosidase 2                              242   6e-74    
ref|XP_010491468.1|  PREDICTED: alpha-galactosidase-like                242   8e-74    Camelina sativa [gold-of-pleasure]
ref|XP_003534634.1|  PREDICTED: alpha-galactosidase-like                243   8e-74    Glycine max [soybeans]
ref|XP_003555544.1|  PREDICTED: alpha-galactosidase-like                243   8e-74    Glycine max [soybeans]
ref|XP_010452822.1|  PREDICTED: alpha-galactosidase-like                242   8e-74    Camelina sativa [gold-of-pleasure]
ref|XP_004959332.1|  PREDICTED: alpha-galactosidase-like                242   1e-73    Setaria italica
ref|XP_002962916.1|  hypothetical protein SELMODRAFT_78263              242   1e-73    
emb|CDP16885.1|  unnamed protein product                                243   1e-73    Coffea canephora [robusta coffee]
ref|NP_001267530.1|  alpha-galactosidase-like precursor                 242   1e-73    Cucumis sativus [cucumbers]
ref|XP_012068620.1|  PREDICTED: alpha-galactosidase                     242   1e-73    
ref|XP_008355996.1|  PREDICTED: alpha-galactosidase-like isoform X2     242   1e-73    
gb|KDP46474.1|  hypothetical protein JCGZ_08446                         242   1e-73    Jatropha curcas
tpg|DAA49502.1|  TPA: hypothetical protein ZEAMMB73_583660              236   2e-73    
gb|AHG94610.1|  alpha galactosidase                                     242   2e-73    Camellia sinensis [black tea]
gb|KJB79780.1|  hypothetical protein B456_013G066400                    241   2e-73    Gossypium raimondii
ref|XP_008445911.1|  PREDICTED: alpha-galactosidase                     242   2e-73    Cucumis melo [Oriental melon]
gb|ACU23822.1|  unknown                                                 242   3e-73    Glycine max [soybeans]
ref|XP_002459948.1|  hypothetical protein SORBIDRAFT_02g018580          238   3e-73    
ref|XP_010104940.1|  hypothetical protein L484_004288                   240   3e-73    
ref|XP_002519009.1|  alpha-galactosidase/alpha-n-acetylgalactosam...    241   3e-73    
ref|XP_009415706.1|  PREDICTED: alpha-galactosidase-like                246   4e-73    
ref|XP_008221112.1|  PREDICTED: alpha-galactosidase-like                241   5e-73    Prunus mume [ume]
ref|XP_006399328.1|  hypothetical protein EUTSA_v10013749mg             240   5e-73    Eutrema salsugineum [saltwater cress]
ref|XP_008221110.1|  PREDICTED: alpha-galactosidase-like                241   5e-73    Prunus mume [ume]
ref|XP_007222449.1|  hypothetical protein PRUPE_ppa006179mg             241   6e-73    Prunus persica
ref|XP_010423102.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-galact...    239   6e-73    Camelina sativa [gold-of-pleasure]
ref|XP_004512699.1|  PREDICTED: alpha-galactosidase-like isoform X2     241   7e-73    
ref|XP_006848641.2|  PREDICTED: alpha-galactosidase                     240   8e-73    Amborella trichopoda
ref|XP_007043147.1|  Alpha-galactosidase 2                              246   8e-73    
ref|XP_004297698.2|  PREDICTED: alpha-galactosidase 1                   240   1e-72    Fragaria vesca subsp. vesca
ref|XP_010248383.1|  PREDICTED: alpha-galactosidase-like                239   1e-72    Nelumbo nucifera [Indian lotus]
ref|XP_008371324.1|  PREDICTED: alpha-galactosidase                     239   1e-72    Malus domestica [apple tree]
ref|XP_008800433.1|  PREDICTED: alpha-galactosidase                     237   2e-72    Phoenix dactylifera
ref|XP_008355995.1|  PREDICTED: alpha-galactosidase-like isoform X1     239   2e-72    
ref|XP_010274932.1|  PREDICTED: alpha-galactosidase                     240   2e-72    
ref|XP_009351606.1|  PREDICTED: alpha-galactosidase-like isoform X2     239   2e-72    Pyrus x bretschneideri [bai li]
ref|XP_009333714.1|  PREDICTED: alpha-galactosidase-like isoform X1     239   2e-72    Pyrus x bretschneideri [bai li]
ref|XP_002962690.1|  hypothetical protein SELMODRAFT_78329              238   2e-72    
gb|KJB57569.1|  hypothetical protein B456_009G170600                    239   2e-72    Gossypium raimondii
ref|XP_009333778.1|  PREDICTED: alpha-galactosidase-like isoform X2     239   2e-72    Pyrus x bretschneideri [bai li]
ref|XP_010068809.1|  PREDICTED: alpha-galactosidase-like                239   2e-72    
ref|XP_010491471.1|  PREDICTED: alpha-galactosidase-like                239   2e-72    
dbj|BAK08274.1|  predicted protein                                      238   2e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010669404.1|  PREDICTED: alpha-galactosidase-like isoform X1     239   3e-72    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006602712.1|  PREDICTED: alpha-galactosidase-like isoform X2     239   3e-72    Glycine max [soybeans]
ref|XP_012091553.1|  PREDICTED: alpha-galactosidase-like                238   3e-72    
gb|KGN51577.1|  hypothetical protein Csa_5G580620                       236   3e-72    Cucumis sativus [cucumbers]
ref|XP_008381790.1|  PREDICTED: alpha-galactosidase-like isoform X1     235   4e-72    
gb|KFK25205.1|  hypothetical protein AALP_AA8G080800                    238   4e-72    Arabis alpina [alpine rockcress]
ref|XP_008381791.1|  PREDICTED: alpha-galactosidase-like isoform X2     233   5e-72    
ref|XP_003535398.1|  PREDICTED: alpha-galactosidase-like                238   5e-72    Glycine max [soybeans]
ref|XP_004290441.1|  PREDICTED: alpha-galactosidase 1-like isofor...    238   5e-72    Fragaria vesca subsp. vesca
ref|XP_010423100.1|  PREDICTED: alpha-galactosidase-like                238   6e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010452823.1|  PREDICTED: alpha-galactosidase-like                238   7e-72    Camelina sativa [gold-of-pleasure]
ref|XP_004236880.1|  PREDICTED: alpha-galactosidase                     238   7e-72    Solanum lycopersicum
ref|XP_008445910.1|  PREDICTED: alpha-galactosidase                     238   7e-72    Cucumis melo [Oriental melon]
ref|XP_011458441.1|  PREDICTED: alpha-galactosidase 1-like isofor...    238   8e-72    Fragaria vesca subsp. vesca
ref|NP_001147362.1|  alpha-galactosidase precursor                      237   1e-71    
ref|XP_007211432.1|  hypothetical protein PRUPE_ppa007136mg             236   1e-71    
ref|XP_002270791.1|  PREDICTED: alpha-galactosidase                     237   1e-71    Vitis vinifera
ref|XP_006360855.1|  PREDICTED: alpha-galactosidase-like                237   1e-71    Solanum tuberosum [potatoes]
gb|EEC67231.1|  hypothetical protein OsI_34152                          239   1e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_008224996.1|  PREDICTED: alpha-galactosidase-like                237   1e-71    Prunus mume [ume]
gb|EEE51197.1|  hypothetical protein OsJ_32006                          239   1e-71    Oryza sativa Japonica Group [Japonica rice]
emb|CAN75822.1|  hypothetical protein VITISV_001661                     235   1e-71    Vitis vinifera
ref|XP_006289531.1|  hypothetical protein CARUB_v10003074mg             236   2e-71    
ref|XP_010245329.1|  PREDICTED: alpha-galactosidase-like                236   2e-71    Nelumbo nucifera [Indian lotus]
ref|NP_001267500.1|  alpha-galactosidase-like precursor                 236   2e-71    Cucumis sativus [cucumbers]
ref|XP_010274933.1|  PREDICTED: alpha-galactosidase-like                236   2e-71    Nelumbo nucifera [Indian lotus]
ref|XP_009350909.1|  PREDICTED: alpha-galactosidase-like isoform X1     236   2e-71    Pyrus x bretschneideri [bai li]
ref|XP_002980405.1|  hypothetical protein SELMODRAFT_112569             236   2e-71    
ref|XP_002513158.1|  alpha-galactosidase/alpha-n-acetylgalactosam...    236   2e-71    Ricinus communis
ref|XP_007043164.1|  Alpha-galactosidase 1 isoform 1                    236   2e-71    Theobroma cacao [chocolate]
ref|XP_002305678.2|  alpha-galactosidase family protein                 236   2e-71    
ref|XP_002975854.1|  hypothetical protein SELMODRAFT_232618             235   3e-71    
ref|XP_011027904.1|  PREDICTED: alpha-galactosidase-like                236   3e-71    Populus euphratica
ref|NP_196455.1|  alpha-galactosidase 1                                 236   3e-71    Arabidopsis thaliana [mouse-ear cress]
gb|AAM13199.1|  alpha-galactosidase-like protein                        236   3e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002467021.1|  hypothetical protein SORBIDRAFT_01g018410          236   3e-71    Sorghum bicolor [broomcorn]
gb|KHG04694.1|  Alpha-galactosidase                                     236   4e-71    Gossypium arboreum [tree cotton]
ref|XP_002513153.1|  alpha-galactosidase/alpha-n-acetylgalactosam...    236   4e-71    
ref|XP_002960133.1|  hypothetical protein SELMODRAFT_163627             235   4e-71    
ref|XP_002984007.1|  hypothetical protein SELMODRAFT_180602             235   4e-71    
ref|XP_010546253.1|  PREDICTED: alpha-galactosidase isoform X1          236   4e-71    Tarenaya hassleriana [spider flower]
ref|XP_010546255.1|  PREDICTED: alpha-galactosidase isoform X2          236   5e-71    Tarenaya hassleriana [spider flower]
gb|ACF78913.1|  unknown                                                 236   5e-71    Zea mays [maize]
ref|XP_009622382.1|  PREDICTED: alpha-galactosidase-like                236   6e-71    Nicotiana tomentosiformis
ref|XP_011075744.1|  PREDICTED: alpha-galactosidase-like                235   6e-71    
ref|XP_010937997.1|  PREDICTED: alpha-galactosidase isoform X2          234   7e-71    
ref|XP_007140063.1|  hypothetical protein PHAVU_008G081100g             235   7e-71    
gb|KDO77051.1|  hypothetical protein CISIN_1g014862mg                   235   9e-71    
ref|XP_006468677.1|  PREDICTED: alpha-galactosidase-like                235   1e-70    
ref|XP_010910002.1|  PREDICTED: alpha-galactosidase isoform X1          234   1e-70    
ref|XP_009351605.1|  PREDICTED: alpha-galactosidase-like isoform X1     234   1e-70    
ref|XP_008350964.1|  PREDICTED: alpha-galactosidase-like                232   1e-70    
ref|XP_008389053.1|  PREDICTED: alpha-galactosidase isoform X1          234   2e-70    
gb|KDO44287.1|  hypothetical protein CISIN_1g012852mg                   233   4e-70    
gb|KDO77052.1|  hypothetical protein CISIN_1g039407mg                   233   4e-70    
ref|XP_009351284.1|  PREDICTED: alpha-galactosidase-like                233   5e-70    
ref|XP_011013732.1|  PREDICTED: alpha-galactosidase-like                233   5e-70    
gb|ABN13605.1|  alpha-galactosidase                                     227   5e-70    
ref|XP_006469082.1|  PREDICTED: alpha-galactosidase-like                233   6e-70    
ref|XP_004492578.1|  PREDICTED: alpha-galactosidase-like                233   6e-70    
ref|XP_007043165.1|  Alpha-galactosidase 1 isoform 2                    232   9e-70    
ref|XP_010521831.1|  PREDICTED: alpha-galactosidase-like isoform X2     232   1e-69    
ref|XP_004982749.1|  PREDICTED: alpha-galactosidase-like isoform X1     233   1e-69    
gb|AFW72933.1|  hypothetical protein ZEAMMB73_085808                    236   1e-69    
gb|AFB73771.1|  alpha-galactosidase                                     231   1e-69    
ref|XP_010031355.1|  PREDICTED: alpha-galactosidase-like                232   2e-69    
ref|XP_010669402.1|  PREDICTED: alpha-galactosidase-like                232   2e-69    
emb|CAF34023.1|  alpha-galactosidase 1                                  231   2e-69    
ref|XP_002316426.2|  hypothetical protein POPTR_0010s26170g             232   2e-69    
ref|XP_004512698.1|  PREDICTED: alpha-galactosidase-like isoform X1     231   3e-69    
gb|EMT09790.1|  Alpha-galactosidase                                     232   3e-69    
ref|XP_012068538.1|  PREDICTED: alpha-galactosidase 1-like              231   3e-69    
gb|AAR02007.1|  galactan:galactan galactosyltransferase 1               231   3e-69    
emb|CAC08337.1|  alpha-galactosidase-like protein                       229   3e-69    
gb|AAG16693.1|  alpha-galactosidase                                     229   4e-69    
ref|XP_010034168.1|  PREDICTED: alpha-galactosidase-like                230   7e-69    
ref|XP_009125728.1|  PREDICTED: alpha-galactosidase-like                230   8e-69    
ref|XP_003548331.1|  PREDICTED: alpha-galactosidase-like                229   9e-69    
emb|CDY40750.1|  BnaAnng06130D                                          229   1e-68    
ref|XP_007036956.1|  Alpha-galactosidase 2 isoform 3                    230   1e-68    
gb|KHG12975.1|  Alpha-galactosidase                                     229   1e-68    
ref|XP_012068543.1|  PREDICTED: alpha-galactosidase 1-like              229   1e-68    
gb|KJB77436.1|  hypothetical protein B456_012G136800                    229   1e-68    
ref|XP_002965742.1|  hypothetical protein SELMODRAFT_85032              230   1e-68    
gb|KDP40460.1|  hypothetical protein JCGZ_24459                         229   1e-68    
emb|CDY44772.1|  BnaC02g01150D                                          229   2e-68    
gb|KEH23291.1|  alpha-galactosidase-like protein                        228   2e-68    
ref|XP_011622310.1|  PREDICTED: alpha-galactosidase                     228   3e-68    
ref|XP_007036957.1|  Alpha-galactosidase isoform 4                      227   4e-68    
ref|XP_008456939.1|  PREDICTED: alpha-galactosidase isoform X2          226   6e-68    
ref|XP_009776716.1|  PREDICTED: alpha-galactosidase-like                221   6e-68    
ref|XP_002513155.1|  alpha-galactosidase/alpha-n-acetylgalactosam...    227   7e-68    
gb|EYU28210.1|  hypothetical protein MIMGU_mgv1a025145mg                227   9e-68    
gb|EYU40747.1|  hypothetical protein MIMGU_mgv1a007693mg                226   1e-67    
gb|EYU30232.1|  hypothetical protein MIMGU_mgv1a007643mg                225   4e-67    
gb|KEH23292.1|  alpha-galactosidase-like protein                        225   4e-67    
gb|EPS65356.1|  hypothetical protein M569_09421                         224   6e-67    
ref|XP_009131062.1|  PREDICTED: alpha-galactosidase                     224   7e-67    
ref|XP_010031102.1|  PREDICTED: alpha-galactosidase isoform X2          222   9e-67    
ref|XP_010521822.1|  PREDICTED: alpha-galactosidase-like isoform X1     224   1e-66    
ref|XP_002962360.1|  hypothetical protein SELMODRAFT_78029              222   2e-66    
gb|KCW50364.1|  hypothetical protein EUGRSUZ_J00127                     222   3e-66    
ref|XP_004982754.1|  PREDICTED: alpha-galactosidase-like isoform X2     223   3e-66    
gb|AAP04002.1|  alpha-galactosidase                                     223   3e-66    
ref|XP_010031100.1|  PREDICTED: alpha-galactosidase isoform X1          222   4e-66    
emb|CDX81099.1|  BnaC03g03530D                                          222   1e-65    
emb|CDY69270.1|  BnaCnng62740D                                          221   1e-65    
ref|XP_010103558.1|  hypothetical protein L484_023052                   222   1e-65    
gb|ERN10222.1|  hypothetical protein AMTR_s00171p00050000               221   2e-65    
ref|XP_006662469.1|  PREDICTED: uncharacterized protein LOC102702220    232   2e-65    
ref|XP_002873355.1|  alpha-galactosidase 1                              221   4e-65    
gb|KDO44286.1|  hypothetical protein CISIN_1g012852mg                   219   6e-65    
gb|KJB31913.1|  hypothetical protein B456_005G214100                    218   2e-64    
ref|XP_007011350.1|  Melibiase family protein isoform 2                 214   5e-64    
ref|XP_009784200.1|  PREDICTED: alpha-galactosidase                     216   1e-63    
emb|CBK19751.2|  unnamed protein product                                215   1e-63    
ref|XP_009131061.1|  PREDICTED: alpha-galactosidase isoform X2          214   2e-63    
gb|AAG13536.1|AC023240_9  putative alpha-galactosidase                  215   3e-63    
ref|XP_004982753.1|  PREDICTED: alpha-galactosidase-like isoform X1     216   8e-63    
gb|KHN14745.1|  Alpha-galactosidase                                     211   1e-62    
ref|NP_001130466.1|  uncharacterized protein LOC100191564               210   6e-62    
gb|KDO77053.1|  hypothetical protein CISIN_1g014963mg                   211   1e-61    
ref|XP_006468676.1|  PREDICTED: alpha-galactosidase-like                211   1e-61    
ref|NP_001241777.1|  alpha-galactosidase precursor                      211   2e-61    
ref|XP_008650798.1|  PREDICTED: uncharacterized protein LOC100191...    211   2e-61    
ref|XP_008650799.1|  PREDICTED: uncharacterized protein LOC100191...    211   2e-61    
gb|KDO56005.1|  hypothetical protein CISIN_1g0388171mg                  201   3e-61    
ref|XP_011070502.1|  PREDICTED: LOW QUALITY PROTEIN: alpha-galact...    209   5e-61    
ref|XP_004364049.1|  alpha-galactosidase                                208   1e-60    
gb|KJE92196.1|  alpha-galactosidase                                     208   2e-60    
ref|XP_010910003.1|  PREDICTED: alpha-galactosidase isoform X2          205   9e-60    
gb|EAZ03724.1|  hypothetical protein OsI_25855                          205   1e-59    
ref|XP_006658523.1|  PREDICTED: alpha-galactosidase-like                212   1e-59    
ref|XP_002461921.1|  hypothetical protein SORBIDRAFT_02g010650          206   1e-59    
dbj|BAC84411.1|  putative alpha-galactosidase                           206   2e-59    
gb|EEE67099.1|  hypothetical protein OsJ_24103                          205   2e-59    
tpg|DAA38645.1|  TPA: putative SERRATE-related C2H2 zinc-finger f...    208   3e-59    
ref|XP_004336156.1|  ribosomal protein S32, putative                    204   3e-59    
ref|XP_009350910.1|  PREDICTED: alpha-galactosidase-like isoform X2     204   3e-59    
tpg|DAA38646.1|  TPA: putative SERRATE-related C2H2 zinc-finger f...    209   6e-59    
ref|XP_003389433.2|  PREDICTED: alpha-galactosidase-like                204   8e-59    
ref|XP_010669405.1|  PREDICTED: alpha-galactosidase-like isoform X2     202   2e-58    
ref|XP_009351607.1|  PREDICTED: alpha-galactosidase-like isoform X3     202   2e-58    
ref|XP_008389054.1|  PREDICTED: alpha-galactosidase isoform X2          201   3e-58    
gb|KDO77044.1|  hypothetical protein CISIN_1g040445mg                   200   4e-58    
ref|WP_029936076.1|  alpha-galactosidase                                198   8e-57    
ref|XP_006399329.1|  hypothetical protein EUTSA_v10013789mg             196   3e-56    
gb|AAQ82455.1|  alpha-galactosidase                                     192   6e-56    
gb|ETO33695.1|  Melibiase family protein                                193   4e-55    
ref|WP_040675664.1|  hypothetical protein                               196   5e-55    
emb|CAN81856.1|  hypothetical protein VITISV_041251                     195   5e-55    
gb|KEH42877.1|  alpha-galactosidase-like protein                        190   3e-54    
ref|XP_001021827.1|  Melibiase family protein                           189   2e-53    
ref|WP_019467403.1|  hypothetical protein                               189   3e-53    
ref|WP_035176625.1|  alpha-galactosidase                                188   4e-53    
ref|WP_033393783.1|  alpha-galactosidase                                192   9e-53    
ref|WP_043156987.1|  alpha-galactosidase                                187   1e-52    
gb|EPS63786.1|  alpha galactosidase                                     178   4e-52    
ref|WP_044951632.1|  alpha-galactosidase                                185   7e-52    
ref|XP_009351804.1|  PREDICTED: alpha-galactosidase-like                180   1e-51    
gb|AIF47331.1|  alpha-galactosidase                                     184   1e-51    
ref|WP_038580741.1|  alpha-galactosidase                                184   1e-51    
ref|WP_044579163.1|  alpha-galactosidase                                189   2e-51    
ref|WP_046084614.1|  alpha-galactosidase                                189   2e-51    
ref|WP_030358136.1|  MULTISPECIES: alpha-galactosidase                  189   2e-51    
ref|WP_026176571.1|  alpha-galactosidase                                184   2e-51    
gb|AGP59984.1|  alpha-galactosidase                                     188   3e-51    
ref|WP_040422808.1|  alpha-galactosidase                                183   3e-51    
ref|WP_026336697.1|  alpha-galactosidase                                183   3e-51    
ref|WP_037537667.1|  alpha-galactosidase                                182   3e-51    
ref|WP_037962060.1|  alpha-galactosidase                                188   3e-51    
ref|WP_035854594.1|  alpha-galactosidase                                188   4e-51    
gb|EXU63243.1|  alpha-galactosidase                                     188   4e-51    
ref|WP_004619417.1|  glycoside hydrolase [                              185   4e-51    
ref|WP_037795019.1|  alpha-galactosidase                                183   4e-51    
ref|WP_037910136.1|  alpha-galactosidase                                187   5e-51    
gb|ABF40678.1|  Alpha-galactosidase                                     183   6e-51    
ref|WP_041855556.1|  alpha-galactosidase                                182   6e-51    
ref|WP_035080410.1|  alpha-galactosidase                                181   6e-51    
ref|WP_033393018.1|  alpha-galactosidase                                182   7e-51    
ref|WP_037256196.1|  alpha-galactosidase                                186   1e-50    
ref|WP_043239885.1|  alpha-galactosidase                                186   2e-50    
gb|AEM85332.1|  Glycosyl hydrolase family 98 putative carbohydrat...    186   2e-50    
ref|WP_026442182.1|  alpha-galactosidase                                181   2e-50    
ref|WP_037784298.1|  alpha-galactosidase                                186   2e-50    
ref|WP_035079902.1|  alpha-galactosidase                                179   2e-50    
ref|WP_016640086.1|  putative Alpha-galactosidase                       186   3e-50    
ref|WP_031481745.1|  alpha-galactosidase                                185   3e-50    
ref|XP_004364050.1|  alpha-galactosidase                                181   3e-50    
dbj|BAB83765.1|  alpha-galactosidase [ [                                182   3e-50    
ref|WP_042195011.1|  alpha-galactosidase                                184   3e-50    
ref|WP_024834502.1|  sugar-binding protein [                            182   4e-50    
gb|AGP52976.1|  alpha-galactosidase                                     181   4e-50    
emb|CEL21572.1|  Alpha-galactosidase precursor                          184   4e-50    
ref|WP_020813682.1|  glycoside hydrolase [                              182   4e-50    
ref|WP_037707549.1|  alpha-galactosidase                                184   5e-50    
ref|WP_037275645.1|  alpha-galactosidase                                180   6e-50    
ref|WP_037846320.1|  alpha-galactosidase                                183   6e-50    
ref|WP_004271772.1|  glycoside hydrolase family 27                      182   6e-50    
ref|WP_030306384.1|  alpha-galactosidase                                184   7e-50    
ref|WP_014056902.1|  alpha-galactosidase                                180   9e-50    
ref|WP_035089843.1|  alpha-galactosidase                                179   1e-49    
ref|WP_033271661.1|  alpha-galactosidase                                184   1e-49    
ref|WP_037849767.1|  alpha-galactosidase                                179   1e-49    
ref|WP_037958114.1|  alpha-galactosidase                                178   1e-49    
ref|WP_033415366.1|  alpha-galactosidase                                183   1e-49    
ref|WP_042222082.1|  alpha-galactosidase                                183   2e-49    
gb|EXU64800.1|  alpha-galactosidase                                     179   2e-49    
ref|XP_008371682.1|  PREDICTED: alpha-galactosidase-like                172   2e-49    
ref|WP_035977145.1|  alpha-galactosidase                                183   2e-49    
ref|WP_037903073.1|  alpha-galactosidase                                183   2e-49    
gb|KJB69473.1|  hypothetical protein B456_011G025100                    177   2e-49    
gb|KJB69470.1|  hypothetical protein B456_011G025100                    177   2e-49    
gb|AHH96213.1|  alpha-galactosidase                                     183   2e-49    
ref|WP_044955943.1|  alpha-galactosidase                                179   2e-49    
gb|EDY60641.2|  alpha-galactosidase                                     183   2e-49    
ref|WP_016325048.1|  Alpha-galactosidase precursor                      183   2e-49    
gb|EFD71674.1|  secreted alpha-galactosidase                            183   2e-49    
ref|WP_022845873.1|  alpha-galactosidase                                178   2e-49    
ref|WP_011026988.1|  alpha-galactosidase                                183   2e-49    
ref|WP_030975242.1|  alpha-galactosidase                                182   3e-49    
ref|XP_004956477.1|  PREDICTED: alpha-galactosidase-like                175   3e-49    
ref|WP_037659460.1|  alpha-galactosidase                                177   3e-49    
ref|WP_041134625.1|  alpha-galactosidase                                182   3e-49    
ref|WP_030920947.1|  alpha-galactosidase                                182   4e-49    
gb|AJE84685.1|  alpha-galactosidase                                     178   4e-49    
gb|EDY52735.1|  alpha-galactosidase                                     180   4e-49    
ref|WP_030862282.1|  alpha-galactosidase                                182   4e-49    
ref|WP_028040907.1|  alpha-galactosidase                                177   5e-49    
ref|WP_015925065.1|  glycoside hydrolase [                              179   5e-49    
ref|WP_040845133.1|  alpha-galactosidase                                177   5e-49    
ref|XP_004982751.1|  PREDICTED: alpha-galactosidase-like isoform X3     177   6e-49    
ref|WP_033381434.1|  alpha-galactosidase                                180   6e-49    
gb|KDO75853.1|  hypothetical protein CISIN_1g044794mg                   175   6e-49    
gb|EGY01650.1|  Alpha-galactosidase                                     177   6e-49    
ref|WP_037854784.1|  alpha-galactosidase                                181   6e-49    
ref|WP_014313499.1|  glycoside hydrolase                                179   7e-49    
ref|WP_030829664.1|  alpha-galactosidase                                181   7e-49    
ref|WP_019065140.1|  alpha-galactosidase                                181   7e-49    
ref|WP_037835558.1|  alpha-galactosidase                                180   8e-49    
ref|WP_040392822.1|  alpha-galactosidase                                177   9e-49    
ref|WP_037741621.1|  alpha-galactosidase                                181   9e-49    
ref|WP_030672909.1|  alpha-galactosidase                                181   1e-48    
ref|WP_031044358.1|  alpha-galactosidase                                181   1e-48    
gb|EPD62846.1|  hypothetical protein HMPREF1211_03710                   181   1e-48    
ref|WP_023457215.1|  hypothetical protein                               177   1e-48    
ref|WP_037709578.1|  alpha-galactosidase                                181   1e-48    
ref|WP_037810160.1|  alpha-galactosidase                                181   1e-48    
gb|EFG05364.1|  Alpha-galactosidase                                     181   1e-48    
ref|WP_037782014.1|  alpha-galactosidase                                181   1e-48    
ref|WP_043489456.1|  alpha-galactosidase                                177   1e-48    
ref|WP_030617630.1|  alpha-galactosidase                                180   2e-48    
gb|ADI05219.1|  secreted alpha-galactosidase                            176   2e-48    
ref|WP_044972303.1|  alpha-galactosidase                                180   2e-48    
ref|WP_037534837.1|  alpha-galactosidase                                176   2e-48    
ref|WP_037867115.1|  alpha-galactosidase                                176   2e-48    
gb|EZP52372.1|  Melibiase family protein                                176   2e-48    
ref|WP_023458958.1|  alpha-galactosidase                                176   3e-48    
ref|WP_043677804.1|  alpha-galactosidase                                180   3e-48    
ref|WP_014174619.1|  alpha-galactosidase                                180   3e-48    
ref|WP_037867487.1|  alpha-galactosidase                                179   3e-48    
ref|WP_037837895.1|  alpha-galactosidase                                179   3e-48    
ref|XP_005975636.1|  PREDICTED: alpha-galactosidase-like                175   4e-48    
ref|WP_044564378.1|  glycoside hydrolase family 27                      177   4e-48    
emb|CEL18746.1|  Alpha-galactosidase precursor                          179   5e-48    



>ref|XP_010525385.1| PREDICTED: alpha-galactosidase [Tarenaya hassleriana]
Length=436

 Score =   350 bits (897),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA+ VGNSWR T+DI DTW SMT IAD+NNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  228  VDDPALWADEVGNSWRTTDDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEVGNGGM  287

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYR HFSIWALMKAPL+IGCD+RNMTAETFEILSN EVIA++QDPLGVQGR+V+V+G
Sbjct  288  TYQEYRGHFSIWALMKAPLLIGCDIRNMTAETFEILSNKEVIAINQDPLGVQGRRVNVNG  347

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC++VWAGPLSGNRLVVALWNRCSK  TITA WDV+GLESS SVS+RDLWKHED+  N
Sbjct  348  EDGCEQVWAGPLSGNRLVVALWNRCSKPATITASWDVLGLESSISVSVRDLWKHEDMEEN  407

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            A  SF A+V  H   +Y+ TPQTV+
Sbjct  408  AAGSFGAQVDIHDCHMYVLTPQTVS  432



>ref|XP_009363810.1| PREDICTED: alpha-galactosidase-like [Pyrus x bretschneideri]
 ref|XP_009363872.1| PREDICTED: alpha-galactosidase-like [Pyrus x bretschneideri]
Length=432

 Score =   347 bits (891),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/205 (78%), Positives = 182/205 (89%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR+T+DI DTW SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  223  VDDPALWAGKVGNSWRSTDDINDTWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  282

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL+IGCDVRNMTAETFEILSN EVIAV+QDPLGVQGRKV VSG
Sbjct  283  TYKEYRAHFSIWALMKAPLLIGCDVRNMTAETFEILSNEEVIAVNQDPLGVQGRKVYVSG  342

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPLSG+RL VALWNRCSK ETITA W+V+GLES  SVS+RDLW+HE+++ +
Sbjct  343  TDGCYQVWAGPLSGDRLTVALWNRCSKAETITATWEVLGLESGISVSVRDLWQHEEVAVD  402

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            AV SF A+V +H   +YIFTP+T +
Sbjct  403  AVSSFGARVDAHDCRMYIFTPRTAS  427



>emb|CDY27226.1| BnaA09g35760D [Brassica napus]
Length=429

 Score =   346 bits (887),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMTAIAD+NNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  220  VDDPALWAKEVGNSWRTTDDINDTWASMTAIADLNNKWASYAGPGGWNDPDMLEVGNGGM  279

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TYEEYR HFSIWALMKAPL+IGCDVRNMTAETFEILSN EVIAV+QDPLGVQGRK+  +G
Sbjct  280  TYEEYRGHFSIWALMKAPLLIGCDVRNMTAETFEILSNKEVIAVNQDPLGVQGRKIQANG  339

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             D CQ+VW+GPL+G+R+VVALWNRCSK  TITA WD+IGLES+ SVS+RDLW+H+DI+ N
Sbjct  340  EDDCQQVWSGPLTGDRMVVALWNRCSKPATITASWDMIGLESTVSVSVRDLWQHKDITDN  399

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
            A  SF A+V++H   +YI TPQ V S S
Sbjct  400  ASVSFEAQVEAHDCHMYILTPQAVVSRS  427



>ref|XP_009116328.1| PREDICTED: alpha-galactosidase isoform X2 [Brassica rapa]
Length=429

 Score =   346 bits (887),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMTAIAD+NNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  220  VDDPALWAKEVGNSWRTTDDINDTWASMTAIADLNNKWASYAGPGGWNDPDMLEVGNGGM  279

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TYEEYR HFSIWALMKAPL+IGCDVRNMTAETFEILSN EVIAV+QDPLGVQGRK+  +G
Sbjct  280  TYEEYRGHFSIWALMKAPLLIGCDVRNMTAETFEILSNKEVIAVNQDPLGVQGRKIQANG  339

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             D CQ+VW+GPL+G+R+VVALWNRCSK  TITA WD+IGLES+ SVS+RDLW+H+DI+ N
Sbjct  340  EDDCQQVWSGPLTGDRMVVALWNRCSKPATITASWDMIGLESTVSVSVRDLWQHKDITDN  399

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
            A  SF A+V++H   +YI TPQ V S S
Sbjct  400  ASVSFEAQVEAHDCHMYILTPQAVVSRS  427



>ref|XP_009116327.1| PREDICTED: alpha-galactosidase isoform X1 [Brassica rapa]
Length=456

 Score =   347 bits (889),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMTAIAD+NNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  247  VDDPALWAKEVGNSWRTTDDINDTWASMTAIADLNNKWASYAGPGGWNDPDMLEVGNGGM  306

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TYEEYR HFSIWALMKAPL+IGCDVRNMTAETFEILSN EVIAV+QDPLGVQGRK+  +G
Sbjct  307  TYEEYRGHFSIWALMKAPLLIGCDVRNMTAETFEILSNKEVIAVNQDPLGVQGRKIQANG  366

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             D CQ+VW+GPL+G+R+VVALWNRCSK  TITA WD+IGLES+ SVS+RDLW+H+DI+ N
Sbjct  367  EDDCQQVWSGPLTGDRMVVALWNRCSKPATITASWDMIGLESTVSVSVRDLWQHKDITDN  426

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
            A  SF A+V++H   +YI TPQ V S S
Sbjct  427  ASVSFEAQVEAHDCHMYILTPQAVVSRS  454



>ref|XP_008369354.1| PREDICTED: alpha-galactosidase [Malus domestica]
Length=432

 Score =   345 bits (886),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/203 (78%), Positives = 180/203 (89%), Gaps = 0/203 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  223  VDDPALWAGKVGNSWRTTDDINDTWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  282

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL+IGCDVRNMTAETFEILSN E+IAV+QDPLGVQGRKV VSG
Sbjct  283  TYKEYRAHFSIWALMKAPLLIGCDVRNMTAETFEILSNAEIIAVNQDPLGVQGRKVYVSG  342

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPLSG+RL VALWNRCSK ETITA W+V+GLES  SVS+RDLW+H++++ +
Sbjct  343  TDGCYQVWAGPLSGDRLTVALWNRCSKSETITATWEVLGLESGISVSVRDLWQHKEVAVD  402

Query  254  AVKSFSAKVKSHGSELYIFTPQT  186
            AV SF A+V +H   +YIFTP+T
Sbjct  403  AVSSFGAQVDAHDCRMYIFTPRT  425



>gb|KDO44285.1| hypothetical protein CISIN_1g012852mg [Citrus sinensis]
Length=455

 Score =   345 bits (886),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 159/205 (78%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T DI DTW SMT+IADIN+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  247  VDDPALWAGKVGNSWRTTGDINDTWASMTSIADINDKWASYAGPGGWNDPDMLEVGNGGM  306

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            +Y+EYRAHFSIWALMKAPL+IGCDVRNMTAETFEILSN EVIAV+QDPLGVQGRKV VSG
Sbjct  307  SYQEYRAHFSIWALMKAPLLIGCDVRNMTAETFEILSNKEVIAVNQDPLGVQGRKVYVSG  366

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             D C +VW GPLSG+RLVVALWNRC K ETITA WD +GLESS  VS+RDLW+H+ ++ +
Sbjct  367  TDNCLQVWVGPLSGHRLVVALWNRCPKAETITAQWDALGLESSTKVSVRDLWQHKQVTGD  426

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            AV SF A+V +H  ++YIFTP+TVT
Sbjct  427  AVSSFGAQVDAHDCQMYIFTPRTVT  451



>emb|CDX72148.1| BnaC08g27260D [Brassica napus]
Length=432

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 180/207 (87%), Gaps = 0/207 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPALWA  VGNSWR T+DI DTW SMT IAD+NNKWA YAGPGGWNDPDMLEVGNGGM+
Sbjct  224  DDPALWAKEVGNSWRTTDDINDTWASMTTIADLNNKWASYAGPGGWNDPDMLEVGNGGMS  283

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
            YEEYRAHFSIWALMKAPL+IGCDVRNMTAETFEILSN EVIAV+QDPLGVQGRK+  +G 
Sbjct  284  YEEYRAHFSIWALMKAPLLIGCDVRNMTAETFEILSNKEVIAVNQDPLGVQGRKIQANGE  343

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            D CQ+VW+GPL+G+R+VVALWNRCSK  TITA WD+IGLES+ SVS+RDLW+H+D++ NA
Sbjct  344  DDCQQVWSGPLTGDRMVVALWNRCSKPATITATWDMIGLESTVSVSVRDLWQHKDVTDNA  403

Query  251  VKSFSAKVKSHGSELYIFTPQTVTSYS  171
              SF A+V++H   +YI TPQ V S S
Sbjct  404  SVSFEAQVEAHDCHMYILTPQAVVSRS  430



>ref|XP_006486193.1| PREDICTED: alpha-galactosidase-like [Citrus sinensis]
Length=455

 Score =   344 bits (882),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/205 (77%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T DI DTW SMT+IADIN+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  247  VDDPALWAGKVGNSWRTTGDINDTWASMTSIADINDKWASYAGPGGWNDPDMLEVGNGGM  306

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            +Y+EYRAHFSIWALMKAPL+IGCDVRN+TAETFEILSN EVIAV+QDPLGVQGRKV VSG
Sbjct  307  SYQEYRAHFSIWALMKAPLLIGCDVRNLTAETFEILSNKEVIAVNQDPLGVQGRKVYVSG  366

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             D C +VW GPLSG+RLVVALWNRC K ETITA WD +GLESS  VS+RDLW+H+ ++ +
Sbjct  367  TDNCLQVWVGPLSGHRLVVALWNRCPKAETITAQWDALGLESSTKVSVRDLWQHKQVTGD  426

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            AV SF A+V +H  ++YIFTP+TVT
Sbjct  427  AVSSFGAQVDAHDCQMYIFTPRTVT  451



>ref|XP_002876361.1| hypothetical protein ARALYDRAFT_486071 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52620.1| hypothetical protein ARALYDRAFT_486071 [Arabidopsis lyrata subsp. 
lyrata]
Length=430

 Score =   343 bits (879),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 179/205 (87%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMT IAD+NNKWA YAGPGGWNDPDMLE+GNGGM
Sbjct  222  VDDPALWAKEVGNSWRTTDDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEIGNGGM  281

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TYEEYR HFSIWALMKAPL+IGCDVRNMTAETFEILSN EVIAV+QDPLGVQGRK+  +G
Sbjct  282  TYEEYRGHFSIWALMKAPLLIGCDVRNMTAETFEILSNKEVIAVNQDPLGVQGRKIQANG  341

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             D CQ+VW+GPLSG+R+VVALWNRCS+  TITA WDVIGLES+ SVS+RDLW+H+D++ N
Sbjct  342  EDDCQQVWSGPLSGDRIVVALWNRCSEQATITASWDVIGLESTISVSVRDLWQHKDVTEN  401

