BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9816

Length=815
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011100175.1|  PREDICTED: monosaccharide-sensing protein 2-...    258   2e-76   Sesamum indicum [beniseed]
gb|EYU43535.1|  hypothetical protein MIMGU_mgv1a002513mg                254   1e-75   Erythranthe guttata [common monkey flower]
ref|XP_006342166.1|  PREDICTED: monosaccharide-sensing protein 2-...    255   2e-75   Solanum tuberosum [potatoes]
gb|EYU43534.1|  hypothetical protein MIMGU_mgv1a001953mg                254   4e-75   Erythranthe guttata [common monkey flower]
gb|EPS65490.1|  hypothetical protein M569_09283                         253   7e-75   Genlisea aurea
gb|ABK29441.1|  sugar transport protein                                 240   4e-74   Coffea canephora [robusta coffee]
ref|NP_001289848.1|  monosaccharide-sensing protein 2                   250   1e-73   Solanum lycopersicum
ref|XP_009595864.1|  PREDICTED: monosaccharide-sensing protein 2        249   2e-73   Nicotiana tomentosiformis
ref|NP_001190922.1|  monosaccharide-sensing protein 2                   244   4e-73   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57059.1|  AT4G35300                                              244   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009796447.1|  PREDICTED: monosaccharide-sensing protein 2-...    247   2e-72   Nicotiana sylvestris
gb|KJB14186.1|  hypothetical protein B456_002G113400                    239   2e-71   Gossypium raimondii
ref|NP_195256.3|  monosaccharide-sensing protein 2                      244   3e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KJB77473.1|  hypothetical protein B456_012G139000                    239   4e-71   Gossypium raimondii
ref|NP_849565.1|  monosaccharide-sensing protein 2                      244   4e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KHN20087.1|  Monosaccharide-sensing protein 2                        243   5e-71   Glycine soja [wild soybean]
ref|XP_011074068.1|  PREDICTED: monosaccharide-sensing protein 2-...    243   6e-71   Sesamum indicum [beniseed]
ref|XP_002867077.1|  hypothetical protein ARALYDRAFT_491117             243   7e-71   
ref|XP_003527273.1|  PREDICTED: monosaccharide-sensing protein 2-...    243   1e-70   Glycine max [soybeans]
gb|ABR25915.1|  sugar transporter type 2a                               227   1e-70   Oryza sativa Indica Group [Indian rice]
gb|KHN33775.1|  Monosaccharide-sensing protein 2                        241   3e-70   Glycine soja [wild soybean]
ref|XP_006486570.1|  PREDICTED: monosaccharide-sensing protein 2-...    241   4e-70   Citrus sinensis [apfelsine]
ref|XP_006577928.1|  PREDICTED: monosaccharide-sensing protein 2-...    241   5e-70   Glycine max [soybeans]
gb|KDO68402.1|  hypothetical protein CISIN_1g004750mg                   241   5e-70   Citrus sinensis [apfelsine]
emb|CDP07261.1|  unnamed protein product                                241   5e-70   Coffea canephora [robusta coffee]
ref|XP_006422393.1|  hypothetical protein CICLE_v10027893mg             240   7e-70   
ref|XP_007135975.1|  hypothetical protein PHAVU_009G007600g             240   9e-70   Phaseolus vulgaris [French bean]
ref|XP_010446942.1|  PREDICTED: monosaccharide-sensing protein 2        239   1e-69   Camelina sativa [gold-of-pleasure]
ref|XP_008358445.1|  PREDICTED: monosaccharide-sensing protein 2-...    227   1e-69   
gb|KJB14185.1|  hypothetical protein B456_002G113400                    239   1e-69   Gossypium raimondii
emb|CDX69128.1|  BnaC01g03250D                                          238   2e-69   
gb|KJB14177.1|  hypothetical protein B456_002G113400                    239   2e-69   Gossypium raimondii
gb|KHG10189.1|  Monosaccharide-sensing 2 -like protein                  239   2e-69   Gossypium arboreum [tree cotton]
ref|XP_004500833.1|  PREDICTED: monosaccharide-sensing protein 2-...    239   2e-69   Cicer arietinum [garbanzo]
ref|XP_010432297.1|  PREDICTED: monosaccharide-sensing protein 2-...    239   2e-69   Camelina sativa [gold-of-pleasure]
gb|KJB79729.1|  hypothetical protein B456_013G064200                    234   2e-69   Gossypium raimondii
emb|CDY65623.1|  BnaCnng48010D                                          238   2e-69   Brassica napus [oilseed rape]
gb|KHG04802.1|  Monosaccharide-sensing protein 2                        238   2e-69   Gossypium arboreum [tree cotton]
ref|XP_003603869.1|  Monosaccharide-sensing protein                     238   3e-69   
ref|XP_003603868.1|  Monosaccharide-sensing protein                     238   3e-69   Medicago truncatula
ref|XP_006283193.1|  hypothetical protein CARUB_v10004225mg             238   3e-69   Capsella rubella
gb|KHG04801.1|  Monosaccharide-sensing protein 2                        238   4e-69   Gossypium arboreum [tree cotton]
ref|XP_009103100.1|  PREDICTED: monosaccharide-sensing protein 2        238   4e-69   
gb|KJB77472.1|  hypothetical protein B456_012G139000                    238   5e-69   Gossypium raimondii
ref|XP_010094525.1|  Monosaccharide-sensing protein 2                   237   9e-69   Morus notabilis
ref|XP_007018119.1|  Tonoplast monosaccharide transporter2 isoform 1    237   1e-68   
ref|XP_007018122.1|  Tonoplast monosaccharide transporter2 isoform 4    237   1e-68   
ref|XP_010437493.1|  PREDICTED: monosaccharide-sensing protein 2-...    236   2e-68   
ref|XP_010061214.1|  PREDICTED: monosaccharide-sensing protein 2-...    236   3e-68   Eucalyptus grandis [rose gum]
dbj|BAJ87413.1|  predicted protein                                      229   4e-68   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007043079.1|  Tonoplast monosaccharide transporter2              235   7e-68   
gb|AJO70165.1|  tonoplast monosaccharide transporters 1                 234   8e-68   Camellia sinensis [black tea]
ref|XP_007137297.1|  hypothetical protein PHAVU_009G115500g             234   9e-68   Phaseolus vulgaris [French bean]
ref|XP_003604104.1|  Monosaccharide-sensing protein                     234   9e-68   Medicago truncatula
gb|KJB79728.1|  hypothetical protein B456_013G064200                    234   2e-67   Gossypium raimondii
ref|XP_004500684.1|  PREDICTED: monosaccharide-sensing protein 2-...    234   2e-67   
gb|KHG05233.1|  Monosaccharide-sensing 2 -like protein                  233   2e-67   Gossypium arboreum [tree cotton]
ref|XP_010066352.1|  PREDICTED: monosaccharide-sensing protein 2-...    233   3e-67   Eucalyptus grandis [rose gum]
ref|XP_008237926.1|  PREDICTED: monosaccharide-sensing protein 2        233   4e-67   Prunus mume [ume]
ref|XP_008373385.1|  PREDICTED: monosaccharide-sensing protein 2-...    232   8e-67   
ref|XP_003518591.1|  PREDICTED: monosaccharide-sensing protein 2-...    231   8e-67   Glycine max [soybeans]
gb|KHN46863.1|  Monosaccharide-sensing protein 2                        231   9e-67   Glycine soja [wild soybean]
ref|XP_007210337.1|  hypothetical protein PRUPE_ppa001932mg             232   9e-67   Prunus persica
ref|XP_008440928.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    231   2e-66   
gb|EMS49950.1|  Monosaccharide-sensing protein 2                        229   3e-66   Triticum urartu
ref|XP_010266257.1|  PREDICTED: monosaccharide-sensing protein 2 ...    230   3e-66   Nelumbo nucifera [Indian lotus]
gb|KHN19961.1|  Monosaccharide-sensing protein 2                        230   3e-66   Glycine soja [wild soybean]
ref|XP_003526737.1|  PREDICTED: monosaccharide-sensing protein 2-...    230   4e-66   Glycine max [soybeans]
ref|XP_010686712.1|  PREDICTED: monosaccharide-sensing protein 2        230   4e-66   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010090703.1|  Monosaccharide-sensing protein 2                   230   4e-66   Morus notabilis
ref|XP_010539774.1|  PREDICTED: monosaccharide-sensing protein 1-...    230   4e-66   Tarenaya hassleriana [spider flower]
ref|XP_003543932.1|  PREDICTED: monosaccharide-sensing protein 2-...    230   5e-66   
gb|KHN33643.1|  Monosaccharide-sensing protein 2                        230   5e-66   Glycine soja [wild soybean]
ref|XP_006412119.1|  hypothetical protein EUTSA_v10024517mg             229   6e-66   Eutrema salsugineum [saltwater cress]
ref|XP_002510716.1|  sugar transporter, putative                        229   6e-66   Ricinus communis
ref|XP_004289029.1|  PREDICTED: monosaccharide-sensing protein 2-...    230   6e-66   Fragaria vesca subsp. vesca
dbj|BAJ89532.1|  predicted protein                                      229   1e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDI66591.1|  putative sugar transporter type 2a protein             229   1e-65   Saccharum hybrid cultivar R570
emb|CDY31497.1|  BnaC05g16060D                                          227   1e-65   Brassica napus [oilseed rape]
gb|EAY85098.1|  hypothetical protein OsI_06450                          228   2e-65   Oryza sativa Indica Group [Indian rice]
ref|XP_006647093.1|  PREDICTED: monosaccharide-sensing protein 2-...    228   2e-65   Oryza brachyantha
ref|XP_010909820.1|  PREDICTED: monosaccharide-sensing protein 2-...    228   3e-65   Elaeis guineensis
emb|CDY29502.1|  BnaA06g14680D                                          226   3e-65   Brassica napus [oilseed rape]
ref|NP_001046359.1|  Os02g0229400                                       228   3e-65   
gb|KDO85210.1|  hypothetical protein CISIN_1g004673mg                   223   3e-65   Citrus sinensis [apfelsine]
ref|XP_009608796.1|  PREDICTED: monosaccharide-sensing protein 2-...    227   4e-65   Nicotiana tomentosiformis
emb|CDI66586.1|  putative sugar transporter type 2a protein             227   4e-65   Saccharum hybrid cultivar R570
gb|EAZ22316.1|  hypothetical protein OsJ_05971                          228   4e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009763350.1|  PREDICTED: monosaccharide-sensing protein 2-...    227   5e-65   Nicotiana sylvestris
ref|XP_011658085.1|  PREDICTED: monosaccharide-sensing protein 2        227   5e-65   Cucumis sativus [cucumbers]
gb|EMT06669.1|  Monosaccharide-sensing protein 2                        228   5e-65   
ref|XP_010548175.1|  PREDICTED: monosaccharide-sensing protein 2        227   6e-65   Tarenaya hassleriana [spider flower]
ref|XP_009340799.1|  PREDICTED: monosaccharide-sensing protein 2-...    227   6e-65   Pyrus x bretschneideri [bai li]
gb|KGN49001.1|  hypothetical protein Csa_6G509700                       227   6e-65   Cucumis sativus [cucumbers]
ref|XP_010680636.1|  PREDICTED: monosaccharide-sensing protein 2-...    227   6e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010690557.1|  PREDICTED: monosaccharide-sensing protein 2        227   7e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009149562.1|  PREDICTED: monosaccharide-sensing protein 1        226   7e-65   Brassica rapa
emb|CBI40753.3|  unnamed protein product                                226   7e-65   Vitis vinifera
ref|XP_008464819.1|  PREDICTED: monosaccharide-sensing protein 2-...    226   7e-65   Cucumis melo [Oriental melon]
ref|XP_010029562.1|  PREDICTED: monosaccharide-sensing protein 2-...    226   9e-65   Eucalyptus grandis [rose gum]
ref|XP_008448165.1|  PREDICTED: monosaccharide-sensing protein 2        226   9e-65   Cucumis melo [Oriental melon]
emb|CBI37732.3|  unnamed protein product                                225   1e-64   Vitis vinifera
gb|KCW64229.1|  hypothetical protein EUGRSUZ_G01880                     226   1e-64   Eucalyptus grandis [rose gum]
ref|XP_011656904.1|  PREDICTED: monosaccharide-sensing protein 2        226   1e-64   Cucumis sativus [cucumbers]
ref|XP_004300112.1|  PREDICTED: monosaccharide-sensing protein 2        226   2e-64   Fragaria vesca subsp. vesca
emb|CAN59780.1|  hypothetical protein VITISV_024656                     226   2e-64   Vitis vinifera
ref|XP_002282975.1|  PREDICTED: monosaccharide-sensing protein 2        225   2e-64   Vitis vinifera
ref|XP_008778122.1|  PREDICTED: monosaccharide-sensing protein 2-...    226   2e-64   
ref|XP_009392211.1|  PREDICTED: monosaccharide-sensing protein 2-...    225   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001267873.1|  hexose transporter-like                            225   2e-64   Vitis vinifera
ref|XP_009390770.1|  PREDICTED: monosaccharide-sensing protein 2-...    225   3e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFP89954.1|  tonoplastic transporter 2                               225   3e-64   Vitis vinifera
ref|XP_011040809.1|  PREDICTED: monosaccharide-sensing protein 2-...    225   3e-64   Populus euphratica
gb|AAX47312.1|  hexose transporter 6                                    225   4e-64   Vitis vinifera
ref|XP_007142576.1|  hypothetical protein PHAVU_008G292400g             224   4e-64   Phaseolus vulgaris [French bean]
ref|XP_004951395.1|  PREDICTED: monosaccharide-sensing protein 2-...    224   5e-64   Setaria italica
ref|XP_003571780.1|  PREDICTED: monosaccharide-sensing protein 2-...    224   6e-64   Brachypodium distachyon [annual false brome]
gb|AIN39841.1|  hypothetical protein                                    224   6e-64   Zoysia matrella [Japanese carpet grass]
ref|XP_010537220.1|  PREDICTED: monosaccharide-sensing protein 1-...    224   6e-64   Tarenaya hassleriana [spider flower]
gb|AIQ77649.1|  tonoplastic transporter 1                               224   6e-64   Vitis vinifera
ref|XP_010678631.1|  PREDICTED: monosaccharide-sensing protein 2-...    223   1e-63   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO85208.1|  hypothetical protein CISIN_1g004673mg                   223   1e-63   Citrus sinensis [apfelsine]
ref|XP_002467580.1|  hypothetical protein SORBIDRAFT_01g030430          223   1e-63   Sorghum bicolor [broomcorn]
dbj|BAJ90138.1|  predicted protein                                      223   1e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAD58958.1|  hexose transporter                                     223   2e-63   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006435423.1|  hypothetical protein CICLE_v10000400mg             223   2e-63   Citrus clementina [clementine]
ref|XP_006416357.1|  hypothetical protein EUTSA_v10006916mg             223   2e-63   Eutrema salsugineum [saltwater cress]
dbj|BAJ33724.1|  unnamed protein product                                223   2e-63   Eutrema halophilum
ref|XP_009401004.1|  PREDICTED: monosaccharide-sensing protein 2-...    223   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397963.1|  PREDICTED: monosaccharide-sensing protein 2-...    222   3e-63   
ref|XP_003574265.1|  PREDICTED: monosaccharide-sensing protein 2-...    222   3e-63   Brachypodium distachyon [annual false brome]
ref|XP_008382498.1|  PREDICTED: monosaccharide-sensing protein 2-...    222   3e-63   
emb|CAN80213.1|  hypothetical protein VITISV_042076                     222   4e-63   Vitis vinifera
ref|XP_010459775.1|  PREDICTED: monosaccharide-sensing protein 1-...    221   4e-63   Camelina sativa [gold-of-pleasure]
emb|CDP14489.1|  unnamed protein product                                222   5e-63   Coffea canephora [robusta coffee]
ref|XP_010477336.1|  PREDICTED: monosaccharide-sensing protein 1        221   8e-63   Camelina sativa [gold-of-pleasure]
ref|XP_002520608.1|  sugar transporter, putative                        221   9e-63   Ricinus communis
ref|XP_010270527.1|  PREDICTED: monosaccharide-sensing protein 2        221   1e-62   Nelumbo nucifera [Indian lotus]
ref|NP_001065182.1|  Os10g0539900                                       220   2e-62   
gb|AFW59276.1|  hypothetical protein ZEAMMB73_154299                    218   2e-62   
gb|EEC67373.1|  hypothetical protein OsI_34495                          220   2e-62   Oryza sativa Indica Group [Indian rice]
emb|CDP01766.1|  unnamed protein product                                220   2e-62   Coffea canephora [robusta coffee]
ref|XP_008645619.1|  PREDICTED: monosaccharide-sensing protein 2-...    220   3e-62   Zea mays [maize]
gb|EPS57524.1|  hypothetical protein M569_17293                         219   3e-62   Genlisea aurea
ref|XP_009110209.1|  PREDICTED: monosaccharide-sensing protein 1        219   4e-62   Brassica rapa
emb|CDX96618.1|  BnaA08g21610D                                          219   4e-62   
gb|AAO37640.1|  putative sugar transporter type 2a                      219   5e-62   Saccharum hybrid cultivar Q117
emb|CDY33650.1|  BnaC08g19500D                                          218   6e-62   Brassica napus [oilseed rape]