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            A  SF A+V +H   +Y+ TPQTV+
Sbjct  402  ASGSFEAQVDAHDCHMYVLTPQTVS  426



>gb|KHG01835.1| Alpha-galactosidase [Gossypium arboreum]
Length=438

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 160/204 (78%), Positives = 176/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V+DPALWA GVGNSWR T+DI DTW SMT IADIN+KWA +AGPGGWNDPDMLEVGNGGM
Sbjct  230  VEDPALWARGVGNSWRTTDDINDTWASMTTIADINDKWASHAGPGGWNDPDMLEVGNGGM  289

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL+IGCDVRNMTAET EILSN EVI+V+QD LGVQGRKV VSG
Sbjct  290  TYQEYRAHFSIWALMKAPLLIGCDVRNMTAETLEILSNKEVISVNQDSLGVQGRKVYVSG  349

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
               C +VWAGPLSGNRLVVA WNRCSK  TITA WDV+GLESS  VSIRDLW+H+++  N
Sbjct  350  EANCLQVWAGPLSGNRLVVAFWNRCSKAATITARWDVLGLESSTHVSIRDLWQHKEVKEN  409

Query  254  AVKSFSAKVKSHGSELYIFTPQTV  183
            AV SF AKV SH   +YIFTP+TV
Sbjct  410  AVASFGAKVDSHDCHVYIFTPKTV  433



>ref|XP_007218029.1| hypothetical protein PRUPE_ppa005977mg [Prunus persica]
 gb|EMJ19228.1| hypothetical protein PRUPE_ppa005977mg [Prunus persica]
Length=434

 Score =   340 bits (871),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/203 (76%), Positives = 179/203 (88%), Gaps = 0/203 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  +GNSWR T+DI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  222  VDDPALWAGKLGNSWRTTDDINDSWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  281

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            +Y+EYRAHFSIWALMKAPL++GCDVRNMTAETFEILSN EVIAV+QDPLGVQGRKVSVSG
Sbjct  282  SYQEYRAHFSIWALMKAPLLVGCDVRNMTAETFEILSNEEVIAVNQDPLGVQGRKVSVSG  341

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPLSG+RL VALWNRCSK +TIT  W+ +GL+SS SVSIRDLW+H++++ +
Sbjct  342  TDGCYQVWAGPLSGHRLTVALWNRCSKAKTITVTWEALGLQSSISVSIRDLWEHKEVAVD  401

Query  254  AVKSFSAKVKSHGSELYIFTPQT  186
             V SF A+V +H   +YIFTPQT
Sbjct  402  TVSSFGARVDAHDCRMYIFTPQT  424



>ref|XP_006292164.1| hypothetical protein CARUB_v10018370mg [Capsella rubella]
 gb|EOA25062.1| hypothetical protein CARUB_v10018370mg [Capsella rubella]
Length=412

 Score =   337 bits (865),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 152/203 (75%), Positives = 177/203 (87%), Gaps = 0/203 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMT IAD+NNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  204  VDDPALWAKEVGNSWRTTDDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEVGNGGM  263

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TYEEYR HFSIWALMKAPL+IGCDVRNMTAETFEILSN EVIA++QDPLGVQGRK+  +G
Sbjct  264  TYEEYRGHFSIWALMKAPLLIGCDVRNMTAETFEILSNKEVIAINQDPLGVQGRKIQANG  323

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             D CQ+VW+GPL+G+R+V+ALWNRCS+  TITA WD+IGLES+ SVS+RDLW+H+D++ N
Sbjct  324  DDNCQQVWSGPLTGDRMVIALWNRCSEPATITASWDLIGLESTISVSVRDLWQHKDVTDN  383

Query  254  AVKSFSAKVKSHGSELYIFTPQT  186
            A  SF A+V +H   +Y+ TPQT
Sbjct  384  ASVSFEAQVDAHDCHMYVLTPQT  406



>ref|XP_010252089.1| PREDICTED: alpha-galactosidase isoform X1 [Nelumbo nucifera]
Length=425

 Score =   338 bits (866),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA GVGNSWR T+DI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  217  VDDPALWAGGVGNSWRTTDDINDSWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  276

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL+IGCDVRNMTAET EILSN EVIAV+QDPLGVQGRKV   G
Sbjct  277  TYQEYRAHFSIWALMKAPLLIGCDVRNMTAETLEILSNKEVIAVNQDPLGVQGRKVYAEG  336

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             D C++VWAGPLSGNRLVVA WNRCSK  TITA W+ +GL+ + SVS+RD+WKHED+  +
Sbjct  337  KDNCKQVWAGPLSGNRLVVAFWNRCSKAVTITAKWEALGLDPTISVSVRDIWKHEDMPED  396

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
            A+ SFS +V SH  ++YIFTPQ    ++
Sbjct  397  ALTSFSTQVDSHDCKMYIFTPQMAYQFA  424



>ref|XP_010427449.1| PREDICTED: alpha-galactosidase-like [Camelina sativa]
Length=436

 Score =   338 bits (866),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 176/202 (87%), Gaps = 0/202 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPALWA  VGNSWR TEDI DTW SMT IAD+NNKWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  229  DDPALWAKEVGNSWRTTEDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEVGNGGMT  288

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
            YEEYR HFSIWALMKAPL+IGCDVRNMTAETFEILSN EVIAV+QDPLGVQGRK+  +G 
Sbjct  289  YEEYRGHFSIWALMKAPLLIGCDVRNMTAETFEILSNKEVIAVNQDPLGVQGRKIQANGD  348

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            D CQ+VW+GPL+G+R+V+ALWNRCS+  TITA WD+IGLES+ SVS+RDLW+H+D++ NA
Sbjct  349  DNCQQVWSGPLTGDRMVIALWNRCSEPATITASWDLIGLESTISVSVRDLWQHKDVTDNA  408

Query  251  VKSFSAKVKSHGSELYIFTPQT  186
              SF A+V +H   +Y+ TPQT
Sbjct  409  SVSFEAQVDAHDCHMYVLTPQT  430



>gb|KFK34880.1| hypothetical protein AALP_AA5G205400 [Arabis alpina]
Length=430

 Score =   337 bits (865),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 178/205 (87%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  +GNSWR T+DI DTW SMT IAD+NNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  222  VDDPALWAKEIGNSWRTTDDINDTWASMTTIADLNNKWASYAGPGGWNDPDMLEVGNGGM  281

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TYEEYR HFSIWALMKAPL+IGCDVRNMTAETFEILSN EVIAV+QDPLGVQGRK+   G
Sbjct  282  TYEEYRGHFSIWALMKAPLLIGCDVRNMTAETFEILSNKEVIAVNQDPLGVQGRKIQADG  341

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             + CQ+VW+GPLSG+R+VVALWNRCS+  TITA W++IGLES+ SVS+RDLW+H+D++ N
Sbjct  342  ENDCQQVWSGPLSGDRMVVALWNRCSEPATITASWEIIGLESTISVSVRDLWQHKDVTEN  401

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            A  SF A+V +H   +Y+ TPQ+V+
Sbjct  402  ASGSFEAQVNAHDCHMYVLTPQSVS  426



>ref|XP_009763014.1| PREDICTED: alpha-galactosidase-like, partial [Nicotiana sylvestris]
Length=329

 Score =   333 bits (855),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 155/205 (76%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPA WA  +GNSWR T+DI DTW SMT IADIN+KWA YAGPGGWNDPDM EVGNGGM
Sbjct  121  VDDPAKWAGKIGNSWRTTDDINDTWASMTTIADINDKWASYAGPGGWNDPDMFEVGNGGM  180

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
             Y EY+ HFSIWALMKAPLIIGCDVRN+TAET EILSN EVIAVDQDPLGVQGR+V  SG
Sbjct  181  NYHEYKGHFSIWALMKAPLIIGCDVRNITAETLEILSNKEVIAVDQDPLGVQGRRVYASG  240

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
            +DGC+++WAGPLSGNRL V LWNRCSK  TITA W  IGLESS  VS+RDLWKHE +S N
Sbjct  241  SDGCEQIWAGPLSGNRLAVVLWNRCSKAATITAKWGAIGLESSIGVSVRDLWKHEVVSEN  300

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
             V SFSA+V +HG E+YI TP+  T
Sbjct  301  TVGSFSARVDAHGCEMYILTPKRAT  325



>ref|XP_008233873.1| PREDICTED: alpha-galactosidase [Prunus mume]
Length=435

 Score =   337 bits (864),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 178/203 (88%), Gaps = 0/203 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  +GNSWR T+DI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  223  VDDPALWAGKLGNSWRTTDDINDSWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  282

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            +Y+EYRAHFSIWALMKAPL++GCDVRNMTAETFEILSN EVIAV+QDPLGVQGRKVS SG
Sbjct  283  SYQEYRAHFSIWALMKAPLLVGCDVRNMTAETFEILSNEEVIAVNQDPLGVQGRKVSASG  342

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGP SG+RL VALWNRCSK +TIT  W+ +GL+SS SVSIRDLW+H++++ +
Sbjct  343  TDGCYQVWAGPQSGHRLTVALWNRCSKAKTITVTWEALGLQSSISVSIRDLWEHKEVAVD  402

Query  254  AVKSFSAKVKSHGSELYIFTPQT  186
            AV SF A+V +H   +YIFTPQT
Sbjct  403  AVSSFGARVDAHDCRMYIFTPQT  425



>gb|KEH35559.1| alpha-galactosidase-like protein [Medicago truncatula]
Length=433

 Score =   337 bits (863),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/209 (76%), Positives = 178/209 (85%), Gaps = 1/209 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMT IAD+N++WA YAGPGGWNDPDMLEVGNGGM
Sbjct  225  VDDPALWAGTVGNSWRTTDDINDTWASMTTIADLNDRWAAYAGPGGWNDPDMLEVGNGGM  284

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYR HFSIWAL KAPL+IGCDVRNMTAETFEILSN EVIA++QD LGVQGRKV  +G
Sbjct  285  TYQEYRGHFSIWALAKAPLLIGCDVRNMTAETFEILSNKEVIAINQDSLGVQGRKVQAAG  344

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPLSGNRL VALWNRCSK  TITA W+ +GLES   VS+RDLW+H+ ++ +
Sbjct  345  IDGCSQVWAGPLSGNRLTVALWNRCSKVATITASWEALGLESGIHVSVRDLWQHKVLNGD  404

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYSS  168
            AV SFSA+V SH  ELYIFTP T TSYS+
Sbjct  405  AVSSFSARVDSHACELYIFTPST-TSYSA  432



>gb|KJB72967.1| hypothetical protein B456_011G207400 [Gossypium raimondii]
Length=419

 Score =   336 bits (862),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V+DPALWA GVGNSWR T+DI DTW SMT IADIN+KWA  AGPGGWNDPDMLEVGNGGM
Sbjct  211  VEDPALWARGVGNSWRTTDDINDTWASMTTIADINDKWASRAGPGGWNDPDMLEVGNGGM  270

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL+IGCDVRNMTAET EILSN EVI+V+QD LGVQGRKV VSG
Sbjct  271  TYQEYRAHFSIWALMKAPLLIGCDVRNMTAETLEILSNKEVISVNQDSLGVQGRKVYVSG  330

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
               C +VWAGPLSGNRLVVA WNRC K  TITA W+V+GLESS +VSIRDLW+H+++  N
Sbjct  331  EANCLQVWAGPLSGNRLVVAFWNRCLKAATITARWEVLGLESSTNVSIRDLWQHKEVKEN  390

Query  254  AVKSFSAKVKSHGSELYIFTPQTV  183
            AV SF AKV SH   +YIFTP+TV
Sbjct  391  AVASFGAKVDSHDCHMYIFTPKTV  414



>ref|NP_974447.1| melibiase family protein [Arabidopsis thaliana]
 gb|AEE79507.1| melibiase family protein [Arabidopsis thaliana]
Length=413

 Score =   336 bits (861),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMT IAD+NNKWA YAGPGGWNDPDMLE+GNGGM
Sbjct  205  VDDPALWAKEVGNSWRTTDDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEIGNGGM  264

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TYEEYR HFSIWALMKAPL+IGCDVRNMTAET EILSN E+IAV+QDPLGVQGRK+  +G
Sbjct  265  TYEEYRGHFSIWALMKAPLLIGCDVRNMTAETLEILSNKEIIAVNQDPLGVQGRKIQANG  324

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             + CQ+VW+GPLSG+R+VVALWNRCS+  TITA WD+IGLES+ SVS+RDLW+H+D++ N
Sbjct  325  ENDCQQVWSGPLSGDRMVVALWNRCSEPATITASWDMIGLESTISVSVRDLWQHKDVTEN  384

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
               SF A+V +H   +Y+ TPQTV+
Sbjct  385  TSGSFEAQVDAHDCHMYVLTPQTVS  409



>gb|KJB72966.1| hypothetical protein B456_011G207400 [Gossypium raimondii]
Length=438

 Score =   336 bits (862),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/204 (77%), Positives = 175/204 (86%), Gaps = 0/204 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V+DPALWA GVGNSWR T+DI DTW SMT IADIN+KWA  AGPGGWNDPDMLEVGNGGM
Sbjct  230  VEDPALWARGVGNSWRTTDDINDTWASMTTIADINDKWASRAGPGGWNDPDMLEVGNGGM  289

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL+IGCDVRNMTAET EILSN EVI+V+QD LGVQGRKV VSG
Sbjct  290  TYQEYRAHFSIWALMKAPLLIGCDVRNMTAETLEILSNKEVISVNQDSLGVQGRKVYVSG  349

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
               C +VWAGPLSGNRLVVA WNRC K  TITA W+V+GLESS +VSIRDLW+H+++  N
Sbjct  350  EANCLQVWAGPLSGNRLVVAFWNRCLKAATITARWEVLGLESSTNVSIRDLWQHKEVKEN  409

Query  254  AVKSFSAKVKSHGSELYIFTPQTV  183
            AV SF AKV SH   +YIFTP+TV
Sbjct  410  AVASFGAKVDSHDCHMYIFTPKTV  433



>ref|XP_009606912.1| PREDICTED: alpha-galactosidase-like [Nicotiana tomentosiformis]
 ref|XP_009606913.1| PREDICTED: alpha-galactosidase-like [Nicotiana tomentosiformis]
Length=434

 Score =   336 bits (861),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VD+PA WA  +GNSWR T+DI DTW SMT IADIN+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  226  VDEPAKWAGKIGNSWRTTDDINDTWASMTTIADINDKWASYAGPGGWNDPDMLEVGNGGM  285

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
             Y EY+ HFSIWALMKAPLIIGCDVRN+TAET EILSN EVIAVDQDPLGVQGR+V  SG
Sbjct  286  NYHEYKGHFSIWALMKAPLIIGCDVRNITAETLEILSNKEVIAVDQDPLGVQGRRVDASG  345

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGCQ+VWAGPLSGNRL + LWNRCSK  TITA W  IGLESS SVS+RDLWKHE +S N
Sbjct  346  PDGCQQVWAGPLSGNRLAIVLWNRCSKAATITAKWGAIGLESSISVSVRDLWKHEVVSEN  405

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
               SFSA+V +HG E+YI TP+  T  S
Sbjct  406  TGGSFSARVDAHGCEMYILTPKRATRAS  433



>ref|XP_007011349.1| Melibiase family protein isoform 1 [Theobroma cacao]
 gb|EOY20159.1| Melibiase family protein isoform 1 [Theobroma cacao]
Length=441

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/203 (77%), Positives = 176/203 (87%), Gaps = 0/203 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V+DPALWA+GVGNSWR T+DI DTW SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  233  VEDPALWAHGVGNSWRTTDDINDTWASMTTIADLNDKWASYAGPGGWNDPDMLEVGNGGM  292

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL++GCDVR+MT ETFEILSN EVIAV+QD LGVQGRKV  +G
Sbjct  293  TYQEYRAHFSIWALMKAPLLVGCDVRSMTNETFEILSNKEVIAVNQDSLGVQGRKVYATG  352

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             + C +VWAGPLSGNRLVVALWNRCSK  TITA W+ +GLESS SVS+RDLW+HED++  
Sbjct  353  ENDCLQVWAGPLSGNRLVVALWNRCSKAATITAKWEALGLESSTSVSVRDLWQHEDLTEK  412

Query  254  AVKSFSAKVKSHGSELYIFTPQT  186
            AV SF AKV SH   +YIFTP T
Sbjct  413  AVASFGAKVDSHDCHMYIFTPTT  435



>ref|XP_012091162.1| PREDICTED: alpha-galactosidase 3 [Jatropha curcas]
 gb|KDP21665.1| hypothetical protein JCGZ_03336 [Jatropha curcas]
Length=435

 Score =   335 bits (860),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 179/209 (86%), Gaps = 1/209 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDP LWA  VGNSWR T+DI DTW SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  226  VDDPPLWAGKVGNSWRTTDDINDTWASMTTIADVNDKWATYAGPGGWNDPDMLEVGNGGM  285

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL+IGCDVRNMTAE +EIL+N EVIA++QDPLGVQGRKV   G
Sbjct  286  TYQEYRAHFSIWALMKAPLLIGCDVRNMTAEAYEILTNKEVIAINQDPLGVQGRKVHTVG  345

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
            ++GCQ+VWAGPLSG+RL VALWNRCSK  TITA WD +GL+S  SVS+RDLW+H+D++ +
Sbjct  346  SEGCQQVWAGPLSGHRLAVALWNRCSKKATITAPWDALGLKSGTSVSVRDLWQHKDLTGD  405

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYSS  168
            AV SF A+V +H   +YIFTP+ +  YSS
Sbjct  406  AVASFDARVDAHDCAMYIFTPK-ILPYSS  433



>emb|CAB87430.1| alpha-galactosidase-like protein [Arabidopsis thaliana]
Length=434

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMT IAD+NNKWA YAGPGGWNDPDMLE+GNGGM
Sbjct  226  VDDPALWAKEVGNSWRTTDDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEIGNGGM  285

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TYEEYR HFSIWALMKAPL+IGCDVRNMTAET EILSN E+IAV+QDPLGVQGRK+  +G
Sbjct  286  TYEEYRGHFSIWALMKAPLLIGCDVRNMTAETLEILSNKEIIAVNQDPLGVQGRKIQANG  345

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             + CQ+VW+GPLSG+R+VVALWNRCS+  TITA WD+IGLES+ SVS+RDLW+H+D++ N
Sbjct  346  ENDCQQVWSGPLSGDRMVVALWNRCSEPATITASWDMIGLESTISVSVRDLWQHKDVTEN  405

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
               SF A+V +H   +Y+ TPQTV+
Sbjct  406  TSGSFEAQVDAHDCHMYVLTPQTVS  430



>ref|NP_191190.2| melibiase family protein [Arabidopsis thaliana]
 sp|Q8VXZ7.1|AGAL3_ARATH RecName: Full=Alpha-galactosidase 3; Short=AtAGAL3; AltName: 
Full=Alpha-D-galactoside galactohydrolase 3; AltName: Full=Melibiase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL67017.1| putative alpha-galactosidase [Arabidopsis thaliana]
 gb|AAM45068.1| putative alpha-galactosidase [Arabidopsis thaliana]
 gb|AEE79508.1| melibiase family protein [Arabidopsis thaliana]
Length=437

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 177/205 (86%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMT IAD+NNKWA YAGPGGWNDPDMLE+GNGGM
Sbjct  229  VDDPALWAKEVGNSWRTTDDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEIGNGGM  288

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TYEEYR HFSIWALMKAPL+IGCDVRNMTAET EILSN E+IAV+QDPLGVQGRK+  +G
Sbjct  289  TYEEYRGHFSIWALMKAPLLIGCDVRNMTAETLEILSNKEIIAVNQDPLGVQGRKIQANG  348

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             + CQ+VW+GPLSG+R+VVALWNRCS+  TITA WD+IGLES+ SVS+RDLW+H+D++ N
Sbjct  349  ENDCQQVWSGPLSGDRMVVALWNRCSEPATITASWDMIGLESTISVSVRDLWQHKDVTEN  408

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
               SF A+V +H   +Y+ TPQTV+
Sbjct  409  TSGSFEAQVDAHDCHMYVLTPQTVS  433



>ref|XP_010504530.1| PREDICTED: alpha-galactosidase-like [Camelina sativa]
Length=436

 Score =   335 bits (858),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPALWA  VGNSWR TEDI DTW SM  IAD+NNKWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  229  DDPALWAKEVGNSWRTTEDINDTWASMITIADLNNKWAAYAGPGGWNDPDMLEVGNGGMT  288

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
            YEEYR HFSIWALMKAPL+IGCD+RNMTAETFEILSN EVIAV+QDPLGVQGRK+  +G 
Sbjct  289  YEEYRGHFSIWALMKAPLLIGCDIRNMTAETFEILSNKEVIAVNQDPLGVQGRKLQANGD  348

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            D CQ+VW+GPL+G+R+V+ALWNRCS+  TITA WD+IGLES+ SVS+RDLW+H+D++ NA
Sbjct  349  DNCQQVWSGPLTGDRMVIALWNRCSEPATITASWDLIGLESTISVSVRDLWQHKDVTDNA  408

Query  251  VKSFSAKVKSHGSELYIFTPQT  186
              SF A+V +H   +Y+ TPQT
Sbjct  409  SVSFEAQVDAHDCHMYVLTPQT  430



>ref|XP_011076596.1| PREDICTED: alpha-galactosidase-like [Sesamum indicum]
Length=428

 Score =   334 bits (856),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 171/201 (85%), Gaps = 0/201 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V+DPALWA  +GNSWR T+DIEDTWESMTAIADIN+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  220  VNDPALWAGRIGNSWRTTDDIEDTWESMTAIADINDKWAAYAGPGGWNDPDMLEVGNGGM  279

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL+IGCDVRNMT ET+EIL+N EVI VDQDPLGVQGRKV   G
Sbjct  280  TYQEYRAHFSIWALMKAPLLIGCDVRNMTPETYEILTNEEVIGVDQDPLGVQGRKVHTYG  339

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPL+G R VVALWNRCSK  TITA W  IGLESSAS S+RDLWKHE  S N
Sbjct  340  PDGCYQVWAGPLTGQRYVVALWNRCSKPATITAEWAAIGLESSASYSVRDLWKHEYASLN  399

Query  254  AVKSFSAKVKSHGSELYIFTP  192
            +  SFSA++ +H  E+YI  P
Sbjct  400  SRTSFSAQIDAHACEMYILAP  420



>ref|XP_010937999.1| PREDICTED: alpha-galactosidase isoform X4 [Elaeis guineensis]
Length=343

 Score =   331 bits (848),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI D+WESMTAIAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  136  VDDPALWAGKVGNSWRTTDDITDSWESMTAIADLNDKWASYAGPGGWNDPDMLEVGNGGM  195

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T+ EYR HFSIWALMKAPL+IGCDVRNMTAETFEILSN EVIAV+QDPLGVQGRKVSV G
Sbjct  196  THMEYRGHFSIWALMKAPLLIGCDVRNMTAETFEILSNEEVIAVNQDPLGVQGRKVSVGG  255

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             +GC +VWAGPLSGNRLVVALWNRCS+  TITA W+ +GL+S+  VSIRDLWKHE +  N
Sbjct  256  KNGCSQVWAGPLSGNRLVVALWNRCSEAVTITAKWETLGLDSTTCVSIRDLWKHETLQEN  315

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
               ++ A+V +H  ++YIF+P +  S S
Sbjct  316  VAGTYGAQVDAHDCKIYIFSPTSSLSVS  343



>gb|AFK44983.1| unknown [Lotus japonicus]
Length=229

 Score =   326 bits (836),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  21   VDDPALWAGTVGNSWRTTDDINDTWASMTTIADLNDKWASYAGPGGWNDPDMLEVGNGGM  80

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWAL KAPL+IGCD+RNMTAET EI+SN EVIA++QD LGVQGRKV V+G
Sbjct  81   TYQEYRAHFSIWALAKAPLLIGCDIRNMTAETLEIISNKEVIAINQDSLGVQGRKVQVAG  140

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPLSG+R VVALWNRCSK   ITA W+ +G+ES   V++RDLW+H+ ++ +
Sbjct  141  KDGCSQVWAGPLSGDRWVVALWNRCSKVANITASWEALGIESGVYVTVRDLWQHKVVTED  200

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            AV SFSA+V +H S LYIFTP TV+
Sbjct  201  AVSSFSAQVDTHDSHLYIFTPSTVS  225



>ref|XP_011010658.1| PREDICTED: alpha-galactosidase [Populus euphratica]
Length=434

 Score =   333 bits (854),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/204 (75%), Positives = 177/204 (87%), Gaps = 0/204 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  226  VDDPALWAGKVGNSWRTTDDINDSWASMTTIADLNDKWASYAGPGGWNDPDMLEVGNGGM  285

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY EYRAHFSIWALMKAPL+IGCDVRNMTAET EIL+N E+IAV+QDPLG+QGRKV  +G
Sbjct  286  TYHEYRAHFSIWALMKAPLLIGCDVRNMTAETIEILTNKEIIAVNQDPLGIQGRKVYSTG  345

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPLSG+R+VVALWNRCSK  TITA WD +GLESS SVS+RDLW+H+DI  +
Sbjct  346  TDGCLQVWAGPLSGHRIVVALWNRCSKAATITAGWDALGLESSTSVSVRDLWQHKDIVGD  405

Query  254  AVKSFSAKVKSHGSELYIFTPQTV  183
            AV SF A+V +H  +++IFT Q+V
Sbjct  406  AVASFGAQVDAHDCQIFIFTLQSV  429



>ref|XP_009802955.1| PREDICTED: alpha-galactosidase-like [Nicotiana sylvestris]
Length=434

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPA WA  +GNSWR T+DI DTW SMT IADIN+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  226  VDDPAKWAGKIGNSWRTTDDINDTWASMTTIADINDKWASYAGPGGWNDPDMLEVGNGGM  285

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
             Y EY+ HFSIWALMKAPLIIGCDVRN+TAET EILSN EVIAVDQDPLGVQGR+V  + 
Sbjct  286  NYHEYKGHFSIWALMKAPLIIGCDVRNITAETLEILSNKEVIAVDQDPLGVQGRRVYAAR  345

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC++VWAGPLSGNRL + LWNRCSK  TITA W  IGL+SS SVS+RDLWKHE +S N
Sbjct  346  PDGCEQVWAGPLSGNRLAIVLWNRCSKAATITAKWGAIGLQSSISVSVRDLWKHEVVSEN  405

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
             V SFSA+V +HG E+YI TP+  T  S
Sbjct  406  MVGSFSARVDAHGCEMYILTPKRATRAS  433



>ref|XP_010516236.1| PREDICTED: alpha-galactosidase-like [Camelina sativa]
Length=436

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 175/202 (87%), Gaps = 0/202 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPALWA  VGNSWR TEDI DTW SMT IAD+NNKWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  229  DDPALWAKEVGNSWRTTEDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEVGNGGMT  288

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
            YEEYR HFSIWALMKAPL+IGCD+RNMTAETFEILSN EVIAV+QDPLGVQGRK+  +G 
Sbjct  289  YEEYRGHFSIWALMKAPLLIGCDIRNMTAETFEILSNKEVIAVNQDPLGVQGRKLQANGD  348

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            D CQ+VW+GPL+G+R+V+ALWNRCS+  TI A W++IGLES+ SVS+RDLW+H+D++ NA
Sbjct  349  DDCQQVWSGPLTGDRMVIALWNRCSEPATIIASWELIGLESTISVSVRDLWQHKDVTDNA  408

Query  251  VKSFSAKVKSHGSELYIFTPQT  186
              SF A+V +H   +Y+ TPQT
Sbjct  409  SVSFEAQVDAHDCHMYVLTPQT  430



>ref|XP_011084838.1| PREDICTED: alpha-galactosidase-like [Sesamum indicum]
Length=424

 Score =   332 bits (851),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/205 (75%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V+DPALWA  VGNSWR T+DI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  216  VNDPALWAGKVGNSWRTTDDINDSWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  275

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL+IGCDVRNMT ET EILSN EVI+V+QDPLGVQGRKV   G
Sbjct  276  TYQEYRAHFSIWALMKAPLLIGCDVRNMTKETLEILSNAEVISVNQDPLGVQGRKVYAYG  335

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
            +D C +VWAGPLSG RLVV LWNRCSK  +ITA+W ++GLESS SVSIRDLWKH+ +S  
Sbjct  336  SDNCYQVWAGPLSGQRLVVILWNRCSKTASITANWSILGLESSISVSIRDLWKHKIVSEK  395

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            AV SFSA+V  H  E+YIFTP + T
Sbjct  396  AVASFSARVDGHACEMYIFTPLSET  420



>ref|XP_010937998.1| PREDICTED: alpha-galactosidase isoform X3 [Elaeis guineensis]
Length=350

 Score =   329 bits (844),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI D+WESMTAIAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  143  VDDPALWAGKVGNSWRTTDDITDSWESMTAIADLNDKWASYAGPGGWNDPDMLEVGNGGM  202

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T+ EYR HFSIWALMKAPL+IGCDVRNMTAETFEILSN EVIAV+QDPLGVQGRKVSV G
Sbjct  203  THMEYRGHFSIWALMKAPLLIGCDVRNMTAETFEILSNEEVIAVNQDPLGVQGRKVSVGG  262

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             +GC +VWAGPLSGNRLVVALWNRCS+  TITA W+ +GL+S+  VSIRDLWKHE +  N
Sbjct  263  KNGCSQVWAGPLSGNRLVVALWNRCSEAVTITAKWETLGLDSTTCVSIRDLWKHETLQEN  322

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
               ++ A+V +H  ++YIF+P +  S S
Sbjct  323  VAGTYGAQVDAHDCKIYIFSPTSSLSVS  350



>ref|XP_002520852.1| alpha-galactosidase/alpha-n-acetylgalactosaminidase, putative 
[Ricinus communis]
 gb|EEF41561.1| alpha-galactosidase/alpha-n-acetylgalactosaminidase, putative 
[Ricinus communis]
Length=360

 Score =   329 bits (843),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 174/204 (85%), Gaps = 0/204 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  152  VDDPALWAGKVGNSWRTTDDINDSWVSMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  211

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL+IGCDVRNMTAET+EIL+N EVIAV+QD LGVQGRKV  SG
Sbjct  212  TYQEYRAHFSIWALMKAPLLIGCDVRNMTAETYEILTNKEVIAVNQDSLGVQGRKVQASG  271

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPLSG+R+ V LWNRCSK  TITA WD +GLES  SV++RDLW+H+DI+ +
Sbjct  272  TDGCLQVWAGPLSGHRMAVVLWNRCSKAATITARWDALGLESGTSVAVRDLWQHKDITGD  331

Query  254  AVKSFSAKVKSHGSELYIFTPQTV  183
            +V SF  +V +H   +Y FTP+TV
Sbjct  332  SVASFGTRVDAHDCAMYTFTPKTV  355



>ref|XP_010322133.1| PREDICTED: alpha-galactosidase [Solanum lycopersicum]
Length=425

 Score =   331 bits (849),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            +DDPA WA  +GNSWR T+DI DTW SMT IADINNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  217  IDDPAKWAGKIGNSWRTTDDINDTWISMTTIADINNKWASYAGPGGWNDPDMLEVGNGGM  276

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
             Y EY+ HFSIWALMKAPLIIGCDVRN+TA+  EILSN EVIAV+QDPLGVQGR+V  SG
Sbjct  277  NYHEYKGHFSIWALMKAPLIIGCDVRNITADALEILSNKEVIAVNQDPLGVQGRRVYSSG  336

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGCQ+VWAGPLS NRL + LWNRCSK  TITA W  IGLE S SVS+RDLWKH+ +S N
Sbjct  337  PDGCQQVWAGPLSRNRLAMVLWNRCSKAATITAKWSAIGLEPSISVSMRDLWKHKVVSEN  396

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
             V SFSA+VK+HG E+YI TPQ  T  S
Sbjct  397  TVGSFSARVKAHGCEMYILTPQRATRSS  424



>ref|XP_010937996.1| PREDICTED: alpha-galactosidase isoform X1 [Elaeis guineensis]
Length=424

 Score =   331 bits (848),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI D+WESMTAIAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  217  VDDPALWAGKVGNSWRTTDDITDSWESMTAIADLNDKWASYAGPGGWNDPDMLEVGNGGM  276

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T+ EYR HFSIWALMKAPL+IGCDVRNMTAETFEILSN EVIAV+QDPLGVQGRKVSV G
Sbjct  277  THMEYRGHFSIWALMKAPLLIGCDVRNMTAETFEILSNEEVIAVNQDPLGVQGRKVSVGG  336

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             +GC +VWAGPLSGNRLVVALWNRCS+  TITA W+ +GL+S+  VSIRDLWKHE +  N
Sbjct  337  KNGCSQVWAGPLSGNRLVVALWNRCSEAVTITAKWETLGLDSTTCVSIRDLWKHETLQEN  396

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
               ++ A+V +H  ++YIF+P +  S S
Sbjct  397  VAGTYGAQVDAHDCKIYIFSPTSSLSVS  424



>ref|XP_006403000.1| hypothetical protein EUTSA_v10005987mg [Eutrema salsugineum]
 gb|ESQ44453.1| hypothetical protein EUTSA_v10005987mg [Eutrema salsugineum]
Length=436

 Score =   331 bits (848),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMT IAD+NNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  228  VDDPALWAKEVGNSWRTTDDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEVGNGGM  287

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TYEEYR HFSIWALMKAPL+IGCDVR MTAETFEILSN EVIAV+QDPLGVQGRK+  +G
Sbjct  288  TYEEYRGHFSIWALMKAPLLIGCDVRKMTAETFEILSNKEVIAVNQDPLGVQGRKIQGNG  347

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             + CQ+VW+GPL+G+R+V+ALWNRCS+  TITA W+ IGLES+ S+S+RDLW+H+D++ N
Sbjct  348  ENDCQQVWSGPLTGDRMVIALWNRCSEPATITASWNAIGLESTISLSVRDLWQHKDVTDN  407

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            A  SF A+V  H   +Y+ TPQTV+
Sbjct  408  ASVSFEAQVDPHDCHMYVLTPQTVS  432



>emb|CDP13918.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   330 bits (847),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 153/206 (74%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI D+W SMT+IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  215  VDDPALWAGKVGNSWRTTDDINDSWASMTSIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  274

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL++GCDVRNM +ETFEILSN EVIAV+QD LGVQGRKV VSG
Sbjct  275  TYQEYRAHFSIWALMKAPLLVGCDVRNMMSETFEILSNEEVIAVNQDSLGVQGRKVYVSG  334

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC++VWAGPLS  R+VV LWNRCSK  TITA W  +GLESS  VS+RDLWKHE ++ N
Sbjct  335  TDGCEQVWAGPLSEQRVVVVLWNRCSKVATITAGWSALGLESSTPVSVRDLWKHEVVADN  394

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTS  177
             V S SA+V++H  E++I TPQT T+
Sbjct  395  RVASLSAQVEAHACEMFILTPQTTTN  420



>ref|XP_006581728.1| PREDICTED: alpha-galactosidase-like [Glycine max]
Length=431

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V+DPALWA+ VGNSWR T DI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  223  VEDPALWADKVGNSWRTTGDINDSWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  282

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWAL KAPL+IGCDVRN+TAET EILSN EVIA++QD LGVQGRKV VSG
Sbjct  283  TYQEYRAHFSIWALAKAPLLIGCDVRNLTAETLEILSNKEVIAINQDSLGVQGRKVQVSG  342

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
            ADGC++VWAGPLSGNRL VALWNRCSK  TITA W+ +GLES   VS+RDLW+H+ ++ +
Sbjct  343  ADGCRQVWAGPLSGNRLAVALWNRCSKVATITASWEALGLESGVHVSVRDLWQHKVVTGD  402

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            AV SFSA+V  H  +LYIF P TV+
Sbjct  403  AVSSFSARVDIHDCQLYIFAPFTVS  427



>ref|XP_006366118.1| PREDICTED: alpha-galactosidase-like [Solanum tuberosum]
Length=436

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            +DDPA WA  +GNSWR T+DI DTW SMT IADINNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  228  IDDPAEWAGKIGNSWRTTDDINDTWISMTTIADINNKWASYAGPGGWNDPDMLEVGNGGM  287

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
             Y EY+ HFSIWALMKAPLIIGCDVRN+TA+T +ILSN EVIAVDQDPLGVQGR+V  SG
Sbjct  288  NYHEYKGHFSIWALMKAPLIIGCDVRNITADTLKILSNKEVIAVDQDPLGVQGRRVYASG  347

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGCQ+VWAGPLS NRL + LWNRCSK  TITA+W  IGLE S SVS+RDLWKHE +S N
Sbjct  348  PDGCQQVWAGPLSRNRLAMVLWNRCSKAATITANWSAIGLEPSISVSMRDLWKHEVVSEN  407

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
             V SFSA+V +HG E+YI TP+  T  S
Sbjct  408  TVGSFSARVNAHGCEMYILTPRRSTRSS  435



>gb|KHN25820.1| Alpha-galactosidase [Glycine soja]
Length=431

 Score =   330 bits (847),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 153/205 (75%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V+DPALWA+ VGNSWR T DI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  223  VEDPALWADKVGNSWRTTGDINDSWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  282

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWAL KAPL+IGCDVRN+TAET EILSN EVIA++QD LGVQGRKV VSG
Sbjct  283  TYQEYRAHFSIWALAKAPLLIGCDVRNLTAETLEILSNKEVIAINQDSLGVQGRKVQVSG  342

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
            ADGC++VWAGPLSGNRL VALWNRCSK  TITA W+ +GLES   VS+RDLW+H+ ++ +
Sbjct  343  ADGCRQVWAGPLSGNRLAVALWNRCSKVATITASWEALGLESGVHVSVRDLWQHKVVTGD  402

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            AV SFSA+V  H  +LYIF P TV+
Sbjct  403  AVSSFSARVDIHDCQLYIFAPFTVS  427



>ref|XP_010253117.1| PREDICTED: alpha-galactosidase-like isoform X1 [Nelumbo nucifera]
Length=425

 Score =   330 bits (846),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA GVGNSWR T+DI D+W SMT  AD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  217  VDDPALWAGGVGNSWRTTDDINDSWASMTTTADLNDKWATYAGPGGWNDPDMLEVGNGGM  276

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T++EYRAHFSIWALMKAPL+IGCDVRNMTAET EILSN EVIAV+QD LGVQGRKV   G
Sbjct  277  TFQEYRAHFSIWALMKAPLLIGCDVRNMTAETLEILSNKEVIAVNQDSLGVQGRKVYAEG  336

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             D C++VWAGPLSGNRLVVA WNRCSK  TITA W+V+GL  +  VS+RD+WKHED++  
Sbjct  337  KDNCRQVWAGPLSGNRLVVAFWNRCSKAVTITAKWEVLGLHPTIKVSVRDIWKHEDVAEV  396

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            A+ SFS +V SH  ++Y+FTPQ ++
Sbjct  397  ALTSFSTRVDSHDCKMYVFTPQILS  421



>ref|XP_010253118.1| PREDICTED: alpha-galactosidase-like isoform X2 [Nelumbo nucifera]
Length=398

 Score =   328 bits (842),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA GVGNSWR T+DI D+W SMT  AD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  190  VDDPALWAGGVGNSWRTTDDINDSWASMTTTADLNDKWATYAGPGGWNDPDMLEVGNGGM  249

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T++EYRAHFSIWALMKAPL+IGCDVRNMTAET EILSN EVIAV+QD LGVQGRKV   G
Sbjct  250  TFQEYRAHFSIWALMKAPLLIGCDVRNMTAETLEILSNKEVIAVNQDSLGVQGRKVYAEG  309