ref|XP_012073594.1|  PREDICTED: monosaccharide-sensing protein 2        218   1e-61   Jatropha curcas
tpg|DAA46101.1|  TPA: hypothetical protein ZEAMMB73_051534              209   1e-61   
gb|EMS63940.1|  Monosaccharide-sensing protein 2                        218   2e-61   Triticum urartu
ref|XP_006306868.1|  hypothetical protein CARUB_v10008415mg             217   2e-61   
ref|XP_007201798.1|  hypothetical protein PRUPE_ppa001957mg             217   2e-61   Prunus persica
gb|EMT29091.1|  Monosaccharide-sensing protein 2                        217   2e-61   
ref|XP_008235816.1|  PREDICTED: monosaccharide-sensing protein 2        216   3e-61   Prunus mume [ume]
gb|KCW55684.1|  hypothetical protein EUGRSUZ_I01534                     206   5e-61   Eucalyptus grandis [rose gum]
ref|XP_009372620.1|  PREDICTED: monosaccharide-sensing protein 2        216   5e-61   Pyrus x bretschneideri [bai li]
tpg|DAA46100.1|  TPA: hypothetical protein ZEAMMB73_051534              211   6e-61   
ref|XP_002307812.1|  hypothetical protein POPTR_0005s27680g             216   6e-61   Populus trichocarpa [western balsam poplar]
ref|XP_008377843.1|  PREDICTED: monosaccharide-sensing protein 2-...    216   8e-61   
ref|XP_009333794.1|  PREDICTED: monosaccharide-sensing protein 2-...    216   9e-61   
emb|CBI21577.3|  unnamed protein product                                214   9e-61   Vitis vinifera
ref|XP_010503840.1|  PREDICTED: monosaccharide-sensing protein 3-...    215   1e-60   Camelina sativa [gold-of-pleasure]
ref|NP_173508.1|  tonoplast monosaccharide transporter1                 215   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004290074.1|  PREDICTED: monosaccharide-sensing protein 2        215   1e-60   Fragaria vesca subsp. vesca
gb|AAD30608.1|AC007369_18  Sugar transporter                            215   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009341490.1|  PREDICTED: monosaccharide-sensing protein 2-...    215   1e-60   Pyrus x bretschneideri [bai li]
ref|XP_009115837.1|  PREDICTED: monosaccharide-sensing protein 3        214   2e-60   Brassica rapa
ref|XP_012073160.1|  PREDICTED: monosaccharide-sensing protein 2        215   2e-60   Jatropha curcas
ref|XP_010515555.1|  PREDICTED: monosaccharide-sensing protein 3        214   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_004978456.1|  PREDICTED: monosaccharide-sensing protein 2-...    214   2e-60   
ref|XP_010426703.1|  PREDICTED: monosaccharide-sensing protein 3-...    214   3e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010063149.1|  PREDICTED: monosaccharide-sensing protein 2-...    214   3e-60   Eucalyptus grandis [rose gum]
ref|XP_010940242.1|  PREDICTED: monosaccharide-sensing protein 2-...    214   3e-60   Elaeis guineensis
ref|XP_002276373.1|  PREDICTED: monosaccharide-sensing protein 2        214   3e-60   Vitis vinifera
gb|ACG25339.1|  hexose transporter                                      214   4e-60   Zea mays [maize]
ref|NP_001147067.1|  hexose transporter                                 214   4e-60   Zea mays [maize]
ref|XP_004983796.1|  PREDICTED: monosaccharide-sensing protein 2-...    214   4e-60   Setaria italica
ref|XP_006403910.1|  hypothetical protein EUTSA_v10011113mg             213   7e-60   Eutrema salsugineum [saltwater cress]
gb|KFK34392.1|  hypothetical protein AALP_AA5G139300                    213   9e-60   Arabis alpina [alpine rockcress]
ref|XP_006384856.1|  transporter-related family protein                 212   2e-59   
ref|XP_002893133.1|  hypothetical protein ARALYDRAFT_472320             212   2e-59   
ref|XP_011098017.1|  PREDICTED: monosaccharide-sensing protein 2-...    211   2e-59   Sesamum indicum [beniseed]
ref|XP_009359631.1|  PREDICTED: monosaccharide-sensing protein 2-...    211   6e-59   
ref|NP_001151936.1|  LOC100285573                                       211   6e-59   Zea mays [maize]
ref|XP_009359629.1|  PREDICTED: monosaccharide-sensing protein 2-...    211   6e-59   Pyrus x bretschneideri [bai li]
ref|XP_009359630.1|  PREDICTED: monosaccharide-sensing protein 2-...    210   6e-59   
ref|XP_009148978.1|  PREDICTED: monosaccharide-sensing protein 3        210   8e-59   Brassica rapa
ref|NP_001190054.1|  tonoplast monosaccharide transporter3              210   8e-59   Arabidopsis thaliana [mouse-ear cress]
gb|EMT28528.1|  Monosaccharide-sensing protein 3                        207   9e-59   
ref|XP_004144248.1|  PREDICTED: monosaccharide-sensing protein 2-...    210   1e-58   Cucumis sativus [cucumbers]
dbj|BAI94493.1|  sugar transporter                                      209   1e-58   Dianthus caryophyllus [carnation]
gb|EYU30848.1|  hypothetical protein MIMGU_mgv1a001984mg                209   2e-58   Erythranthe guttata [common monkey flower]
ref|XP_008812559.1|  PREDICTED: monosaccharide-sensing protein 2-...    209   2e-58   Phoenix dactylifera
ref|XP_007204446.1|  hypothetical protein PRUPE_ppa026426mg             209   2e-58   Prunus persica
ref|XP_008392888.1|  PREDICTED: monosaccharide-sensing protein 2-...    204   3e-58   
ref|XP_008242106.1|  PREDICTED: monosaccharide-sensing protein 2-...    208   4e-58   Prunus mume [ume]
ref|XP_004977696.1|  PREDICTED: monosaccharide-sensing protein 2-...    195   5e-58   Setaria italica
gb|ABK29442.1|  sugar transport protein                                 193   6e-58   Coffea canephora [robusta coffee]
ref|XP_004964709.1|  PREDICTED: monosaccharide-sensing protein 2-...    207   8e-58   Setaria italica
ref|XP_006855646.1|  PREDICTED: monosaccharide-sensing protein 2        207   1e-57   
ref|XP_008786687.1|  PREDICTED: monosaccharide-sensing protein 2-...    207   1e-57   Phoenix dactylifera
ref|XP_002312798.1|  transporter-related family protein                 206   2e-57   
ref|XP_011099908.1|  PREDICTED: monosaccharide-sensing protein 2-...    206   2e-57   Sesamum indicum [beniseed]
ref|XP_010028861.1|  PREDICTED: LOW QUALITY PROTEIN: monosacchari...    206   2e-57   
ref|XP_011000869.1|  PREDICTED: monosaccharide-sensing protein 2-...    206   3e-57   Populus euphratica
ref|XP_009776539.1|  PREDICTED: monosaccharide-sensing protein 2-...    205   4e-57   Nicotiana sylvestris
ref|XP_009622210.1|  PREDICTED: monosaccharide-sensing protein 2-...    205   5e-57   Nicotiana tomentosiformis
ref|XP_006662557.1|  PREDICTED: monosaccharide-sensing protein 2-...    204   7e-57   
ref|XP_009589978.1|  PREDICTED: monosaccharide-sensing protein 2-...    204   7e-57   Nicotiana tomentosiformis
ref|XP_002300629.1|  hypothetical protein POPTR_0002s00760g             204   7e-57   Populus trichocarpa [western balsam poplar]
ref|XP_009775817.1|  PREDICTED: monosaccharide-sensing protein 2-...    204   9e-57   Nicotiana sylvestris
ref|XP_006343319.1|  PREDICTED: monosaccharide-sensing protein 2-...    204   1e-56   Solanum tuberosum [potatoes]
ref|NP_001067890.1|  Os11g0475600                                       204   1e-56   
gb|EAY80902.1|  hypothetical protein OsI_36080                          204   1e-56   Oryza sativa Indica Group [Indian rice]
ref|NP_001280690.1|  monosaccharide-sensing protein 2-like              204   2e-56   Solanum lycopersicum
ref|XP_003560303.1|  PREDICTED: monosaccharide-sensing protein 2-...    203   2e-56   Brachypodium distachyon [annual false brome]
ref|XP_011041174.1|  PREDICTED: monosaccharide-sensing protein 2-...    202   7e-56   Populus euphratica
ref|XP_011034826.1|  PREDICTED: monosaccharide-sensing protein 2-...    201   1e-55   Populus euphratica
emb|CAN64713.1|  hypothetical protein VITISV_043728                     187   1e-55   Vitis vinifera
ref|XP_002439068.1|  hypothetical protein SORBIDRAFT_10g031000          201   3e-55   Sorghum bicolor [broomcorn]
dbj|BAK02857.1|  predicted protein                                      200   4e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007203009.1|  hypothetical protein PRUPE_ppa017631mg             198   2e-54   Prunus persica
ref|XP_008242155.1|  PREDICTED: monosaccharide-sensing protein 2-...    197   3e-54   Prunus mume [ume]
gb|KJB12351.1|  hypothetical protein B456_002G014400                    197   4e-54   Gossypium raimondii
gb|KJB12354.1|  hypothetical protein B456_002G014400                    197   4e-54   Gossypium raimondii
ref|XP_006292750.1|  hypothetical protein CARUB_v10018997mg             196   1e-53   