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             D C++VWAGPLSGNRLVVA WNRCSK  TITA W+V+GL  +  VS+RD+WKHED++  
Sbjct  310  KDNCRQVWAGPLSGNRLVVAFWNRCSKAVTITAKWEVLGLHPTIKVSVRDIWKHEDVAEV  369

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            A+ SFS +V SH  ++Y+FTPQ ++
Sbjct  370  ALTSFSTRVDSHDCKMYVFTPQILS  394



>ref|XP_008374730.1| PREDICTED: alpha-galactosidase-like [Malus domestica]
Length=431

 Score =   329 bits (843),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 151/205 (74%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  +GNSWR T+DI D+W SMTAIAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  222  VDDPALWAGKLGNSWRTTDDINDSWASMTAIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  281

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYR+HFSIWALMKAPL+IGCDVRNMTAETFEILSN EVIAV+QDPLGVQGRKV+VSG
Sbjct  282  TYQEYRSHFSIWALMKAPLLIGCDVRNMTAETFEILSNEEVIAVNQDPLGVQGRKVNVSG  341

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPLSG R  V LWNRCSK  TITA W+ +GL+S  SVS+R LW+H++++ +
Sbjct  342  PDGCYQVWAGPLSGYRWAVVLWNRCSKANTITATWEALGLKSGISVSVRXLWQHKEVAVD  401

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            AV SF A+V +H   +YIFTP T +
Sbjct  402  AVSSFGAQVDAHDCLMYIFTPHTTS  426



>ref|XP_010670635.1| PREDICTED: alpha-galactosidase [Beta vulgaris subsp. vulgaris]
Length=429

 Score =   328 bits (842),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 175/209 (84%), Gaps = 0/209 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR TEDI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  220  VDDPALWAGEVGNSWRTTEDINDSWASMTTIADLNDKWASYAGPGGWNDPDMLEVGNGGM  279

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY EYRAHFSIWALMKAPL+IGCD+RNMTAET EILSNTEVI V+QDPLGVQGRKV  SG
Sbjct  280  TYHEYRAHFSIWALMKAPLLIGCDIRNMTAETLEILSNTEVIGVNQDPLGVQGRKVHASG  339

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             + CQ+VWAGPLSGNR+ VALWNRC     ITA W+V+GL+SS SVSI+DLW+H+ I+ +
Sbjct  340  PNDCQQVWAGPLSGNRIAVALWNRCPSAAVITAGWNVLGLQSSVSVSIQDLWQHKLIAKD  399

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYSS  168
            AV SF  +V+SH   +YIFTP+    +S+
Sbjct  400  AVSSFGVRVESHDCAMYIFTPKISQLHSA  428



>ref|XP_004502844.1| PREDICTED: alpha-galactosidase-like isoform X1 [Cicer arietinum]
Length=433

 Score =   327 bits (839),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  225  VDDPALWAGKVGNSWRTTDDINDTWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  284

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWAL KAPL++GCD+RNMTAET EIL+N EVIA++QD LGVQGRKV VSG
Sbjct  285  TYQEYRAHFSIWALAKAPLLVGCDIRNMTAETREILTNKEVIAINQDSLGVQGRKVQVSG  344

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             + C +VWAGPLSG+RL VALWNRCSK  TITA W+ +GLES   VS+RDLW+H+ I+ +
Sbjct  345  INDCSQVWAGPLSGSRLAVALWNRCSKVATITASWEALGLESGIHVSVRDLWQHKVINGD  404

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
            AV SFSA+V SH S+LYIFTP T  SYS
Sbjct  405  AVSSFSAQVDSHDSKLYIFTPSTA-SYS  431



>gb|AAU86897.1| glycosyl hydrolase family-like protein [Salvia miltiorrhiza]
Length=431

 Score =   326 bits (836),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  224  VDDPALWAGTVGNSWRTTDDINDSWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  283

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TYEEYRAHFSIWALMKAPL+IGCDVRN+T+E FEILSN EVI+V+QDPLGVQGRKV   G
Sbjct  284  TYEEYRAHFSIWALMKAPLLIGCDVRNITSEAFEILSNEEVISVNQDPLGVQGRKVYAYG  343

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
            AD   +VWAGPLSG RL V LWNR SK  +IT  WDV+GLESS SVS+RDLWKH  +SAN
Sbjct  344  ADNSYQVWAGPLSGQRLAVVLWNRGSKTASITVKWDVLGLESSISVSVRDLWKHNYVSAN  403

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
            ++  FSA+V +H SE+Y+FTP    S S
Sbjct  404  SMAYFSARVDAHSSEMYVFTPSMTFSAS  431



>ref|XP_010067604.1| PREDICTED: alpha-galactosidase-like [Eucalyptus grandis]
 gb|KCW65765.1| hypothetical protein EUGRSUZ_G03128 [Eucalyptus grandis]
Length=432

 Score =   326 bits (836),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  +GNSWR T+DI DTW SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  224  VDDPALWAGKIGNSWRTTDDINDTWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  283

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL++GCDVRNMTAET++++SN EVIAV+QD LGVQGRKV+VSG
Sbjct  284  TYQEYRAHFSIWALMKAPLLVGCDVRNMTAETYQLVSNEEVIAVNQDSLGVQGRKVNVSG  343

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
              GC +VWAGPLS  RLVVALWNRCSK  +ITA W+ +GL+SS SVSIRDLW+H+D++ +
Sbjct  344  TGGCSQVWAGPLSRRRLVVALWNRCSKAVSITAAWEALGLDSSTSVSIRDLWQHKDVAED  403

Query  254  AVKSFSAKVKSHGSELYIFTPQT  186
               SFSA+V +H   +Y+ TPQT
Sbjct  404  VASSFSAQVDAHDCHMYMLTPQT  426



>gb|EPS71460.1| glycosyl hydrolase family-like protein, partial [Genlisea aurea]
Length=427

 Score =   325 bits (834),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 150/201 (75%), Positives = 173/201 (86%), Gaps = 0/201 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T DI+D WESMT IADIN+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  227  VDDPALWAGSVGNSWRTTVDIKDNWESMTGIADINDKWAAYAGPGGWNDPDMLEVGNGGM  286

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
             Y+EY++HFSIWALMKAPL+IGCDVR+M+ ETFEI+SN EVI+V+QDPLGVQGRKVS SG
Sbjct  287  AYQEYKSHFSIWALMKAPLLIGCDVRSMSPETFEIISNEEVISVNQDPLGVQGRKVSTSG  346

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
              GC EVWAGPL+GNRL V LWNRC +  +ITA W+ +GLES  SVSI+DLWKHE++S N
Sbjct  347  PAGCNEVWAGPLTGNRLAVVLWNRCWERSSITADWESLGLESETSVSIKDLWKHEEVSVN  406

Query  254  AVKSFSAKVKSHGSELYIFTP  192
            +V SFS +V+ HG E+YIFTP
Sbjct  407  SVGSFSGEVEGHGCEMYIFTP  427



>ref|XP_007137622.1| hypothetical protein PHAVU_009G142100g [Phaseolus vulgaris]
 gb|ESW09616.1| hypothetical protein PHAVU_009G142100g [Phaseolus vulgaris]
Length=433

 Score =   326 bits (835),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            +D+PALWA+ VGNSWR TEDI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  225  IDNPALWADKVGNSWRTTEDINDSWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  284

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWAL KAPL+IGCDVRN+TAET EIL N EVIA++QD LGVQGRKV V+G
Sbjct  285  TYQEYRAHFSIWALAKAPLLIGCDVRNLTAETLEILGNEEVIAINQDSLGVQGRKVQVAG  344

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPLSGNRLVVALWNRCS+  TITA W+ +GLES   VS+RDLW+H+ ++ +
Sbjct  345  VDGCGQVWAGPLSGNRLVVALWNRCSEVATITASWEALGLESGVHVSVRDLWQHKLVTGD  404

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            AV SFSA+V  H  +LYIFTP  V+
Sbjct  405  AVSSFSARVDIHDCQLYIFTPFIVS  429



>emb|CAN75523.1| hypothetical protein VITISV_043596 [Vitis vinifera]
Length=449

 Score =   326 bits (836),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI D+W SMT IAD+N++WA YAGPGGWNDPDMLEVGNGGM
Sbjct  241  VDDPALWAGKVGNSWRTTDDINDSWASMTTIADLNDEWAAYAGPGGWNDPDMLEVGNGGM  300

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEYRAHFSIWALMKAPL++GCDVRN+TAETFEI+ N EVI ++QD LG+QGRKV VSG
Sbjct  301  TLEEYRAHFSIWALMKAPLLVGCDVRNITAETFEIIGNKEVIDINQDSLGIQGRKVHVSG  360

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC++VWAGPLSG+RLVVALWNRCSK  TIT  W+V+GLESS SVSIRDLWKH D+S +
Sbjct  361  KDGCRQVWAGPLSGHRLVVALWNRCSKAATITVGWEVLGLESSMSVSIRDLWKHXDLSGD  420

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            AV SF + V SH   +YIFTP + +
Sbjct  421  AVASFGSLVASHDCGMYIFTPVSAS  445



>ref|XP_002279730.1| PREDICTED: alpha-galactosidase [Vitis vinifera]
 emb|CBI25379.3| unnamed protein product [Vitis vinifera]
Length=427

 Score =   325 bits (834),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI D+W SMT IAD+N++WA YAGPGGWNDPDMLEVGNGGM
Sbjct  219  VDDPALWAGKVGNSWRTTDDINDSWASMTTIADLNDEWAAYAGPGGWNDPDMLEVGNGGM  278

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEYRAHFSIWALMKAPL++GCDVRN+TAETFEI+ N EVI ++QD LG+QGRKV VSG
Sbjct  279  TLEEYRAHFSIWALMKAPLLVGCDVRNITAETFEIIGNKEVIDINQDSLGIQGRKVHVSG  338

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC++VWAGPLSG+RLVVALWNRCSK  TIT  W+V+GLESS SVSIRDLWKH D+S +
Sbjct  339  KDGCRQVWAGPLSGHRLVVALWNRCSKAATITVGWEVLGLESSMSVSIRDLWKHVDLSGD  398

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
            AV SF + V SH   +YIFTP + +
Sbjct  399  AVASFGSLVASHDCGMYIFTPVSAS  423



>ref|XP_002325481.2| hypothetical protein POPTR_0019s08450g [Populus trichocarpa]
 gb|EEE99862.2| hypothetical protein POPTR_0019s08450g [Populus trichocarpa]
Length=437

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/204 (74%), Positives = 173/204 (85%), Gaps = 0/204 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI D+W SMT  AD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  229  VDDPALWAGKVGNSWRTTDDINDSWASMTTTADLNDKWASYAGPGGWNDPDMLEVGNGGM  288

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY EYRAHFSIWALMKAPL+IGCDVRNMTAET EIL+N E+IAV+QDPLG+QGRKV  +G
Sbjct  289  TYHEYRAHFSIWALMKAPLLIGCDVRNMTAETIEILTNKEIIAVNQDPLGIQGRKVYSTG  348

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPLSG+R+VVALWNRCSK  TITA W  +GLESS SVS+RDLW+ +DI  +
Sbjct  349  TDGCLQVWAGPLSGHRIVVALWNRCSKAATITAGWGALGLESSTSVSVRDLWQGKDIVGD  408

Query  254  AVKSFSAKVKSHGSELYIFTPQTV  183
            AV SF A+V +H   ++IFTP +V
Sbjct  409  AVASFGARVDAHDCLIFIFTPHSV  432



>ref|XP_010103637.1| hypothetical protein L484_011230 [Morus notabilis]
 gb|EXB96520.1| hypothetical protein L484_011230 [Morus notabilis]
Length=420

 Score =   324 bits (831),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/203 (74%), Positives = 171/203 (84%), Gaps = 0/203 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR TEDI DTW SMT IAD+NNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  212  VDDPALWAGKVGNSWRTTEDINDTWASMTTIADLNNKWAAYAGPGGWNDPDMLEVGNGGM  271

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T +EYR HFSIWALMKAPLIIGCDVR+++AET EILSN EVI V+QD LGVQGR+V  SG
Sbjct  272  TCQEYRGHFSIWALMKAPLIIGCDVRSISAETIEILSNKEVILVNQDRLGVQGRRVDASG  331

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             +GC +VW+GPLSG+RL VALWNRCSK  TITAHW  +GL+   SVS+RDLW+H+DI+A 
Sbjct  332  PEGCSQVWSGPLSGDRLAVALWNRCSKTTTITAHWKALGLQPRTSVSVRDLWQHKDIAAG  391

Query  254  AVKSFSAKVKSHGSELYIFTPQT  186
             V S+SA+V+SH S LYIF+  T
Sbjct  392  VVSSYSARVESHDSHLYIFSLHT  414



>ref|XP_008808316.1| PREDICTED: alpha-galactosidase [Phoenix dactylifera]
Length=422

 Score =   323 bits (828),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI D+WESMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  215  VDDPALWAGKVGNSWRTTDDITDSWESMTTIADLNDKWASYAGPGGWNDPDMLEVGNGGM  274

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY EYR HFSIWALMKAPL++GCDVR MTA+TFEILSN EVIAV+QDPLGVQGRKVSV G
Sbjct  275  TYMEYRGHFSIWALMKAPLLMGCDVRKMTAKTFEILSNEEVIAVNQDPLGVQGRKVSVGG  334

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             + C +VWAGPLS NRLVVALWNRCS+  TITA W+++GL+S+ SVSIRDLWKHE +  N
Sbjct  335  NNDCSQVWAGPLSENRLVVALWNRCSEAVTITAKWEMLGLDSTTSVSIRDLWKHETLQEN  394

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
               S+ A+V +H  ++YIF+P +  S S
Sbjct  395  VAGSYGAEVDAHDCKMYIFSPTSSLSVS  422



>ref|XP_004307724.1| PREDICTED: alpha-galactosidase 3 [Fragaria vesca subsp. vesca]
Length=431

 Score =   323 bits (828),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 151/203 (74%), Positives = 175/203 (86%), Gaps = 0/203 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  222  VDDPALWAGKVGNSWRTTDDINDSWASMTTIADLNDKWASYAGPGGWNDPDMLEVGNGGM  281

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            +Y+EYRAHFSIWALMKAPL+IGCDVRNMTAET+EILSN EVIAV+QD LGVQGRKV+VSG
Sbjct  282  SYQEYRAHFSIWALMKAPLLIGCDVRNMTAETYEILSNEEVIAVNQDSLGVQGRKVNVSG  341

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DG  +VWAGPLSG+RL VALWNR S  +TIT  W+ +GL+SS SVS+RDLW+H+ ++ N
Sbjct  342  TDGVYQVWAGPLSGHRLAVALWNRGSTAKTITVKWEELGLQSSISVSVRDLWQHKLVTDN  401

Query  254  AVKSFSAKVKSHGSELYIFTPQT  186
            AV SF A V++H   LY+FTPQT
Sbjct  402  AVSSFGALVEAHDCHLYLFTPQT  424



>ref|XP_011076595.1| PREDICTED: alpha-galactosidase-like [Sesamum indicum]
Length=425

 Score =   321 bits (823),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 170/209 (81%), Gaps = 0/209 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V DPALWA  VGNSWR T+DI D+W SMT IAD+N+KWA +AGPGGWNDPDMLEVGNGGM
Sbjct  217  VHDPALWAGKVGNSWRTTDDINDSWASMTTIADLNDKWAAFAGPGGWNDPDMLEVGNGGM  276

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            +Y EYRAHFSIWALMKAPL+IGCDVRNMT ETFEILSN EVIAV+QDPLGVQGRKV   G
Sbjct  277  SYHEYRAHFSIWALMKAPLLIGCDVRNMTQETFEILSNEEVIAVNQDPLGVQGRKVYSYG  336

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPLSG RL V LWNR SK  TITA W  +G+ESS SVSI+DLWKH+ ++ N
Sbjct  337  PDGCYQVWAGPLSGQRLAVVLWNRGSKPATITAKWASLGIESSTSVSIKDLWKHKCVTEN  396

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYSS  168
             V SFSA+V  H  E+YIF+P  V   +S
Sbjct  397  KVASFSARVDPHACEMYIFSPLAVARSAS  425



>ref|XP_004502845.1| PREDICTED: alpha-galactosidase-like isoform X2 [Cicer arietinum]
Length=430

 Score =   320 bits (820),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 176/208 (85%), Gaps = 4/208 (2%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  225  VDDPALWAGKVGNSWRTTDDINDTWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  284

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWAL KAPL++GCD+RNMTAET EIL+N EVIA++QD LGVQGRKV VSG
Sbjct  285  TYQEYRAHFSIWALAKAPLLVGCDIRNMTAETREILTNKEVIAINQDSLGVQGRKVQVSG  344

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             +   EVWAGPLSG+RL VALWNRCSK  TITA W+ +GLES   VS+RDLW+H+ I+ +
Sbjct  345  IN---EVWAGPLSGSRLAVALWNRCSKVATITASWEALGLESGIHVSVRDLWQHKVINGD  401

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
            AV SFSA+V SH S+LYIFTP T  SYS
Sbjct  402  AVSSFSAQVDSHDSKLYIFTPSTA-SYS  428



>ref|XP_008456938.1| PREDICTED: alpha-galactosidase isoform X1 [Cucumis melo]
Length=430

 Score =   319 bits (817),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/201 (74%), Positives = 167/201 (83%), Gaps = 0/201 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMT +ADINNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  222  VDDPALWAGKVGNSWRTTDDINDTWASMTTLADINNKWAAYAGPGGWNDPDMLEVGNGGM  281

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMK+PL+IGCDVRNMT ET EIL N EVIAV+QDPLGVQGRKV   G
Sbjct  282  TYQEYRAHFSIWALMKSPLLIGCDVRNMTKETSEILMNKEVIAVNQDPLGVQGRKVKDFG  341

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPLSG+RL V LWNRCS   TIT  W+V+GL+ + SVS+RDLW HED+  +
Sbjct  342  KDGCLQVWAGPLSGSRLAVVLWNRCSVASTITTDWNVLGLKPNTSVSVRDLWLHEDVEGD  401

Query  254  AVKSFSAKVKSHGSELYIFTP  192
            AV SF A+V  H  +++IFTP
Sbjct  402  AVSSFGAEVDPHDCKMFIFTP  422



>gb|KGN50728.1| hypothetical protein Csa_5G220910 [Cucumis sativus]
Length=430

 Score =   318 bits (816),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 168/201 (84%), Gaps = 0/201 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMT +AD+NNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  222  VDDPALWAGKVGNSWRTTDDINDTWASMTTLADLNNKWAAYAGPGGWNDPDMLEVGNGGM  281

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMK+PL+IGCDVRNMT ET EIL N EVIAV+QDPLGVQGRKV V G
Sbjct  282  TYQEYRAHFSIWALMKSPLLIGCDVRNMTKETSEILMNKEVIAVNQDPLGVQGRKVKVFG  341

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPLSG+RL V LWNRCS   TIT  W+ +GL+ + SVS+RDLW HED++ +
Sbjct  342  KDGCLQVWAGPLSGSRLAVVLWNRCSVASTITTDWNALGLKPNTSVSVRDLWLHEDVAGD  401

Query  254  AVKSFSAKVKSHGSELYIFTP  192
            A+ SF A+V  H  ++++FTP
Sbjct  402  AMSSFGAEVDPHDCKMFVFTP  422



>ref|NP_001292680.1| alpha-galactosidase 3 precursor [Cucumis sativus]
 gb|AEQ94270.1| alpha galacdosidase 3 [Cucumis sativus]
Length=430

 Score =   318 bits (815),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 168/201 (84%), Gaps = 0/201 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI DTW SMT +AD+NNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  222  VDDPALWAGKVGNSWRTTDDINDTWASMTTLADLNNKWAAYAGPGGWNDPDMLEVGNGGM  281

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMK+PL+IGCDVRNMT ET EIL N EVIAV+QDPLGVQGRKV V G
Sbjct  282  TYQEYRAHFSIWALMKSPLLIGCDVRNMTKETSEILMNKEVIAVNQDPLGVQGRKVKVFG  341

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC ++WAGPLSG+RL V LWNRCS   TIT  W+ +GL+ + SVS+RDLW HED++ +
Sbjct  342  KDGCLQIWAGPLSGSRLAVVLWNRCSVASTITTDWNALGLKPNTSVSVRDLWLHEDVAGD  401

Query  254  AVKSFSAKVKSHGSELYIFTP  192
            A+ SF A+V  H  ++++FTP
Sbjct  402  AMSSFGAEVDPHDCKMFVFTP  422



>ref|XP_006843705.1| PREDICTED: alpha-galactosidase 3 [Amborella trichopoda]
 gb|ERN05380.1| hypothetical protein AMTR_s00007p00210400 [Amborella trichopoda]
Length=426

 Score =   316 bits (810),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/205 (73%), Positives = 170/205 (83%), Gaps = 1/205 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPALWA  VGNSWR T+DI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  220  DDPALWAGRVGNSWRTTQDINDSWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGMT  279

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
            +EEYRAHFSIW+LMKAPL+IGCDVRNMTAET EILSN EVIAV+QDPLG+QGRKVS  G+
Sbjct  280  FEEYRAHFSIWSLMKAPLLIGCDVRNMTAETLEILSNKEVIAVNQDPLGIQGRKVSAEGS  339

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            D C +VWAGPLSGNR+VVALWNRCS+  TI A W+ IGL SSASV +RDLWKHED+  N 
Sbjct  340  DYCSQVWAGPLSGNRMVVALWNRCSEPVTIKAKWETIGLHSSASVLMRDLWKHEDL-GNI  398

Query  251  VKSFSAKVKSHGSELYIFTPQTVTS  177
               F A + SH   +YI TP  +++
Sbjct  399  DGFFEAIIASHDCGMYILTPLALSN  423



>ref|XP_003562450.1| PREDICTED: alpha-galactosidase [Brachypodium distachyon]
Length=428

 Score =   313 bits (803),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 167/207 (81%), Gaps = 0/207 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPALWA  VGNSWR T+DI+DTW+SMT IAD NNKWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  222  DDPALWAGKVGNSWRTTDDIQDTWKSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMT  281

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
            + EYRAHFSIWALMKAPL+IGCDVRNMT+ET EILSN EVI V+QD LGVQGR++   G 
Sbjct  282  FAEYRAHFSIWALMKAPLLIGCDVRNMTSETVEILSNKEVIQVNQDRLGVQGRRILGQGK  341

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DGC+EVWAGPLSGNRL VALWNRCS    IT     +GL+ S++ S+RDLWKHE +S N 
Sbjct  342  DGCREVWAGPLSGNRLAVALWNRCSATTNITMKLPAVGLDGSSAYSVRDLWKHETLSPNV  401

Query  251  VKSFSAKVKSHGSELYIFTPQTVTSYS  171
            V +F A+V +H  ++Y+FTP    S S
Sbjct  402  VATFGAQVNAHDCKMYVFTPAVSVSAS  428



>gb|AHA84202.1| alpha-galactosidase-like protein [Phaseolus vulgaris]
Length=420

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 168/196 (86%), Gaps = 0/196 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            +D+PALWA+ VGNSWR TEDI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  225  IDNPALWADKVGNSWRTTEDINDSWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  284

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWAL KAPL+IGCDVRN+TAET EIL N EVIA++QD LGVQGRKV V+G
Sbjct  285  TYQEYRAHFSIWALAKAPLLIGCDVRNLTAETLEILGNEEVIAINQDSLGVQGRKVQVAG  344

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DGC +VWAGPLSGNRLVVALWNRCS+  TITA W+ +GLES   VS+RDLW+H+ ++ +
Sbjct  345  VDGCGQVWAGPLSGNRLVVALWNRCSEVATITASWEALGLESGVHVSVRDLWQHKLVTGD  404

Query  254  AVKSFSAKVKSHGSEL  207
            AV SFSA+V  H  +L
Sbjct  405  AVSSFSARVDIHDFQL  420



>dbj|BAJ95779.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 168/207 (81%), Gaps = 0/207 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPALWA  VGNSWR T+DI+DTW+SMT IAD NNKWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  224  DDPALWAGKVGNSWRTTDDIQDTWKSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMT  283

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
            + EYRAHFSIWALMKAPL+IGCDVRNMT++T EILSN EVI V+QDPLGVQGR++   G 
Sbjct  284  FAEYRAHFSIWALMKAPLLIGCDVRNMTSQTIEILSNKEVIQVNQDPLGVQGRRILGQGK  343

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
             GC+EVWAGPLSGNRL VALWNRCS+   IT     +GL+ S++ S+RDLWKHE +SAN 
Sbjct  344  GGCREVWAGPLSGNRLAVALWNRCSETVNITMTLPAVGLDGSSAYSVRDLWKHETLSANV  403

Query  251  VKSFSAKVKSHGSELYIFTPQTVTSYS  171
            V +F A+V  H  ++YIFTP    S S
Sbjct  404  VGTFGAQVDMHDCKMYIFTPAVGFSTS  430



>ref|XP_002461216.1| hypothetical protein SORBIDRAFT_02g042960 [Sorghum bicolor]
 gb|EER97737.1| hypothetical protein SORBIDRAFT_02g042960 [Sorghum bicolor]
Length=431

 Score =   311 bits (798),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/202 (72%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPALWA  VGNSWR T+DI DTW+SMT IAD NNKWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  225  DDPALWAGKVGNSWRTTDDITDTWQSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMT  284

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWALMKAPL+IGCDVRNMT+ET EILSN EVI V+QDPLGVQGRK+   G 
Sbjct  285  SAEYRSHFSIWALMKAPLLIGCDVRNMTSETMEILSNKEVIQVNQDPLGVQGRKILGEGK  344

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
             GC+EVWAGPLSGNRLV+ALWNRCS+   IT     +GL+ SA+ S+RDLWKHE +S N 
Sbjct  345  YGCREVWAGPLSGNRLVIALWNRCSETANITMKLPAVGLDGSAAYSVRDLWKHETLSENV  404

Query  251  VKSFSAKVKSHGSELYIFTPQT  186
            V +F A+V  H +++YIF+P T
Sbjct  405  VGTFGAQVDVHDTKMYIFSPAT  426



>ref|XP_006435888.1| hypothetical protein CICLE_v10034010mg [Citrus clementina]
 ref|XP_006435889.1| hypothetical protein CICLE_v10034010mg [Citrus clementina]
 ref|XP_006435890.1| hypothetical protein CICLE_v10034010mg [Citrus clementina]
 gb|ESR49128.1| hypothetical protein CICLE_v10034010mg [Citrus clementina]
 gb|ESR49129.1| hypothetical protein CICLE_v10034010mg [Citrus clementina]
 gb|ESR49130.1| hypothetical protein CICLE_v10034010mg [Citrus clementina]
Length=182

 Score =   301 bits (772),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  713  MTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYEEYRAHFSIWALMKAPLIIGCDVRN  534
            MT+IADIN+KWA YAGPGGWNDPDMLEVGNGGM+Y+EYRAHFSIWALMKAPL+IGCDVRN
Sbjct  1    MTSIADINDKWASYAGPGGWNDPDMLEVGNGGMSYQEYRAHFSIWALMKAPLLIGCDVRN  60

Query  533  MTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADGCQEVWAGPLSGNRLVVALWNRCSK  354
            +TAETFEILSN EVIAV+QDPLGVQGRKV VSG D C +VW GPLSG+RLVVALWNRC K
Sbjct  61   LTAETFEILSNKEVIAVNQDPLGVQGRKVYVSGTDNCLQVWVGPLSGHRLVVALWNRCPK  120

Query  353  DETITAHWDVIGLESSASVSIRDLWKHEDISANAVKSFSAKVKSHGSELYIFTPQTVT  180
             ETITA WD +GLESS  VS+RDLW+H+ ++ +AV SF A+V +H  ++YIFTP+TVT
Sbjct  121  AETITAQWDALGLESSTKVSVRDLWQHKQVTGDAVSSFGAQVDAHDCQMYIFTPRTVT  178



>ref|NP_001130661.1| hypothetical protein precursor [Zea mays]
 gb|ACF78970.1| unknown [Zea mays]
 gb|ACF88218.1| unknown [Zea mays]
 gb|ACN34719.1| unknown [Zea mays]
 tpg|DAA64125.1| TPA: hypothetical protein ZEAMMB73_968166 [Zea mays]
Length=425

 Score =   310 bits (793),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/204 (71%), Positives = 164/204 (80%), Gaps = 0/204 (0%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            DPALWA  VGNSWR T+DI DTW+SMT IAD NNKWA YAGPGGWNDPDMLEVGNGGMT 
Sbjct  220  DPALWAGKVGNSWRTTDDITDTWKSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMTL  279

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
             EYR+HFSIWALMKAPL+IGCDVRNMT+ET EILSN EVI V+QDPLGVQGRK+   G  
Sbjct  280  AEYRSHFSIWALMKAPLLIGCDVRNMTSETMEILSNKEVIQVNQDPLGVQGRKILGQGKY  339

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
            GC+EVWAGPLSGNRLVVALWNRCS    +T     +GL+  A+ S+RDLWKHE IS N V
Sbjct  340  GCREVWAGPLSGNRLVVALWNRCSDTANVTMKLPAVGLDGYAAYSVRDLWKHETISENVV  399

Query  248  KSFSAKVKSHGSELYIFTPQTVTS  177
             +F A+V  H + +YIF+P T+ +
Sbjct  400  GTFGAQVDVHDTNMYIFSPATIVA  423



>ref|XP_009404674.1| PREDICTED: alpha-galactosidase [Musa acuminata subsp. malaccensis]
Length=422

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 166/205 (81%), Gaps = 0/205 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  VGNSWR T+DI D+W SMT IAD+NNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  214  VDDPALWAEKVGNSWRTTDDISDSWVSMTTIADLNNKWASYAGPGGWNDPDMLEVGNGGM  273

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T+ EYR+HFSIWALMKAPL++GCDVRNM AETFEILSN E+IAV+QDPLGVQGRK+   G
Sbjct  274  THAEYRSHFSIWALMKAPLLLGCDVRNMAAETFEILSNEEIIAVNQDPLGVQGRKILSEG  333

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             D C +VWAGPLSGNRLVVALWNRCS+  TIT  W+ +GL+++   S+RDLWKHE +  N
Sbjct  334  NDECSQVWAGPLSGNRLVVALWNRCSQAVTITVTWETLGLDNTTCFSVRDLWKHETLEGN  393

Query  254  AVKSFSAKVKSHGSELYIFTPQTVT  180
                  A+V SH  +++I +P + +
Sbjct  394  MAGRLGAEVDSHDCKMFILSPPSTS  418



>ref|NP_001060639.1| Os07g0679300 [Oryza sativa Japonica Group]
 dbj|BAC79549.1| putative alpha-galactosidase [Oryza sativa Japonica Group]
 dbj|BAD31216.1| putative alpha-galactosidase [Oryza sativa Japonica Group]
 dbj|BAF22553.1| Os07g0679300 [Oryza sativa Japonica Group]
 dbj|BAG94006.1| unnamed protein product [Oryza sativa Japonica Group]
Length=425

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 163/207 (79%), Gaps = 0/207 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPALWA  VGNSWR T+DI+DTW+SMT IAD NNKWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  219  DDPALWAGKVGNSWRTTDDIQDTWKSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMT  278

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
            + EYRAHFSIWALMKAPL+IGCDVRNMT ET EILSN EVI V+QDPLGVQGR++   G 
Sbjct  279  FAEYRAHFSIWALMKAPLLIGCDVRNMTKETMEILSNKEVIQVNQDPLGVQGRRILGQGK  338

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +GCQEVWAGPLSGNRL V LWNRC +   I      +GL+ S+  S+RDLWKHE +S N 
Sbjct  339  NGCQEVWAGPLSGNRLAVVLWNRCEESANIIVKLPSVGLDGSSPYSVRDLWKHETLSENV  398

Query  251  VKSFSAKVKSHGSELYIFTPQTVTSYS  171
            V +F A+V  H  ++YIFTP    + S
Sbjct  399  VGTFGAQVDVHDCKMYIFTPAVTVASS  425



>ref|XP_006658965.1| PREDICTED: alpha-galactosidase-like [Oryza brachyantha]
Length=478

 Score =   311 bits (796),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 166/207 (80%), Gaps = 0/207 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPALWA  VGNSWR T+DI+DTW+SMT IAD NNKWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  272  DDPALWAAKVGNSWRTTDDIQDTWKSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMT  331

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
            + EYRAHFSIWALMKAPL+IGCDVRNMT ET EILSN EVI V+QDPLGVQGR++   G 
Sbjct  332  FAEYRAHFSIWALMKAPLLIGCDVRNMTKETTEILSNKEVIQVNQDPLGVQGRRILGQGK  391

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +GCQEVWAGPLSGNRL VALWNRC +   IT     +GL+ S++ S+RDLWKHE +S N 
Sbjct  392  NGCQEVWAGPLSGNRLAVALWNRCEETANITIKLPSVGLDGSSAYSVRDLWKHETLSENV  451

Query  251  VKSFSAKVKSHGSELYIFTPQTVTSYS  171
            V +F A+V  H S++YIFT     + S
Sbjct  452  VGTFGAQVDVHDSKMYIFTAAVTVAAS  478



>gb|EEC82687.1| hypothetical protein OsI_27343 [Oryza sativa Indica Group]
Length=427

 Score =   306 bits (783),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 162/207 (78%), Gaps = 0/207 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPALWA  VGNSWR T+DI+DTW+SMT IAD NNKWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  221  DDPALWAGKVGNSWRTTDDIQDTWKSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMT  280

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
            + EYRAHFSIWALMKAPL+IGCDVRNMT ET EILSN EVI V+QDPLGVQGR++   G 
Sbjct  281  FAEYRAHFSIWALMKAPLLIGCDVRNMTKETMEILSNKEVIQVNQDPLGVQGRRILGQGK  340

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +GCQEVWAGPLSGNRL V LWNRC +   I      +GL+ S+  S+RDLWKHE +S N 
Sbjct  341  NGCQEVWAGPLSGNRLAVVLWNRCEESANIIVKLPSVGLDGSSPYSVRDLWKHETLSENV  400

Query  251  VKSFSAKVKSHGSELYIFTPQTVTSYS  171
            V +F A+V  H  ++ IFTP    + S
Sbjct  401  VGTFGAQVDVHDCKMCIFTPAVTVASS  427



>gb|EPS61200.1| glycosyl hydrolase family-like protein, partial [Genlisea aurea]
Length=374

 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/200 (71%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V DPALWA  VGNSWR T+DI D+W S T IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  175  VHDPALWAGKVGNSWRTTDDINDSWASFTTIADLNDKWAPYAGPGGWNDPDMLEVGNGGM  234

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            +Y+EYRAHFS+WALMK+PL+IGCDVRNM+ ETFEILSN EVIAV+QD LGVQGRKV + G
Sbjct  235  SYDEYRAHFSLWALMKSPLLIGCDVRNMSPETFEILSNEEVIAVNQDSLGVQGRKVYLYG  294

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
                 +VWAGP+SG RL V LWNR +K  TIT  W  +GLESSA+VSIRDLWKHE +S N
Sbjct  295  PGDSYQVWAGPISGQRLAVLLWNRSAKTATITVQWSHLGLESSAAVSIRDLWKHEYVSQN  354

Query  254  AVKSFSAKVKSHGSELYIFT  195
             V +FS +V SHG E +IF+
Sbjct  355  KVAAFSVRVASHGCEFFIFS  374



>ref|XP_004958697.1| PREDICTED: alpha-galactosidase-like [Setaria italica]
Length=431

 Score =   303 bits (775),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 139/199 (70%), Positives = 163/199 (82%), Gaps = 0/199 (0%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            DPALWA  VGNSWR T DI DTW+SMT IAD NNKWA YAGPGGWNDPDMLEVGNGGMT+
Sbjct  226  DPALWAGKVGNSWRTTGDITDTWKSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMTF  285

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
             EY +HFSIWALMKAPL+IGCDVRN+T+ET EILSN EVI V+QDPLGVQGR++   G  
Sbjct  286  AEYHSHFSIWALMKAPLLIGCDVRNLTSETLEILSNKEVIQVNQDPLGVQGRRILGEGKY  345

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
            GC+EVWAGPLSGNRL VALWNRCS+   IT     +GL+ SA+ S+RDLWKHE +S N +
Sbjct  346  GCREVWAGPLSGNRLAVALWNRCSEAANITMKLPAVGLDGSAAYSVRDLWKHETLSENVI  405

Query  248  KSFSAKVKSHGSELYIFTP  192
             +F A+V+ H +++YIF+P
Sbjct  406  GTFGAQVEVHDTKMYIFSP  424



>gb|KJB72965.1| hypothetical protein B456_011G207400 [Gossypium raimondii]
Length=410

 Score =   295 bits (754),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 153/179 (85%), Gaps = 0/179 (0%)
 Frame = -2

Query  719  ESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYEEYRAHFSIWALMKAPLIIGCDV  540
            E MT IADIN+KWA  AGPGGWNDPDMLEVGNGGMTY+EYRAHFSIWALMKAPL+IGCDV
Sbjct  227  ECMTTIADINDKWASRAGPGGWNDPDMLEVGNGGMTYQEYRAHFSIWALMKAPLLIGCDV  286

Query  539  RNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADGCQEVWAGPLSGNRLVVALWNRC  360
            RNMTAET EILSN EVI+V+QD LGVQGRKV VSG   C +VWAGPLSGNRLVVA WNRC
Sbjct  287  RNMTAETLEILSNKEVISVNQDSLGVQGRKVYVSGEANCLQVWAGPLSGNRLVVAFWNRC  346

Query  359  SKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVKSFSAKVKSHGSELYIFTPQTV  183
             K  TITA W+V+GLESS +VSIRDLW+H+++  NAV SF AKV SH   +YIFTP+TV
Sbjct  347  LKAATITARWEVLGLESSTNVSIRDLWQHKEVKENAVASFGAKVDSHDCHMYIFTPKTV  405



>gb|KCW65766.1| hypothetical protein EUGRSUZ_G03128 [Eucalyptus grandis]
Length=414

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 154/173 (89%), Gaps = 0/173 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA  +GNSWR T+DI DTW SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  224  VDDPALWAGKIGNSWRTTDDINDTWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  283

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL++GCDVRNMTAET++++SN EVIAV+QD LGVQGRKV+VSG
Sbjct  284  TYQEYRAHFSIWALMKAPLLVGCDVRNMTAETYQLVSNEEVIAVNQDSLGVQGRKVNVSG  343

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWK  276
              GC +VWAGPLS  RLVVALWNRCSK  +ITA W+ +GL+SS SVSIRDLW+
Sbjct  344  TGGCSQVWAGPLSRRRLVVALWNRCSKAVSITAAWEALGLDSSTSVSIRDLWQ  396



>gb|EAZ41098.1| hypothetical protein OsJ_25590 [Oryza sativa Japonica Group]
Length=437

 Score =   292 bits (747),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 143/243 (59%), Positives = 163/243 (67%), Gaps = 36/243 (15%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPALWA  VGNSWR T+DI+DTW+SMT IAD NNKWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  195  DDPALWAGKVGNSWRTTDDIQDTWKSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMT  254

Query  611  YEEYRAHFSIWALMKA------------------------------------PLIIGCDV  540
            + EYRAHFSIWALMKA                                    PL+IGCDV
Sbjct  255  FAEYRAHFSIWALMKASTHWVHSVITRMAPIFQYVAFGLHDSNLFVLLLDQAPLLIGCDV  314

Query  539  RNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADGCQEVWAGPLSGNRLVVALWNRC  360
            RNMT ET EILSN EVI V+QDPLGVQGR++   G +GCQEVWAGPLSGNRL V LWNRC
Sbjct  315  RNMTKETMEILSNKEVIQVNQDPLGVQGRRILGQGKNGCQEVWAGPLSGNRLAVVLWNRC  374