emb|CDX78009.1|  BnaA09g32040D                                          195   1e-53   
emb|CDX73717.1|  BnaC08g22860D                                          195   1e-53   
gb|EMS60524.1|  Monosaccharide-sensing protein 3                        190   2e-53   Triticum urartu
gb|EYU40481.1|  hypothetical protein MIMGU_mgv1a001997mg                195   2e-53   Erythranthe guttata [common monkey flower]
ref|XP_002877807.1|  predicted protein                                  193   1e-52   
emb|CDY16303.1|  BnaC01g23380D                                          192   1e-52   Brassica napus [oilseed rape]
emb|CDY33276.1|  BnaA01g19430D                                          192   2e-52   Brassica napus [oilseed rape]
ref|NP_190717.1|  tonoplast monosaccharide transporter3                 192   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022133.1|  PREDICTED: monosaccharide-sensing protein 2-...    192   2e-52   Populus euphratica
ref|XP_002306419.1|  hypothetical protein POPTR_0005s10180g             192   3e-52   
ref|XP_006649210.1|  PREDICTED: monosaccharide-sensing protein 2-...    191   3e-52   
gb|KHG14026.1|  Monosaccharide-sensing 2 -like protein                  192   3e-52   Gossypium arboreum [tree cotton]
gb|KJB31963.1|  hypothetical protein B456_005G216600                    191   5e-52   Gossypium raimondii
ref|XP_004289030.1|  PREDICTED: monosaccharide-sensing protein 2        191   6e-52   Fragaria vesca subsp. vesca
gb|EMT01868.1|  Monosaccharide-sensing protein 2                        188   7e-52   
gb|EAY88138.1|  hypothetical protein OsI_09573                          187   9e-51   Oryza sativa Indica Group [Indian rice]
dbj|BAD23011.1|  putative hexose transporter                            187   1e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004954530.1|  PREDICTED: monosaccharide-sensing protein 2-...    187   1e-50   Setaria italica
ref|XP_010097645.1|  Monosaccharide-sensing protein 3                   187   1e-50   Morus notabilis
ref|XP_009359632.1|  PREDICTED: monosaccharide-sensing protein 2-...    187   2e-50   Pyrus x bretschneideri [bai li]
gb|EMT02609.1|  Monosaccharide-sensing protein 3                        186   2e-50   
ref|XP_012065453.1|  PREDICTED: monosaccharide-sensing protein 2-...    186   5e-50   Jatropha curcas
gb|EMS63099.1|  Monosaccharide-sensing protein 3                        185   7e-50   Triticum urartu
gb|KHG00737.1|  Monosaccharide-sensing 2 -like protein                  181   2e-48   Gossypium arboreum [tree cotton]
gb|AGT16371.1|  hexose transporter                                      178   1e-47   Saccharum hybrid cultivar R570
emb|CAA90628.1|  sugar transporter                                      177   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003573173.1|  PREDICTED: monosaccharide-sensing protein 2-...    174   6e-46   Brachypodium distachyon [annual false brome]
ref|XP_010029563.1|  PREDICTED: monosaccharide-sensing protein 2-...    173   8e-46   Eucalyptus grandis [rose gum]
ref|XP_003629095.1|  Monosaccharide-sensing protein                     172   3e-45   
gb|EEE58264.1|  hypothetical protein OsJ_09268                          170   3e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002979533.1|  hypothetical protein SELMODRAFT_111167             172   3e-45   
gb|EAY88374.1|  hypothetical protein OsI_09831                          171   5e-45   Oryza sativa Indica Group [Indian rice]
gb|AAN17390.1|  Putative sugar transporter protein                      171   5e-45   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA85398.1|  unnamed protein product                                171   6e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002977746.1|  hypothetical protein SELMODRAFT_10582              171   9e-45   
ref|XP_001784511.1|  predicted protein                                  170   1e-44   
ref|XP_004509464.1|  PREDICTED: monosaccharide-sensing protein 2-...    169   2e-44   Cicer arietinum [garbanzo]
ref|XP_006653836.1|  PREDICTED: monosaccharide-sensing protein 2-...    169   3e-44   Oryza brachyantha
ref|XP_003562146.1|  PREDICTED: monosaccharide-sensing protein 2-...    167   8e-44   
ref|XP_007156262.1|  hypothetical protein PHAVU_003G271500g             166   2e-43   Phaseolus vulgaris [French bean]
ref|XP_004977442.1|  PREDICTED: monosaccharide-sensing protein 2-...    154   1e-42   
ref|XP_003548779.1|  PREDICTED: monosaccharide-sensing protein 3-...    164   2e-42   Glycine max [soybeans]
ref|XP_003517121.1|  PREDICTED: monosaccharide-sensing protein 2-...    163   3e-42   
ref|XP_007158028.1|  hypothetical protein PHAVU_002G118100g             163   4e-42   Phaseolus vulgaris [French bean]
gb|KHN35942.1|  Monosaccharide-sensing protein 3                        163   4e-42   Glycine soja [wild soybean]
ref|XP_001761207.1|  predicted protein                                  162   1e-41   
ref|XP_002970170.1|  hypothetical protein SELMODRAFT_231525             162   1e-41   
ref|XP_003537696.1|  PREDICTED: monosaccharide-sensing protein 2-...    161   2e-41   Glycine max [soybeans]
gb|AES95370.2|  tonoplast monosaccharide transporter 2                  157   5e-40   Medicago truncatula
ref|XP_004512287.1|  PREDICTED: monosaccharide-sensing protein 2-...    157   5e-40   Cicer arietinum [garbanzo]
ref|XP_003612412.1|  Monosaccharide-sensing protein                     157   6e-40   
gb|AFK36736.1|  unknown                                                 148   6e-39   Lotus japonicus
ref|XP_009387331.1|  PREDICTED: monosaccharide-sensing protein 1-...    152   2e-38   
ref|XP_001773057.1|  predicted protein                                  153   2e-38   
ref|XP_001754179.1|  predicted protein                                  150   1e-37   
ref|XP_010237536.1|  PREDICTED: monosaccharide-sensing protein 2-...    145   8e-37   
ref|XP_002978337.1|  hypothetical protein SELMODRAFT_268165             148   1e-36   
emb|CAD58959.1|  sugar transporter                                      147   2e-36   
ref|XP_003577342.1|  PREDICTED: monosaccharide-sensing protein 2-...    145   7e-36   
ref|XP_002981960.1|  hypothetical protein SELMODRAFT_179172             143   5e-35   
gb|EEC68553.1|  hypothetical protein OsI_36866                          142   8e-35   
ref|XP_006663052.1|  PREDICTED: monosaccharide-sensing protein 2-...    141   2e-34   
gb|ABA94776.1|  Sugar transporter, putative, expressed                  141   2e-34   
gb|ABA94777.1|  Sugar transporter, putative, expressed                  141   2e-34   
ref|XP_002986014.1|  hypothetical protein SELMODRAFT_182142             141   3e-34   
ref|XP_002981894.1|  hypothetical protein SELMODRAFT_179271             141   3e-34   
ref|XP_002982939.1|  hypothetical protein SELMODRAFT_445340             140   4e-34   
ref|XP_003614108.1|  Monosaccharide-sensing protein                     136   2e-32   
ref|XP_004979746.1|  PREDICTED: monosaccharide-sensing protein 3-...    133   1e-31   
ref|NP_001140361.1|  uncharacterized protein LOC100272411               129   7e-31   
ref|XP_008676725.1|  PREDICTED: uncharacterized protein LOC100272...    128   2e-30   
gb|AAN40021.1|  putative sugar transporter protein                      129   2e-30   
ref|XP_002453101.1|  hypothetical protein SORBIDRAFT_04g038470          120   4e-30   
ref|XP_002449882.1|  hypothetical protein SORBIDRAFT_05g024860          129   5e-30   
gb|AAM94321.1|  putative sugar transporter                              129   5e-30   
ref|XP_008676723.1|  PREDICTED: uncharacterized protein LOC100272...    128   6e-30   
ref|XP_008242156.1|  PREDICTED: monosaccharide-sensing protein 2-...    113   3e-27   
gb|ABK93009.1|  unknown                                                 106   2e-25   
ref|WP_019233467.1|  sugar:proton symporter                           97.4    2e-19   
ref|WP_018699802.1|  hypothetical protein                             95.5    7e-19   
ref|WP_031563482.1|  sugar:proton symporter                           93.2    4e-18   
ref|WP_032827048.1|  MULTISPECIES: major facilitator transporter      90.1    4e-18   
ref|WP_036745963.1|  major facilitator transporter                    92.8    5e-18   