Query  359  SKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVKSFSAKVKSHGSELYIFTPQTVT  180
             +   I      +GL+ S+  S+RDLWKHE +S N V +F A+V  H  ++YIFTP    
Sbjct  375  EESANIIVKLPSVGLDGSSPYSVRDLWKHETLSENVVGTFGAQVDVHDCKMYIFTPAVTV  434

Query  179  SYS  171
            + S
Sbjct  435  ASS  437



>tpg|DAA55548.1| TPA: hypothetical protein ZEAMMB73_350257 [Zea mays]
Length=669

 Score =   289 bits (740),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/204 (67%), Positives = 157/204 (77%), Gaps = 3/204 (1%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            DPALWA  VGNSW  T+DI  TW+SMT IAD NNKWA YAGPGGW+DPDMLEVGNGGMT 
Sbjct  350  DPALWAGKVGNSWHTTDDITVTWKSMTYIADKNNKWASYAGPGGWDDPDMLEVGNGGMTL  409

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
             EY +HFSIWALMKAPL+IGCDVRNMT+ET EILSN EVI   Q+PLGVQGRK+   G  
Sbjct  410  AEYLSHFSIWALMKAPLLIGCDVRNMTSETMEILSNKEVI---QNPLGVQGRKILGQGKY  466

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
            GC+EVWAGPLSGNRLVVALWNRCS    +T     +GL+  A+ S+RDLWKHE +S N V
Sbjct  467  GCREVWAGPLSGNRLVVALWNRCSDTANVTMKLPAVGLDGYAAYSVRDLWKHETLSENVV  526

Query  248  KSFSAKVKSHGSELYIFTPQTVTS  177
             +F A+V  H +++YIF    V S
Sbjct  527  GTFGAQVDVHDTKMYIFLCNHVAS  550



>gb|EMT18876.1| Alpha-galactosidase [Aegilops tauschii]
Length=383

 Score =   278 bits (710),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/172 (76%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPALWA  VGNSWR T+DI+DTW+SMT IAD NNKWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  207  DDPALWAGKVGNSWRTTDDIQDTWKSMTDIADKNNKWASYAGPGGWNDPDMLEVGNGGMT  266

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
            + EYRAHFSIWALMKAPL+IGCDVRNMT+ET EILSN EVI V+QDPLGVQGR++   G 
Sbjct  267  FAEYRAHFSIWALMKAPLLIGCDVRNMTSETIEILSNKEVIQVNQDPLGVQGRRILGQGK  326

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWK  276
             GC+EVWAGPLSGNRL VALWNRCS+   IT     +GL+ S++ S+RDLWK
Sbjct  327  GGCREVWAGPLSGNRLAVALWNRCSETVNITMTLPAVGLDGSSAYSVRDLWK  378



>gb|ACU20662.1| unknown [Glycine max]
Length=374

 Score =   267 bits (683),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 136/152 (89%), Gaps = 0/152 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V+DPALWA+ VGNSWR T DI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  223  VEDPALWADKVGNSWRTTGDINDSWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  282

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWAL KAPL+IGCDVRN+T ET EILSN EVIA++QD LGVQGRKV VSG
Sbjct  283  TYQEYRAHFSIWALAKAPLLIGCDVRNLTGETLEILSNKEVIAINQDSLGVQGRKVQVSG  342

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETIT  339
            ADGC++VWAGPLSGNRL VALWNRCSK  TIT
Sbjct  343  ADGCRQVWAGPLSGNRLAVALWNRCSKVATIT  374



>ref|XP_002986493.1| hypothetical protein SELMODRAFT_446636 [Selaginella moellendorffii]
 gb|EFJ12350.1| hypothetical protein SELMODRAFT_446636 [Selaginella moellendorffii]
Length=409

 Score =   268 bits (685),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 151/201 (75%), Gaps = 0/201 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPA WA  VGNSWR T DI DTW+SMT IAD+N++WA +AGPGGWNDPDMLEVGNGGM
Sbjct  197  VDDPAEWAPDVGNSWRTTGDITDTWKSMTTIADLNDRWASFAGPGGWNDPDMLEVGNGGM  256

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T +EYR+HFSIWALMKAPLI+GCD+R+M+ +T EI++N EVI+V+QD LG+QGRKV   G
Sbjct  257  TIDEYRSHFSIWALMKAPLILGCDLRDMSNDTLEIITNKEVISVNQDSLGIQGRKVCKKG  316

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             + C E+WAGPLS  R  V +WNRC +D  I   W  I L  S  V+IRDLWKHE  S  
Sbjct  317  PEECHEIWAGPLSLKRTAVVIWNRCEEDADIEVSWQEISLHPSTRVTIRDLWKHEYWSGV  376

Query  254  AVKSFSAKVKSHGSELYIFTP  192
              +S    V  HG+E++I +P
Sbjct  377  YNESIVVSVAPHGAEMFILSP  397



>gb|AFK38956.1| unknown [Lotus japonicus]
Length=203

 Score =   260 bits (665),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 153/202 (76%), Gaps = 4/202 (2%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            ++DPA WA  VGNSWR T DIED W+SM + AD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  6    LEDPATWARSVGNSWRTTGDIEDKWDSMISRADLNDKWASYAGPGGWNDPDMLEVGNGGM  65

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEYRAHFSIWAL KAPL+IGCD+R++   T E+LSN+EVIAV+QD LGVQG+KV    
Sbjct  66   TTEEYRAHFSIWALAKAPLLIGCDIRSLDHATMELLSNSEVIAVNQDKLGVQGKKVK---  122

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
            ++   EVWAGPLS NRL V LWNR S   T+TA W  IGLES  SV  RDLW+H   S+ 
Sbjct  123  SESDLEVWAGPLSNNRLAVILWNRSSSKATVTASWSDIGLESGTSVDARDLWEHSTKSSI  182

Query  254  AVKSFSAKVKSHGSELYIFTPQ  189
            + +  SA++ SH  ++Y+ TP 
Sbjct  183  SGE-MSAELDSHACKMYVLTPN  203



>ref|XP_002523047.1| alpha-galactosidase/alpha-n-acetylgalactosaminidase, putative 
[Ricinus communis]
 gb|EEF39351.1| alpha-galactosidase/alpha-n-acetylgalactosaminidase, putative 
[Ricinus communis]
Length=184

 Score =   259 bits (663),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 140/174 (80%), Gaps = 0/174 (0%)
 Frame = -2

Query  713  MTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYEEYRAHFSIWALMKAPLIIGCDVRN  534
            MT IAD+N+KWA YAGPGGWNDPDMLEVGNGGMTY+E R +FSIWALMKAPL+IGCDVRN
Sbjct  1    MTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGMTYQECRTYFSIWALMKAPLLIGCDVRN  60

Query  533  MTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADGCQEVWAGPLSGNRLVVALWNRCSK  354
            MTAET+EIL+N EVIAV+QDP GVQGRKV  S  DGC +VWAGPL+G+R+ V L NRCSK
Sbjct  61   MTAETYEILTNKEVIAVNQDPHGVQGRKVQTSRTDGCLQVWAGPLTGHRMAVVLCNRCSK  120

Query  353  DETITAHWDVIGLESSASVSIRDLWKHEDISANAVKSFSAKVKSHGSELYIFTP  192
              TIT  WD +G+ES  +V +RDLW+H+DI+ ++  SF  +V +H ++     P
Sbjct  121  SATITVRWDALGVESGTTVVVRDLWQHKDITGDSAASFGTRVDAHAAQCIFLLP  174



>ref|XP_002964911.1| hypothetical protein SELMODRAFT_83268 [Selaginella moellendorffii]
 gb|EFJ33749.1| hypothetical protein SELMODRAFT_83268 [Selaginella moellendorffii]
Length=413

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 150/201 (75%), Gaps = 0/201 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPA WA  VGNSWR T DI DTW+SMT IAD+N++WA +AGPGGWNDPDMLEVGNGGM
Sbjct  192  VDDPAEWAPDVGNSWRTTGDITDTWKSMTTIADLNDRWASFAGPGGWNDPDMLEVGNGGM  251

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T +EYR+HFSIWALMKAPLI+GCD+R+M+ +T EI++N EVI+V+QD LG+QGRKV   G
Sbjct  252  TIDEYRSHFSIWALMKAPLILGCDLRDMSNDTLEIITNKEVISVNQDSLGIQGRKVCKKG  311

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             + C E+WAGPLS  R  V +WNRC  D  I   W  I L  S  V+IRDLWKHE  S  
Sbjct  312  PEECHEIWAGPLSLKRTAVVIWNRCEGDADIEVSWQEISLHPSTRVTIRDLWKHEYWSGV  371

Query  254  AVKSFSAKVKSHGSELYIFTP  192
              +S    V  HG+E++I +P
Sbjct  372  YNESIVVSVAPHGAEMFILSP  392



>ref|XP_002459951.1| hypothetical protein SORBIDRAFT_02g018600 [Sorghum bicolor]
 gb|EER96472.1| hypothetical protein SORBIDRAFT_02g018600 [Sorghum bicolor]
Length=331

 Score =   261 bits (667),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 147/202 (73%), Gaps = 4/202 (2%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V+DPA WA G+GNSWR T DI+DTW  MTAIAD NNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  134  VNDPATWAGGIGNSWRTTGDIKDTWAKMTAIADKNNKWASYAGPGGWNDPDMLEVGNGGM  193

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEYR+HFSIWALMKAPL+IGCD+R+M+ ET EILSN  VIAV+QD LGVQG KV    
Sbjct  194  TTEEYRSHFSIWALMKAPLLIGCDIRSMSNETKEILSNRNVIAVNQDGLGVQGHKVQ---  250

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DG QEVWAGPL+G R  V LWNR S   +ITA W  IGL +S      DLW  + ISA 
Sbjct  251  QDGDQEVWAGPLTGGRFAVVLWNRGSAQASITASWSSIGLNASTVADAHDLWIDDIISA-  309

Query  254  AVKSFSAKVKSHGSELYIFTPQ  189
                    V SH  ++Y+ TP+
Sbjct  310  VQGELEETVDSHACKMYVLTPK  331



>ref|XP_002459949.1| hypothetical protein SORBIDRAFT_02g018590 [Sorghum bicolor]
 gb|EER96470.1| hypothetical protein SORBIDRAFT_02g018590 [Sorghum bicolor]
Length=302

 Score =   258 bits (660),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 150/202 (74%), Gaps = 4/202 (2%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPA WA+GVGNSWR T DI+D W SMTAIAD N+KWA YA PGGWNDPDMLEVGNGGM
Sbjct  105  VDDPATWASGVGNSWRTTGDIQDNWGSMTAIADANDKWASYAQPGGWNDPDMLEVGNGGM  164

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEYR+HFSIWAL+KAPL+IGCD+R+M+++T EILSN  VI V+QD LGVQGRKV    
Sbjct  165  TTEEYRSHFSIWALVKAPLLIGCDIRSMSSDTKEILSNQNVITVNQDVLGVQGRKVL---  221

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DG QEVWAGPLSG R+ V LWNR S   +ITA W  IGL  S  V   DLW  E ++++
Sbjct  222  QDGDQEVWAGPLSGGRVAVVLWNRGSDQASITASWSSIGLNESTVVDAHDLWTGE-VTSS  280

Query  254  AVKSFSAKVKSHGSELYIFTPQ  189
                    V +H  ++Y+ TP+
Sbjct  281  VQGELKETVDTHACKMYVLTPK  302



>sp|Q42656.1|AGAL_COFAR RecName: Full=Alpha-galactosidase; AltName: Full=Alpha-D-galactoside 
galactohydrolase; AltName: Full=Melibiase; Flags: Precursor 
[Coffea arabica]
 gb|AAA33022.1| alpha-galactosidase [Coffea arabica]
 emb|CDP18121.1| unnamed protein product [Coffea canephora]
Length=378

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 153/202 (76%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DI+D+W SMT+ AD+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  182  EDPATWAKEVGNSWRTTGDIDDSWSSMTSRADMNDKWASYAGPGGWNDPDMLEVGNGGMT  241

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPL+IGCD+R+M   TF++LSN EVIAV+QD LGVQG KV   G 
Sbjct  242  TTEYRSHFSIWALAKAPLLIGCDIRSMDGATFQLLSNAEVIAVNQDKLGVQGNKVKTYGD  301

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLSG R+ VALWNR S   TITA+W  +GL S+A V+ RDLW H   +  +
Sbjct  302  ---LEVWAGPLSGKRVAVALWNRGSSTATITAYWSDVGLPSTAVVNARDLWAHS--TEKS  356

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            VK   SA V +H S++Y+ TPQ
Sbjct  357  VKGQISAAVDAHDSKMYVLTPQ  378



>emb|CAI47559.1| alpha galactosidase [Coffea arabica]
Length=420

 Score =   261 bits (668),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 154/202 (76%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DI+D+W SMT+ AD+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  224  EDPATWAKEVGNSWRTTGDIDDSWSSMTSRADMNDKWASYAGPGGWNDPDMLEVGNGGMT  283

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPL+IGCD+R++   TF++LSN EVIAV+QD LGVQG+KV   G 
Sbjct  284  TTEYRSHFSIWALAKAPLLIGCDIRSIDGATFQLLSNAEVIAVNQDKLGVQGKKVKTYGD  343

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLSG R+ VALWNR S   TITA+W  +GL S+A V+ RDLW H   +  +
Sbjct  344  ---LEVWAGPLSGKRVAVALWNRGSSTATITAYWSDVGLPSTAVVNARDLWAHS--TEKS  398

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            VK   SA V +H S++Y+ TPQ
Sbjct  399  VKGQISAAVDAHDSKMYVLTPQ  420



>emb|CAI47560.1| alpha-galactosidase [Coffea canephora]
Length=378

 Score =   259 bits (663),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 152/202 (75%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DI+D+W SMT+ AD+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  182  EDPATWAKEVGNSWRTTGDIDDSWSSMTSRADMNDKWASYAGPGGWNDPDMLEVGNGGMT  241

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPL+IGCD+R+M   TF++LSN EVIAV+QD LGVQG KV   G 
Sbjct  242  TTEYRSHFSIWALAKAPLLIGCDIRSMDGATFQLLSNAEVIAVNQDKLGVQGNKVKTYGD  301

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLSG R+ VALWNR S   TITA+W  +GL S+A V+ RDLW H   +  +
Sbjct  302  ---LEVWAGPLSGKRVAVALWNRGSSTATITAYWSDVGLPSTAVVNARDLWAHS--TEKS  356

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            VK   SA   +H S++Y+ TPQ
Sbjct  357  VKGQISAAADAHDSKMYVLTPQ  378



>ref|XP_010909867.1| PREDICTED: alpha-galactosidase isoform X2 [Elaeis guineensis]
Length=337

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 149/200 (75%), Gaps = 4/200 (2%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            DPA WA GVGNSWR T DI+D W+SMTA AD NNKWA YAGPGGWNDPDMLEVGNGGMT 
Sbjct  142  DPATWARGVGNSWRTTGDIQDKWDSMTARADENNKWAGYAGPGGWNDPDMLEVGNGGMTT  201

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
            +EYR+HFSIWAL KAPL+IGCDVR M+ ET EILSN EVIAV+QD LGVQG+KV     D
Sbjct  202  DEYRSHFSIWALAKAPLLIGCDVRAMSDETKEILSNDEVIAVNQDTLGVQGKKVK---GD  258

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
            G  EVWAGPL G  + V LWNR S   +ITA+W  IGL+ SA V  RD+W H  I +   
Sbjct  259  GSAEVWAGPLKGGGVAVVLWNRGSSQTSITANWSDIGLDPSAVVDARDVWAHSTIWSVG-  317

Query  248  KSFSAKVKSHGSELYIFTPQ  189
             S +A V +H  ++Y+ TP+
Sbjct  318  GSITATVDTHACKMYVLTPK  337



>ref|XP_008800438.1| PREDICTED: alpha-galactosidase [Phoenix dactylifera]
Length=410

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 154/200 (77%), Gaps = 4/200 (2%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            DPA WA GVGNSWR T DI+D W+SMT+ AD N+KWA YA PGGWNDPDMLEVGNGGMT 
Sbjct  215  DPATWARGVGNSWRTTGDIQDNWDSMTSCADENDKWAGYAAPGGWNDPDMLEVGNGGMTT  274

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
            EEYR+HFSIWAL KAPL+IGCD+R+M+ ET EILSN EVIAV+QD LGVQG+KV   G+D
Sbjct  275  EEYRSHFSIWALAKAPLLIGCDIRSMSDETKEILSNYEVIAVNQDKLGVQGKKVKWGGSD  334

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
               EVWAGPLSG R+ V LWNR S   ++TA+W  IGL+SSA V  RDLW+H   S+   
Sbjct  335  ---EVWAGPLSGGRVAVILWNRGSSQTSVTANWSDIGLDSSAVVDARDLWEHSTKSSVQG  391

Query  248  KSFSAKVKSHGSELYIFTPQ  189
            K  +A + +H  ++++ TP+
Sbjct  392  K-ITATLDAHACKMFVLTPK  410



>ref|XP_010274959.1| PREDICTED: alpha-galactosidase [Nelumbo nucifera]
Length=409

 Score =   259 bits (662),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 153/203 (75%), Gaps = 4/203 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA G+GNSWR T+DI D+W SM   AD+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  209  EDPATWAPGLGNSWRTTDDIVDSWGSMATRADLNDKWASYAGPGGWNDPDMLEVGNGGMT  268

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL+KAPL+IGCD+R+M   TFEILSN EVI V+QD LGVQG+KV     
Sbjct  269  TEEYRSHFSIWALIKAPLLIGCDIRSMDNATFEILSNKEVIDVNQDKLGVQGKKVK---K  325

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLSGNR+ V LWNR      +T  W  IGL SS  V +R+LWKH+  ++  
Sbjct  326  DGELEVWAGPLSGNRVAVILWNRGPIKAELTVFWSDIGLSSSTIVDVRNLWKHKTETSVQ  385

Query  251  VKSFSAKVKSHGSELYIFTPQTV  183
             K  SA+V+SHG E+Y+ +P  V
Sbjct  386  GK-ISAEVESHGCEMYVLSPSGV  407



>ref|XP_001755838.1| predicted protein [Physcomitrella patens]
 gb|EDQ79511.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   258 bits (660),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 151/205 (74%), Gaps = 5/205 (2%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            +D PA WAN VGNSWR T DI D W SM  I ++NN WA+YA PGGWNDPDMLEVGNGGM
Sbjct  183  IDSPATWANNVGNSWRTTGDITDDWNSMVGIVELNNVWADYAAPGGWNDPDMLEVGNGGM  242

Query  614  TYEEYRAHFSIWALMK----APLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKV  447
            T EEYR+HFS+WALMK    APL+IGCDVRN+ AE  EIL+N EVIAV+QDPLGVQG++V
Sbjct  243  TVEEYRSHFSLWALMKARSFAPLLIGCDVRNIGAEILEILANEEVIAVNQDPLGVQGKRV  302

Query  446  SVSGADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHED  267
             + G  G  EVW+GPLS  R+V+ LWNR S+   ITA W  +G+ +   +++RDLWKHE 
Sbjct  303  RMDGFSGL-EVWSGPLSSGRVVLLLWNRSSESANITARWSDMGIPNDTLLTVRDLWKHET  361

Query  266  ISANAVKSFSAKVKSHGSELYIFTP  192
            IS   +     +V SHG +++I TP
Sbjct  362  ISEAEMYEICQEVPSHGVKMFILTP  386



>gb|KCW65110.1| hypothetical protein EUGRSUZ_G02615 [Eucalyptus grandis]
Length=368

 Score =   257 bits (656),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 152/201 (76%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI+D W+SMTAIAD+NNKWAEYAGPGGWNDPDMLEVGNGGMT
Sbjct  171  EDPATWAPTIGNSWRTTGDIQDNWDSMTAIADLNNKWAEYAGPGGWNDPDMLEVGNGGMT  230

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL+KAPL+IGCD+R+M   T EILSN EVIAV+QD LGVQG+K+     
Sbjct  231  AEEYRSHFSIWALVKAPLLIGCDIRSMDNATLEILSNREVIAVNQDGLGVQGKKIK---K  287

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVW GPL+ +R+ V LWNR +    ITA W  IGL S+A V+ RDLW+H  + A+ 
Sbjct  288  DGDLEVWTGPLTDHRVAVVLWNRGASPANITASWTDIGLNSAAIVNARDLWEHVTL-ASV  346

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                +A V  H  ++++ TPQ
Sbjct  347  RDQIAALVDPHACKMFVLTPQ  367



>emb|CAA74160.1| alpha-galactosidase [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   251 bits (641),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 148/202 (73%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVG-NSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            ++PA WA G+G NSWR T DI D W SMT+ AD N++WA YAGPGGWNDPDMLEVGNGGM
Sbjct  8    ENPATWARGMGGNSWRTTGDIADNWGSMTSRADQNDRWASYAGPGGWNDPDMLEVGNGGM  67

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            +  EYR+HFSIWAL KAPL+IGCDVR+MT +T  I+SN EVIAV+QD LGVQG+KV    
Sbjct  68   SEAEYRSHFSIWALAKAPLLIGCDVRSMTPQTKTIISNQEVIAVNQDRLGVQGKKVQ---  124

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
            +DG  EVWAG LSGNR  V LWNR     TITAHW  +GL +SASV+ RDLW H   SA 
Sbjct  125  SDGGLEVWAGLLSGNRKAVVLWNRQGYQATITAHWSNVGLPASASVTARDLWAHSSFSAQ  184

Query  254  AVKSFSAKVKSHGSELYIFTPQ  189
                 SA V  H  ++YI TP+
Sbjct  185  G--QLSASVGPHDCKMYILTPK  204



>gb|KCW57929.1| hypothetical protein EUGRSUZ_H00669 [Eucalyptus grandis]
Length=259

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA+ +GNSWR T DI D W+SM + AD+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  63   EDPATWASSIGNSWRTTGDISDNWDSMISRADLNDKWASYAGPGGWNDPDMLEVGNGGMT  122

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL+KAPL+IGCDVR+M   T  +LSN EVIAV+QD LGVQG+KV    +
Sbjct  123  TEEYRSHFSIWALVKAPLLIGCDVRSMDKTTIMLLSNKEVIAVNQDRLGVQGKKVK---S  179

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPL+ N++ V LWNR S   T+TA W  IGL S+  V  RDLW H   +  +
Sbjct  180  DGNLEVWAGPLTANKVAVVLWNRGSSRATVTASWSDIGLHSTTVVKARDLWMHS--TKRS  237

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            +K   SA + SH  ++Y+ TPQ
Sbjct  238  IKGQISADIDSHACKMYVVTPQ  259



>ref|XP_010909866.1| PREDICTED: alpha-galactosidase isoform X1 [Elaeis guineensis]
Length=409

 Score =   258 bits (658),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 149/200 (75%), Gaps = 4/200 (2%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            DPA WA GVGNSWR T DI+D W+SMTA AD NNKWA YAGPGGWNDPDMLEVGNGGMT 
Sbjct  214  DPATWARGVGNSWRTTGDIQDKWDSMTARADENNKWAGYAGPGGWNDPDMLEVGNGGMTT  273

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
            +EYR+HFSIWAL KAPL+IGCDVR M+ ET EILSN EVIAV+QD LGVQG+KV     D
Sbjct  274  DEYRSHFSIWALAKAPLLIGCDVRAMSDETKEILSNDEVIAVNQDTLGVQGKKVK---GD  330

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
            G  EVWAGPL G  + V LWNR S   +ITA+W  IGL+ SA V  RD+W H  I +   
Sbjct  331  GSAEVWAGPLKGGGVAVVLWNRGSSQTSITANWSDIGLDPSAVVDARDVWAHSTIWSVG-  389

Query  248  KSFSAKVKSHGSELYIFTPQ  189
             S +A V +H  ++Y+ TP+
Sbjct  390  GSITATVDTHACKMYVLTPK  409



>gb|AEB98600.1| alpha-galactosidase [Nicotiana tabacum]
Length=413

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 148/202 (73%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPA WA+ VGNSWR T DI D W+SMT+ AD+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  216  DDPATWASSVGNSWRTTGDISDNWDSMTSRADMNDKWASYAGPGGWNDPDMLEVGNGGMT  275

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPLIIGCD+R+M     EILSN EVIAV+QD LGVQG+KV     
Sbjct  276  TAEYRSHFSIWALAKAPLIIGCDLRSMDQTAHEILSNKEVIAVNQDKLGVQGKKVK---Q  332

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPLSG RL + LWNR S    ITA+W  IGL+SS  V  RDLW H   +  +
Sbjct  333  NGDLEVWAGPLSGKRLAMVLWNRSSSKADITAYWSDIGLDSSTVVDARDLWAHS--TKGS  390

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            VK   SA + SH   +Y+ TP+
Sbjct  391  VKGQLSASIDSHDCRMYVLTPK  412



>ref|XP_010067046.1| PREDICTED: LOW QUALITY PROTEIN: alpha-galactosidase [Eucalyptus 
grandis]
Length=417

 Score =   257 bits (656),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 152/201 (76%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI+D W+SMTAIAD+NNKWAEYAGPGGWNDPDMLEVGNGGMT
Sbjct  220  EDPATWAPTIGNSWRTTGDIQDNWDSMTAIADLNNKWAEYAGPGGWNDPDMLEVGNGGMT  279

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL+KAPL+IGCD+R+M   T EILSN EVIAV+QD LGVQG+K+     
Sbjct  280  AEEYRSHFSIWALVKAPLLIGCDIRSMDNATLEILSNREVIAVNQDGLGVQGKKIK---K  336

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVW GPL+ +R+ V LWNR +    ITA W  IGL S+A V+ RDLW+H  + A+ 
Sbjct  337  DGDLEVWTGPLTDHRVAVVLWNRGASPANITASWTDIGLNSAAIVNARDLWEHVTL-ASV  395

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                +A V  H  ++++ TPQ
Sbjct  396  RDQIAALVDPHACKMFVLTPQ  416



>ref|XP_009605413.1| PREDICTED: alpha-galactosidase [Nicotiana tomentosiformis]
Length=414

 Score =   256 bits (655),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 148/202 (73%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPA WA+ VGNSWR T DI D W+SMT+ AD+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  217  DDPATWASSVGNSWRTTGDISDNWDSMTSRADMNDKWASYAGPGGWNDPDMLEVGNGGMT  276

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPLIIGCD+R+M     EILSN EVIAV+QD LGVQG+KV     
Sbjct  277  TAEYRSHFSIWALAKAPLIIGCDLRSMDQTAHEILSNKEVIAVNQDKLGVQGKKVK---Q  333

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPLSG R+ V LWNR S    ITA+W  IGL+SS  V  RDLW H   +  +
Sbjct  334  NGDLEVWAGPLSGKRVAVVLWNRSSSKADITAYWSDIGLDSSTVVDARDLWAHS--TKGS  391

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            VK   SA + SH   +Y+ TP+
Sbjct  392  VKGQLSASIDSHDCRMYVLTPK  413



>gb|KEH42878.1| alpha-galactosidase-like protein [Medicago truncatula]
Length=409

 Score =   256 bits (654),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 148/202 (73%), Gaps = 4/202 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DIED W SMT+IAD NNKWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  212  EDPATWAKSVGNSWRTTGDIEDNWNSMTSIADSNNKWASYAGPGGWNDPDMLEVGNGGMT  271

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL++GCD+R M   T+E+++N+EVIAV+QD LGVQG+KV  +  
Sbjct  272  TEEYRSHFSIWALAKAPLLVGCDIRAMDNTTYELITNSEVIAVNQDKLGVQGKKVKSTND  331

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLS N+L V LWNR S + T+ A W  IGLE  A V  RDLW+H       
Sbjct  332  ---LEVWAGPLSENKLAVILWNRSSSNATVIASWSEIGLEPEAIVDARDLWEHS-TQLFV  387

Query  251  VKSFSAKVKSHGSELYIFTPQT  186
             K  SA++ SH  ++Y+ TP +
Sbjct  388  SKEISAEIDSHACKMYVLTPTS  409



>ref|XP_003574116.1| PREDICTED: alpha-galactosidase [Brachypodium distachyon]
Length=411

 Score =   256 bits (654),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 125/201 (62%), Positives = 147/201 (73%), Gaps = 5/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            ++PA W  G+GNSWR T DI D W SMT+ AD N++WA YAGPGGWNDPDMLEVGNGGM+
Sbjct  216  ENPATWGAGMGNSWRTTADIADNWASMTSCADQNDRWASYAGPGGWNDPDMLEVGNGGMS  275

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPL+IGCDVR M+ +T +ILSN EVIAV+QD LGVQG+KV    +
Sbjct  276  DAEYRSHFSIWALAKAPLLIGCDVRTMSQQTKDILSNGEVIAVNQDSLGVQGKKVQ---S  332

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            D   EVWAGPLSGNR  V LWNR     TITAHW  +GL +SA+V+ RDLW H   SA  
Sbjct  333  DNGLEVWAGPLSGNRKAVVLWNRQGYQATITAHWSNVGLPASAAVTARDLWAHSSFSAQG  392

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA V  H  ++YI TP+
Sbjct  393  --QISASVAPHDCKMYILTPK  411



>ref|XP_009760245.1| PREDICTED: alpha-galactosidase [Nicotiana sylvestris]
Length=414

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 129/201 (64%), Positives = 147/201 (73%), Gaps = 6/201 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPA WA+ VGNSWR T DI D W+SMT+ AD+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  217  DDPATWASSVGNSWRTTGDISDNWDSMTSRADMNDKWASYAGPGGWNDPDMLEVGNGGMT  276

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPLIIGCD+R+M     EILSN EVIAV+QD LGVQG+KV     
Sbjct  277  TAEYRSHFSIWALAKAPLIIGCDLRSMDQTAHEILSNKEVIAVNQDRLGVQGKKVK---Q  333

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLSG R+ V LWNR S    ITA+W  IGL+SS  V  RDLW H   +  +
Sbjct  334  DGELEVWAGPLSGKRVAVVLWNRSSSKADITAYWSDIGLDSSTVVDARDLWAHS--TKGS  391

Query  251  VK-SFSAKVKSHGSELYIFTP  192
            VK   SA + SH   +Y+ TP
Sbjct  392  VKGQISASIDSHDCRMYVLTP  412



>gb|AEB98601.1| alpha-galactosidase [Nicotiana tabacum]
Length=413

 Score =   256 bits (653),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 147/201 (73%), Gaps = 6/201 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPA WA+ VGNSWR T DI D W+SMT+ AD+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  216  DDPATWASSVGNSWRTTGDISDNWDSMTSRADMNDKWASYAGPGGWNDPDMLEVGNGGMT  275

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPLIIGCD+R+M     EILSN EVIAV+QD LGVQG+KV     
Sbjct  276  TAEYRSHFSIWALAKAPLIIGCDLRSMDQTAHEILSNKEVIAVNQDKLGVQGKKVK---Q  332

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPLSG RL + LWNR S    ITA+W  IGL+SS  V  RDLW H   +  +
Sbjct  333  NGDLEVWAGPLSGKRLAMVLWNRSSSKADITAYWSDIGLDSSTVVDARDLWAHS--TKGS  390

Query  251  VK-SFSAKVKSHGSELYIFTP  192
            VK   SA + SH   +Y+ TP
Sbjct  391  VKGQLSASIDSHDCRMYVLTP  411



>gb|KCW57928.1| hypothetical protein EUGRSUZ_H00669 [Eucalyptus grandis]
Length=323

 Score =   253 bits (646),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 151/202 (75%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA+ +GNSWR T+DI D W+SMT+ AD+N+KWA YAGPGGWNDPDMLEVGNG MT
Sbjct  127  EDPATWASSIGNSWRTTDDIFDNWDSMTSRADLNDKWASYAGPGGWNDPDMLEVGNGVMT  186

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL+KAPL+IGCDVR+M   T  +LSN EVIAV+QD LGVQG+KV    +
Sbjct  187  TEEYRSHFSIWALVKAPLLIGCDVRSMDYTTLMLLSNKEVIAVNQDGLGVQGKKVK---S  243

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS N++ V LWNR S   T+TA W  IGL S+  V  RDLW H   +  +
Sbjct  244  DGNLEVWAGPLSTNKVAVVLWNRGSSRATVTASWSDIGLNSTTVVKARDLWMHS--TKRS  301

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            +K   SA + SH  ++Y+ +PQ
Sbjct  302  IKGQISADIDSHACKMYVLSPQ  323



>ref|XP_009397580.1| PREDICTED: alpha-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=406

 Score =   255 bits (652),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 151/202 (75%), Gaps = 4/202 (2%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPA WA+ +G+SWR T DI D+W+SMT+ AD N+KWA YA PGGWNDPDMLEVGNGGM
Sbjct  209  VDDPATWASSIGHSWRTTGDIFDSWDSMTSRADENDKWASYAKPGGWNDPDMLEVGNGGM  268

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEYR+HFSIWAL KAPL+IGCDVR+++ +  EILSN+EVIAV+QD LGVQG+KV   G
Sbjct  269  TTEEYRSHFSIWALAKAPLLIGCDVRSISEDALEILSNSEVIAVNQDSLGVQGKKVVWGG  328

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
                 EVWAGPLSG  + V LWNR S   TITA W  IGL SS  V+ RDLW H D +A+
Sbjct  329  G---TEVWAGPLSGGTVAVVLWNRGSSPATITAEWSDIGLSSSTVVNARDLWAHSD-TAS  384

Query  254  AVKSFSAKVKSHGSELYIFTPQ  189
                 +A V SH  ++Y+ TPQ
Sbjct  385  VQGELTATVDSHACKMYVLTPQ  406



>ref|XP_002314831.2| hypothetical protein POPTR_0010s12820g [Populus trichocarpa]
 gb|EEF01002.2| hypothetical protein POPTR_0010s12820g [Populus trichocarpa]
Length=406

 Score =   255 bits (652),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 152/201 (76%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            D+PA WA G+GNSWR T DI+DTW+SM + AD N+ WA YAGPGGWNDPDMLEVGNGGM+
Sbjct  210  DNPATWAAGIGNSWRTTGDIKDTWDSMISRADQNDDWASYAGPGGWNDPDMLEVGNGGMS  269

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWALMKAPL++GCD+R+M  +TFE+LSN EVIAV+QD LG+QG+KV  +G 
Sbjct  270  TEEYRSHFSIWALMKAPLLLGCDIRSMDNDTFELLSNKEVIAVNQDKLGLQGKKVKKTGD  329

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLSG R+   LWNR S    ITA +  IGL+SSA V+ RDLW H  +++  
Sbjct  330  ---LEVWAGPLSGKRIAAVLWNRGSSRAAITADFKDIGLKSSAVVNARDLWAHSTMTS-V  385

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                +  V+SH  ++++ TPQ
Sbjct  386  RHQLTVTVESHACKMFVLTPQ  406



>gb|ABK24468.1| unknown [Picea sitchensis]
Length=377

 Score =   254 bits (649),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA+ +GNSWR T+DI D+W SMTAIAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  215  VDDPALWADNIGNSWRTTDDINDSWWSMTAIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  274

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYR+HFSIWALMKAPL++GCDVRNMT ETFEILSN EVIAV+QD LG+QGRKVS  G
Sbjct  275  TYQEYRSHFSIWALMKAPLLVGCDVRNMTKETFEILSNKEVIAVNQDTLGIQGRKVSAEG  334

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSK  354
             DGC++VWAGPLSG RL V  WNR  K
Sbjct  335  LDGCRQVWAGPLSGGRLAVVFWNRFQK  361



>ref|XP_011038765.1| PREDICTED: alpha-galactosidase-like [Populus euphratica]
Length=408

 Score =   255 bits (651),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 155/204 (76%), Gaps = 7/204 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            D+PA WA G+GNSWR T DI+DTW+SMT+ AD NN WA YAGPGGWNDPDMLEVGNGGM+
Sbjct  209  DNPATWAAGIGNSWRTTGDIKDTWDSMTSRADQNNDWASYAGPGGWNDPDMLEVGNGGMS  268

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWALMKAPL++GCD+R+M  +TFE+LSN EVIAV+QD LG+QG+KV  +G 
Sbjct  269  TEEYRSHFSIWALMKAPLLLGCDIRSMDNDTFELLSNKEVIAVNQDKLGLQGKKVKKTGD  328

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLW---KHEDIS  261
                EVWAGPLSG R+   LWNR S   +ITA +  IGL+SSA V+ RDLW   +H  ++
Sbjct  329  ---LEVWAGPLSGKRIAAVLWNRGSSRASITADFKDIGLKSSAVVNTRDLWANLQHSTMT  385

Query  260  ANAVKSFSAKVKSHGSELYIFTPQ  189
            +      +  V+SH  ++++ TPQ
Sbjct  386  S-VRHQLTVTVESHACKMFVLTPQ  408



>gb|ABK25009.1| unknown [Picea sitchensis]
Length=399

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 152/200 (76%), Gaps = 3/200 (2%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            +D PA WA  +G+SWR T+DIED WESM + AD NN++A+YAGPGGWNDPDMLEVGNG M
Sbjct  199  LDVPATWARQIGSSWRTTDDIEDKWESMISRADQNNEFAQYAGPGGWNDPDMLEVGNGNM  258

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEY +HFSIWALMKAPL+IGCDV +M  +T+ ILSN+EVIAV+QDPLGVQG+KV+  G
Sbjct  259  TPEEYGSHFSIWALMKAPLLIGCDVTSMDKKTYGILSNSEVIAVNQDPLGVQGKKVNKLG  318

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
                 EVWAGPLS NR+ V L NR +    ITA W+ IGL  SA V +R+LW+H ++ AN
Sbjct  319  D---LEVWAGPLSNNRVAVVLLNRSNSRTIITAKWEDIGLNPSAVVRVRNLWRHRELEAN  375

Query  254  AVKSFSAKVKSHGSELYIFT  195
               S +A VK HG ++Y+ T
Sbjct  376  HQGSLTASVKPHGCKMYVLT  395



>ref|XP_004495485.1| PREDICTED: alpha-galactosidase-like [Cicer arietinum]
Length=400

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 152/202 (75%), Gaps = 4/202 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DI+D W+SMT+IAD N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  202  EDPATWAKSVGNSWRTTGDIKDNWKSMTSIADANDKWASYAGPGGWNDPDMLEVGNGGMT  261

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYRAHFSIWAL KAPL++GCD++ M   T E++SN+EVIAV+QD LGVQG+KV  S +
Sbjct  262  TEEYRAHFSIWALAKAPLLVGCDIQAMDNTTSELISNSEVIAVNQDTLGVQGKKVK-SNS  320

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            D   EVWAGPLS N++ V LWNR S + T+TA W  +GLES   V  RDLW H   S+  
Sbjct  321  D--LEVWAGPLSNNKVAVILWNRSSSNATVTASWSDLGLESGTIVDARDLWDHSTQSS-V  377

Query  251  VKSFSAKVKSHGSELYIFTPQT  186
                SA++ SH  ++Y+ TPQ+
Sbjct  378  SGDISAELASHACKMYVLTPQS  399



>ref|XP_002271010.1| PREDICTED: alpha-galactosidase-like [Vitis vinifera]
Length=368

 Score =   253 bits (647),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            D+PA WA+ +GNSWR T DI+DTWESMT+ AD+N+ WA YAGPGGWNDPDMLEVGNGGM+
Sbjct  172  DNPATWASSIGNSWRTTGDIKDTWESMTSHADLNDVWASYAGPGGWNDPDMLEVGNGGMS  231

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M  ETFE+LSN EVI V+QD LG QG+KV  +G 
Sbjct  232  TEEYRSHFSIWALAKAPLLIGCDIRSMDNETFELLSNKEVIEVNQDKLGAQGKKVKKTGD  291

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVW+GPLS NR+ V LWNR S + TI A W  IGL SSA V  RDLW H  I +  
Sbjct  292  ---LEVWSGPLSDNRVAVVLWNRESSEATIIADWSDIGLNSSAVVDARDLWTHSTIYS-I  347

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                 A V++H  ++Y  TP 
Sbjct  348  RHQLKATVEAHACKMYALTPH  368



>ref|XP_006372279.1| hypothetical protein POPTR_0018s14920g [Populus trichocarpa]
 gb|ERP50076.1| hypothetical protein POPTR_0018s14920g [Populus trichocarpa]
Length=430

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 150/201 (75%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA+ VGNSWR T DI D W+SMT+ AD N++WA YA PGGWNDPDMLEVGNGGMT
Sbjct  234  EDPATWASNVGNSWRTTGDISDNWDSMTSRADQNDQWASYAAPGGWNDPDMLEVGNGGMT  293

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCDVR M+ ET EILSN EVIAV+QD LGVQG+KV     
Sbjct  294  TEEYRSHFSIWALAKAPLLIGCDVRTMSDETIEILSNREVIAVNQDKLGVQGKKVK---N  350

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPLS N++ V LWNR S   T+TA+W  IGL+ + +V+ RDLW H +   + 
Sbjct  351  NGDLEVWAGPLSNNKIAVVLWNRGSSRATVTAYWSDIGLDPTTTVNARDLWAHSN-QPSV  409

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA + SH  ++Y+ TPQ
Sbjct  410  KGQISADLDSHACKMYVLTPQ  430



>ref|XP_009402637.1| PREDICTED: alpha-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=400

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 150/201 (75%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            D+PA WA+G+GNSWR T DI D+W SMT+ AD NN+WA YAGPGGWNDPDMLEVGNGGM+
Sbjct  204  DNPATWASGIGNSWRTTGDIYDSWGSMTSRADENNRWASYAGPGGWNDPDMLEVGNGGMS  263

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL+KAPL+IGCDVR ++ +  EILSN+EVIAV+QD LGVQG+KV     
Sbjct  264  TEEYRSHFSIWALVKAPLLIGCDVRTISGDALEILSNSEVIAVNQDYLGVQGKKVF---G  320

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
             G +EVWAG LSG ++ V LWNR S   TITA W  IGL SS +VS+RDLW    I  + 
Sbjct  321  GGSEEVWAGRLSGGKVAVVLWNRGSSRATITARWSDIGLSSSTAVSVRDLWARATI-GSV  379

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                +A V  H  ++Y+ TP+
Sbjct  380  RGQLAATVAPHACKMYVLTPR  400



>gb|EYU20102.1| hypothetical protein MIMGU_mgv1a0068852mg, partial [Erythranthe 
guttata]
Length=160

 Score =   246 bits (628),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 130/160 (81%), Gaps = 0/160 (0%)
 Frame = -2

Query  647  PDMLEVGNGGMTYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPL  468
            PDMLEVGNGGMT EEYRAHFSIWALMK+PLIIGCDVRN+TAE F ILSN EVIAV+QD L
Sbjct  1    PDMLEVGNGGMTDEEYRAHFSIWALMKSPLIIGCDVRNITAEAFAILSNEEVIAVNQDSL  60

Query  467  GVQGRKVSVSGADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIR  288
            G+QGRKV   G DGC +VWAGPLSG RL V LWNRCSK  T+T  W  +GLESS SVSIR
Sbjct  61   GIQGRKVDSYGPDGCYQVWAGPLSGQRLAVVLWNRCSKTGTVTTKWASLGLESSTSVSIR  120

Query  287  DLWKHEDISANAVKSFSAKVKSHGSELYIFTPQTVTSYSS  168
            DLWKHE +S N V SFSA++K H  E+YIFTP T++  +S
Sbjct  121  DLWKHEYVSENKVSSFSARLKPHACEMYIFTPSTLSHSAS  160



>ref|XP_002268711.1| PREDICTED: alpha-galactosidase [Vitis vinifera]
 emb|CBI35341.3| unnamed protein product [Vitis vinifera]
Length=409

 Score =   254 bits (649),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/201 (64%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DIED W+SMT+ AD N+KWA +AGPGGWNDPDMLEVGNGGM 
Sbjct  213  EDPATWAKDVGNSWRTTGDIEDNWDSMTSRADENDKWAAHAGPGGWNDPDMLEVGNGGMR  272

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEY++HFSIWAL KAPL+IGCDVR+M   TFE+LSN EVIAV+QD LGVQGRKV     
Sbjct  273  KEEYQSHFSIWALAKAPLLIGCDVRSMDNSTFELLSNKEVIAVNQDELGVQGRKVK---K  329

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS N++ V LWNR S    +TAHW  IGL  SA V  RDLW H   S+  
Sbjct  330  DGNLEVWAGPLSDNKVAVVLWNRGSSQANMTAHWSDIGLSPSAVVDARDLWAHSTQSS-V  388

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                 A+V SH  ++YI TP+
Sbjct  389  QGQLWAQVDSHACKMYILTPK  409



>emb|CBI35340.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   254 bits (649),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            D+PA WA+ +GNSWR T DI+DTWESMT+ AD+N+ WA YAGPGGWNDPDMLEVGNGGM+
Sbjct  210  DNPATWASSIGNSWRTTGDIKDTWESMTSHADLNDVWASYAGPGGWNDPDMLEVGNGGMS  269

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M  ETFE+LSN EVI V+QD LG QG+KV  +G 
Sbjct  270  TEEYRSHFSIWALAKAPLLIGCDIRSMDNETFELLSNKEVIEVNQDKLGAQGKKVKKTGD  329

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVW+GPLS NR+ V LWNR S + TI A W  IGL SSA V  RDLW H  I +  
Sbjct  330  ---LEVWSGPLSDNRVAVVLWNRESSEATIIADWSDIGLNSSAVVDARDLWTHSTIYS-I  385

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                 A V++H  ++Y  TP 
Sbjct  386  RHQLKATVEAHACKMYALTPH  406



>gb|KFK25204.1| hypothetical protein AALP_AA8G080700 [Arabis alpina]
Length=396

 Score =   253 bits (646),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 147/199 (74%), Gaps = 4/199 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPA WA  +GNSWR T DI+D W SMT+IAD+N++WA YA PG WNDPDMLEVGNGGMT
Sbjct  198  DDPATWAGDIGNSWRTTGDIQDNWNSMTSIADLNDRWASYARPGSWNDPDMLEVGNGGMT  257

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M  +TFE+LSN EVIAV+QD LG+QG+K+     
Sbjct  258  KEEYRSHFSIWALAKAPLLIGCDLRSMNKDTFELLSNKEVIAVNQDKLGIQGKKIK---K  314

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPLS  R+ V LWNR S    ITA W  IGL+SSA+V+ RDLW H   S   
Sbjct  315  EGDLEVWAGPLSKKRVAVILWNRGSLPANITARWAEIGLDSSATVNARDLWAHSTHSG-V  373

Query  251  VKSFSAKVKSHGSELYIFT  195
             K  SA V+ H  ++Y  T
Sbjct  374  KKQLSALVEPHACKMYTLT  392



>ref|XP_011017548.1| PREDICTED: alpha-galactosidase-like [Populus euphratica]
Length=443

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 4/202 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA+ VGNSWR T DI D W+SMT+ AD N++WA YA PGGWNDPDMLEVGNGGMT
Sbjct  233  EDPATWASNVGNSWRTTGDISDNWDSMTSRADQNDQWASYAAPGGWNDPDMLEVGNGGMT  292

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCDVR M+ ET EILSN EVIAV+QD LGVQG+KV     
Sbjct  293  TEEYRSHFSIWALAKAPLLIGCDVRTMSDETLEILSNREVIAVNQDKLGVQGKKVK---N  349

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPLS N++ V LWNR S   T+TA+W  IGL+S+ +V+ RDLW H +   + 
Sbjct  350  NGDLEVWAGPLSNNKIAVVLWNRGSSRATVTAYWSDIGLDSTTTVNARDLWAHSN-QPSV  408

Query  251  VKSFSAKVKSHGSELYIFTPQT  186
                SA + SH  ++Y+  P +
Sbjct  409  KGQISADLDSHACKMYVLLPSS  430



>gb|KCW57925.1| hypothetical protein EUGRSUZ_H00669 [Eucalyptus grandis]
Length=416

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 151/202 (75%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA+ +GNSWR T+DI D W+SMT+ AD+N+KWA YAGPGGWNDPDMLEVGNG MT
Sbjct  220  EDPATWASSIGNSWRTTDDIFDNWDSMTSRADLNDKWASYAGPGGWNDPDMLEVGNGVMT  279

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL+KAPL+IGCDVR+M   T  +LSN EVIAV+QD LGVQG+KV    +
Sbjct  280  TEEYRSHFSIWALVKAPLLIGCDVRSMDYTTLMLLSNKEVIAVNQDGLGVQGKKVK---S  336

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPL+ N++ V LWNR S   T+TA W  IGL S+  V  RDLW H   +  +
Sbjct  337  DGNLEVWAGPLTANKVAVVLWNRGSSRATVTASWSDIGLHSTTVVKARDLWMHS--TKRS  394

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            +K   SA + SH  ++Y+ TPQ
Sbjct  395  IKGQISADIDSHACKMYVVTPQ  416



>gb|KCW57924.1| hypothetical protein EUGRSUZ_H00669 [Eucalyptus grandis]
Length=416

 Score =   253 bits (645),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 151/202 (75%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA+ +GNSWR T+DI D W+SMT+ AD+N+KWA YAGPGGWNDPDMLEVGNG MT
Sbjct  220  EDPATWASSIGNSWRTTDDIFDNWDSMTSRADLNDKWASYAGPGGWNDPDMLEVGNGVMT  279

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL+KAPL+IGCDVR+M   T  +LSN EVIAV+QD LGVQG+KV    +
Sbjct  280  TEEYRSHFSIWALVKAPLLIGCDVRSMDYTTLMLLSNKEVIAVNQDGLGVQGKKVK---S  336

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS N++ V LWNR S   T+TA W  IGL S+  V  RDLW H   +  +
Sbjct  337  DGNLEVWAGPLSTNKVAVVLWNRGSSRATVTASWSDIGLNSTTVVKARDLWMHS--TKRS  394

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            +K   SA + SH  ++Y+ TPQ
Sbjct  395  IKGQISADIDSHACKMYVVTPQ  416



>dbj|BAC66445.1| alpha-galactosidase [Helianthus annuus]
Length=428

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 153/202 (76%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WAN VGNSWR T DI D W+SMT+ AD N+KWA YA PGGWNDPDMLEVGNGGMT
Sbjct  232  EDPATWANEVGNSWRTTGDISDNWDSMTSRADENDKWAAYAKPGGWNDPDMLEVGNGGMT  291

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL++GCD+R+M+ ET +ILSN EVIAV+QD LGVQG+KV     
Sbjct  292  TEEYRSHFSIWALAKAPLLVGCDMRSMSKETHDILSNREVIAVNQDSLGVQGKKVK---K  348

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPL+ N++ V LWNR S    ITA+W  IGL S+  V++RDLW H   +  +
Sbjct  349  NGDLEVWAGPLAHNKVAVILWNRGSSRAQITAYWSDIGLNSTTVVNVRDLWAHR--TQRS  406

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            VK   SA V+SH  ++Y+ TP+
Sbjct  407  VKGQISATVESHACKMYVLTPR  428



>gb|KCW57926.1| hypothetical protein EUGRSUZ_H00669 [Eucalyptus grandis]
Length=416

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 151/202 (75%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA+ +GNSWR T+DI D W+SMT+ AD+N+KWA YAGPGGWNDPDMLEVGNG MT
Sbjct  220  EDPATWASSIGNSWRTTDDIFDNWDSMTSRADLNDKWASYAGPGGWNDPDMLEVGNGVMT  279

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL+KAPL+IGCDVR+M   T  +LSN EVIAV+QD LGVQG+KV    +
Sbjct  280  TEEYRSHFSIWALVKAPLLIGCDVRSMDYTTLMLLSNKEVIAVNQDGLGVQGKKVK---S  336

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS N++ V LWNR S   T+TA W  IGL S+  V  RDLW H   +  +
Sbjct  337  DGNLEVWAGPLSTNKVAVVLWNRGSSRATVTASWSDIGLNSTTVVKARDLWMHS--TKRS  394

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            +K   SA + SH  ++Y+ +PQ
Sbjct  395  IKGQISADIDSHACKMYVLSPQ  416



>ref|XP_006478162.1| PREDICTED: alpha-galactosidase-like [Citrus sinensis]
Length=408

 Score =   251 bits (642),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 151/203 (74%), Gaps = 6/203 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI+D W SMT++AD N+KWA YAGPGG+NDPDMLEVGNGGMT
Sbjct  210  EDPATWAPKIGNSWRTTGDIKDNWNSMTSLADQNDKWASYAGPGGYNDPDMLEVGNGGMT  269

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYRAHFSIWAL KAPL+IGCD+R M   TFEIL N EVIAV+QD LGVQG+KV     
Sbjct  270  TEEYRAHFSIWALAKAPLLIGCDIRAMDKITFEILGNKEVIAVNQDKLGVQGKKVK---K  326

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLE--SSASVSIRDLWKHEDISA  258
            +G  EVWAGPLSGNR+ V LWNR S   T+TA+W  IGL+   S  V+ RDLW+H+ I  
Sbjct  327  EGDLEVWAGPLSGNRVAVVLWNRGSSKATVTANWSDIGLKLNHSTVVNARDLWQHKTILP  386

Query  257  NAVKSFSAKVKSHGSELYIFTPQ  189
                  +A ++SH  ++++ TPQ
Sbjct  387  -INGQIAANLESHACKMFVLTPQ  408



>emb|CAN66885.1| hypothetical protein VITISV_000962 [Vitis vinifera]
Length=392

 Score =   251 bits (641),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/201 (63%), Positives = 146/201 (73%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DIED W+SMT+ AD N+KWA +AGPGGWNDPDMLEVGNGGM 
Sbjct  196  EDPATWAKDVGNSWRTTGDIEDNWDSMTSRADENDKWAAHAGPGGWNDPDMLEVGNGGMX  255

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEY++HFSIWAL KAPL+IGCDVR+M   TFE+LSN EVIAV+QD LGVQGRKV     
Sbjct  256  KEEYQSHFSIWALAKAPLLIGCDVRSMDNSTFELLSNKEVIAVNQDELGVQGRKVK---K  312

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS N++ V LWNR S    +TAHW  IGL  SA V  RDLW     S+  
Sbjct  313  DGNLEVWAGPLSDNKVAVVLWNRGSSQANMTAHWSDIGLSPSAVVDARDLWAXSTQSS-V  371

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                 A+V SH  ++YI TP+
Sbjct  372  QGQLWAQVDSHACKMYILTPK  392



>gb|EYU22322.1| hypothetical protein MIMGU_mgv1a007981mg [Erythranthe guttata]
Length=329

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DI D W+SMT+ ADIN++WA YAGPGGWNDPDMLEVGNGGMT
Sbjct  133  EDPATWAKSVGNSWRTTGDIVDNWDSMTSRADINDQWASYAGPGGWNDPDMLEVGNGGMT  192

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL+KAPLIIGCD+R+M   T  +LSN EVIAV+QD LG+QG+K+     
Sbjct  193  TEEYRSHFSIWALVKAPLIIGCDIRSMDKTTLALLSNKEVIAVNQDKLGIQGKKIK---K  249

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVW G LS NR+ + LWNR S   TITA+W  +GL S+     RDLW H    A+ 
Sbjct  250  DGDLEVWGGALSENRVALVLWNRGSSQATITAYWSDLGLNSTTVADARDLWAHS-TQASV  308

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA V SH  ++Y+ +P+
Sbjct  309  QGQISATVASHDCKMYVLSPK  329



>ref|XP_006848642.1| PREDICTED: alpha-galactosidase [Amborella trichopoda]
 gb|ERN10223.1| hypothetical protein AMTR_s00171p00051180 [Amborella trichopoda]
Length=414

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 149/199 (75%), Gaps = 4/199 (2%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            +PA WA  +GNSWR T DI+D W SMT  AD N+ WA+YAGPG WNDPDMLEVGNGGMT 
Sbjct  218  NPATWAPAIGNSWRTTGDIKDEWSSMTNTADSNDAWAKYAGPGAWNDPDMLEVGNGGMTT  277

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
            EEYR+HFSIWAL+KAPL+IGCDV + + ET EILSN EVIAV+QD LGVQG+KV     +
Sbjct  278  EEYRSHFSIWALVKAPLLIGCDVGSASKETLEILSNKEVIAVNQDKLGVQGKKVK---KE  334

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
            G QEVWAGPLSG R+ + LWNR S   +ITA W+ +GL+S+A+V  RDLW H  +S+   
Sbjct  335  GDQEVWAGPLSGGRVAMILWNRGSYQTSITAKWEDVGLKSTATVDARDLWAHSTMSS-IK  393

Query  248  KSFSAKVKSHGSELYIFTP  192
               +A V SH  ++Y+ TP
Sbjct  394  GQLTATVDSHACKMYVLTP  412



>gb|KEH42875.1| alpha-galactosidase-like protein [Medicago truncatula]
Length=414

 Score =   250 bits (639),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 148/201 (74%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DIED W+SMT+I D N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  216  EDPATWAKSVGNSWRTTGDIEDNWKSMTSIIDANDKWASYAGPGGWNDPDMLEVGNGGMT  275

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYRAHFSIWAL KAPL++GC+++ M   T+E++SN+EVIAV+QD LGVQG+KV    +
Sbjct  276  TEEYRAHFSIWALAKAPLLVGCNIQAMDNTTYELISNSEVIAVNQDKLGVQGKKVK---S  332

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +   EVWAGPLS N++ V LWNR S + T+TA W  IGLE    V  RDLW+H   S   
Sbjct  333  NNDLEVWAGPLSKNKVAVVLWNRSSSNATVTASWSDIGLEPETIVDARDLWEHSTQSL-V  391

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA + SH  ++Y+ TP+
Sbjct  392  SGEISADLDSHACKMYVLTPK  412



>pdb|1UAS|A Chain A, Crystal Structure Of Rice Alpha-Galactosidase
Length=362

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 145/200 (73%), Gaps = 5/200 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            ++PA WA  +GNSWR T DI D W SMT+ AD N++WA YAGPGGWNDPDMLEVGNGGM+
Sbjct  167  ENPATWAGRMGNSWRTTGDIADNWGSMTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMS  226

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPL+IGCDVR+M+ +T  ILSN+EVIAV+QD LGVQG+KV    +
Sbjct  227  EAEYRSHFSIWALAKAPLLIGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQ---S  283

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            D   EVWAGPLS NR  V LWNR S   TITAHW  IGL  S +V+ RDLW H   +A  
Sbjct  284  DNGLEVWAGPLSNNRKAVVLWNRQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQG  343

Query  251  VKSFSAKVKSHGSELYIFTP  192
                SA V  H  ++Y+ TP
Sbjct  344  --QISASVAPHDCKMYVLTP  361



>gb|KHN14744.1| Alpha-galactosidase [Glycine soja]
Length=355

 Score =   248 bits (634),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 148/200 (74%), Gaps = 4/200 (2%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            DPA WA  VGNSWR T DIED W SMT+IAD N++WA YAGPGGWNDPDMLEVGNGGMT 
Sbjct  158  DPATWAKTVGNSWRTTGDIEDNWNSMTSIADANDRWASYAGPGGWNDPDMLEVGNGGMTT  217

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
            EEYRAHFSIWAL KAPL++GCD++ M   T+E++SN EV+AV+QD LG+QG+KV  +   
Sbjct  218  EEYRAHFSIWALAKAPLLVGCDIQAMDNTTYELISNREVVAVNQDKLGIQGKKVKNNNG-  276

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
               EVW GPL GN++ V LWNR S + T+TA W  IGLE    V  RDLW+H   ++ + 
Sbjct  277  --LEVWTGPLRGNKVAVILWNRSSSNATVTACWSDIGLEPGTIVDARDLWEHSTQTSVSG  334

Query  248  KSFSAKVKSHGSELYIFTPQ  189
            K  SA++ SH  ++Y+ TP+
Sbjct  335  K-ISAELDSHACKMYVLTPR  353



>sp|P14749.1|AGAL_CYATE RecName: Full=Alpha-galactosidase; AltName: Full=Alpha-D-galactoside 
galactohydrolase; AltName: Full=Melibiase; Flags: Precursor 
[Cyamopsis tetragonoloba]
 emb|CAA32772.1| alpha-galactosidase preproprotein [Cyamopsis tetragonoloba]
Length=411

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 147/202 (73%), Gaps = 4/202 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DP +WA  +GNSWR T DIED W SMT+IAD N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  214  EDPQIWAKSIGNSWRTTGDIEDNWNSMTSIADSNDKWASYAGPGGWNDPDMLEVGNGGMT  273

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL++GCD+R M   T E++SN EVIAV+QD LGVQG+KV  +  
Sbjct  274  TEEYRSHFSIWALAKAPLLVGCDIRAMDDTTHELISNAEVIAVNQDKLGVQGKKVKSTND  333

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLS N++ V LWNR S   T+TA W  IGL+   +V  RDLW+H   S   
Sbjct  334  ---LEVWAGPLSDNKVAVILWNRSSSRATVTASWSDIGLQQGTTVDARDLWEHSTQSL-V  389

Query  251  VKSFSAKVKSHGSELYIFTPQT  186
                SA++ SH  ++Y+ TP++
Sbjct  390  SGEISAEIDSHACKMYVLTPRS  411



>ref|XP_010546252.1| PREDICTED: alpha-galactosidase [Tarenaya hassleriana]
Length=400

 Score =   249 bits (637),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/201 (61%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPA WA GVGNSWR T DI+D WESMT IAD N++WA YA PG WNDPDMLEVGNGGMT
Sbjct  202  DDPATWAGGVGNSWRTTGDIQDKWESMTLIADQNDRWASYAKPGSWNDPDMLEVGNGGMT  261

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M   TF++LSN EVIAV+QD LGVQG+KV     
Sbjct  262  TEEYRSHFSIWALAKAPLLIGCDIRSMDKLTFKLLSNKEVIAVNQDKLGVQGKKVK---K  318

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPL+  R+ + LWNR      ITA W  IGL SS  V +RDLW+H   SA  
Sbjct  319  EGDLEVWAGPLTKKRVAIVLWNRGESQANITARWTDIGLGSSTVVDVRDLWEHSTKSAVK  378

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
             +  SA V+ H  ++Y  T +
Sbjct  379  YQ-ISALVEPHACKMYTLTRR  398



>ref|XP_002467020.1| hypothetical protein SORBIDRAFT_01g018400 [Sorghum bicolor]
 gb|EER94018.1| hypothetical protein SORBIDRAFT_01g018400 [Sorghum bicolor]
Length=426

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/200 (61%), Positives = 146/200 (73%), Gaps = 5/200 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            ++PA WA  +GNSWR T+DI D W SMT+ AD N++WA YAGPGGWNDPDMLEVGNGGM+
Sbjct  231  ENPATWAGSMGNSWRTTDDIADNWGSMTSRADQNDRWASYAGPGGWNDPDMLEVGNGGMS  290

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPL+IGCDVR+M+ +T +ILSN+EVIAV+QD LGVQG+KV    +
Sbjct  291  EAEYRSHFSIWALAKAPLLIGCDVRSMSQQTKDILSNSEVIAVNQDSLGVQGKKVQ---S  347

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +   EVWAGPLS NR  V LWNR     TITA W  IGL SS +V+ RDLW H   SA  
Sbjct  348  NNGLEVWAGPLSNNRKAVVLWNRQGYQATITAQWSSIGLASSTAVTARDLWAHSSFSAQG  407

Query  251  VKSFSAKVKSHGSELYIFTP  192
                SA V  H  ++Y+ TP
Sbjct  408  --QLSASVAPHDCKMYVLTP  425



>ref|XP_002978044.1| hypothetical protein SELMODRAFT_108242 [Selaginella moellendorffii]
 gb|EFJ20701.1| hypothetical protein SELMODRAFT_108242 [Selaginella moellendorffii]
Length=402

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 146/202 (72%), Gaps = 0/202 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPALWA GVGNSWR T DI+D W+SM   AD N+KWA+YAGPGGWNDPDMLEVGNGGM+
Sbjct  201  EDPALWAPGVGNSWRTTGDIKDNWQSMIVRADQNDKWAKYAGPGGWNDPDMLEVGNGGMS  260

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYRAHFS+WALMKAPLIIGCDVRN+  E  +IL N EVIA++QD +GVQG++VS  GA
Sbjct  261  LEEYRAHFSLWALMKAPLIIGCDVRNLKQEYLDILMNKEVIAINQDSMGVQGKRVSRKGA  320

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
               + VW GPLS  + V  L NR      I A+W+ IG +  +SV +RD+W H+D+ A +
Sbjct  321  LEARLVWGGPLSQGKFVALLLNRGDSTAKIRAYWEQIGAKPGSSVQVRDVWAHKDLGAFS  380

Query  251  VKSFSAKVKSHGSELYIFTPQT  186
                   V +H  ++Y+  P++
Sbjct  381  QGYIEEAVDAHAIKMYVVVPKS  402



>gb|KEH27106.1| alpha-galactosidase-like protein [Medicago truncatula]
Length=408

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 150/201 (75%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DIED W SMT+I D+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  210  EDPATWAKSVGNSWRTTGDIEDNWNSMTSIIDVNDKWASYAGPGGWNDPDMLEVGNGGMT  269

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL++GC+++ M   T+E++SN+EVIAV+QD LGVQG+KV    +
Sbjct  270  TEEYRSHFSIWALAKAPLLVGCNIQAMDNITYELISNSEVIAVNQDKLGVQGKKVK---S  326

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +   EVWAGPL+ N++ V LWNR S + T+TA W  IGL+S   V  RDLW+H   S   
Sbjct  327  NNDLEVWAGPLTNNKVAVILWNRSSSNATVTASWSDIGLKSETIVDARDLWEHSTQSM-V  385

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA++ SH  ++Y+ TP+
Sbjct  386  SGEISAELDSHACKMYVLTPK  406



>ref|XP_003535399.2| PREDICTED: alpha-galactosidase-like [Glycine max]
Length=410

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 148/200 (74%), Gaps = 4/200 (2%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            DPA WA  VGNSWR T DIED W SMT+IAD N++WA YAGPGGWNDPDMLEVGNGGMT 
Sbjct  213  DPATWAKTVGNSWRTTGDIEDNWNSMTSIADANDRWASYAGPGGWNDPDMLEVGNGGMTT  272

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
            EEYRAHFSIWAL KAPL++GCD++ M   T+E++SN EV+AV+QD LG+QG+KV  +   
Sbjct  273  EEYRAHFSIWALAKAPLLVGCDIQAMDNTTYELISNREVVAVNQDKLGIQGKKVKNNNG-  331

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
               EVW GPL GN++ V LWNR S + T+TA W  IGLE    V  RDLW+H   ++ + 
Sbjct  332  --LEVWTGPLRGNKVAVILWNRSSSNATVTACWSDIGLEPGTIVDARDLWEHSTQTSVSG  389

Query  248  KSFSAKVKSHGSELYIFTPQ  189
            K  SA++ SH  ++Y+ TP+
Sbjct  390  K-ISAELDSHACKMYVLTPR  408



>ref|XP_004299748.1| PREDICTED: alpha-galactosidase [Fragaria vesca subsp. vesca]
Length=415

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 148/202 (73%), Gaps = 4/202 (2%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V+DPA WA  VGNSWR T DI D W+SMT+ AD N+ WA YAGPGGWNDPDMLEVGNGGM
Sbjct  218  VEDPATWAASVGNSWRTTGDISDNWDSMTSRADQNDIWASYAGPGGWNDPDMLEVGNGGM  277

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEYRAHFSIWAL KAPL+IGCD+R+M   T  +LSN EVIAV+QD LG QG++V+ SG
Sbjct  278  TLEEYRAHFSIWALAKAPLLIGCDIRSMDDATLSLLSNKEVIAVNQDKLGAQGKQVT-SG  336

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             D   +VWAGPLS NR+ + LWNR     T+TAHW  IGL+ +  V  RDLW+H     +
Sbjct  337  TD--LQVWAGPLSDNRVALVLWNRSPSKATVTAHWSDIGLKPATVVEARDLWEHS-TGPS  393

Query  254  AVKSFSAKVKSHGSELYIFTPQ  189
              +  SA ++SH  ++Y+ TP+
Sbjct  394  VSEKLSADLESHACKMYVLTPK  415



>gb|AIL28756.1| alpha galactosidase isoform 2 [Cocos nucifera]
Length=398

 Score =   248 bits (634),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/200 (62%), Positives = 146/200 (73%), Gaps = 4/200 (2%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            DPA WA GVGNSWR T DI+D WESM + AD N+KWA +AGPGGWNDPDMLEVGNGGMT 
Sbjct  203  DPATWARGVGNSWRTTGDIQDKWESMISRADENDKWAGHAGPGGWNDPDMLEVGNGGMTT  262

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
            +EYR+HFSIWAL KAPL+IGCDVR M+ ET EIL N E IAV+QD LGVQG+KV     D
Sbjct  263  DEYRSHFSIWALAKAPLLIGCDVRAMSDETKEILINEEAIAVNQDALGVQGKKVK---GD  319

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
            G  EVWAGPLSG R+ V LWNR S   +ITA+W  IGL+ S  V  RD+W +  I +   
Sbjct  320  GSAEVWAGPLSGGRVAVVLWNRGSSQTSITANWSDIGLDPSTVVDARDVWAYSTIWS-VQ  378

Query  248  KSFSAKVKSHGSELYIFTPQ  189
             S +A V +H   +Y+ TP+
Sbjct  379  GSITATVDTHACRMYVLTPK  398



>ref|NP_001064939.2| Os10g0493600 [Oryza sativa Japonica Group]
 sp|Q9FXT4.1|AGAL_ORYSJ RecName: Full=Alpha-galactosidase; AltName: Full=Alpha-D-galactoside 
galactohydrolase; AltName: Full=Melibiase; Flags: Precursor 
[Oryza sativa Japonica Group]
 dbj|BAB12570.1| alpha-galactosidase [Oryza sativa Japonica Group]
 gb|AAM92832.1| putative alpha-galactosidase preproprotein [Oryza sativa Japonica 
Group]
 gb|AAP54412.1| Alpha-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABB47819.1| Alpha-galactosidase precursor, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF26853.2| Os10g0493600 [Oryza sativa Japonica Group]
Length=417

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 145/200 (73%), Gaps = 5/200 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            ++PA WA  +GNSWR T DI D W SMT+ AD N++WA YAGPGGWNDPDMLEVGNGGM+
Sbjct  222  ENPATWAGRMGNSWRTTGDIADNWGSMTSRADENDQWAAYAGPGGWNDPDMLEVGNGGMS  281

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPL+IGCDVR+M+ +T  ILSN+EVIAV+QD LGVQG+KV    +
Sbjct  282  EAEYRSHFSIWALAKAPLLIGCDVRSMSQQTKNILSNSEVIAVNQDSLGVQGKKVQ---S  338

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            D   EVWAGPLS NR  V LWNR S   TITAHW  IGL  S +V+ RDLW H   +A  
Sbjct  339  DNGLEVWAGPLSNNRKAVVLWNRQSYQATITAHWSNIGLAGSVAVTARDLWAHSSFAAQG  398

Query  251  VKSFSAKVKSHGSELYIFTP  192
                SA V  H  ++Y+ TP
Sbjct  399  --QISASVAPHDCKMYVLTP  416



>gb|EYU22321.1| hypothetical protein MIMGU_mgv1a007981mg [Erythranthe guttata]
Length=389

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DI D W+SMT+ ADIN++WA YAGPGGWNDPDMLEVGNGGMT
Sbjct  193  EDPATWAKSVGNSWRTTGDIVDNWDSMTSRADINDQWASYAGPGGWNDPDMLEVGNGGMT  252

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL+KAPLIIGCD+R+M   T  +LSN EVIAV+QD LG+QG+K+     
Sbjct  253  TEEYRSHFSIWALVKAPLIIGCDIRSMDKTTLALLSNKEVIAVNQDKLGIQGKKIK---K  309

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVW G LS NR+ + LWNR S   TITA+W  +GL S+     RDLW H    A+ 
Sbjct  310  DGDLEVWGGALSENRVALVLWNRGSSQATITAYWSDLGLNSTTVADARDLWAHS-TQASV  368

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA V SH  ++Y+ +P+
Sbjct  369  QGQISATVASHDCKMYVLSPK  389



>gb|KJB69469.1| hypothetical protein B456_011G025100 [Gossypium raimondii]
Length=449

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 140/200 (70%), Gaps = 3/200 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA   G++WR T DI DTW S+T+IAD NN W  YAGPG WNDPDMLEVGNGGM 
Sbjct  250  EDPAKWAGSYGHTWRTTGDINDTWASITSIADSNNIWGRYAGPGRWNDPDMLEVGNGGMN  309

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWALMKAPL+IGCDVR+ + ET  IL N EVI V+QD LGVQGRK+    +
Sbjct  310  IEEYRSHFSIWALMKAPLLIGCDVRSASKETLTILGNKEVIDVNQDSLGVQGRKIR---S  366

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPLSG R+VV LWNR      I+  W  IGL  S  V+IRDLWKH  +S N 
Sbjct  367  NGGLEVWAGPLSGKRVVVVLWNRSQARAIISVKWREIGLSPSTPVAIRDLWKHSFVSMNK  426

Query  251  VKSFSAKVKSHGSELYIFTP  192
                 A V  H  ++YI TP
Sbjct  427  RYRMGAYVAGHACKMYIMTP  446



>emb|CDX81098.1| BnaC03g03520D [Brassica napus]
Length=398

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 145/202 (72%), Gaps = 4/202 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI D W+SMT IAD N++WA YA PG WNDPDMLEVGNGGMT
Sbjct  200  EDPATWAGAIGNSWRTTGDIRDNWKSMTMIADQNDRWASYARPGSWNDPDMLEVGNGGMT  259

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M   TFE+LSN EVIAV+QD LG+QG+K+     
Sbjct  260  REEYRSHFSIWALAKAPLLIGCDLRSMDKVTFELLSNKEVIAVNQDKLGIQGKKIK---K  316

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS  R+ V LWNR S    I A W+ IGL+SSA V+ RDLW H   S   
Sbjct  317  DGDLEVWAGPLSMKRVAVILWNRGSSPANINARWEEIGLDSSAIVNARDLWAHVTHSG-V  375

Query  251  VKSFSAKVKSHGSELYIFTPQT  186
             K  SA V+ H  ++Y  T +T
Sbjct  376  RKQLSALVEPHACKMYTLTRRT  397



>gb|ADE77708.1| unknown [Picea sitchensis]
Length=396

 Score =   248 bits (633),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/198 (60%), Positives = 147/198 (74%), Gaps = 3/198 (2%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            +PA W   + NSWR T DI+D W+S+T+ AD N++WA YAGPGGWNDPDMLEVGNG M+ 
Sbjct  198  NPATWGPKIANSWRTTGDIQDNWDSITSRADQNDQWAAYAGPGGWNDPDMLEVGNGNMST  257

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
             EYR+HFSIWALMKAPL+IGCD+R+ T+ET EILSN+EVI V+QDPLGVQG+KVS  G  
Sbjct  258  VEYRSHFSIWALMKAPLLIGCDIRSATSETLEILSNSEVINVNQDPLGVQGKKVSQQGD-  316

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
               EVWAGPLS NR+ V LWNR +  + ITA+W  IGL S A V  RDLW H  + ++  
Sbjct  317  --LEVWAGPLSNNRVAVILWNRSTSQDAITANWGAIGLPSDAIVQARDLWAHSYLPSDLQ  374

Query  248  KSFSAKVKSHGSELYIFT  195
             S ++ V SH  ++YI T
Sbjct  375  GSLTSTVDSHDVKMYILT  392



>ref|XP_006351522.1| PREDICTED: alpha-galactosidase-like [Solanum tuberosum]
Length=411

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 124/201 (62%), Positives = 147/201 (73%), Gaps = 6/201 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            D+PA WA+ VGNSWR T DI D W SMT+ AD+NN+WA YAGPGGWNDPDMLEVGNGGM 
Sbjct  214  DNPATWASSVGNSWRTTGDITDDWNSMTSRADLNNQWASYAGPGGWNDPDMLEVGNGGMN  273

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
            + EYR+HFSIWAL+KAPLIIGCD+R+M      ILSN+EVIAV+QD LGVQG++V   G 
Sbjct  274  FGEYRSHFSIWALVKAPLIIGCDLRSMDNTAHGILSNSEVIAVNQDKLGVQGKRVKQYGD  333

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLSG R+ + LWNR S    ITA+W  IGL+SS  V  RDLW H   +  +
Sbjct  334  ---LEVWAGPLSGKRVALVLWNRGSSKADITAYWSDIGLDSSTVVDARDLWAHS--TKGS  388

Query  251  VK-SFSAKVKSHGSELYIFTP  192
            VK   SA V+SH   +Y+ TP
Sbjct  389  VKGQISASVESHDCSMYVLTP  409



>ref|XP_003574114.2| PREDICTED: alpha-galactosidase [Brachypodium distachyon]
Length=420

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PA WA   GNSWR T DIEDTW+SMT+ AD N  WAEYA PGGWNDPDMLEVGNGGMT +
Sbjct  219  PARWAAAYGNSWRTTNDIEDTWDSMTSRADQNEVWAEYARPGGWNDPDMLEVGNGGMTND  278

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPLIIGCDVR+M+ +T++IL+NTEVIAV+QDPLGVQG+KV + G++ 
Sbjct  279  EYIVHFSIWAISKAPLIIGCDVRHMSQDTYDILANTEVIAVNQDPLGVQGKKVRMEGSN-  337

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDET-ITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
              E+WA PLSG R  V L NR +KDE  ITA WD IGL +  +V  RDLW+H+ + A   
Sbjct  338  --EIWAAPLSGYRTAVVLLNRHAKDEAEITARWDDIGLPAGMAVEARDLWQHKTLDAKFT  395

Query  248  KSFSAKVKSHGSELYIFTPQT  186
                  V  H + +++ TP T
Sbjct  396  DKMPFNVTPHAARMFLLTPLT  416



>ref|XP_009402016.1| PREDICTED: alpha-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=247

 Score =   243 bits (619),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 142/202 (70%), Gaps = 3/202 (1%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALWA+ +GNSWR T DI D+WESM + AD N  +AE+A PGGWNDPDMLEVGNGGM+ +
Sbjct  42   PALWADKLGNSWRTTFDINDSWESMVSRADQNEVYAEHARPGGWNDPDMLEVGNGGMSND  101

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFS+WA  KAPLIIGCDVR+MT ET  IL N EVIAV+QDPLGVQ +KV + G   
Sbjct  102  EYIVHFSLWAASKAPLIIGCDVRSMTKETLAILGNEEVIAVNQDPLGVQAKKVRMYGD--  159

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPLSG R VV L NR  +  TITA WD IGL  +  V +RDLWKH  +    V 
Sbjct  160  -SEVWAGPLSGYRTVVVLLNRSPEFRTITAQWDDIGLPLNTVVEVRDLWKHATLEKRFVN  218

Query  245  SFSAKVKSHGSELYIFTPQTVT  180
               A V  H  ++++ TP T++
Sbjct  219  ELRADVHHHACKMFLLTPLTLS  240



>ref|XP_003619801.1| Alpha galactosidase [Medicago truncatula]
 gb|AES76019.1| alpha-galactosidase-like protein [Medicago truncatula]
Length=420