gb|EFB42172.1|  hypothetical protein pah_c014o100                     92.8    5e-18   
gb|ABX10829.1|  general substrate transporter                         88.6    5e-18   
ref|WP_028380912.1|  sugar:proton symporter                           92.8    6e-18   
ref|WP_033027706.1|  major facilitator transporter                    89.7    6e-18   
ref|WP_033012988.1|  major facilitator transporter                    89.7    7e-18   
gb|ERG08448.1|  sugar transporter                                     90.1    7e-18   
gb|ABX10828.1|  general substrate transporter                         87.8    9e-18   
gb|ERG08434.1|  sugar transporter                                     89.4    2e-17   
ref|WP_033012985.1|  major facilitator transporter                    89.4    2e-17   
ref|WP_013644894.1|  major facilitator transporter                    90.5    4e-17   
ref|WP_016710574.1|  major facilitator transporter                    90.1    5e-17   
ref|XP_004339367.1|  transporter, major facilitator superfamily p...  90.9    5e-17   
ref|WP_013924234.1|  major facilitator transporter                    89.4    8e-17   
ref|WP_024610330.1|  major facilitator transporter                    89.7    8e-17   
ref|WP_028378007.1|  sugar:proton symporter                           89.7    8e-17   
ref|WP_028379283.1|  sugar:proton symporter                           89.7    8e-17   
ref|WP_027228917.1|  sugar:proton symporter                           89.7    8e-17   
ref|WP_007375162.1|  glucose transport protein                        89.4    8e-17   
ref|WP_003635103.1|  sugar:proton symporter                           89.4    8e-17   
ref|WP_033028785.1|  MULTISPECIES: major facilitator transporter      89.4    8e-17   
ref|WP_014866604.1|  major facilitator transporter                    89.4    8e-17   
ref|WP_024594228.1|  major facilitator transporter                    89.4    9e-17   
ref|WP_043236249.1|  sugar transporter                                89.4    1e-16   
ref|WP_027269579.1|  sugar:proton symporter                           89.0    1e-16   
ref|WP_020694258.1|  hypothetical protein                             89.0    1e-16   
ref|WP_018631168.1|  hypothetical protein                             89.0    1e-16   
ref|WP_029557156.1|  sugar transporter                                88.6    2e-16   
ref|WP_024277537.1|  sugar transporter                                88.6    2e-16   
ref|WP_041339107.1|  major facilitator transporter                    88.6    2e-16   
ref|WP_035714084.1|  sugar transporter                                88.2    2e-16   
gb|ABS66075.1|  sugar transporter                                     87.4    4e-16   
gb|ABM54152.1|  sugar transporter                                     87.0    4e-16   
ref|XP_005704896.1|  MFS transporter, SP family, sugar:H+ symporter   87.4    5e-16   
ref|XP_005174792.1|  PREDICTED: facilitated trehalose transporter...  88.2    5e-16   
ref|WP_038828964.1|  metabolite transporter CsbC                      86.7    7e-16   
gb|KFF54976.1|  metabolite transporter CsbC                           86.7    7e-16   
ref|WP_021481038.1|  major facilitator transporter                    86.7    7e-16   
ref|WP_003326199.1|  MULTISPECIES: major facilitator transporter      86.7    7e-16   
ref|WP_014666032.1|  major facilitator transporter                    86.7    7e-16   
ref|WP_041576361.1|  sugar transporter                                86.7    8e-16   
ref|WP_010621797.1|  MFS transporter                                  86.3    8e-16   
ref|WP_024599028.1|  major facilitator transporter                    86.7    8e-16   
ref|WP_007765369.1|  MFS transporter                                  86.7    8e-16   
ref|WP_038428086.1|  metabolite transporter CsbC                      86.3    9e-16   
ref|WP_028555263.1|  MFS transporter                                  86.3    9e-16   
ref|WP_045096454.1|  sugar:proton symporter                           86.3    1e-15   
gb|KFK78858.1|  putative metabolite transport protein CsbC            86.3    1e-15   
ref|WP_040081246.1|  metabolite transporter CsbC                      86.3    1e-15   
ref|WP_024572430.1|  metabolite transporter CsbC                      86.3    1e-15   
ref|XP_008596447.1|  hexose transporter                               87.0    1e-15   
gb|KGQ07113.1|  Putative polyol transporter 1                         87.0    1e-15   
ref|XP_001422705.1|  MFS family transporter: hexose                   86.3    1e-15   
ref|XP_004992344.1|  hypothetical protein PTSG_06943                  86.3    1e-15   
ref|WP_003219045.1|  MULTISPECIES: major facilitator transporter      86.3    1e-15   
ref|WP_041882616.1|  sugar:proton symporter                           86.3    1e-15   
ref|WP_035891457.1|  sugar:proton symporter                           86.3    1e-15   
ref|WP_006872344.1|  sugar:proton symporter                           85.9    1e-15   
ref|WP_027222610.1|  sugar:proton symporter                           85.9    1e-15   
ref|WP_028383633.1|  sugar:proton symporter                           85.9    1e-15   
ref|WP_010790464.1|  Major myo-inositol transporter IolT              85.9    1e-15   
dbj|GAK78547.1|  putative sugar transporter                           84.7    2e-15   
ref|WP_007585142.1|  major facilitator transporter                    85.9    2e-15   
ref|WP_027223498.1|  sugar:proton symporter                           85.9    2e-15   
ref|WP_007560303.1|  MFS transporter                                  85.9    2e-15   
ref|XP_006621467.1|  PREDICTED: solute carrier family 2, facilita...  85.9    2e-15   
ref|XP_003693200.1|  PREDICTED: solute carrier family 2, facilita...  85.9    2e-15   
dbj|BAI87684.2|  hypothetical protein BSNT_10673                      84.7    2e-15   
ref|WP_010654727.1|  sugar:proton symporter                           85.5    2e-15   
gb|EEF77612.1|  transporter, major facilitator family protein         83.6    2e-15   
ref|WP_039074963.1|  metabolite transporter CsbC                      85.5    2e-15   
ref|WP_027266629.1|  sugar:proton symporter                           85.5    2e-15   
ref|WP_043553534.1|  major facilitator transporter                    85.5    2e-15   
ref|WP_010946170.1|  sugar:proton symporter                           85.5    2e-15   
ref|WP_039378215.1|  major facilitator transporter                    85.1    2e-15   
dbj|GAK28219.1|  sugar transporter                                    80.1    2e-15   
gb|AES71915.2|  sugar porter (SP) family MFS transporter              85.1    3e-15   
ref|XP_003398790.1|  PREDICTED: solute carrier family 2, facilita...  85.5    3e-15   
ref|XP_003601664.1|  hypothetical protein MTR_3g084110                85.1    3e-15   
ref|WP_024713281.1|  metabolite transporter CsbC                      84.7    3e-15   
ref|WP_018577072.1|  sugar:proton symporter                           84.7    3e-15   
ref|XP_002733383.2|  PREDICTED: solute carrier family 2, facilita...  83.6    3e-15   
gb|KIA76326.1|  putative metabolite transport protein YwtG            85.1    3e-15   
ref|WP_035155729.1|  MFS transporter                                  84.7    3e-15   
ref|WP_019234077.1|  hypothetical protein                             84.7    3e-15   
ref|WP_035352377.1|  hypothetical protein                             84.7    3e-15   
ref|WP_044639214.1|  MFS transporter                                  84.7    3e-15   
ref|WP_011405548.1|  major facilitator transporter                    85.1    3e-15   
gb|KIU10011.1|  sugar transporter                                     84.3    4e-15   
gb|KFC79470.1|  sugar-proton symporter                                84.7    4e-15   
ref|XP_003489694.1|  PREDICTED: solute carrier family 2, facilita...  85.1    4e-15   
ref|WP_034793608.1|  MFS transporter                                  84.7    4e-15   
ref|XP_009024311.1|  hypothetical protein HELRODRAFT_114157           84.7    4e-15   
ref|WP_043858362.1|  metabolite transporter CsbC                      84.3    4e-15   
ref|WP_003244055.1|  metabolite transport protein CsbC                84.3    4e-15   
ref|WP_015715023.1|  major facilitator transporter                    84.3    4e-15   