 Score =   248 bits (633),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
             +DP++W   VGNSWR T DIED W+SM + AD NNKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  223  AEDPSIWGKSVGNSWRTTSDIEDKWDSMISCADQNNKWASYAGPGGWNDPDMLEVGNGGM  282

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEYRAHFSIWAL+KAPL+IGCD+R +   T E+L N+EVIAV+QD LG+QG+KV    
Sbjct  283  TTEEYRAHFSIWALVKAPLLIGCDIRALDDITKELLRNSEVIAVNQDKLGIQGKKVK---  339

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
            ++   EVWAGPLS NRL V LWNR S    +TA W  +GL+   S+  RDLW+H    + 
Sbjct  340  SNDDLEVWAGPLSDNRLAVVLWNRSSSKAIVTASWSDLGLKPGTSIDARDLWEHS-TQSK  398

Query  254  AVKSFSAKVKSHGSELYIFTP  192
                 SA++ SH  ++YI TP
Sbjct  399  VSGDISAELDSHACKMYILTP  419



>ref|XP_006289400.1| hypothetical protein CARUB_v10002899mg [Capsella rubella]
 gb|EOA22298.1| hypothetical protein CARUB_v10002899mg [Capsella rubella]
Length=370

 Score =   246 bits (629),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 150/201 (75%), Gaps = 6/201 (3%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V+DPA WA  +GNSWR T DIED W SMT IAD+N++WA YA PG WNDPDMLEVGNGGM
Sbjct  171  VEDPATWAGAIGNSWRTTGDIEDKWSSMTTIADLNDQWASYARPGSWNDPDMLEVGNGGM  230

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEYR+HFSIWAL KAPL+IGCD+R+M   TFE+LSN EVI+V+QD LG+QG+KV    
Sbjct  231  TKEEYRSHFSIWALAKAPLLIGCDLRSMDKGTFELLSNKEVISVNQDKLGIQGKKVK---  287

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             +G  EVWAGPLS  R+ V LWNR S    ITA W  +GL+SS +V+ RDLW+H  ++  
Sbjct  288  KEGDLEVWAGPLSKKRVAVILWNRGSVPANITARWADLGLDSSVTVNARDLWEH--LTHP  345

Query  254  AVKS-FSAKVKSHGSELYIFT  195
            ++K+  SA V+ H  ++Y  T
Sbjct  346  SIKTQLSALVEPHACKMYTLT  366



>gb|ACF80887.1| unknown [Zea mays]
Length=423

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 141/199 (71%), Gaps = 5/199 (3%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            +PA WA G+GNSWR T+DI D W SMT+ AD N++WA YAGPGGWNDPDMLEVGNGGM+ 
Sbjct  229  NPATWAGGMGNSWRTTDDIADNWGSMTSRADQNDRWASYAGPGGWNDPDMLEVGNGGMSE  288

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
             EYR+HFSIWAL KAPL+IGCDVR M+ +T  ILSN+EVIAV+QD  G QG+KV  S   
Sbjct  289  AEYRSHFSIWALAKAPLLIGCDVRAMSQQTMGILSNSEVIAVNQDSQGAQGKKVQSSNG-  347

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
               EVWAGPLS NR  V LWNR     TITA W  IGL SS +V+ RDLW H   SA   
Sbjct  348  --LEVWAGPLSNNRKAVVLWNRQGYQATITAQWSSIGLASSTAVTARDLWAHSSFSAQG-  404

Query  248  KSFSAKVKSHGSELYIFTP  192
               SA V  H  ++Y+ TP
Sbjct  405  -QLSASVPPHDCKMYVLTP  422



>tpg|DAA49499.1| TPA: hypothetical protein ZEAMMB73_096407 [Zea mays]
 tpg|DAA49500.1| TPA: hypothetical protein ZEAMMB73_096407 [Zea mays]
Length=423

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 141/199 (71%), Gaps = 5/199 (3%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            +PA WA G+GNSWR T+DI D W SMT+ AD N++WA YAGPGGWNDPDMLEVGNGGM+ 
Sbjct  229  NPATWAGGMGNSWRTTDDIADNWGSMTSRADQNDRWASYAGPGGWNDPDMLEVGNGGMSE  288

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
             EYR+HFSIWAL KAPL+IGCDVR M+ +T  ILSN+EVIAV+QD  G QG+KV  S   
Sbjct  289  AEYRSHFSIWALAKAPLLIGCDVRAMSQQTMGILSNSEVIAVNQDSQGAQGKKVQSSNG-  347

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
               EVWAGPLS NR  V LWNR     TITA W  IGL SS +V+ RDLW H   SA   
Sbjct  348  --LEVWAGPLSNNRKAVVLWNRQGYQATITAQWSSIGLASSTAVTARDLWAHSSFSAQG-  404

Query  248  KSFSAKVKSHGSELYIFTP  192
               SA V  H  ++Y+ TP
Sbjct  405  -QLSASVPPHDCKMYVLTP  422



>ref|NP_001142381.1| uncharacterized protein LOC100274554 precursor [Zea mays]
 gb|ACF88364.1| unknown [Zea mays]
Length=423

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 141/199 (71%), Gaps = 5/199 (3%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            +PA WA G+GNSWR T+DI D W SMT+ AD N++WA YAGPGGWNDPDMLEVGNGGM+ 
Sbjct  229  NPATWAGGMGNSWRTTDDIADNWGSMTSRADQNDRWASYAGPGGWNDPDMLEVGNGGMSE  288

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
             EYR+HFSIWAL KAPL+IGCDVR M+ +T  ILSN+EVIAV+QD  G QG+KV  S   
Sbjct  289  AEYRSHFSIWALAKAPLLIGCDVRAMSQQTMGILSNSEVIAVNQDSQGAQGKKVQSSNG-  347

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
               EVWAGPLS NR  V LWNR     TITA W  IGL SS +V+ RDLW H   SA   
Sbjct  348  --LEVWAGPLSNNRKAVVLWNRQGYQATITAQWSSIGLASSTAVTARDLWAHSSFSAQG-  404

Query  248  KSFSAKVKSHGSELYIFTP  192
               SA V  H  ++Y+ TP
Sbjct  405  -QLSASVPPHDCKMYVLTP  422



>ref|XP_007152504.1| hypothetical protein PHAVU_004G135800g [Phaseolus vulgaris]
 gb|ESW24498.1| hypothetical protein PHAVU_004G135800g [Phaseolus vulgaris]
Length=423

 Score =   248 bits (632),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 143/199 (72%), Gaps = 4/199 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DIED WESM + AD+N++WA YAGPGGWNDPDMLEVGNGGMT
Sbjct  227  EDPATWAKSVGNSWRTTGDIEDKWESMISRADLNDEWASYAGPGGWNDPDMLEVGNGGMT  286

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYRAHFSIWAL KAPL+IGCD+R +   T E+LSN EVIAV+QD LGVQG+KV    +
Sbjct  287  TEEYRAHFSIWALAKAPLLIGCDIRALDVTTKELLSNEEVIAVNQDKLGVQGKKVK---S  343

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +   EVWAGPLS NRL V LWNR S    +TA W  IGL+    V  RDLWKH   S+  
Sbjct  344  NNDLEVWAGPLSNNRLAVILWNRSSSKAKVTASWSDIGLKPGTLVDARDLWKHSTQSS-V  402

Query  251  VKSFSAKVKSHGSELYIFT  195
                SA++ SH   +Y+ T
Sbjct  403  SGEISAELDSHACNMYVLT  421



>gb|KHN24471.1| Alpha-galactosidase [Glycine soja]
Length=353

 Score =   245 bits (626),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DIED WESM + AD+N+KWA  AGPGGWNDPDMLEVGNGGMT
Sbjct  157  EDPATWAKSVGNSWRTTGDIEDKWESMISRADLNDKWASCAGPGGWNDPDMLEVGNGGMT  216

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYRAHFSIWAL KAPL+IGCD+R + A T E+LSN EVIAV+QD LGVQG+KV    +
Sbjct  217  TEEYRAHFSIWALAKAPLLIGCDIRALDATTKELLSNNEVIAVNQDKLGVQGKKVK---S  273

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +   EVWAGPLS N++ V LWNR S    +TA W  IGL+   SV  RDLW H   S+  
Sbjct  274  NNDLEVWAGPLSNNKVAVILWNRSSSKAKVTASWSDIGLKPGTSVKARDLWAHSTQSS-V  332

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                S+++ SH  ++Y+ +P 
Sbjct  333  SGEISSELDSHACKMYVLSPN  353



>ref|XP_007036959.1| Alpha-galactosidase 2 isoform 6 [Theobroma cacao]
 gb|EOY21460.1| Alpha-galactosidase 2 isoform 6 [Theobroma cacao]
Length=278

 Score =   243 bits (619),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 146/201 (73%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            + PA WA  +GNSWR + D+ D W+SM   AD N++WA YAGPGGWNDPDMLEVGNGGMT
Sbjct  82   EHPATWAPDIGNSWRTSGDVRDNWDSMIVRADRNDEWASYAGPGGWNDPDMLEVGNGGMT  141

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWA+ KAPLIIGCD+R M  +T+EILSN +VIAV+QD LGVQG+KV     
Sbjct  142  VEEYRSHFSIWAIAKAPLIIGCDIRTMDNDTYEILSNEDVIAVNQDKLGVQGKKVK---R  198

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS N++ V LWNR S++  +TA W  IGL+ + +V  RDLW H     + 
Sbjct  199  DGHLEVWAGPLSDNKVAVVLWNRGSRNANVTALWSDIGLQPTVAVKARDLWTHS-TEYSL  257

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA+++SH  ++Y+ TP 
Sbjct  258  KGQISAQLESHACKMYVLTPH  278



>ref|NP_001233971.1| alpha-galactosidase precursor [Solanum lycopersicum]
 gb|AAF04591.1|AF191823_1 alpha-galactosidase [Solanum lycopersicum]
Length=409

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 148/202 (73%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            D+PA WA+ VGNSWR T DI D W SMT+ AD+N++WA YAGPGGWNDPDMLEVGNGGM+
Sbjct  212  DNPATWASSVGNSWRTTGDITDDWNSMTSRADLNDQWASYAGPGGWNDPDMLEVGNGGMS  271

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
            + EYR+HFSIWAL+KAPLIIGCD+R+M     +ILSN EVIAV+QD LGVQG+KV   G 
Sbjct  272  FGEYRSHFSIWALVKAPLIIGCDLRSMDNTAHDILSNPEVIAVNQDKLGVQGKKVKQYGD  331

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLSG R+ V LWNR S    ITA+W  IGL+ S  V  RDLW H   +  +
Sbjct  332  ---LEVWAGPLSGKRVAVVLWNRGSYKADITAYWSDIGLDYSTLVDARDLWAHS--TKGS  386

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            VK   SA V+SH   +Y+ TP+
Sbjct  387  VKGQLSASVESHDCSMYVLTPK  408



>ref|XP_010100576.1| hypothetical protein L484_012133 [Morus notabilis]
 gb|EXB82819.1| hypothetical protein L484_012133 [Morus notabilis]
Length=379

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 142/200 (71%), Gaps = 3/200 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA   GN+WR T DI+D+W+S+T+IAD+NN W  YAGPG WNDPDMLEVGNGGM+
Sbjct  182  EDPATWAGRYGNAWRTTGDIKDSWDSITSIADVNNIWGRYAGPGRWNDPDMLEVGNGGMS  241

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWA MKAPL+IGCDVR++  ET  IL N EVI V+QDPLGVQ RK+    +
Sbjct  242  LEEYRSHFSIWAAMKAPLLIGCDVRSVNKETLGILGNKEVIYVNQDPLGVQARKIR---S  298

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +   E+WAGPLS  R+VV  WNR S    I+  W  IGL S   V +RDLW H  +S N 
Sbjct  299  ENGLEIWAGPLSRRRVVVVFWNRASSWTAISVGWREIGLPSLTPVVVRDLWAHSFVSRNM  358

Query  251  VKSFSAKVKSHGSELYIFTP  192
            +   SA V  HG ++YI TP
Sbjct  359  LSRLSANVAPHGCKMYILTP  378



>gb|KHM99768.1| Alpha-galactosidase [Glycine soja]
Length=426

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DIED W+SM + AD+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  230  EDPATWAKSVGNSWRTTGDIEDKWDSMISRADLNDKWASYAGPGGWNDPDMLEVGNGGMT  289

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYRAHFSIW+L KAPL+IGCD+R + A T E+LSN EVIAV+QD LGVQG+KV  +  
Sbjct  290  TEEYRAHFSIWSLAKAPLLIGCDIRALDATTKELLSNKEVIAVNQDKLGVQGKKVKSTND  349

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLS N++ V LWNR S    +TA W  IGL+   SV  RDLW H   S+  
Sbjct  350  ---LEVWAGPLSNNKVAVILWNRSSSKAKVTASWSDIGLKPGTSVEARDLWAHSTQSS-V  405

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA++ SH  ++Y+ TP 
Sbjct  406  SGEISAELDSHACKMYVVTPN  426



>emb|CDY44771.1| BnaC02g01160D [Brassica napus]
Length=394

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 142/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            DDPA WA  +GNSWR T DI+D W+SMT IAD N++WA YA PG WNDPDMLEVGNGGMT
Sbjct  196  DDPATWAGDIGNSWRTTGDIQDNWKSMTTIADQNDRWASYARPGSWNDPDMLEVGNGGMT  255

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M   TFE+LSN EVIAV+QD LG+QG+KV     
Sbjct  256  REEYRSHFSIWALAKAPLLIGCDLRSMDKVTFELLSNKEVIAVNQDKLGIQGKKVK---K  312

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS  R+ V LWNR      ITA W+ IGL  SA V+ RDLW H   S   
Sbjct  313  DGDLEVWAGPLSKKRVAVILWNRGLLPANITARWEDIGLRPSAIVNARDLWAHSTHSG-V  371

Query  251  VKSFSAKVKSHGSELYIFT  195
             K  SA V+ H  ++Y  T
Sbjct  372  KKQLSALVEPHACKMYTLT  390



>ref|XP_009125726.1| PREDICTED: alpha-galactosidase-like [Brassica rapa]
 emb|CDY40751.1| BnaAnng06140D [Brassica napus]
Length=394

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 144/199 (72%), Gaps = 4/199 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI+D W+SMT IAD N++WA YA PG WNDPDMLEVGNGGMT
Sbjct  196  EDPATWAGDIGNSWRTTGDIQDNWKSMTTIADQNDRWASYARPGSWNDPDMLEVGNGGMT  255

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M   TFE+LSN +VIAV+QD LG+QG+KV     
Sbjct  256  REEYRSHFSIWALAKAPLLIGCDLRSMDKVTFELLSNKDVIAVNQDKLGIQGKKVK---K  312

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS  R+ V LWNR S    ITA W+ IGL SSA V+ RDLW H   S   
Sbjct  313  DGDLEVWAGPLSKKRVAVILWNRGSLPANITAGWEDIGLHSSAIVNARDLWAHSTHSG-V  371

Query  251  VKSFSAKVKSHGSELYIFT  195
             K  SA V+ H  ++Y  T
Sbjct  372  KKQLSALVEPHACKMYTLT  390



>gb|AAA73964.1| alpha-galactosidase [Phaseolus vulgaris]
Length=425

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 143/199 (72%), Gaps = 4/199 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DIED WESM + AD+N++WA YAGPGGWNDPDMLEVGNGGMT
Sbjct  229  EDPATWAKSVGNSWRTTGDIEDKWESMISRADLNDEWASYAGPGGWNDPDMLEVGNGGMT  288

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYRAHFSIWAL KAPL+IGCD+R +   T E+LSN EVIAV+QD LGVQG+KV    +
Sbjct  289  TEEYRAHFSIWALAKAPLLIGCDIRALDVTTKELLSNEEVIAVNQDKLGVQGKKVK---S  345

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +   EVWAGPLS NRL V LWNR S    +TA W  IGL+    V  RDLWKH   S+  
Sbjct  346  NNDLEVWAGPLSNNRLAVILWNRSSSKAKVTASWSDIGLKPGTLVDARDLWKHSTQSS-V  404

Query  251  VKSFSAKVKSHGSELYIFT  195
                SA++ SH   +Y+ T
Sbjct  405  SGEISAELDSHACNMYVLT  423



>ref|XP_004982750.1| PREDICTED: alpha-galactosidase-like isoform X2 [Setaria italica]
Length=422

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 146/201 (73%), Gaps = 5/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            ++PA WA  +GNSWR T+DI D W SMT+ AD N++WA YAGPGGWNDPDMLEVGNGGM+
Sbjct  227  ENPATWAGSMGNSWRTTDDIVDNWGSMTSRADQNDRWASYAGPGGWNDPDMLEVGNGGMS  286

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPL+IGCDVR+M+ +T +ILSN EVIAV+QD LGVQG+KV    +
Sbjct  287  EAEYRSHFSIWALAKAPLLIGCDVRSMSQQTKDILSNWEVIAVNQDSLGVQGKKVQ---S  343

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +   EVWAGPLS NR  V LWNR     TITA W  IGL SS +V+ RDLW H   SA  
Sbjct  344  NNGLEVWAGPLSNNRKAVVLWNRQGYQATITAQWSSIGLASSTAVTARDLWAHSSFSAQG  403

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA V  H  ++Y+ TP+
Sbjct  404  --QLSASVAPHDCKMYVLTPK  422



>gb|ABK24922.1| unknown [Picea sitchensis]
Length=396

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 141/199 (71%), Gaps = 3/199 (2%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            +PA WA  + NSWR T DIED WES+T+ AD NN+WA YAGPGGWNDPDMLEVGNG M  
Sbjct  198  NPATWAPKIANSWRTTGDIEDKWESITSRADQNNQWAAYAGPGGWNDPDMLEVGNGNMNI  257

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
            EEYR+HFSIWALMKAPL+IGCD+R+ + +T EIL N EVI V+QDPLGVQG+KVS  G  
Sbjct  258  EEYRSHFSIWALMKAPLLIGCDIRSASPQTLEILGNKEVINVNQDPLGVQGKKVSKQGD-  316

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
               EVWAGPLS  R+ + LWNR      ITA W  IGL S+A V  RDLW H  +  +  
Sbjct  317  --IEVWAGPLSNRRVAIILWNRSGSQAYITARWADIGLPSNALVQARDLWAHRYLPTSLR  374

Query  248  KSFSAKVKSHGSELYIFTP  192
             S ++ V SH  ++YI  P
Sbjct  375  GSLTSTVASHACKMYILNP  393



>ref|XP_006661897.1| PREDICTED: alpha-galactosidase-like [Oryza brachyantha]
Length=357

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/200 (61%), Positives = 144/200 (72%), Gaps = 5/200 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            ++PA WA  +GNSWR T DI D W+SMT+ AD N++WA YAGPGGWNDPDMLEVGNGGM+
Sbjct  162  ENPATWAGRMGNSWRTTGDIADNWDSMTSRADQNDQWAAYAGPGGWNDPDMLEVGNGGMS  221

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPL+IGCDVR+M+ +T +ILSN+EVIAV+QD LGVQG+KV    +
Sbjct  222  EAEYRSHFSIWALAKAPLLIGCDVRSMSQQTKDILSNSEVIAVNQDRLGVQGKKVQ---S  278

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            D   EVWAGPLS NR  + LWNR     TITAHW  IGL  S   + RDLW H   +A  
Sbjct  279  DNGLEVWAGPLSDNRKAIVLWNRQPYQATITAHWSNIGLAPSVVATARDLWAHSSFAAQG  338

Query  251  VKSFSAKVKSHGSELYIFTP  192
                SA V  H  ++YI TP
Sbjct  339  --QISASVAPHDCKMYILTP  356



>ref|XP_002271908.2| PREDICTED: alpha-galactosidase [Vitis vinifera]
 emb|CBI38328.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 142/200 (71%), Gaps = 3/200 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            ++PA WA+ +GN+WR T DI+D W+S+T+IAD NN W  YAGPG WNDPDMLEVGNGGM+
Sbjct  207  ENPATWASSIGNAWRTTGDIKDNWDSITSIADANNIWGRYAGPGRWNDPDMLEVGNGGMS  266

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWALMKAPL+IGCDVR+ + ET  IL N EVI V+QDPLG+QGRK+    +
Sbjct  267  LEEYRSHFSIWALMKAPLLIGCDVRSSSKETLSILGNKEVIDVNQDPLGIQGRKIH---S  323

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLS  R+ V LWNR S    IT  W  IGL  S  V++RDLW H  +S + 
Sbjct  324  KASVEVWAGPLSKRRVAVVLWNRGSSQAPITVGWREIGLSPSNPVTVRDLWTHSFLSRSM  383

Query  251  VKSFSAKVKSHGSELYIFTP  192
                +A V  H  ++YI TP
Sbjct  384  RSRLTAYVAPHACKMYILTP  403



>ref|NP_001235022.1| alpha galactosidase precursor [Glycine max]
 gb|AAA73963.1| alpha galactosidase [Glycine max]
Length=422

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DI+D W+SM + AD+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  226  EDPATWAKSVGNSWRTTGDIQDKWDSMISRADLNDKWASYAGPGGWNDPDMLEVGNGGMT  285

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYRAHFSIW+L KAPL+IGCD+R + A T E+LSN EVIAV+QD LGVQG+KV  +  
Sbjct  286  TEEYRAHFSIWSLAKAPLLIGCDIRALDATTKELLSNKEVIAVNQDKLGVQGKKVKSTND  345

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLS N++ V LWNR S    +TA W  IGL+   SV  RDLW H   S+  
Sbjct  346  ---LEVWAGPLSNNKVAVILWNRSSSKAKVTASWSDIGLKPGTSVEARDLWAHSTQSS-V  401

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA++ SH  ++Y+ TP 
Sbjct  402  SGEISAELDSHACKMYVVTPN  422



>ref|XP_006599670.1| PREDICTED: alpha-galactosidase-like isoform X2 [Glycine max]
Length=406

 Score =   246 bits (628),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DIED WESM + AD+N+KWA  AGPGGWNDPDMLEVGNGGMT
Sbjct  210  EDPATWAKSVGNSWRTTGDIEDKWESMISRADLNDKWASCAGPGGWNDPDMLEVGNGGMT  269

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYRAHFSIWAL KAPL+IGCD+R + A T E+LSN EVIAV+QD LGVQG+KV    +
Sbjct  270  TEEYRAHFSIWALAKAPLLIGCDIRALDATTKELLSNNEVIAVNQDKLGVQGKKVK---S  326

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +   EVWAGPLS N++ V LWNR S    +TA W  IGL+   SV  RDLW H   S+  
Sbjct  327  NNDLEVWAGPLSNNKVAVILWNRSSSKAKVTASWSDIGLKPGTSVKARDLWAHSTQSS-V  385

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                S+++ SH  ++Y+ +P 
Sbjct  386  SGEISSELDSHACKMYVLSPN  406



>ref|XP_011072096.1| PREDICTED: alpha-galactosidase [Sesamum indicum]
Length=410

 Score =   246 bits (628),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 147/201 (73%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DI D+W+SMT+ AD+N+KWA YAGPGGWNDPDMLEVGNGGM 
Sbjct  214  EDPATWAKSVGNSWRTTGDISDSWDSMTSRADLNDKWASYAGPGGWNDPDMLEVGNGGMN  273

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL+KAPL+IGCD+R++  ET  +LSN EVIA++QD LG+QG+K+     
Sbjct  274  GNEYRSHFSIWALVKAPLLIGCDIRSVDKETLGLLSNKEVIAINQDKLGIQGKKIK---K  330

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVW GPLSGNR+ + L NR +   TITA+W  +GL S+  V +RD+W H     + 
Sbjct  331  DGDLEVWGGPLSGNRVAILLLNRGASQATITAYWSDLGLNSTTVVDVRDVWAHS-TQTSV  389

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA V SH  ++Y+ +P+
Sbjct  390  EGQISAAVASHDCKMYVLSPK  410



>gb|EMS47307.1| Alpha-galactosidase [Triticum urartu]
Length=419

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 149/202 (74%), Gaps = 4/202 (2%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPA WA    NSWR TEDI++TWESMT  AD N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  222  VDDPATWAGSFANSWRTTEDIKNTWESMTDNADKNDKWAPYAGPGGWNDPDMLEVGNGGM  281

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEYR+HFSIWAL+KAPLI+GCD+ +M+AET EI++N  VIAV+QD LGVQGRKV    
Sbjct  282  TIEEYRSHFSIWALVKAPLILGCDISSMSAETKEIITNQNVIAVNQDKLGVQGRKVQ---  338

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DG  EVWAG LS  R+ + LWNR   + +ITA W  IGL  SA V   DLW  E ++++
Sbjct  339  QDGDLEVWAGRLSRGRVALVLWNRGPAEASITASWSNIGLNQSAVVDAHDLWTDE-VTSS  397

Query  254  AVKSFSAKVKSHGSELYIFTPQ  189
               + + K+ SH  ++Y+ TP+
Sbjct  398  MQGNLTNKMDSHACKMYVLTPK  419



>ref|XP_003548276.1| PREDICTED: alpha-galactosidase-like isoform X1 [Glycine max]
Length=425

 Score =   246 bits (628),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/201 (60%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DIED WESM + AD+N+KWA  AGPGGWNDPDMLEVGNGGMT
Sbjct  229  EDPATWAKSVGNSWRTTGDIEDKWESMISRADLNDKWASCAGPGGWNDPDMLEVGNGGMT  288

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYRAHFSIWAL KAPL+IGCD+R + A T E+LSN EVIAV+QD LGVQG+KV    +
Sbjct  289  TEEYRAHFSIWALAKAPLLIGCDIRALDATTKELLSNNEVIAVNQDKLGVQGKKVK---S  345

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +   EVWAGPLS N++ V LWNR S    +TA W  IGL+   SV  RDLW H   S+  
Sbjct  346  NNDLEVWAGPLSNNKVAVILWNRSSSKAKVTASWSDIGLKPGTSVKARDLWAHSTQSS-V  404

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                S+++ SH  ++Y+ +P 
Sbjct  405  SGEISSELDSHACKMYVLSPN  425



>ref|XP_009389232.1| PREDICTED: alpha-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=397

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 149/203 (73%), Gaps = 4/203 (2%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPA WA+ +G+SWR TEDI D W+ M ++AD N++WA YA PGGWNDPDMLEVGNGGM
Sbjct  198  VDDPATWASTLGHSWRTTEDIFDKWDRMISLADQNDRWAAYAKPGGWNDPDMLEVGNGGM  257

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEYR+HFSIWAL+KAPL+IGCDVR++T E ++ILSN EVIAV+QD LGVQGRK+ +  
Sbjct  258  TTEEYRSHFSIWALVKAPLLIGCDVRSITKEAYDILSNQEVIAVNQDSLGVQGRKIVLGP  317

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLES-SASVSIRDLWKHEDISA  258
             +   EVWAG LSG R+ V LWNR S   TITA W  IG+ S SA V  RD+W H DI  
Sbjct  318  NN--TEVWAGVLSGGRVAVVLWNRGSSRATITAQWPNIGIVSPSAIVKARDIWAHADI-G  374

Query  257  NAVKSFSAKVKSHGSELYIFTPQ  189
            N     +  V SH  ++YI T Q
Sbjct  375  NLQGQITVTVDSHACKMYILTLQ  397



>ref|XP_009131060.1| PREDICTED: alpha-galactosidase isoform X1 [Brassica rapa]
Length=398

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 143/199 (72%), Gaps = 4/199 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI D W+SMT IAD N++WA YA PG WNDPDMLEVGNGGMT
Sbjct  200  EDPATWAGAIGNSWRTTGDIRDNWQSMTMIADQNDRWASYARPGSWNDPDMLEVGNGGMT  259

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M   T+E+LSN EVI V+QD LG+QG+K+     
Sbjct  260  REEYRSHFSIWALAKAPLLIGCDLRSMDKVTYELLSNKEVIGVNQDKLGIQGKKIK---K  316

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPLS  R+ V LWNR S    ITA W+ IGL+SSA V+ RDLW H   S   
Sbjct  317  EGDLEVWAGPLSMKRVAVILWNRGSSTANITARWEDIGLDSSAIVNARDLWAHSTHSG-V  375

Query  251  VKSFSAKVKSHGSELYIFT  195
             K  SA V+ H  ++Y  T
Sbjct  376  RKQLSALVEPHACKMYTLT  394



>emb|CDX78339.1| BnaA03g02510D [Brassica napus]
Length=369

 Score =   244 bits (623),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 143/199 (72%), Gaps = 4/199 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI D W+SMT IAD N++WA YA PG WNDPDMLEVGNGGMT
Sbjct  171  EDPATWAGAIGNSWRTTGDIRDNWQSMTMIADQNDRWASYARPGSWNDPDMLEVGNGGMT  230

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M   T+E+LSN EVI V+QD LG+QG+K+     
Sbjct  231  REEYRSHFSIWALAKAPLLIGCDLRSMDKVTYELLSNKEVIGVNQDKLGIQGKKIK---K  287

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPLS  R+ V LWNR S    ITA W+ IGL+SSA V+ RDLW H   S   
Sbjct  288  EGDLEVWAGPLSMKRVAVILWNRGSSTANITARWEDIGLDSSAIVNARDLWAHSTHSG-V  346

Query  251  VKSFSAKVKSHGSELYIFT  195
             K  SA V+ H  ++Y  T
Sbjct  347  RKQLSALVEPHACKMYTLT  365



>gb|KEH27104.1| alpha-galactosidase-like protein [Medicago truncatula]
Length=407

 Score =   245 bits (625),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 149/201 (74%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DI+D W  MT+I D+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  209  EDPATWAKSVGNSWRTTGDIKDNWHRMTSIIDVNDKWASYAGPGGWNDPDMLEVGNGGMT  268

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL++GC+++ M   T+E++SN+EVIAV+QD LGVQG+KV    +
Sbjct  269  TEEYRSHFSIWALAKAPLLVGCNIQAMDNITYELISNSEVIAVNQDKLGVQGKKVK---S  325

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +   EVWAGPL+ N++ V LWNR S + T+TA W  IGL+S   V  RDLW+H   S   
Sbjct  326  NNDLEVWAGPLTNNKVAVILWNRSSSNATVTASWLDIGLKSETIVDARDLWEHSTKSL-V  384

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
            +   S ++ SH  ++Y+ TP+
Sbjct  385  LGKISVELDSHACKMYVLTPK  405



>ref|XP_007025711.1| Alpha-galactosidase 2 [Theobroma cacao]
 gb|EOY28333.1| Alpha-galactosidase 2 [Theobroma cacao]
Length=409

 Score =   245 bits (625),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 142/200 (71%), Gaps = 3/200 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            + PA+WA   G+SWR T DI DTW S+T+IAD N+ WA YAGPGGWNDPDMLEVGNGGMT
Sbjct  210  EKPAIWAGAYGHSWRTTGDINDTWASITSIADANDVWARYAGPGGWNDPDMLEVGNGGMT  269

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWALMKAPL++GCDV + + ET  I+ N EVI ++QDPLGVQGRK+   G 
Sbjct  270  VEEYRSHFSIWALMKAPLLLGCDVSSASRETLSIIGNKEVIDINQDPLGVQGRKIRTKGG  329

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                E+WAGPLS  R+VV LWNR      I+  W  IGL  S  V++RD+WKH+ ++   
Sbjct  330  ---LEIWAGPLSRGRVVVVLWNRSRARAPISVGWREIGLSPSRPVTVRDVWKHKFVAMKR  386

Query  251  VKSFSAKVKSHGSELYIFTP  192
                ++ V SH  ++Y+ TP
Sbjct  387  RYRLTSSVASHSCKMYVMTP  406



>ref|XP_009387196.1| PREDICTED: alpha-galactosidase-like, partial [Musa acuminata 
subsp. malaccensis]
Length=210

 Score =   238 bits (607),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 142/202 (70%), Gaps = 3/202 (1%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALWA+ +GNSWR T DI D+WESM + AD N  +AE+A PGGWNDPDMLEVGNGGM+ +
Sbjct  5    PALWADKLGNSWRTTFDINDSWESMVSRADQNEVYAEHARPGGWNDPDMLEVGNGGMSND  64

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFS+WA  KAPLIIGCDVR+MT ET  IL N EVIAV+QDPLGVQ +KV + G   
Sbjct  65   EYIVHFSLWAASKAPLIIGCDVRSMTKETLAILGNEEVIAVNQDPLGVQAKKVRMYGD--  122

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPLS  R VV L NR  +  TITA WD IGL  +  V ++DLWKH  +    V 
Sbjct  123  -SEVWAGPLSRYRTVVILLNRSPEFRTITAQWDDIGLPPNTVVEVKDLWKHVTLEKRFVN  181

Query  245  SFSAKVKSHGSELYIFTPQTVT  180
              +A V  H  ++++ TP T++
Sbjct  182  ELTADVHHHACKMFLLTPLTLS  203



>gb|KCW76293.1| hypothetical protein EUGRSUZ_D00664 [Eucalyptus grandis]
Length=379

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 142/200 (71%), Gaps = 3/200 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            ++PA WA  +GNSWR T DI+D W+S+T+IADINN W  +AGPG WNDPDMLEVGNGGMT
Sbjct  182  ENPAKWAGQLGNSWRTTGDIKDRWDSVTSIADINNIWGRFAGPGRWNDPDMLEVGNGGMT  241

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWA+MKAPL+IGCD+R+ + ET  IL N EVI V+QDPLGVQ RK+     
Sbjct  242  LEEYRSHFSIWAVMKAPLLIGCDIRSASRETLAILRNKEVIDVNQDPLGVQARKLRSKAG  301

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLS  R+V+ LWNR      IT  W  IGL  S +V +RD+WKH  +S + 
Sbjct  302  ---LEVWAGPLSRRRVVIVLWNRSGVRAPITVGWREIGLSPSQAVIVRDVWKHSFVSKSV  358

Query  251  VKSFSAKVKSHGSELYIFTP  192
                +A V  H  ++Y+FTP
Sbjct  359  RFHLTALVAPHACKMYVFTP  378



>ref|XP_010025990.1| PREDICTED: probable alpha-galactosidase A [Eucalyptus grandis]
Length=833

 Score =   254 bits (648),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 150/202 (74%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA+ +GNSWR T DI D W+SM + AD+N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  637  EDPATWASSIGNSWRTTGDISDNWDSMISRADLNDKWASYAGPGGWNDPDMLEVGNGGMT  696

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL+KAPL+IGCDVR+M   T  +LSN EVIAV+QD LGVQG+KV    +
Sbjct  697  TEEYRSHFSIWALVKAPLLIGCDVRSMDKTTIMLLSNKEVIAVNQDRLGVQGKKVK---S  753

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPL+ N++ V LWNR S   T+TA W  IGL S+  V  RDLW H   +  +
Sbjct  754  DGNLEVWAGPLTANKVAVVLWNRGSSRATVTASWSDIGLHSTTVVKARDLWMHS--TKRS  811

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            +K   SA + SH  ++Y+ TPQ
Sbjct  812  IKGQISADIDSHACKMYVVTPQ  833


 Score =   252 bits (644),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 152/204 (75%), Gaps = 6/204 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA+ +GNSWR T+DI D W+SMT+ AD+N+KWA YAGPGGWNDPDMLEVGNG MT
Sbjct  220  EDPATWASSIGNSWRTTDDIFDNWDSMTSRADLNDKWASYAGPGGWNDPDMLEVGNGVMT  279

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL+KAPL+IGCDVR+M   T  +LSN EVIAV+QD LGVQG+KV    +
Sbjct  280  TEEYRSHFSIWALVKAPLLIGCDVRSMDYTTLMLLSNKEVIAVNQDGLGVQGKKVK---S  336

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS N++ V LWNR S   T+TA W  IGL S+  V  RDLW H   +  +
Sbjct  337  DGNLEVWAGPLSTNKVAVVLWNRGSSRATVTASWSDIGLNSTTVVKARDLWMHS--TKRS  394

Query  251  VK-SFSAKVKSHGSELYIFTPQTV  183
            +K   SA + SH  ++Y+ +PQ +
Sbjct  395  IKGQISADIDSHACKMYVLSPQAM  418



>ref|XP_003552322.1| PREDICTED: alpha-galactosidase-like isoform X1 [Glycine max]
 gb|KHN40614.1| Alpha-galactosidase [Glycine soja]
Length=410

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   VGNSWR T DI D+WESM + AD+N  +AEYA PGGWNDPDMLEVGNGGMT  
Sbjct  214  PALWGAKVGNSWRTTNDINDSWESMVSRADMNEVYAEYARPGGWNDPDMLEVGNGGMTKN  273

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFS+WAL KAPL++GCDVRNMT ET EI++N EVI+V+QDPLGVQG+KV +   +G
Sbjct  274  EYIVHFSLWALSKAPLLLGCDVRNMTKETMEIVANKEVISVNQDPLGVQGKKVRM---EG  330

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
             QE+WAGPLSG R+ V L NR     +ITA+WD I +   ++V  RDLW+H+ +    V 
Sbjct  331  DQEIWAGPLSGYRVAVVLLNRGPSKISITANWDDIDIPPKSAVEARDLWEHKTLMRPFVD  390

Query  245  SFSAKVKSHGSELYIFTP  192
              +A V  HG ++Y+  P
Sbjct  391  KLTATVDPHGCKMYVLKP  408



>ref|XP_007023252.1| Alpha-galactosidase 2 [Theobroma cacao]
 gb|EOY25874.1| Alpha-galactosidase 2 [Theobroma cacao]
Length=411

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 143/201 (71%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI+D W+ MT+IAD N+KWA YA PG WNDPDMLEVGNGGMT
Sbjct  215  EDPATWAPSIGNSWRTTGDIKDNWDRMTSIADQNDKWASYAQPGSWNDPDMLEVGNGGMT  274

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIW+L KAPL+IGCD+R+M   TFE+LSN EVIAV+QD LGVQG+KV     
Sbjct  275  TEEYRSHFSIWSLAKAPLLIGCDIRSMDNVTFELLSNKEVIAVNQDKLGVQGKKVK---K  331

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPL+ NR+ V LWNR S    ITA+W  IGL+ S    ++ LW H     + 
Sbjct  332  DGDLEVWAGPLTDNRVAVVLWNRGSSSANITAYWSDIGLKPSTVCDVQHLWAHS-TELSV  390

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA+V +H   +Y  TP+
Sbjct  391  QDQLSAQVDAHACRMYTITPR  411



>ref|NP_001031855.1| alpha-galactosidase 2 [Arabidopsis thaliana]
 dbj|BAH19885.1| AT5G08370 [Arabidopsis thaliana]
 gb|AED91291.1| alpha-galactosidase 2 [Arabidopsis thaliana]
Length=370

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 142/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI+D W+SMT IAD N++WA YA PG WNDPDMLEVGNGGMT
Sbjct  172  EDPATWAGDIGNSWRTTGDIQDNWKSMTLIADQNDRWASYARPGSWNDPDMLEVGNGGMT  231

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEY +HFSIWAL KAPL+IGCD+R+M   TFE+LSN EVIAV+QD LG+QG+KV     
Sbjct  232  KEEYMSHFSIWALAKAPLLIGCDLRSMDKVTFELLSNKEVIAVNQDKLGIQGKKVK---K  288

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPLS  R+ V LWNR S    ITA W  IGL SS  V+ RDLW+H   S   
Sbjct  289  EGDLEVWAGPLSKKRVAVILWNRGSASANITARWAEIGLNSSDIVNARDLWEHSTYSC-V  347

Query  251  VKSFSAKVKSHGSELYIFT  195
             K  SA V+ H  ++Y  T
Sbjct  348  KKQLSALVEPHACKMYTLT  366



>ref|XP_002966697.1| hypothetical protein SELMODRAFT_86208 [Selaginella moellendorffii]
 gb|EFJ32724.1| hypothetical protein SELMODRAFT_86208 [Selaginella moellendorffii]
Length=402

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 143/202 (71%), Gaps = 0/202 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPALWA GVGNSWR T DI+D W+SM   AD N+KWA+YAGPGGWNDPDMLEVGNGGM+
Sbjct  201  EDPALWAPGVGNSWRTTGDIKDNWKSMIVRADQNDKWAKYAGPGGWNDPDMLEVGNGGMS  260

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR HFS+WALMKAPLIIGCDVRN+  E   IL N EVIA++QD +GVQG++VS  GA
Sbjct  261  LEEYRTHFSLWALMKAPLIIGCDVRNLKQEYLNILMNKEVIAINQDSMGVQGKRVSRKGA  320

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
               + VW GPLS  + V  L N+      I A+W+ IG +  +SV +RD+W H+D+   +
Sbjct  321  LEARLVWGGPLSQGKFVALLLNQGDSTAKIRAYWEQIGAKPGSSVQVRDVWAHKDLGVFS  380

Query  251  VKSFSAKVKSHGSELYIFTPQT  186
                   V +H  ++Y+  P++
Sbjct  381  QGYIEEAVDAHAIKMYVVVPKS  402



>ref|XP_009333844.1| PREDICTED: alpha-galactosidase-like isoform X3 [Pyrus x bretschneideri]
Length=404

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 142/200 (71%), Gaps = 3/200 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA   GN+WR T DI+DTWES+T+IAD NN WA YAGPG WNDPDMLEVGNGGM+
Sbjct  208  EDPAKWAGQYGNAWRTTGDIQDTWESITSIADQNNIWATYAGPGKWNDPDMLEVGNGGMS  267

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEY++HFSIWA+MKAPL+IGCD+ + + ET +IL N EVI V+QD LGVQ RK+    +
Sbjct  268  VEEYQSHFSIWAVMKAPLLIGCDIPSASKETLQILGNKEVIDVNQDSLGVQARKLR---S  324

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLSG R+VV LWNR      IT  W+ IGL     V +RDLW H  IS N 
Sbjct  325  RDDLEVWAGPLSGKRVVVVLWNRGGSLAPITVTWEEIGLSPDTPVIVRDLWTHSFISRNM  384

Query  251  VKSFSAKVKSHGSELYIFTP  192
              S +A V SHG  +Y+ TP
Sbjct  385  HTSLTANVASHGCNMYVLTP  404



>ref|XP_007036958.1| Alpha-galactosidase isoform 5 [Theobroma cacao]
 gb|EOY21459.1| Alpha-galactosidase isoform 5 [Theobroma cacao]
Length=393

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 146/201 (73%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            + PA WA  +GNSWR + D+ D W+SM   AD N++WA YAGPGGWNDPDMLEVGNGGMT
Sbjct  197  EHPATWAPDIGNSWRTSGDVRDNWDSMIVRADRNDEWASYAGPGGWNDPDMLEVGNGGMT  256

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWA+ KAPLIIGCD+R M  +T+EILSN +VIAV+QD LGVQG+KV     
Sbjct  257  VEEYRSHFSIWAIAKAPLIIGCDIRTMDNDTYEILSNEDVIAVNQDKLGVQGKKVK---R  313

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS N++ V LWNR S++  +TA W  IGL+ + +V  RDLW H     + 
Sbjct  314  DGHLEVWAGPLSDNKVAVVLWNRGSRNANVTALWSDIGLQPTVAVKARDLWTHS-TEYSL  372

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA+++SH  ++Y+ TP 
Sbjct  373  KGQISAQLESHACKMYVLTPH  393



>ref|NP_568193.1| alpha-galactosidase 2 [Arabidopsis thaliana]
 sp|Q8RX86.1|AGAL2_ARATH RecName: Full=Alpha-galactosidase 2; Short=AtAGAL2; AltName: 
Full=Alpha-D-galactoside galactohydrolase 2; AltName: Full=Melibiase; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAL90902.1| AT5g08370/F8L15_100 [Arabidopsis thaliana]
 gb|AAM62753.1| alpha-galactosidase-like protein [Arabidopsis thaliana]
 gb|AAN18186.1| At5g08370/F8L15_100 [Arabidopsis thaliana]
 gb|AED91290.1| alpha-galactosidase 2 [Arabidopsis thaliana]
Length=396

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 142/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI+D W+SMT IAD N++WA YA PG WNDPDMLEVGNGGMT
Sbjct  198  EDPATWAGDIGNSWRTTGDIQDNWKSMTLIADQNDRWASYARPGSWNDPDMLEVGNGGMT  257

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEY +HFSIWAL KAPL+IGCD+R+M   TFE+LSN EVIAV+QD LG+QG+KV     
Sbjct  258  KEEYMSHFSIWALAKAPLLIGCDLRSMDKVTFELLSNKEVIAVNQDKLGIQGKKVK---K  314

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPLS  R+ V LWNR S    ITA W  IGL SS  V+ RDLW+H   S   
Sbjct  315  EGDLEVWAGPLSKKRVAVILWNRGSASANITARWAEIGLNSSDIVNARDLWEHSTYSC-V  373

Query  251  VKSFSAKVKSHGSELYIFT  195
             K  SA V+ H  ++Y  T
Sbjct  374  KKQLSALVEPHACKMYTLT  392



>gb|KHN05008.1| Alpha-galactosidase [Glycine soja]
Length=402

 Score =   243 bits (620),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 144/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            DPA WA  VGNSWR T DIED W SMT IAD N++W  YAGPGGWNDPDMLEVGNGGMT 
Sbjct  205  DPATWAKTVGNSWRTTGDIEDNWNSMTNIADANDQWVSYAGPGGWNDPDMLEVGNGGMTT  264

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
            EEYRAHFSIWAL KAPL++GCD+R+M   TFE++SN EVIAV+QD  GVQG+KV    ++
Sbjct  265  EEYRAHFSIWALAKAPLLVGCDIRSMDKTTFELISNPEVIAVNQDKEGVQGKKVK---SN  321

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
               EVWAGPL  N++ V LWNR S + T+TA W  IGLE    V  +DLW +     +  
Sbjct  322  NDLEVWAGPLIDNKVAVVLWNRSSSNATVTASWSDIGLEPGTMVDAKDLWANT-TQQSVS  380

Query  248  KSFSAKVKSHGSELYIFTPQT  186
               SA++ SH  ++Y+ TP++
Sbjct  381  GEISAQLDSHACKMYVLTPKS  401



>ref|XP_007036955.1| Alpha-galactosidase isoform 2 [Theobroma cacao]
 gb|EOY21456.1| Alpha-galactosidase isoform 2 [Theobroma cacao]
Length=409

 Score =   243 bits (621),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 146/201 (73%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            + PA WA  +GNSWR + D+ D W+SM   AD N++WA YAGPGGWNDPDMLEVGNGGMT
Sbjct  213  EHPATWAPDIGNSWRTSGDVRDNWDSMIVRADRNDEWASYAGPGGWNDPDMLEVGNGGMT  272

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWA+ KAPLIIGCD+R M  +T+EILSN +VIAV+QD LGVQG+KV     
Sbjct  273  VEEYRSHFSIWAIAKAPLIIGCDIRTMDNDTYEILSNEDVIAVNQDKLGVQGKKVK---R  329

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS N++ V LWNR S++  +TA W  IGL+ + +V  RDLW H     + 
Sbjct  330  DGHLEVWAGPLSDNKVAVVLWNRGSRNANVTALWSDIGLQPTVAVKARDLWTHS-TEYSL  388

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA+++SH  ++Y+ TP 
Sbjct  389  KGQISAQLESHACKMYVLTPH  409



>ref|XP_010252090.1| PREDICTED: alpha-galactosidase isoform X2 [Nelumbo nucifera]
Length=378

 Score =   242 bits (618),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 137/208 (66%), Gaps = 47/208 (23%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VDDPALWA GVGNSWR T+DI D+W SMT IAD+N+KWA YAGPGGWNDPDMLEVGNGGM
Sbjct  217  VDDPALWAGGVGNSWRTTDDINDSWASMTTIADLNDKWAAYAGPGGWNDPDMLEVGNGGM  276

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            TY+EYRAHFSIWALMKAPL+IGCDVRNMTAET EILSN EVIAV+QDPLGVQGRKV   G
Sbjct  277  TYQEYRAHFSIWALMKAPLLIGCDVRNMTAETLEILSNKEVIAVNQDPLGVQGRKVYAEG  336

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             D C++                                               HED+  +
Sbjct  337  KDNCKQ-----------------------------------------------HEDMPED  349

Query  254  AVKSFSAKVKSHGSELYIFTPQTVTSYS  171
            A+ SFS +V SH  ++YIFTPQ    ++
Sbjct  350  ALTSFSTQVDSHDCKMYIFTPQMAYQFA  377



>ref|XP_007036954.1| Alpha-galactosidase isoform 1 [Theobroma cacao]
 gb|EOY21455.1| Alpha-galactosidase isoform 1 [Theobroma cacao]
Length=412

 Score =   243 bits (620),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 146/201 (73%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            + PA WA  +GNSWR + D+ D W+SM   AD N++WA YAGPGGWNDPDMLEVGNGGMT
Sbjct  216  EHPATWAPDIGNSWRTSGDVRDNWDSMIVRADRNDEWASYAGPGGWNDPDMLEVGNGGMT  275

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWA+ KAPLIIGCD+R M  +T+EILSN +VIAV+QD LGVQG+KV     
Sbjct  276  VEEYRSHFSIWAIAKAPLIIGCDIRTMDNDTYEILSNEDVIAVNQDKLGVQGKKVK---R  332

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS N++ V LWNR S++  +TA W  IGL+ + +V  RDLW H     + 
Sbjct  333  DGHLEVWAGPLSDNKVAVVLWNRGSRNANVTALWSDIGLQPTVAVKARDLWTHS-TEYSL  391

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA+++SH  ++Y+ TP 
Sbjct  392  KGQISAQLESHACKMYVLTPH  412



>ref|XP_002525666.1| alpha-galactosidase/alpha-n-acetylgalactosaminidase, putative 
[Ricinus communis]
 gb|EEF36784.1| alpha-galactosidase/alpha-n-acetylgalactosaminidase, putative 
[Ricinus communis]
Length=415

 Score =   243 bits (621),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 149/202 (74%), Gaps = 7/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI D WESM + A  N+KWA YA PGGWNDPDMLEVGNGGMT
Sbjct  217  EDPATWAPSIGNSWRTTGDISDNWESMISRAGENDKWASYARPGGWNDPDMLEVGNGGMT  276

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M+ ET+EILSN EVIAV+QD LGVQG+KV     
Sbjct  277  TEEYRSHFSIWALAKAPLLIGCDIRSMSNETYEILSNKEVIAVNQDKLGVQGKKVK---N  333

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSAS-VSIRDLWKHEDISAN  255
            DG  EVWAGPLS  ++ + LWNR S   T+TA+W  IGL +S + V  RDLW H   + +
Sbjct  334  DGDLEVWAGPLSNRKVAIVLWNRGSSRATVTAYWSDIGLNNSTTMVHARDLWAHS--TQS  391

Query  254  AVKS-FSAKVKSHGSELYIFTP  192
            +VK   SA + SH  ++Y+ TP
Sbjct  392  SVKGHISADLDSHACKMYVLTP  413



>ref|XP_002873354.1| alpha-galactosidase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49613.1| alpha-galactosidase 2 [Arabidopsis lyrata subsp. lyrata]
Length=394

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 142/199 (71%), Gaps = 4/199 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI+D W+SMT IAD N++WA YA PG WNDPDMLEVGNGGMT
Sbjct  196  EDPATWAGDIGNSWRTTGDIQDNWKSMTLIADQNDRWASYARPGSWNDPDMLEVGNGGMT  255

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M   TFE+LSN EVIAV+QD LG+QG+K+     
Sbjct  256  KEEYRSHFSIWALAKAPLLIGCDLRSMDNVTFELLSNKEVIAVNQDKLGIQGKKIK---K  312

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS  R+ V LWNR S    ITA W  IGL SS  V+ RDLW+H   S   
Sbjct  313  DGDLEVWAGPLSKKRVAVILWNRGSVSAKITARWADIGLSSSDIVNARDLWEHSTHS-RV  371

Query  251  VKSFSAKVKSHGSELYIFT  195
                SA V+ H  ++Y  T
Sbjct  372  KNQLSALVEPHACKMYTLT  390



>ref|XP_010491468.1| PREDICTED: alpha-galactosidase-like [Camelina sativa]
Length=395

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 143/199 (72%), Gaps = 4/199 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI+D W SMT IAD N +WA YA PG WNDPDMLEVGNGGMT
Sbjct  197  EDPATWAGDIGNSWRTTGDIQDNWNSMTMIADQNYRWASYARPGSWNDPDMLEVGNGGMT  256

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M   TFE+LSN EVI+V+QD LGVQG+KV     
Sbjct  257  KEEYRSHFSIWALAKAPLLIGCDLRSMDKVTFELLSNKEVISVNQDKLGVQGKKVK---K  313

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPLS  R+ V LWNR S    ITA W  +GL+SSA V+ RDLW H   S+  
Sbjct  314  EGDLEVWAGPLSKKRVAVILWNRGSVPANITARWADLGLDSSAIVNARDLWAHSTYSSIK  373

Query  251  VKSFSAKVKSHGSELYIFT  195
             +  SA V+ H  ++Y  T
Sbjct  374  TQ-LSALVEPHACKMYTLT  391



>ref|XP_003534634.1| PREDICTED: alpha-galactosidase-like [Glycine max]
 gb|KHN29490.1| Alpha-galactosidase [Glycine soja]
Length=410

 Score =   243 bits (619),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 145/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   VGNSWR T DI D+WESM + AD+N  +AEYA PGGWNDPDMLEVGNGGMT  
Sbjct  214  PALWGAKVGNSWRTTNDINDSWESMISRADMNEVYAEYARPGGWNDPDMLEVGNGGMTKN  273

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFS+WAL KAPL++GCDVRN+T ET EI++N EVIAV+QDPLGVQG+KV +   +G
Sbjct  274  EYTVHFSLWALSKAPLLLGCDVRNITKETMEIVANKEVIAVNQDPLGVQGKKVRM---EG  330

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
             +E+WAGPLSG R+ V L NR     +ITA+WD IG+   ++V  RDLW+H+ +    V 
Sbjct  331  DEEIWAGPLSGYRVAVVLLNRGPWKISITANWDDIGIPPKSAVEARDLWEHKTLMRPFVD  390

Query  245  SFSAKVKSHGSELYIFTP  192
              +A V  HG ++Y+  P
Sbjct  391  KLTATVDPHGCKMYVLKP  408



>ref|XP_003555544.1| PREDICTED: alpha-galactosidase-like [Glycine max]
Length=420

 Score =   243 bits (620),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 144/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            DPA WA  VGNSWR T DIED W SMT IAD N++W  YAGPGGWNDPDMLEVGNGGMT 
Sbjct  223  DPATWAKTVGNSWRTTGDIEDNWNSMTNIADANDQWVSYAGPGGWNDPDMLEVGNGGMTT  282

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
            EEYRAHFSIWAL KAPL++GCD+R+M   TFE++SN EVIAV+QD  GVQG+KV    ++
Sbjct  283  EEYRAHFSIWALAKAPLLVGCDIRSMDKTTFELISNPEVIAVNQDKEGVQGKKVK---SN  339

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
               EVWAGPL  N++ V LWNR S + T+TA W  IGLE    V  +DLW +     +  
Sbjct  340  NDLEVWAGPLIDNKVAVVLWNRSSSNATVTASWSDIGLEPGTMVDAKDLWANT-TQQSVS  398

Query  248  KSFSAKVKSHGSELYIFTPQT  186
               SA++ SH  ++Y+ TP++
Sbjct  399  GEISAQLDSHACKMYVLTPKS  419



>ref|XP_010452822.1| PREDICTED: alpha-galactosidase-like [Camelina sativa]
Length=395

 Score =   242 bits (618),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 120/199 (60%), Positives = 145/199 (73%), Gaps = 4/199 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI+D W SMT IAD N++WA YA PG WNDPDMLEVGNGGMT
Sbjct  197  EDPATWAGDIGNSWRTTGDIQDNWNSMTMIADQNDRWASYARPGSWNDPDMLEVGNGGMT  256

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M   TFE+LSN EVI+V+QD LG+QG+KV     
Sbjct  257  KEEYRSHFSIWALAKAPLLIGCDLRSMDKVTFELLSNKEVISVNQDKLGIQGKKVK---K  313

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPLS  R+ V LWNR S    ITA W  +GL+SSA V+ RDLW    +S+  
Sbjct  314  EGDLEVWAGPLSKKRVAVILWNRGSVPANITARWADLGLDSSAIVNARDLWARLTLSSIK  373

Query  251  VKSFSAKVKSHGSELYIFT  195
             +  SA V+ H S++Y  T
Sbjct  374  TQ-LSALVEPHASKMYTLT  391



>ref|XP_004959332.1| PREDICTED: alpha-galactosidase-like [Setaria italica]
Length=399

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/202 (60%), Positives = 146/202 (72%), Gaps = 5/202 (2%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            +D PA WA GVGNSWR   DI+D W SMT+ AD N+ WA +AGPGGWNDPDMLEVGNGGM
Sbjct  203  IDRPATWA-GVGNSWRTAGDIKDEWGSMTSNADSNDVWAPFAGPGGWNDPDMLEVGNGGM  261

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEYR+HFSIWAL KAPL+ GCD+R+M+ ET EILSN  VIAV+QD LGVQG KV    
Sbjct  262  TTEEYRSHFSIWALAKAPLLTGCDIRSMSKETMEILSNRNVIAVNQDALGVQGHKVQ---  318

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             DG QEVWAGPLSG R+ V LWNR   + +ITA W  IGL +SA V   DLW  + ++++
Sbjct  319  KDGDQEVWAGPLSGGRVAVVLWNRGPAEASITASWSSIGLRASAVVDAHDLWT-DAVTSS  377

Query  254  AVKSFSAKVKSHGSELYIFTPQ  189
                  A V +H  ++Y+ TP+
Sbjct  378  VQGQLKATVGTHACKMYVLTPK  399



>ref|XP_002962916.1| hypothetical protein SELMODRAFT_78263 [Selaginella moellendorffii]
 gb|EFJ36379.1| hypothetical protein SELMODRAFT_78263 [Selaginella moellendorffii]
Length=401

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/205 (55%), Positives = 141/205 (69%), Gaps = 0/205 (0%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            D PALWA    NSWR + D++D W+ +  +AD NN WA YAGPGGWNDPDML+VGNG M+
Sbjct  186  DHPALWAGKYANSWRTSLDVKDRWDRIQILADDNNMWAAYAGPGGWNDPDMLQVGNGRMS  245

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIW++MKAPLIIGC++R +  E  EI  N E+I ++QDPLG+Q RKVS  G 
Sbjct  246  VAEYRSHFSIWSIMKAPLIIGCELRKIREEHLEIYKNKEIIDINQDPLGIQARKVSRQGR  305

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
              C+EVWAGPLSG R+V+ALWNR  +   I  +W  +GLE   SV +RDLWKHED S   
Sbjct  306  CKCREVWAGPLSGKRIVLALWNRDWRRVAIKVNWFDLGLEPGVSVCVRDLWKHEDWSERQ  365

Query  251  VKSFSAKVKSHGSELYIFTPQTVTS  177
               F   + SH   +YI +   +TS
Sbjct  366  QDGFEVAIDSHDCGVYILSDVRLTS  390



>emb|CDP16885.1| unnamed protein product [Coffea canephora]
Length=436

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 142/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   +GNSWR T DI DTW+SM + AD N  +AEYA PGGWNDPDMLEVGNGGMT  
Sbjct  239  PALWGGNLGNSWRTTNDISDTWDSMVSRADENEVYAEYARPGGWNDPDMLEVGNGGMTKN  298

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL+IGCDV N+T ET EIL N EVIAV+QD  GVQ +KV + G   
Sbjct  299  EYIVHFSIWAISKAPLLIGCDVNNITKETMEILGNEEVIAVNQDKFGVQAKKVRMLGD--  356

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPLS  R+ V L NR ++ ++ITAHW+ IGL     V++RDLW+H+ +    V 
Sbjct  357  -LEVWAGPLSDYRVAVLLVNRSTRRDSITAHWEDIGLPLKTVVTVRDLWQHKTLKKKFVG  415

Query  245  SFSAKVKSHGSELYIFTP  192
            S +A V  H S++YIFTP
Sbjct  416  SLTATVDYHASKMYIFTP  433



>ref|NP_001267530.1| alpha-galactosidase-like precursor [Cucumis sativus]
 gb|ABC88435.1| acid alpha galactosidase 2 [Cucumis sativus]
 gb|KGN51578.1| hypothetical protein Csa_5G580630 [Cucumis sativus]
Length=421

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 146/202 (72%), Gaps = 7/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DI+D W SMT IAD N+KWA YA PGGWNDPDMLEVGNGGMT
Sbjct  226  EDPATWAVNVGNSWRTTSDIQDNWISMTTIADQNDKWASYAKPGGWNDPDMLEVGNGGMT  285

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPL+IGCD+R+M   T ++LSN EVIAV+QD LGVQG+KV   G 
Sbjct  286  IAEYRSHFSIWALAKAPLLIGCDIRSMDNNTMKLLSNKEVIAVNQDKLGVQGKKVHKYGD  345

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAG LSG R+ V LWNR      ITA+W  IGL SS +V+ RDLW+H   S+  
Sbjct  346  ---LEVWAGLLSGKRVAVVLWNRSLWRANITAYWSDIGLSSSTTVTARDLWEH---SSQV  399

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            V+   +A+V SH  ++++ TP 
Sbjct  400  VRHHLTAQVDSHDCKMFVLTPH  421



>ref|XP_012068620.1| PREDICTED: alpha-galactosidase [Jatropha curcas]
Length=423

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 144/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI + WESM + AD N++WA +AGPGGWNDPDMLEVGNGGMT
Sbjct  217  EDPATWAADIGNSWRTTGDISNNWESMISRADSNDQWASHAGPGGWNDPDMLEVGNGGMT  276

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M+ ET+EILSN EVIAV+QD LGVQG+KV V   
Sbjct  277  IEEYRSHFSIWALAKAPLLIGCDIRSMSNETYEILSNKEVIAVNQDKLGVQGKKVKV---  333

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS  ++ V LWNR     T+TA+W  I L+ +     RDLW H     + 
Sbjct  334  DGNLEVWAGPLSDRKVAVVLWNRGGSKATVTANWSDIDLKPTTIADARDLWAHS-TQTSV  392

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA + SH  ++Y+ TP 
Sbjct  393  EGQISADLDSHACKMYVLTPH  413



>ref|XP_008355996.1| PREDICTED: alpha-galactosidase-like isoform X2 [Malus domestica]
Length=404

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 142/200 (71%), Gaps = 3/200 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA   GN+WR T DIEDTWES+T+IAD NN WA YAGPG WNDPDMLEVGNGGM+
Sbjct  208  EDPATWAGQYGNAWRTTGDIEDTWESITSIADQNNIWATYAGPGKWNDPDMLEVGNGGMS  267

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             +EY++HFSIWA+MKAPL+IGCD+ + + ET +IL N EVI V+QDPLGVQ RK+    +
Sbjct  268  VQEYQSHFSIWAVMKAPLLIGCDIPSASKETLQILGNKEVIDVNQDPLGVQARKLR---S  324

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLS  R+VV LWNR      IT  W  +GL  +  V++RDLW H  +S   
Sbjct  325  KDDLEVWAGPLSNKRVVVVLWNRGRSLAPITVTWKEVGLSPNTPVTVRDLWAHSFVSRRM  384

Query  251  VKSFSAKVKSHGSELYIFTP  192
            +   +A V  HG ++Y+ TP
Sbjct  385  LTGLTANVAPHGCKMYVLTP  404



>gb|KDP46474.1| hypothetical protein JCGZ_08446 [Jatropha curcas]
Length=418

 Score =   242 bits (618),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 144/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI + WESM + AD N++WA +AGPGGWNDPDMLEVGNGGMT
Sbjct  212  EDPATWAADIGNSWRTTGDISNNWESMISRADSNDQWASHAGPGGWNDPDMLEVGNGGMT  271

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M+ ET+EILSN EVIAV+QD LGVQG+KV V   
Sbjct  272  IEEYRSHFSIWALAKAPLLIGCDIRSMSNETYEILSNKEVIAVNQDKLGVQGKKVKV---  328

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS  ++ V LWNR     T+TA+W  I L+ +     RDLW H     + 
Sbjct  329  DGNLEVWAGPLSDRKVAVVLWNRGGSKATVTANWSDIDLKPTTIADARDLWAHS-TQTSV  387

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA + SH  ++Y+ TP 
Sbjct  388  EGQISADLDSHACKMYVLTPH  408



>tpg|DAA49502.1| TPA: hypothetical protein ZEAMMB73_583660 [Zea mays]
 tpg|DAA49503.1| TPA: hypothetical protein ZEAMMB73_583660 [Zea mays]
Length=224

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 136/200 (68%), Gaps = 4/200 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PA W    GNSWR T DI DTW+SM A AD N  W+EYA PGGWNDPDMLEVGNGGMT  
Sbjct  24   PATWGATYGNSWRTTNDIADTWDSMIATADQNEVWSEYARPGGWNDPDMLEVGNGGMTNS  83

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFS+WA+ KAPLIIGCDVR+M+ ET+ IL+N EVIAV+QDPLGVQG+KV +   +G
Sbjct  84   EYVVHFSLWAISKAPLIIGCDVRHMSRETYAILANKEVIAVNQDPLGVQGKKVRM---EG  140

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDE-TITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
              E+WA PLS  R  V L NR +KDE TI AHWD IGL +   V  RDLW HE + A   
Sbjct  141  SSEIWAAPLSEYRTAVLLLNRHAKDEATIAAHWDDIGLPAGTPVEARDLWLHETLDATFT  200

Query  248  KSFSAKVKSHGSELYIFTPQ  189
               S  V  H   + +  P+
Sbjct  201  DKMSFDVAPHSCRMLVLKPR  220



>gb|AHG94610.1| alpha galactosidase [Camellia sinensis]
Length=417

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/202 (60%), Positives = 144/202 (71%), Gaps = 6/202 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI D W SMT+ AD N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  221  EDPATWAPAIGNSWRTTGDISDNWNSMTSRADQNDKWASYAGPGGWNDPDMLEVGNGGMT  280

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPL+IGCD+R +   T  +LSN EVIAV+QD LGVQG+KV     
Sbjct  281  IAEYRSHFSIWALAKAPLLIGCDIRAIDNVTLGLLSNNEVIAVNQDKLGVQGKKVK---K  337

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPL+  ++ V LWNR     TITAHW  IGL  +  V+ RDLW+H   +  +
Sbjct  338  DGDLEVWAGPLNHKKVAVILWNRGPSTATITAHWFDIGLTRTTIVNARDLWEHS--TKKS  395

Query  251  VK-SFSAKVKSHGSELYIFTPQ  189
            VK   SA V SH  ++Y+ TPQ
Sbjct  396  VKGQLSADVASHDCKMYVLTPQ  417



>gb|KJB79780.1| hypothetical protein B456_013G066400 [Gossypium raimondii]
Length=413

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 140/202 (69%), Gaps = 4/202 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DIED W+SMT IAD N++WA YA PG WNDPDMLEVGNGGMT
Sbjct  211  EDPATWAPSIGNSWRTTGDIEDNWDSMTGIADQNDQWASYAKPGAWNDPDMLEVGNGGMT  270

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR HFSIWAL KAPL+IGCDVR+M   TFE+++N EVI V+QD LGVQG+KV     
Sbjct  271  TEEYRCHFSIWALAKAPLLIGCDVRSMDNVTFELVANKEVIDVNQDKLGVQGKKVK---K  327

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPL+ N + V LWNR S    ITA+W  IGL+ S  V  RDLW H       
Sbjct  328  EGDLEVWAGPLANNMVAVVLWNRGSSSANITAYWSDIGLKPSTVVDCRDLWAHS-TETGV  386

Query  251  VKSFSAKVKSHGSELYIFTPQT  186
                SA+V SH  ++Y   P T
Sbjct  387  EDEISAEVDSHACKMYTLKPHT  408



>ref|XP_008445911.1| PREDICTED: alpha-galactosidase [Cucumis melo]
Length=419

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/201 (61%), Positives = 143/201 (71%), Gaps = 5/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DI+D W SMT IAD N+KWA YA PGGWNDPDMLEVGNGGMT
Sbjct  224  EDPATWAVNVGNSWRTTSDIQDNWISMTTIADQNDKWASYAKPGGWNDPDMLEVGNGGMT  283

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
              EYR+HFSIWAL KAPL+IGCD+R+M   T ++LSN EVIAV+QD LGVQG+KV   G 
Sbjct  284  TAEYRSHFSIWALAKAPLLIGCDIRSMDNITMKLLSNKEVIAVNQDKLGVQGKKVYKYGD  343

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLSG R+ V LWNR      ITA W  IGL SS +V+ RDLW+H   S   
Sbjct  344  ---LEVWAGPLSGKRVAVVLWNRGLWRANITASWSDIGLCSSTTVTARDLWQHS--SQVV  398

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                +A+V SH  ++++ TP 
Sbjct  399  QHHLTAQVDSHDCKMFVLTPH  419



>gb|ACU23822.1| unknown [Glycine max]
Length=426

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 120/201 (60%), Positives = 144/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  VGNSWR T DI+D W+SM + AD+N+KWA YAG GGWNDPDMLEVGNGGMT
Sbjct  230  EDPATWAKSVGNSWRTTGDIQDKWDSMISRADLNDKWAFYAGLGGWNDPDMLEVGNGGMT  289

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYRAHFSIW+L KAPL+IGCD+R + A T E+LSN EVIAV+QD LGVQG+KV  +  
Sbjct  290  TEEYRAHFSIWSLAKAPLLIGCDIRALDATTKELLSNKEVIAVNQDKLGVQGKKVKSTND  349

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLS N++ V LWNR S    +TA W  IGL+   SV  RDLW H   S+  
Sbjct  350  ---LEVWAGPLSNNKVAVILWNRSSSKAKVTASWSDIGLKPGTSVEARDLWAHSTQSS-V  405

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                SA++ SH  ++Y+ TP 
Sbjct  406  SGEISAELDSHACKMYVVTPN  426



>ref|XP_002459948.1| hypothetical protein SORBIDRAFT_02g018580 [Sorghum bicolor]
 gb|EER96469.1| hypothetical protein SORBIDRAFT_02g018580 [Sorghum bicolor]
Length=307

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 144/202 (71%), Gaps = 4/202 (2%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            V +PA WA+ +GNSWR   DI+D W SM + AD N+ WA+YAGPGGWNDPDMLE+GNGGM
Sbjct  110  VGNPATWASSLGNSWRTAGDIKDNWGSMASNADSNDYWAKYAGPGGWNDPDMLEIGNGGM  169

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEYR+HFSIWAL KAPL+ GCD+R+M+ +T +ILSN  VIAV+QD LGVQG KV    
Sbjct  170  TTEEYRSHFSIWALAKAPLLTGCDIRSMSKDTKDILSNQNVIAVNQDALGVQGLKVQ---  226

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             +G QEVWAGPLSG R+ V LWNR     +ITA W  IGL +SA V   DLW  E  S+ 
Sbjct  227  KNGDQEVWAGPLSGGRVAVVLWNRGPTQASITASWSSIGLSTSAVVDAHDLWTGEATSS-  285

Query  254  AVKSFSAKVKSHGSELYIFTPQ  189
                  A V++H  ++Y+ TP+
Sbjct  286  VQGELKATVETHACKMYVLTPK  307



>ref|XP_010104940.1| hypothetical protein L484_004288 [Morus notabilis]
 gb|EXC02507.1| hypothetical protein L484_004288 [Morus notabilis]
Length=380

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 145/208 (70%), Gaps = 11/208 (5%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWE-------SMTAIADINNKWAEYAGPGGWNDPDMLE  633
            +DPA WA  +GNSWR T DI D WE       SMT+ AD N+KWA YA PGGWNDPDMLE
Sbjct  177  EDPATWAPKIGNSWRTTGDIVDNWERRVFGQYSMTSRADENDKWASYAAPGGWNDPDMLE  236

Query  632  VGNGGMTYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGR  453
            VGNGGMT EEYRAHFSIWAL KAPL+IGCD+R M   TF +L+NT+VIAV+QD LGVQG+
Sbjct  237  VGNGGMTIEEYRAHFSIWALSKAPLLIGCDIRAMDNITFSLLTNTDVIAVNQDKLGVQGK  296

Query  452  KVSVSGADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKH  273
            KV     DG  EVWAGPLS NR  V LWNR     T+TA+W  IGL  +  V+  DLW H
Sbjct  297  KVK---KDGDLEVWAGPLSNNRKAVVLWNRSPSTATLTAYWSDIGLNPTNVVNAHDLWTH  353

Query  272  EDISANAVKSFSAKVKSHGSELYIFTPQ  189
               SA   K  SAK++SH  ++Y+ T Q
Sbjct  354  WTQSAVKEK-LSAKIESHACKMYVLTLQ  380



>ref|XP_002519009.1| alpha-galactosidase/alpha-n-acetylgalactosaminidase, putative 
[Ricinus communis]
 gb|EEF43220.1| alpha-galactosidase/alpha-n-acetylgalactosaminidase, putative 
[Ricinus communis]
Length=403

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 140/200 (70%), Gaps = 3/200 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA   GN+WR T DI+D WES+T++AD NN W  YAGPG WNDPDMLEVGNGGM+
Sbjct  206  EDPAKWAGRYGNAWRTTGDIKDNWESVTSLADENNIWGRYAGPGRWNDPDMLEVGNGGMS  265

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWALMKAPL+IGCDVR+ + +T  IL N EVI V+QDPLG+QGRK+  SGA
Sbjct  266  LEEYRSHFSIWALMKAPLLIGCDVRSASKQTLRILGNKEVIDVNQDPLGIQGRKIR-SGA  324

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                E+WAGPLS  R+V+ LWNR      I+  W  +GL     V+IRDLW H  IS   
Sbjct  325  G--LEIWAGPLSRKRIVILLWNRSGSKAPISVGWREVGLSPITPVNIRDLWAHSFISMRK  382

Query  251  VKSFSAKVKSHGSELYIFTP  192
                +A V  H  ++YI TP
Sbjct  383  RFGLTAYVAPHACKMYILTP  402



>ref|XP_009415706.1| PREDICTED: alpha-galactosidase-like [Musa acuminata subsp. malaccensis]
Length=603

 Score =   246 bits (627),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/202 (59%), Positives = 142/202 (70%), Gaps = 3/202 (1%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALWAN +GNSWR T DI D+WESM + AD N  +AE+A PGGWNDPDMLEVGNGGM+ +
Sbjct  203  PALWANKLGNSWRTTFDINDSWESMVSRADQNEVYAEHARPGGWNDPDMLEVGNGGMSND  262

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFS+WA  KAPLIIGCDVR+MT ET  IL N EVIAV+QDPLGVQ +KV + G   
Sbjct  263  EYIVHFSLWAASKAPLIIGCDVRSMTKETLAILGNEEVIAVNQDPLGVQAKKVRMYGDS-  321

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPLSG R VV L NR  +  TITA WD IGL  +  V +RDLWKH  +    V 
Sbjct  322  --EVWAGPLSGYRTVVVLLNRSPEFRTITAQWDDIGLPPNTVVEVRDLWKHATLEKRFVN  379

Query  245  SFSAKVKSHGSELYIFTPQTVT  180
               A V  H  ++++ TP T++
Sbjct  380  ELRAGVHHHACKMFLLTPLTLS  401



>ref|XP_008221112.1| PREDICTED: alpha-galactosidase-like [Prunus mume]
Length=423

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 148/198 (75%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   VGNSWR T+DI DTWESM + AD+N  +AE+A PGGWNDPDMLEVGNGGMT +
Sbjct  227  PALWGAKVGNSWRTTKDISDTWESMVSRADMNEVYAEFARPGGWNDPDMLEVGNGGMTKD  286

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL++GCDVRN+T ET EI++N EVI+V+QDPLGVQ +KV +   +G
Sbjct  287  EYVVHFSIWAISKAPLLLGCDVRNITKETMEIVANKEVISVNQDPLGVQAKKVRM---EG  343

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPLSG R+ + L N+     +ITA+WD +G+ +++ V  RDLW+H+ + A  V 
Sbjct  344  DLEVWAGPLSGYRVALLLVNQGPSRTSITANWDDVGIPTNSVVEARDLWEHKTLKARFVG  403

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SH  ++Y+  P
Sbjct  404  NLTATVGSHACKMYVLKP  421



>ref|XP_006399328.1| hypothetical protein EUTSA_v10013749mg [Eutrema salsugineum]
 gb|ESQ40781.1| hypothetical protein EUTSA_v10013749mg [Eutrema salsugineum]
Length=394

 Score =   240 bits (612),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 141/201 (70%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI+D W+SMT IAD N++WA YA PG WNDPDML  GNGGMT
Sbjct  196  EDPATWAGDIGNSWRTTGDIQDNWKSMTTIADQNDRWASYARPGSWNDPDMLRSGNGGMT  255

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M   TFE+LSN EV+AV+QD LG+QG+K+     
Sbjct  256  REEYRSHFSIWALAKAPLLIGCDLRSMDKVTFELLSNKEVVAVNQDKLGIQGKKIK---K  312

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS  R+ V LWNR      IT  W  IGLESSA V+ RDLW H   S   
Sbjct  313  DGDLEVWAGPLSKKRVAVILWNRGLLAANITVRWAEIGLESSAIVNARDLWAHSTHSG-V  371

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
             +  SA V+ H  ++Y  T +
Sbjct  372  KRQLSALVEPHACKMYTLTRR  392



>ref|XP_008221110.1| PREDICTED: alpha-galactosidase-like [Prunus mume]
 ref|XP_008221111.1| PREDICTED: alpha-galactosidase-like [Prunus mume]
Length=423

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 148/198 (75%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   VGNSWR T+DI DTWESM + AD+N  +AE+A PGGWNDPDMLEVGNGGMT +
Sbjct  227  PALWGAKVGNSWRTTKDISDTWESMVSRADMNEVYAEFARPGGWNDPDMLEVGNGGMTKD  286

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL++GCDVRN+T ET EI++N EVI+V+QDPLGVQ +KV +   +G
Sbjct  287  EYVVHFSIWAISKAPLLLGCDVRNITKETMEIVANKEVISVNQDPLGVQAKKVRM---EG  343

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPLSG R+ + L N+     +ITA+WD +G+ +++ V  RDLW+H+ + A  V 
Sbjct  344  DLEVWAGPLSGYRVALLLVNQGPSRTSITANWDDVGIPTNSVVEARDLWEHKTLKARFVG  403

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SH  ++Y+  P
Sbjct  404  NLTATVGSHACKMYVLKP  421



>ref|XP_007222449.1| hypothetical protein PRUPE_ppa006179mg [Prunus persica]
 gb|EMJ23648.1| hypothetical protein PRUPE_ppa006179mg [Prunus persica]
Length=423

 Score =   241 bits (614),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 149/198 (75%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   VGNSWR T+DI DTWESM + AD+N  +AE+A PGGWNDPDMLEVGNGGMT +
Sbjct  227  PALWGAKVGNSWRTTKDISDTWESMVSRADMNEIYAEFARPGGWNDPDMLEVGNGGMTKD  286