ref|WP_004307928.1|  MULTISPECIES: MFS transporter                    84.3    4e-15   
ref|WP_042976872.1|  metabolite transporter CsbC                      84.3    4e-15   
ref|WP_032845792.1|  MULTISPECIES: MFS transporter                    84.3    4e-15   
emb|CBH25983.1|  putative sugar-transporter subfamily                 84.7    5e-15   
gb|EIY61831.1|  sugar porter (SP) family MFS transporter              84.3    5e-15   
ref|WP_033882801.1|  MULTISPECIES: metabolite transporter CsbC        84.3    5e-15   
ref|WP_020429182.1|  hypothetical protein                             81.6    5e-15   
ref|WP_014216842.1|  sugar:proton symporter                           84.3    5e-15   
dbj|GAN81326.1|  major facilitator superfamily sugar transporter      84.3    5e-15   
ref|WP_015385124.1|  putative sugar transporter                       84.3    5e-15   
ref|WP_029318579.1|  metabolite transporter CsbC                      84.3    5e-15   
ref|WP_004306567.1|  MFS transporter                                  84.3    5e-15   
ref|WP_019712602.1|  major facilitator transporter                    84.3    5e-15   
ref|WP_003227045.1|  major facilitator transporter                    84.3    5e-15   
ref|WP_025849336.1|  MFS transporter                                  84.3    5e-15   
ref|WP_014478492.1|  major facilitator transporter                    84.0    5e-15   
ref|WP_014841005.1|  sugar:proton symporter                           84.0    6e-15   
ref|WP_027219158.1|  sugar:proton symporter                           84.0    6e-15   
ref|WP_011214682.1|  sugar:proton symporter                           84.0    6e-15   
sp|B3MG58.2|TRET1_DROAN  RecName: Full=Facilitated trehalose tran...  84.7    6e-15   
ref|WP_027264806.1|  sugar:proton symporter                           84.0    6e-15   
ref|XP_001959931.1|  GF13114                                          84.7    6e-15   
ref|XP_787337.3|  PREDICTED: solute carrier family 2, facilitated...  84.0    6e-15   
ref|XP_005705489.1|  MFS transporter, SP family, sugar:H+ symporter   84.0    7e-15   
ref|WP_011213069.1|  sugar:proton symporter                           84.0    7e-15   
ref|WP_022277842.1|  sugar porter (SP) family MFS transporter         83.6    7e-15   
ref|WP_012169786.1|  sugar transporter                                83.6    8e-15   
ref|WP_011945599.1|  sugar:proton symporter                           83.6    8e-15   
ref|WP_033011127.1|  hypothetical protein                             78.6    8e-15   
ref|WP_008302074.1|  MULTISPECIES: D-xylose-proton symporter          83.6    8e-15   
ref|WP_038622452.1|  major facilitator transporter                    83.6    8e-15   
ref|WP_013754705.1|  major facilitator transporter                    83.6    8e-15   
ref|WP_014843330.1|  sugar:proton symporter                           83.6    8e-15   
dbj|GAN28872.1|  putative metabolite transport protein CsbC           83.6    8e-15   
dbj|GAC08662.1|  D-xylose-proton symporter                            83.6    9e-15   
ref|WP_018754345.1|  MFS transporter                                  83.6    9e-15   
ref|WP_027224240.1|  sugar:proton symporter                           83.6    9e-15   
ref|WP_043085813.1|  major facilitator transporter                    79.0    9e-15   
gb|KFA22558.1|  major facilitator transporter                         78.6    9e-15   
ref|WP_033611623.1|  MFS transporter                                  83.2    1e-14   
ref|WP_044442034.1|  major facilitator transporter                    83.6    1e-14   
ref|WP_019259960.1|  major facilitator transporter                    83.2    1e-14   
sp|Q291H8.3|TRET1_DROPS  RecName: Full=Facilitated trehalose tran...  84.3    1e-14   
sp|B4GAP7.2|TRET1_DROPE  RecName: Full=Facilitated trehalose tran...  84.3    1e-14   
gb|KJC63930.1|  major facilitator transporter                         83.2    1e-14   
ref|XP_001360559.2|  GA15593                                          84.3    1e-14   
ref|XP_002016109.1|  GL11419                                          84.3    1e-14   
ref|XP_002777372.1|  hexose transporter, putative                     82.0    1e-14   
ref|WP_035476539.1|  major facilitator transporter                    83.2    1e-14   
ref|XP_003699336.1|  PREDICTED: solute carrier family 2, facilita...  83.6    1e-14   
ref|WP_009000594.1|  MFS transporter                                  83.2    1e-14   
ref|WP_005679385.1|  MULTISPECIES: MFS transporter                    83.2    1e-14   
ref|WP_043090971.1|  hypothetical protein                             79.0    1e-14   
gb|KGT84775.1|  hypothetical protein OC00_06535                       78.6    1e-14   
ref|WP_033484407.1|  MULTISPECIES: major facilitator transporter      78.6    1e-14   
ref|XP_012154106.1|  PREDICTED: solute carrier family 2, facilita...  83.6    1e-14   
ref|WP_044654006.1|  MFS transporter                                  83.2    1e-14   
ref|XP_003082978.1|  hexose transporter (ISS)                         83.6    1e-14   
ref|WP_014368462.1|  MFS transporter                                  83.2    1e-14   
gb|ERH62287.1|  MFS transporter                                       83.2    1e-14   
ref|WP_009283556.1|  sugar transporter                                83.2    1e-14   
emb|CEG02078.1|  Major facilitator superfamily domain, general su...  83.6    1e-14   
ref|WP_041338092.1|  metabolite transporter CsbC                      82.8    1e-14   
ref|WP_020448594.1|  D-xylose-proton symporter                        82.8    1e-14   
ref|WP_038954325.1|  hypothetical protein                             78.2    1e-14   
ref|WP_013914552.1|  MFS transporter                                  83.2    1e-14   
ref|XP_001748408.1|  hypothetical protein                             83.2    1e-14   
ref|WP_028551479.1|  MFS transporter                                  82.8    1e-14   
ref|WP_045075692.1|  major facilitator transporter                    82.8    1e-14   
ref|XP_010686665.1|  PREDICTED: inositol transporter 4-like           83.2    1e-14   
ref|WP_026144597.1|  hypothetical protein                             78.6    1e-14   
ref|WP_042504924.1|  major facilitator transporter                    78.6    2e-14   
ref|WP_019183278.1|  major facilitator transporter                    82.8    2e-14   
ref|WP_026974727.1|  MFS transporter                                  82.8    2e-14   
emb|CDL60973.1|  sugar-proton symporter                               81.3    2e-14   
ref|WP_020090293.1|  MFS transporter                                  82.4    2e-14   
ref|XP_006670006.1|  galactose-proton symport, putative               83.2    2e-14   
emb|CDL51605.1|  sugar-proton symporter                               80.9    2e-14   
ref|WP_011507026.1|  MULTISPECIES: major facilitator transporter      82.4    2e-14   
ref|XP_005174793.1|  PREDICTED: facilitated trehalose transporter...  82.8    2e-14   
ref|XP_004502238.1|  PREDICTED: inositol transporter 1-like           82.8    2e-14   
gb|AAT89285.1|  sugar transporter                                     82.8    2e-14   
ref|WP_038689086.1|  major facilitator transporter                    82.4    2e-14   
ref|WP_007832171.1|  major facilitator transporter                    82.4    2e-14   
ref|WP_022521950.1|  Glucose transport protein (fragment)             77.8    2e-14   
ref|WP_041767588.1|  major facilitator transporter                    82.4    2e-14   
ref|XP_001986495.1|  GH21392                                          83.2    2e-14   
ref|WP_010536987.1|  MFS transporter                                  82.4    2e-14   
ref|WP_045033599.1|  MFS transporter                                  78.6    2e-14   
ref|WP_022471577.1|  sugar porter (SP) family MFS transporter         82.4    2e-14   
sp|B4LPX5.2|TRET1_DROVI  RecName: Full=Facilitated trehalose tran...  83.2    2e-14   
gb|EES68295.2|  sugar porter (SP) family MFS transporter              82.4    2e-14   
ref|XP_005707745.1|  MFS transporter, SP family, sugar:H+ symporter   82.4    2e-14   
ref|XP_002050122.1|  GJ20366                                          83.2    2e-14   
ref|XP_005707000.1|  MFS transporter, SP family, sugar:H+ symporter   82.4    2e-14   