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL++GCDVRN+T ET EI++N EVI+V+QDPLGVQ +KV +   +G
Sbjct  287  EYVVHFSIWAISKAPLLLGCDVRNITKETMEIVANKEVISVNQDPLGVQAKKVRM---EG  343

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPLSG R+ + L N+     +ITA+WD +G+ +++ V  RDLW+H+ ++A  V 
Sbjct  344  DLEVWAGPLSGYRVALLLVNQGPSRTSITANWDDVGIPTNSVVEARDLWEHKTLNARFVG  403

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SH  ++Y+  P
Sbjct  404  NLTATVGSHACKMYVLKP  421



>ref|XP_010423102.1| PREDICTED: LOW QUALITY PROTEIN: alpha-galactosidase-like [Camelina 
sativa]
Length=366

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 119/199 (60%), Positives = 145/199 (73%), Gaps = 4/199 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DI+D W +MT IAD N++WA YA PG WNDPDMLEVGNGGMT
Sbjct  168  EDPATWAGDIGNSWRTTGDIQDNWNNMTMIADQNDRWASYARPGSWNDPDMLEVGNGGMT  227

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R+M   TFE+LSN EVI+V+QD LG+QG+KV     
Sbjct  228  KEEYRSHFSIWALAKAPLLIGCDLRSMDKVTFELLSNKEVISVNQDKLGIQGKKVK---K  284

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +G  EVWAGPLS  R+ V LWNR S    ITA W  +GL+SSA V+ RDLW H  +S+  
Sbjct  285  EGDLEVWAGPLSKKRVAVILWNRGSVPANITARWADLGLDSSAIVNSRDLWAHMTLSSIK  344

Query  251  VKSFSAKVKSHGSELYIFT  195
             +  SA V+    ++YI T
Sbjct  345  TQ-LSALVEPDACKMYILT  362



>ref|XP_004512699.1| PREDICTED: alpha-galactosidase-like isoform X2 [Cicer arietinum]
Length=423

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 145/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA W   VGNSWR T DIED W+SM + AD N+KWA YAGPGGWNDPDMLEVGNGGMT
Sbjct  227  EDPATWGKSVGNSWRTTGDIEDKWDSMISRADQNDKWASYAGPGGWNDPDMLEVGNGGMT  286

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWAL KAPL+IGCD+R +   T ++LSN EVIAV+QD LGVQG+KV    +
Sbjct  287  TEEYRSHFSIWALAKAPLLIGCDIRALDNITKKLLSNFEVIAVNQDKLGVQGKKVK---S  343

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            +   EVWAGPLS N+L V LWNR S   T+TA W  +GL+   SV  RDLW+H   S+  
Sbjct  344  NDDLEVWAGPLSYNKLAVVLWNRSSSKATVTASWSDLGLKPGTSVDARDLWEHSTQSS-V  402

Query  251  VKSFSAKVKSHGSELYIFTPQ  189
                S+++ SH  ++Y+ +P 
Sbjct  403  SGDISSELDSHACKMYVLSPN  423



>ref|XP_006848641.2| PREDICTED: alpha-galactosidase [Amborella trichopoda]
Length=420

 Score =   240 bits (613),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/198 (60%), Positives = 141/198 (71%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   VGNSWR T DI DTW+SM +  D+N+ WA YA  GGWNDPDMLEVGNGGMT  
Sbjct  223  PALWGAAVGNSWRTTNDIADTWDSMISRVDMNDVWAPYARFGGWNDPDMLEVGNGGMTKN  282

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY AHFS+WAL+KAPL+IGCDVR+   ET EI+ N EVIAV+QD LGVQG KV +   +G
Sbjct  283  EYIAHFSLWALVKAPLLIGCDVRSANNETLEIIGNEEVIAVNQDLLGVQGTKVRM---EG  339

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
             QE+WAGPL G R+ V L NR  +D  I A WD IGL S+A+  +RDLWKH+ +     K
Sbjct  340  DQEIWAGPLWGGRVAVVLLNRGPRDYEIIAEWDDIGLPSTATAKVRDLWKHKTLKKTFHK  399

Query  245  SFSAKVKSHGSELYIFTP  192
              +A VK H  ++YI TP
Sbjct  400  RLTATVKPHSCKMYILTP  417



>ref|XP_007043147.1| Alpha-galactosidase 2 [Theobroma cacao]
 gb|EOX98978.1| Alpha-galactosidase 2 [Theobroma cacao]
Length=664

 Score =   246 bits (629),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 145/197 (74%), Gaps = 5/197 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA  +GNSWR T DIED WESMT+IAD N+KWA YA PG WNDPDMLEVGNGGMT
Sbjct  220  EDPATWAPNIGNSWRTTGDIEDKWESMTSIADQNDKWASYAQPGAWNDPDMLEVGNGGMT  279

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR HFSIWAL KAPL+IGCDVR+M   TFE+LSN EVIAV+QD LGVQG+KV     
Sbjct  280  TEEYRCHFSIWALAKAPLLIGCDVRSMDNVTFELLSNKEVIAVNQDKLGVQGKKVK---K  336

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISA--  258
            DG  EVWAGPL+ +++ V LWNR S    ITA+W  IGL+ S  V  RDLW +E  S   
Sbjct  337  DGDLEVWAGPLTNHKVAVVLWNRGSSLANITAYWSDIGLKPSTIVDARDLWANEQHSTER  396

Query  257  NAVKSFSAKVKSHGSEL  207
            +A K  SA+V SH  ++
Sbjct  397  SAQKQISAEVDSHACKI  413


 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 90/154 (58%), Gaps = 32/154 (21%)
 Frame = -2

Query  650  DPDMLEVGNGGMTYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDP  471
            D DMLEVGNGGM+ EEYR+HFS WAL+KAP I+GCD R+M  +TFE+LSN EVIAV+QD 
Sbjct  543  DLDMLEVGNGGMSTEEYRSHFSSWALVKAPRILGCDTRSMDNDTFELLSNNEVIAVNQDE  602

Query  470  LGVQGRKVSVSGADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSI  291
            LGVQG+KV   G     EVWA  ++    ++ L                + LE+    S+
Sbjct  603  LGVQGKKVRKIGD---LEVWADGMTLGSTLLQL----------------LMLETYGRHSV  643

Query  290  RDLWKHEDISANAVKSFSAKVKSHGSELYIFTPQ  189
            R          N +K   A + SH  ++Y+ TPQ
Sbjct  644  R----------NQIK---ATLVSHACKMYVLTPQ  664



>ref|XP_004297698.2| PREDICTED: alpha-galactosidase 1 [Fragaria vesca subsp. vesca]
Length=417

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 145/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   VGNSWR T DI DTWESM + AD+N  +AE+A PGGWNDPDMLEVGNGGMT +
Sbjct  221  PALWGAKVGNSWRTTNDISDTWESMISRADMNEVYAEFARPGGWNDPDMLEVGNGGMTKD  280

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL+IGCDVRNMT ET EI++N EVI+V+QDPLGVQ +KV +   +G
Sbjct  281  EYVVHFSIWAISKAPLLIGCDVRNMTKETMEIIANEEVISVNQDPLGVQAKKVRM---EG  337

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPLSG R+ + L NR S   +IT +WD IG+  ++ V  RDLW+H+ +    V 
Sbjct  338  DLEVWAGPLSGYRVALLLVNRGSWRTSITGYWDDIGIPPNSVVEARDLWEHKTLKKRFVG  397

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A + SH  ++Y+  P
Sbjct  398  NLTATMDSHACKMYVLKP  415



>ref|XP_010248383.1| PREDICTED: alpha-galactosidase-like [Nelumbo nucifera]
Length=407

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/198 (59%), Positives = 140/198 (71%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   VGNSWR T DI D WESM + AD+N  +A+ A PGGWNDPDMLEVGNGGMT +
Sbjct  211  PALWGAKVGNSWRTTGDITDNWESMMSRADMNEVYADLARPGGWNDPDMLEVGNGGMTKD  270

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL+IGCDVRN + ET EI+SN EVIAV+QDPLGVQ +KV + G   
Sbjct  271  EYIVHFSIWAISKAPLLIGCDVRNASKETMEIISNKEVIAVNQDPLGVQAKKVRMEGD--  328

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
             QEVWAGPLSG+R VV L NR      +TAHWD IG+  +  V  RDLW+HE +    V 
Sbjct  329  -QEVWAGPLSGHRTVVLLVNRGPWKYPVTAHWDDIGIPPNTVVEARDLWEHETLKTRFVG  387

Query  245  SFSAKVKSHGSELYIFTP  192
              +  + SH  ++Y+ TP
Sbjct  388  KLTVTMDSHACKMYVLTP  405



>ref|XP_008371324.1| PREDICTED: alpha-galactosidase [Malus domestica]
 ref|XP_008355997.1| PREDICTED: alpha-galactosidase-like isoform X3 [Malus domestica]
Length=404

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 141/200 (71%), Gaps = 3/200 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA   GN WR T DI+DTWES+T+IAD NN WA YAGPG WNDPDMLEVGNGGM+
Sbjct  208  EDPAKWAGQYGNVWRTTGDIKDTWESITSIADQNNIWATYAGPGKWNDPDMLEVGNGGMS  267

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             +EY++HFSIWA+MKAPL+IGCD+ + + ET +IL N EVI V+QDPLGVQ RK+    +
Sbjct  268  VQEYQSHFSIWAVMKAPLLIGCDIPSASKETLQILGNKEVIDVNQDPLGVQARKLR---S  324

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLS  R+VV LWNR      IT  W  +GL  +  V++RDLW H  +S   
Sbjct  325  KDDLEVWAGPLSNKRVVVVLWNRGRSLAPITVTWKEVGLSPNTPVTVRDLWAHSFVSRRM  384

Query  251  VKSFSAKVKSHGSELYIFTP  192
            +   +A V  HG ++Y+ TP
Sbjct  385  LTGLTANVAPHGCKMYVLTP  404



>ref|XP_008800433.1| PREDICTED: alpha-galactosidase, partial [Phoenix dactylifera]
Length=338

 Score =   237 bits (605),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 137/198 (69%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   +GNSWR T DI D+WESM + AD N  +AEYA PGGWNDPDMLEVGNGGMT +
Sbjct  142  PALWGAKLGNSWRTTSDINDSWESMVSRADQNEAYAEYARPGGWNDPDMLEVGNGGMTND  201

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL+IGCDVRNMT ET +I+ N EVIAV+QDPLG+Q +KV +   +G
Sbjct  202  EYIVHFSIWAISKAPLLIGCDVRNMTRETMDIIGNKEVIAVNQDPLGIQAKKVRM---EG  258

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPLSG +  + L NR  K   ITA+WD IG+     V  RDLWKHE +    + 
Sbjct  259  DLEVWAGPLSGYKTAIVLLNRSLKPSPITANWDDIGIPPKTVVEARDLWKHETLKKKFMD  318

Query  245  SFSAKVKSHGSELYIFTP  192
              +  +  H   +++ TP
Sbjct  319  KMTVSIGPHSCRMFVLTP  336



>ref|XP_008355995.1| PREDICTED: alpha-galactosidase-like isoform X1 [Malus domestica]
Length=404

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 141/200 (71%), Gaps = 3/200 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA   GN WR T DI+DTWES+T+IAD NN WA YAGPG WNDPDMLEVGNGGM+
Sbjct  208  EDPAKWAGQYGNVWRTTGDIKDTWESITSIADQNNIWATYAGPGKWNDPDMLEVGNGGMS  267

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             +EY++HFSIWA+MKAPL+IGCD+ + + ET +IL N EVI V+QDPLGVQ RK+    +
Sbjct  268  VQEYQSHFSIWAVMKAPLLIGCDIPSASKETLQILGNKEVIDVNQDPLGVQARKLR---S  324

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLS  R+VV LWNR      IT  W  +GL  +  V++RDLW H  +S   
Sbjct  325  KDDLEVWAGPLSNKRVVVVLWNRGRSLAPITVTWKEVGLSPNTPVTVRDLWAHSFVSRRM  384

Query  251  VKSFSAKVKSHGSELYIFTP  192
            +   +A V  HG ++Y+ TP
Sbjct  385  LTGLTANVAPHGCKMYVLTP  404



>ref|XP_010274932.1| PREDICTED: alpha-galactosidase [Nelumbo nucifera]
Length=433

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/198 (59%), Positives = 143/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   VGNSWR T DI D W+SM + AD+N  +A+ A PGGWNDPDMLEVGNGGMT +
Sbjct  237  PALWGANVGNSWRTTNDIADNWDSMVSRADMNEVYADLARPGGWNDPDMLEVGNGGMTKD  296

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY AHFSIW++ KAPL+IGCDVRN T ET EI+SN EVIAV+QDPLGVQ +KV +   +G
Sbjct  297  EYIAHFSIWSISKAPLLIGCDVRNATKETMEIISNKEVIAVNQDPLGVQAKKVRM---EG  353

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVW+GPLSG R VV L+NR S    ITA+WD IG+   + V  RDLW+H+ +      
Sbjct  354  DLEVWSGPLSGYRTVVLLFNRGSSRNPITANWDDIGIPPHSLVKARDLWEHKTLKTRFAG  413

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SH  ++Y+ TP
Sbjct  414  NLTATVDSHACKMYVLTP  431



>ref|XP_009351606.1| PREDICTED: alpha-galactosidase-like isoform X2 [Pyrus x bretschneideri]
Length=411

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 145/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PA W   VGNSWR T DI DTWESM + AD+N  +AE+A PGGWNDPDMLEVGNGGMT  
Sbjct  215  PATWGANVGNSWRTTSDISDTWESMVSRADMNEVYAEFARPGGWNDPDMLEVGNGGMTKN  274

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFS+WA+ KAPL++GC+V N+T ET EI++N E+I+V+QDPLGVQ +KV + G   
Sbjct  275  EYIVHFSMWAISKAPLLLGCNVGNITKETMEIIANKELISVNQDPLGVQAKKVRLQGN--  332

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
             +EVWAGPLSG R+ + L NR  K ++ TAHWD IG+ +++ V  RDLW+H+ + A  V 
Sbjct  333  -REVWAGPLSGYRVALLLVNRSRKRDSFTAHWDDIGIPTNSVVEARDLWEHKTLKARFVG  391

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SH  ++Y+  P
Sbjct  392  NLTATVDSHACKMYVLKP  409



>ref|XP_009333714.1| PREDICTED: alpha-galactosidase-like isoform X1 [Pyrus x bretschneideri]
Length=404

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 140/200 (70%), Gaps = 3/200 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA   GN WR T DI DTWES+T+IAD NN W  YAGPG WNDPDMLEVGNGGM+
Sbjct  208  EDPAKWAGQYGNVWRTTGDIRDTWESITSIADQNNIWKTYAGPGKWNDPDMLEVGNGGMS  267

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWA+MKAPL+IGCD+ + + ET +IL N EVI V+QDPLGVQ  K+    +
Sbjct  268  VEEYRSHFSIWAVMKAPLLIGCDIPSASKETLQILGNKEVIDVNQDPLGVQAGKLR---S  324

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLS  R+VV LWNR      IT  W  +GL  + SV++RDLW H  +S + 
Sbjct  325  KDNLEVWAGPLSNKRVVVVLWNRGGSLAPITVTWKEVGLSPNTSVTVRDLWAHSFVSRSM  384

Query  251  VKSFSAKVKSHGSELYIFTP  192
            +   +A V  HG ++Y+ TP
Sbjct  385  LTGLTANVAPHGCKMYVLTP  404



>ref|XP_002962690.1| hypothetical protein SELMODRAFT_78329 [Selaginella moellendorffii]
 gb|EFJ36153.1| hypothetical protein SELMODRAFT_78329 [Selaginella moellendorffii]
Length=390

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 145/200 (73%), Gaps = 5/200 (3%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA+ VGNSWR T DIE+ WESM +IAD NN WAE+A PGGWNDPDMLE+GNGGM+
Sbjct  195  EDPATWASSVGNSWRTTGDIENKWESMISIADKNNAWAEHAAPGGWNDPDMLEIGNGGMS  254

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
            ++E R HFS+WALMKAPLIIGCDVRN  A+   IL N EVI ++QD LGVQGRKV+    
Sbjct  255  FQESRTHFSLWALMKAPLIIGCDVRNTVAQDLAILMNKEVIQINQDALGVQGRKVA---G  311

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG QEVW GPLS  R  + + NR S    ITA +  +G+ S+ SV IRD+WK    + N+
Sbjct  312  DGEQEVWGGPLSNGRFALLMLNRGSDPADITAEFAALGIPSNVSVMIRDVWKVRTGTYNS  371

Query  251  VKSFSAKVKSHGSELYIFTP  192
              S +++V+SH   +YI TP
Sbjct  372  --SITSRVESHDVAMYILTP  389



>gb|KJB57569.1| hypothetical protein B456_009G170600 [Gossypium raimondii]
Length=408

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 141/200 (71%), Gaps = 3/200 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA   G+SWR T DI DT+ S+T IAD+NN+W  YAGP  WNDPDMLEVGNGGMT
Sbjct  209  EDPAKWAGAYGHSWRTTGDINDTFASVTWIADLNNRWGRYAGPSRWNDPDMLEVGNGGMT  268

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             +EYR+HFSIW+LMKAPL+IGCD+R+++  T  IL N EVI V+QD LGVQGRK  +   
Sbjct  269  MDEYRSHFSIWSLMKAPLLIGCDLRSVSNRTLRILGNKEVIEVNQDSLGVQGRK--LRSK  326

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
            DG  EVWAGPLS NR+VV LWNR      ITA W   GL  +    +RDLWKH+ +S N 
Sbjct  327  DGL-EVWAGPLSDNRVVVVLWNRSELRALITAAWRDFGLSPNTPAIVRDLWKHKYVSMNK  385

Query  251  VKSFSAKVKSHGSELYIFTP  192
            +   +A V  H  ++Y+ TP
Sbjct  386  LDRLTASVAPHACKMYVLTP  405



>ref|XP_009333778.1| PREDICTED: alpha-galactosidase-like isoform X2 [Pyrus x bretschneideri]
Length=404

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 140/200 (70%), Gaps = 3/200 (2%)
 Frame = -2

Query  791  DDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMT  612
            +DPA WA   GN WR T DI DTWES+T+IAD NN W  YAGPG WNDPDMLEVGNGGM+
Sbjct  208  EDPAKWAGQYGNVWRTTGDIRDTWESITSIADQNNIWKTYAGPGKWNDPDMLEVGNGGMS  267

Query  611  YEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGA  432
             EEYR+HFSIWA+MKAPL+IGCD+ + + ET +IL N EVI V+QDPLGVQ  K+    +
Sbjct  268  VEEYRSHFSIWAVMKAPLLIGCDIPSASKETLQILGNKEVIDVNQDPLGVQAGKLR---S  324

Query  431  DGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANA  252
                EVWAGPLS  R+VV LWNR      IT  W  +GL  + SV++RDLW H  +S + 
Sbjct  325  KDNLEVWAGPLSNKRVVVVLWNRGGSLAPITVTWKEVGLSPNTSVTVRDLWAHSFVSRSM  384

Query  251  VKSFSAKVKSHGSELYIFTP  192
            +   +A V  HG ++Y+ TP
Sbjct  385  LTGLTANVAPHGCKMYVLTP  404



>ref|XP_010068809.1| PREDICTED: alpha-galactosidase-like [Eucalyptus grandis]
Length=404

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 146/200 (73%), Gaps = 4/200 (2%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            +PA WA  +GNSWR T DI+DTW SM + AD+N+ WA YAGPGGWNDPDMLEVGNG MT 
Sbjct  209  NPATWAPSIGNSWRTTGDIKDTWGSMISKADLNDMWASYAGPGGWNDPDMLEVGNGNMTT  268

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
            EEYR HFS+W+L KAPLI+GCD+R++  +TFE++SN EVIAV+QD LG+QG+KV+ +G  
Sbjct  269  EEYRCHFSLWSLAKAPLILGCDIRSVDNDTFELVSNKEVIAVNQDVLGIQGKKVNRTGD-  327

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
               EVW+GPLSGNR+ V L NR     T+TA W  IGL SS  V  RDLW+H   +    
Sbjct  328  --LEVWSGPLSGNRVAVVLINRGLSTATVTAEWSDIGLNSSVIVDARDLWQHSTTTTIQY  385

Query  248  KSFSAKVKSHGSELYIFTPQ  189
            +  +A + SH  ++Y+ TPQ
Sbjct  386  Q-VNATLDSHACKMYVLTPQ  404



>ref|XP_010491471.1| PREDICTED: alpha-galactosidase-like [Camelina sativa]
Length=414

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 145/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW + VGNSWR T DI+DTW SM +IAD+N  +AE+A PGGWNDPDMLEVGNGGMT E
Sbjct  218  PALWGSPVGNSWRTTNDIKDTWLSMISIADMNEVYAEHARPGGWNDPDMLEVGNGGMTKE  277

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL++GCD+RNMT ET EI++N EVIA++QDP GVQ +KV +   +G
Sbjct  278  EYIVHFSIWAISKAPLLLGCDIRNMTKETMEIVANKEVIAINQDPHGVQAKKVRM---EG  334

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPLSG R+ + L NR     +ITA WD I + +++ V  RDLW+H+ +    V 
Sbjct  335  DIEVWAGPLSGYRVALLLLNRGPSRTSITALWDDIDIPANSIVQARDLWEHKTLKQKFVG  394

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SH  +LY+  P
Sbjct  395  NLTATVDSHACKLYVLKP  412



>dbj|BAK08274.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 146/202 (72%), Gaps = 4/202 (2%)
 Frame = -2

Query  794  VDDPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGM  615
            VD+PA WA  + NSWR TEDI++TWESMT   D +NKWA YAGPGGWNDPDMLEVGNGGM
Sbjct  191  VDEPATWAGSMANSWRTTEDIKNTWESMTDNIDKSNKWAPYAGPGGWNDPDMLEVGNGGM  250

Query  614  TYEEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSG  435
            T EEYR+HFSIWAL+KAPL++GCD+ +MT ET EILSN +VIAV+QD LGVQG KV    
Sbjct  251  TTEEYRSHFSIWALVKAPLVLGCDISSMTPETKEILSNQKVIAVNQDKLGVQGLKVQ---  307

Query  434  ADGCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
             D   EVWAG LSG+R+ + LWN    + +ITA W  IGL  SA V   DLW  E ++++
Sbjct  308  QDEDLEVWAGRLSGDRVALVLWNSGPTEASITASWSNIGLSPSAVVDAHDLWTDE-VTSS  366

Query  254  AVKSFSAKVKSHGSELYIFTPQ  189
               +    V SH  ++Y+ TP+
Sbjct  367  VQGNLKKTVASHACKMYVLTPK  388



>ref|XP_010669404.1| PREDICTED: alpha-galactosidase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=413

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 142/198 (72%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   VGNSWR T+DI D WESM   AD+N  +A+YA PGGWNDPDMLEVGNGGM+ +
Sbjct  217  PALWGYQVGNSWRTTDDISDNWESMVTRADMNEFYADYARPGGWNDPDMLEVGNGGMSKD  276

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL+IGCDVRNMT ET  IL N EVIAV+QDPLG+Q +KV + G   
Sbjct  277  EYIVHFSIWAISKAPLLIGCDVRNMTQETMGILGNEEVIAVNQDPLGIQAKKVRMEGG--  334

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPL+   + + + NR +   +ITAHWD IGL   + V  RDLW+H+ +    V+
Sbjct  335  -LEVWAGPLTNYTVALLIVNRGAVTMSITAHWDDIGLPMDSIVEARDLWEHKTLEQRFVQ  393

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SHGS++Y+  P
Sbjct  394  NLTASVDSHGSKMYVLKP  411



>ref|XP_006602712.1| PREDICTED: alpha-galactosidase-like isoform X2 [Glycine max]
Length=416

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 142/201 (71%), Gaps = 3/201 (1%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   VGNSWR T DI D+WESM + AD+N  +AEYA PGGWNDPDMLEVGNGGMT  
Sbjct  214  PALWGAKVGNSWRTTNDINDSWESMVSRADMNEVYAEYARPGGWNDPDMLEVGNGGMTKN  273

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFS+WAL KAPL++GCDVRNMT ET EI++N EVI+V+QDPLGVQG+KV + G   
Sbjct  274  EYIVHFSLWALSKAPLLLGCDVRNMTKETMEIVANKEVISVNQDPLGVQGKKVRMEGDQE  333

Query  425  CQ---EVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISAN  255
                 ++WAGPLSG R+ V L NR     +ITA+WD I +   ++V  RDLW+H+ +   
Sbjct  334  VTLFGQIWAGPLSGYRVAVVLLNRGPSKISITANWDDIDIPPKSAVEARDLWEHKTLMRP  393

Query  254  AVKSFSAKVKSHGSELYIFTP  192
             V   +A V  HG ++Y+  P
Sbjct  394  FVDKLTATVDPHGCKMYVLKP  414



>ref|XP_012091553.1| PREDICTED: alpha-galactosidase-like [Jatropha curcas]
 gb|KDP20924.1| hypothetical protein JCGZ_21395 [Jatropha curcas]
Length=399

 Score =   238 bits (608),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 137/198 (69%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PA WA   GN+WR T DI+D+WES+T+IAD NN W  YAGPG WNDPDMLEVGNGGM  E
Sbjct  204  PAKWAGQYGNAWRTTGDIKDSWESVTSIADENNIWGRYAGPGRWNDPDMLEVGNGGMGLE  263

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EYR+HFSIWALMKAPL+IGCDVR+ + +T  IL N EVI V+QDPLGVQGRK+    A  
Sbjct  264  EYRSHFSIWALMKAPLLIGCDVRSASRQTLSILRNKEVIDVNQDPLGVQGRKIRSKAA--  321

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              E+WAGPLS  R+VV L NR      I+  W  +GL  S+SV +RDLW H  +S     
Sbjct  322  -LEIWAGPLSRKRVVVVLLNRSGSRAPISVGWREVGLSPSSSVIVRDLWMHSFVSMRKRY  380

Query  245  SFSAKVKSHGSELYIFTP  192
              +A V  H  ++YI TP
Sbjct  381  GITAYVAPHACKMYILTP  398



>gb|KGN51577.1| hypothetical protein Csa_5G580620 [Cucumis sativus]
Length=339

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW + +GNSWR T DI D+WESM + AD+N  +A+YA PGGWNDPDMLEVGNGGMT +
Sbjct  143  PALWGDKLGNSWRTTNDINDSWESMISRADLNEIYADYARPGGWNDPDMLEVGNGGMTKD  202

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFS+WA+ KAPL++GCD+RN+T ET  I++NTEVIAV+QDPLGVQ +KV    ++G
Sbjct  203  EYIVHFSLWAISKAPLLLGCDLRNLTKETKAIVTNTEVIAVNQDPLGVQAKKVR---SEG  259

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPLSG R+ V L NR      I+A WD IG+  +++V  RDLW+H  +    V 
Sbjct  260  DLEVWAGPLSGYRVAVVLLNRGPWRNAISAQWDDIGIPPNSNVEARDLWEHTTLKTTFVA  319

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SH  +LYI  P
Sbjct  320  NLTATVDSHACKLYILKP  337



>ref|XP_008381790.1| PREDICTED: alpha-galactosidase-like isoform X1 [Malus domestica]
Length=295

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PA W   VGNSWR T DI DTWESM + AD+N  +AE+A PGGWNDPDMLEVGNGGM  +
Sbjct  99   PATWGANVGNSWRTTSDISDTWESMVSRADMNEVYAEFARPGGWNDPDMLEVGNGGMRKD  158

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL++GC+V N+T ET +I++N EVI+V+QDPLGVQ +KV + G   
Sbjct  159  EYIVHFSIWAISKAPLLLGCNVGNITKETMDIIANKEVISVNQDPLGVQAKKVRLQGN--  216

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
             +EVWAGPLSG R+ + L NR  K ++ TAHWD IG+ +++ V  R+LW+H+ + A  V 
Sbjct  217  -REVWAGPLSGYRVALLLVNRSRKRDSFTAHWDDIGIPTNSVVEARNLWEHKTLKARFVG  275

Query  245  SFSAKVKSHGSELYIFTP  192
            + +  + SH  ++Y+  P
Sbjct  276  NLTTTLDSHACKMYVLKP  293



>gb|KFK25205.1| hypothetical protein AALP_AA8G080800 [Arabis alpina]
Length=415

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 145/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW + VGNSWR T DI+D W SM +IAD+N  +AE+A PGGWNDPDMLEVGNGGMT +
Sbjct  219  PALWGSPVGNSWRTTNDIKDNWVSMISIADMNEVYAEHARPGGWNDPDMLEVGNGGMTKD  278

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL++GCD+RNMT ET EI++N EVIA++QDP GVQ +KV +   +G
Sbjct  279  EYIVHFSIWAISKAPLLLGCDIRNMTKETMEIVANKEVIAINQDPHGVQAKKVRM---EG  335

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              E+WAGPLSG R+ + L NR      ITAHWD I + +++ V  RDLW+H+ +    V+
Sbjct  336  DMEIWAGPLSGYRVALLLLNRGPLRIPITAHWDDIEIPANSIVEARDLWEHKTLKQKFVE  395

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SH  +LYI  P
Sbjct  396  NLTATVDSHACKLYILKP  413



>ref|XP_008381791.1| PREDICTED: alpha-galactosidase-like isoform X2 [Malus domestica]
Length=261

 Score =   233 bits (595),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 108/198 (55%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PA W   VGNSWR T DI DTWESM + AD+N  +AE+A PGGWNDPDMLEVGNGGM  +
Sbjct  65   PATWGANVGNSWRTTSDISDTWESMVSRADMNEVYAEFARPGGWNDPDMLEVGNGGMRKD  124

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL++GC+V N+T ET +I++N EVI+V+QDPLGVQ +KV + G   
Sbjct  125  EYIVHFSIWAISKAPLLLGCNVGNITKETMDIIANKEVISVNQDPLGVQAKKVRLQGN--  182

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
             +EVWAGPLSG R+ + L NR  K ++ TAHWD IG+ +++ V  R+LW+H+ + A  V 
Sbjct  183  -REVWAGPLSGYRVALLLVNRSRKRDSFTAHWDDIGIPTNSVVEARNLWEHKTLKARFVG  241

Query  245  SFSAKVKSHGSELYIFTP  192
            + +  + SH  ++Y+  P
Sbjct  242  NLTTTLDSHACKMYVLKP  259



>ref|XP_003535398.1| PREDICTED: alpha-galactosidase-like [Glycine max]
Length=422

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 144/201 (72%), Gaps = 4/201 (2%)
 Frame = -2

Query  788  DPALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTY  609
            DPA WA  VGNSWR T DIED W SMT IAD N++W  YAG GGWNDPDMLEVGNGGMT 
Sbjct  225  DPATWAKTVGNSWRTTGDIEDNWNSMTTIADANDRWVSYAGSGGWNDPDMLEVGNGGMTT  284

Query  608  EEYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGAD  429
            EEYRAHFSIWAL KAPL++GCD+R M   T++++SN EVIAV+QD  GVQG+KV    ++
Sbjct  285  EEYRAHFSIWALAKAPLLVGCDIRAMDNTTYDLISNREVIAVNQDKEGVQGKKVK---SN  341

Query  428  GCQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
               EVWAGPLS N++ V LWNR S + T+TA W  IGL+    V  +DLW +   S+   
Sbjct  342  NDLEVWAGPLSDNKVAVILWNRSSSNATVTASWSNIGLKPGTMVDAKDLWANSTQSS-VS  400

Query  248  KSFSAKVKSHGSELYIFTPQT  186
               SA++ SH  ++Y+ TP++
Sbjct  401  GEISAELDSHACKMYVLTPKS  421



>ref|XP_004290441.1| PREDICTED: alpha-galactosidase 1-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=399

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 146/198 (74%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   +GNSWR T+DI D+WESM + AD+N  +AEYA PGGWNDPDMLEVGNGGMT +
Sbjct  203  PALWGAKLGNSWRTTKDISDSWESMVSRADMNEVYAEYARPGGWNDPDMLEVGNGGMTKD  262

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL++GCDVRNM+ +T EI++N EVI+V+QDPLGVQ +KV +   +G
Sbjct  263  EYVVHFSIWAISKAPLLLGCDVRNMSKDTLEIVANKEVISVNQDPLGVQAKKVRL---EG  319

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              E+WAGPLSG R+ + L N+  ++ TITA W+ IGL  +  V  RDLW+H+ +    V 
Sbjct  320  DLEIWAGPLSGYRVALLLINQGPENNTITAQWEDIGLPPNTVVEARDLWEHKTLKKLFVG  379

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SH  ++Y+  P
Sbjct  380  NLTASVNSHACKMYVLKP  397



>ref|XP_010423100.1| PREDICTED: alpha-galactosidase-like [Camelina sativa]
Length=414

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 145/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW + VGNSWR T DI+DTW SM +IAD+N  +AE+A PGGWNDPDMLEVGNGGMT E
Sbjct  218  PALWGSPVGNSWRTTNDIKDTWLSMISIADMNEVYAEHARPGGWNDPDMLEVGNGGMTKE  277

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL++GCD+RNMT ET EI++N EVIA++QDP GVQ +KV +   +G
Sbjct  278  EYIVHFSIWAISKAPLLLGCDIRNMTKETMEIVANKEVIAINQDPHGVQAKKVRM---EG  334

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPLSG R+ + L NR     +ITA WD I + +++ V  RDLW+H+ +    V 
Sbjct  335  DIEVWAGPLSGYRVALLLLNRGPSRTSITALWDDIEIPANSIVQARDLWEHKTLKQKFVG  394

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SH  +LY+  P
Sbjct  395  NLTATVDSHACKLYVLKP  412



>ref|XP_010452823.1| PREDICTED: alpha-galactosidase-like [Camelina sativa]
Length=414

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/198 (57%), Positives = 145/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW + VGNSWR T DI+DTW SM +IAD+N  +AE+A PGGWNDPDMLEVGNGGMT E
Sbjct  218  PALWGSPVGNSWRTTNDIKDTWLSMISIADMNEVYAEHARPGGWNDPDMLEVGNGGMTKE  277

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL++GCD+RNMT ET EI++N EVIA++QDP GVQ +KV +   +G
Sbjct  278  EYIVHFSIWAISKAPLLLGCDIRNMTKETMEIVANKEVIAINQDPHGVQAKKVRM---EG  334

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPLSG R+ + L NR     +ITA WD + + +++ V  RDLW+H+ +    V 
Sbjct  335  DIEVWAGPLSGYRVALLLLNRGPSRTSITALWDDLEIPANSIVQARDLWEHKTLKQKFVG  394

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SH  +LY+  P
Sbjct  395  NLTATVDSHACKLYVLKP  412



>ref|XP_004236880.1| PREDICTED: alpha-galactosidase [Solanum lycopersicum]
Length=418

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 115/198 (58%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   +GNSWR T DI DTWESM + AD N  +A+YA PGGWNDPDMLEVGNGGMT +
Sbjct  222  PALWGGKLGNSWRTTNDISDTWESMISRADQNEVYADYARPGGWNDPDMLEVGNGGMTKD  281

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPLIIGCDVRN++ +T EIL+N EVIAVDQD LGVQG+KV +   +G
Sbjct  282  EYIIHFSIWAISKAPLIIGCDVRNLSHDTMEILANKEVIAVDQDELGVQGKKVRM---EG  338

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              E+WAGPLSG R+ + L NR  +   ITA+WD IG+  ++ V  RDLW+H+ +    V 
Sbjct  339  DLEIWAGPLSGYRVALVLLNRGPQRYEITANWDDIGIPPNSVVIARDLWEHKTLETKFVG  398

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SH  ++Y+  P
Sbjct  399  NLTATVNSHACKMYVLKP  416



>ref|XP_008445910.1| PREDICTED: alpha-galactosidase [Cucumis melo]
Length=414

 Score =   238 bits (606),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 144/198 (73%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW + +GNSWR T DI D+WESM + AD+N  +A+YA PGGWNDPDMLEVGNGGMT +
Sbjct  218  PALWGDKLGNSWRTTNDINDSWESMISRADLNEIYADYARPGGWNDPDMLEVGNGGMTKD  277

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFS+WA+ KAPL++GCD+RN+T ET EI++NTEVIAV+QDPLGVQ +KV    ++G
Sbjct  278  EYIVHFSLWAISKAPLLLGCDLRNLTKETKEIITNTEVIAVNQDPLGVQAKKVR---SEG  334

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              EVWAGPLSG R+ V L NR      ITA WD IG+  +++V  RDLW+   +    V 
Sbjct  335  DLEVWAGPLSGYRVAVVLLNRGPWRNAITAQWDDIGIPPNSNVEARDLWERTTLKTTFVA  394

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SH  +LYI  P
Sbjct  395  NLTATVDSHACKLYILKP  412



>ref|XP_011458441.1| PREDICTED: alpha-galactosidase 1-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=434

 Score =   238 bits (607),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 146/198 (74%), Gaps = 3/198 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PALW   +GNSWR T+DI D+WESM + AD+N  +AEYA PGGWNDPDMLEVGNGGMT +
Sbjct  238  PALWGAKLGNSWRTTKDISDSWESMVSRADMNEVYAEYARPGGWNDPDMLEVGNGGMTKD  297

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFSIWA+ KAPL++GCDVRNM+ +T EI++N EVI+V+QDPLGVQ +KV +   +G
Sbjct  298  EYVVHFSIWAISKAPLLLGCDVRNMSKDTLEIVANKEVISVNQDPLGVQAKKVRL---EG  354

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDETITAHWDVIGLESSASVSIRDLWKHEDISANAVK  246
              E+WAGPLSG R+ + L N+  ++ TITA W+ IGL  +  V  RDLW+H+ +    V 
Sbjct  355  DLEIWAGPLSGYRVALLLINQGPENNTITAQWEDIGLPPNTVVEARDLWEHKTLKKLFVG  414

Query  245  SFSAKVKSHGSELYIFTP  192
            + +A V SH  ++Y+  P
Sbjct  415  NLTASVNSHACKMYVLKP  432



>ref|NP_001147362.1| alpha-galactosidase precursor [Zea mays]
 gb|ACG27087.1| alpha-galactosidase precursor [Zea mays]
Length=412

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 137/200 (69%), Gaps = 4/200 (2%)
 Frame = -2

Query  785  PALWANGVGNSWRNTEDIEDTWESMTAIADINNKWAEYAGPGGWNDPDMLEVGNGGMTYE  606
            PA W    GNSWR T DI DTW+SM A AD N  W+EYA PGGWNDPDMLEVGNGGMT  
Sbjct  212  PATWGATYGNSWRTTNDIADTWDSMIATADQNEVWSEYARPGGWNDPDMLEVGNGGMTNS  271

Query  605  EYRAHFSIWALMKAPLIIGCDVRNMTAETFEILSNTEVIAVDQDPLGVQGRKVSVSGADG  426
            EY  HFS+WA+ KAPLIIGCDVR+M+ ET+ IL+N EVIAV+QDPLGVQG+KV +   +G
Sbjct  272  EYVVHFSLWAISKAPLIIGCDVRHMSRETYAILANKEVIAVNQDPLGVQGKKVRM---EG  328

Query  425  CQEVWAGPLSGNRLVVALWNRCSKDE-TITAHWDVIGLESSASVSIRDLWKHEDISANAV  249
              E+WA PLS  R  V L NR +KDE TITAHWD IGL +   V  RDLW HE + A   
Sbjct  329  SSEIWAAPLSEYRTAVLLLNRHAKDEATITAHWDDIGLPAGTPVEARDLWLHETLDATFT  388

Query  248  KSFSAKVKSHGSELYIFTPQ  189
               S  V  H   + +  P+
Sbjct  389  DKMSFDVAPHSCRMLVLKPR  408



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1628027073272