>ref|XP_011100175.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=740

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 138/161 (86%), Positives = 152/161 (94%), Gaps = 2/161 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMRFMDVSGRR+LLL+TIPVLI SLV LV+GNV N G+VAHAV+STICV++YFC+FVMG
Sbjct  580  VAMRFMDVSGRRSLLLTTIPVLIISLVALVIGNVFNFGTVAHAVISTICVVIYFCTFVMG  639

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFWICDVIVTY+LPVMLSS+GLAGVFGIYAVVC
Sbjct  640  YGPIPNILCSEIFPTRVRGICIAICALVFWICDVIVTYTLPVMLSSIGLAGVFGIYAVVC  699

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEM--AKNE  290
            V+SWIF+FLRVPETKGMPLEVITEFFAVGA+QA    AKNE
Sbjct  700  VVSWIFIFLRVPETKGMPLEVITEFFAVGAKQAAAGSAKNE  740



>gb|EYU43535.1| hypothetical protein MIMGU_mgv1a002513mg [Erythranthe guttata]
Length=665

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/159 (84%), Positives = 151/159 (95%), Gaps = 2/159 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMRFMD++GRR+LLL+TIPVLI SL+ LV+GNV + G+VAHAV+ST+CVI+YFC+FVMG
Sbjct  509  VAMRFMDIAGRRSLLLTTIPVLILSLIALVIGNVFDFGTVAHAVISTVCVIVYFCTFVMG  568

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFWICDVIVTYSLPVMLSS+GLAGVFGIYAVVC
Sbjct  569  YGPIPNILCSEIFPTRVRGICIAICALVFWICDVIVTYSLPVMLSSIGLAGVFGIYAVVC  628

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+F+FLRVPETKGMPLEVITEFFAVGA+Q   AK+E
Sbjct  629  VISWVFIFLRVPETKGMPLEVITEFFAVGAKQG--AKSE  665



>ref|XP_006342166.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006342167.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=737

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMRFMDV+GRR+LLL TIPVLI SL+ LV+GN INLGSVAHAV+STICVILYFC FV G
Sbjct  579  IAMRFMDVAGRRSLLLYTIPVLILSLICLVIGNTINLGSVAHAVVSTICVILYFCFFVTG  638

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFWICDVIVTY+LPVML+S+GL+GVFGIYA+VC
Sbjct  639  YGPIPNILCSEIFPTRVRGLCIAICALVFWICDVIVTYTLPVMLNSIGLSGVFGIYAIVC  698

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISWIFVFLRVPETKGMPLEVITEFFAVGARQA +AK+E
Sbjct  699  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAAIAKHE  737



>gb|EYU43534.1| hypothetical protein MIMGU_mgv1a001953mg [Erythranthe guttata]
Length=734

 Score =   254 bits (649),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMRFMD++GRR+LLL+T+PVLI SL+ LV+GNV + G++AHA++ST CV++YFC+FVMG
Sbjct  576  VAMRFMDIAGRRSLLLTTLPVLIISLIALVIGNVFDFGTLAHAIISTTCVVIYFCTFVMG  635

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFWICDVIVTYSLPVMLSS+GLAGVFGIYAVVC
Sbjct  636  YGPIPNILCSEIFPTRVRGICIAICALVFWICDVIVTYSLPVMLSSIGLAGVFGIYAVVC  695

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+F+FLRVPETKGMPLEVITEFFAVGA+Q+  AK E
Sbjct  696  VISWVFIFLRVPETKGMPLEVITEFFAVGAKQSAAAKGE  734



>gb|EPS65490.1| hypothetical protein M569_09283 [Genlisea aurea]
Length=734

 Score =   253 bits (647),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 131/159 (82%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMRFMDV+GRR+LLL+TIPVLI SL++LV+GNV++LG+VAHAV+STICV++YFC+FVMG
Sbjct  575  VAMRFMDVAGRRSLLLTTIPVLIVSLIILVIGNVVHLGTVAHAVVSTICVVIYFCTFVMG  634

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG  IAIC+LVFWICDVIVTY+LPVMLSS+GLAGVFGIYAVVC
Sbjct  635  YGPIPNILCSEIFPTRVRGIAIAICSLVFWICDVIVTYTLPVMLSSIGLAGVFGIYAVVC  694

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW+F+FLRVPETKGMPLEVITEFFAVGA+Q E +KN+
Sbjct  695  AISWVFIFLRVPETKGMPLEVITEFFAVGAKQIEESKNQ  733



>gb|ABK29441.1| sugar transport protein, partial [Coffea canephora]
Length=290

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM FMD+SGRR LLLSTIPVL  SLV+LV+ NV++LG++AHAV+ST+CV+LYFC FVMG
Sbjct  135  VAMWFMDLSGRRALLLSTIPVLTVSLVILVVANVVDLGTIAHAVMSTLCVVLYFCCFVMG  194

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGP+PNILCAEIFPTRVRG CIAIC+LV+WICDVIVTY+LPV+LSS+GLAGVFGIYAVVC
Sbjct  195  YGPVPNILCAEIFPTRVRGLCIAICSLVYWICDVIVTYTLPVLLSSIGLAGVFGIYAVVC  254

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQ  311
            VISW+FVFLRVPETKGMPLEVITEFFAVGA++
Sbjct  255  VISWVFVFLRVPETKGMPLEVITEFFAVGAKK  286



>ref|NP_001289848.1| monosaccharide-sensing protein 2 [Solanum lycopersicum]
 dbj|BAO96237.1| tonoplast monosaccharide transporter 2 [Solanum lycopersicum]
Length=738

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 136/160 (85%), Positives = 151/160 (94%), Gaps = 1/160 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMRFMDV+GRR+LLL TIPVLI SL+ LV+GN +NLGSVAHAV+STICVILYFC FV G
Sbjct  579  IAMRFMDVAGRRSLLLYTIPVLILSLICLVIGNTVNLGSVAHAVVSTICVILYFCFFVTG  638

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFWICDVIVTY+LPVML+S+GL+GVFGIYA+VC
Sbjct  639  YGPIPNILCSEIFPTRVRGLCIAICALVFWICDVIVTYTLPVMLNSIGLSGVFGIYAIVC  698

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQ-AEMAKNE  290
            VISWIFVFLRVPETKGMPLEVITEFFAVGARQ A +AK+E
Sbjct  699  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAAAIAKHE  738



>ref|XP_009595864.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595865.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
 ref|XP_009595866.1| PREDICTED: monosaccharide-sensing protein 2 [Nicotiana tomentosiformis]
Length=738

 Score =   249 bits (637),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 140/159 (88%), Positives = 151/159 (95%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMRFMDV+GRRTLLL TIPVLI SL++LV+GN +NLGSVAHAV+ST+CVILYFC FV G
Sbjct  580  IAMRFMDVAGRRTLLLYTIPVLILSLILLVIGNTVNLGSVAHAVVSTVCVILYFCFFVTG  639

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILCAEIFPTRVRG CIAICALVFWICDVIVTY+LPVMLSS+GLAGVFGIYAVVC
Sbjct  640  YGPIPNILCAEIFPTRVRGLCIAICALVFWICDVIVTYTLPVMLSSIGLAGVFGIYAVVC  699

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW FVFLRVPETKGMPLEVITEFFAVGARQA MAK+E
Sbjct  700  VISWFFVFLRVPETKGMPLEVITEFFAVGARQAAMAKHE  738



>ref|NP_001190922.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86496.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=542

 Score =   244 bits (624),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIP+LI SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG
Sbjct  384  VAMRLMDLSGRRTLLLTTIPILIASLLVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMG  443

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YA+VC
Sbjct  444  FGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAIVC  503

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW+FVF++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  504  CISWVFVFIKVPETKGMPLEVITEFFSVGARQAEAAKNE  542



>dbj|BAH57059.1| AT4G35300 [Arabidopsis thaliana]
Length=585

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIP+LI SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG
Sbjct  427  VAMRLMDLSGRRTLLLTTIPILIASLLVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMG  486

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YA+VC
Sbjct  487  FGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAIVC  546

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW+FVF++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  547  CISWVFVFIKVPETKGMPLEVITEFFSVGARQAEAAKNE  585



>ref|XP_009796447.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796448.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009796450.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=738

 Score =   247 bits (630),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 139/159 (87%), Positives = 150/159 (94%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMRFMDV+GRRTLLL TIPVLI SL++LV+GN +NLGSVAHAV+ST+CVILYFC FV G
Sbjct  580  IAMRFMDVAGRRTLLLYTIPVLILSLILLVIGNTVNLGSVAHAVVSTVCVILYFCFFVTG  639

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILCAEIFPTRVRG CIAICALVFWICDVIVTY+LPVML S+GLAGVFGIYAVVC
Sbjct  640  YGPIPNILCAEIFPTRVRGLCIAICALVFWICDVIVTYTLPVMLRSIGLAGVFGIYAVVC  699

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW FVFLRVPETKGMPLEVITEFFAVGARQA MAK+E
Sbjct  700  VISWFFVFLRVPETKGMPLEVITEFFAVGARQAAMAKHE  738



>gb|KJB14186.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=524

 Score =   239 bits (611),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MD+SGRR LLL+TIPVLI SL++LV   +++LG+V +A +ST CVI+YFC FVMG
Sbjct  366  VAMKLMDISGRRRLLLTTIPVLIVSLIILVFSELVDLGTVVNAAISTACVIVYFCCFVMG  425

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LPVMLSS+GLAG+FGIYAVVC
Sbjct  426  YGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLSSIGLAGIFGIYAVVC  485

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            +ISW+FVFL+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  486  LISWVFVFLKVPETKGMPLEVITEFFAVGARQAGATKNE  524



>ref|NP_195256.3| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001154287.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 sp|Q8LPQ8.2|MSSP2_ARATH RecName: Full=Monosaccharide-sensing protein 2; AltName: Full=Sugar 
transporter MSSP2 [Arabidopsis thaliana]
 emb|CAA18739.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAB80247.1| putative sugar transporter protein [Arabidopsis thaliana]
 emb|CAD58692.1| monosaccharide sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86494.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86495.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=729

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIP+LI SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG
Sbjct  571  VAMRLMDLSGRRTLLLTTIPILIASLLVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMG  630

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YA+VC
Sbjct  631  FGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAIVC  690

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW+FVF++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  691  CISWVFVFIKVPETKGMPLEVITEFFSVGARQAEAAKNE  729



>gb|KJB77473.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=523

 Score =   239 bits (610),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRR+LLLST+PVLI SL+VLV+G+V+ +G+V HA +ST+ V+LYFC FVMG
Sbjct  365  VAMRLMDIAGRRSLLLSTLPVLIISLLVLVIGSVVKMGNVVHAAISTVSVVLYFCFFVMG  424

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIA+CAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC
Sbjct  425  FGPIPNILCAEIFPTRVRGICIAMCALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAVVC  484

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN 
Sbjct  485  VISWVFVFLKVPETKGMPLEVITEFFSVGAKQVAAAKNN  523



>ref|NP_849565.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 ref|NP_001190923.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AAM19835.1| AT4g35300/F23E12_140 [Arabidopsis thaliana]
 gb|AEE86493.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
 gb|AEE86497.1| monosaccharide-sensing protein 2 [Arabidopsis thaliana]
Length=739

 Score =   244 bits (622),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIP+LI SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG
Sbjct  581  VAMRLMDLSGRRTLLLTTIPILIASLLVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YA+VC
Sbjct  641  FGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAIVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW+FVF++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  701  CISWVFVFIKVPETKGMPLEVITEFFSVGARQAEAAKNE  739



>gb|KHN20087.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=712

 Score =   243 bits (620),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MDVSGRR LLL+TIPVLI SL++LV+G+++N G+VAHA +ST+CV++YFC FVMG
Sbjct  554  VAMKLMDVSGRRQLLLTTIPVLIVSLIILVIGSLVNFGNVAHAAISTVCVVVYFCCFVMG  613

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFWI D+I+TYSLPVMLSS+GL GVF IYAVVC
Sbjct  614  YGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIITYSLPVMLSSLGLGGVFAIYAVVC  673

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISWIFVFL+VPETKGMPLEVI+EFF+VGA+QA  AKNE
Sbjct  674  FISWIFVFLKVPETKGMPLEVISEFFSVGAKQAASAKNE  712



>ref|XP_011074068.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011074069.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=739

 Score =   243 bits (621),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 152/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMRFMD+SGRR+LLL+TIPVLI +L+ LV+GNV + G+VAHAV+STICV++YFC+FVMG
Sbjct  581  VAMRFMDISGRRSLLLTTIPVLIVALIALVIGNVFDFGTVAHAVISTICVVIYFCTFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFWICDVIVTY+LPVMLSS+GLAGVFGIYAVVC
Sbjct  641  YGPIPNILCSEIFPTRVRGICIAICALVFWICDVIVTYTLPVMLSSIGLAGVFGIYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISWIF+FLRVPETKGMPLEVITEFFAVGA+QA  AK+E
Sbjct  701  VISWIFIFLRVPETKGMPLEVITEFFAVGAKQAAAAKHE  739



>ref|XP_002867077.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43336.1| hypothetical protein ARALYDRAFT_491117 [Arabidopsis lyrata subsp. 
lyrata]
Length=739

 Score =   243 bits (620),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIP+LI SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG
Sbjct  581  VAMRLMDLSGRRTLLLTTIPILIASLLVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PNILC+EIFPTRVRG CIAICAL FW+CD+IVTYSLPV+L S+GLAGVFG+YA+VC
Sbjct  641  FGPAPNILCSEIFPTRVRGICIAICALTFWVCDIIVTYSLPVLLKSIGLAGVFGMYAIVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW+FVF++VPETKGMPLEVITEFF+VGARQAE AKNE
Sbjct  701  CISWVFVFIKVPETKGMPLEVITEFFSVGARQAEAAKNE  739



>ref|XP_003527273.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006581130.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
Length=737

 Score =   243 bits (619),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MDVSGRR LLL+TIPVLI SL++LV+G+++N G+VAHA +ST+CV++YFC FVMG
Sbjct  579  VAMKLMDVSGRRQLLLTTIPVLIVSLIILVIGSLVNFGNVAHAAISTVCVVVYFCCFVMG  638

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFWI D+I+TYSLPVMLSS+GL GVF IYAVVC
Sbjct  639  YGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIITYSLPVMLSSLGLGGVFAIYAVVC  698

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISWIFVFL+VPETKGMPLEVI+EFF+VGA+QA  AKNE
Sbjct  699  FISWIFVFLKVPETKGMPLEVISEFFSVGAKQAASAKNE  737



>gb|ABR25915.1| sugar transporter type 2a [Oryza sativa Indica Group]
Length=178

 Score =   227 bits (578),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL TIPVLI SLVVLV+ NVI+LG+VAHA LSTI VI+YFC FVMG
Sbjct  21   LAMRLMDISGRRFLLLGTIPVLIASLVVLVVSNVIDLGTVAHAALSTISVIIYFCCFVMG  80

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC
Sbjct  81   FGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVC  140

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
             I+++FVFL+VPETKGMPLEVITEFFAVGA+Q +  K
Sbjct  141  SIAFVFVFLKVPETKGMPLEVITEFFAVGAKQMQATK  177



>gb|KHN33775.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=737

 Score =   241 bits (615),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MDVSGRR LLL+TIPVLI SL++LV+G+++N G+VAHA +ST+CV++YFC FVMG
Sbjct  579  VAMKLMDVSGRRQLLLTTIPVLIVSLIILVIGSLVNFGNVAHAAISTVCVVVYFCCFVMG  638

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFWI D+I+TYSLPVML S+GL GVF IYAVVC
Sbjct  639  YGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIITYSLPVMLGSLGLGGVFAIYAVVC  698

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISWIFVFL+VPETKGMPLEVI+EFF+VGA+QA  AKNE
Sbjct  699  FISWIFVFLKVPETKGMPLEVISEFFSVGAKQAASAKNE  737



>ref|XP_006486570.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Citrus 
sinensis]
 ref|XP_006486571.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Citrus 
sinensis]
Length=732

 Score =   241 bits (614),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLLSTIP+LI SLVVLVL +VI +GSV HA +ST+ V+LYFC FVMG
Sbjct  574  VAMRLMDISGRRTLLLSTIPILITSLVVLVLSSVIKMGSVVHASISTVSVVLYFCCFVMG  633

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTYSLPV+L+S+GLAGVFG+YAVVC
Sbjct  634  FGPIPNILCSEIFPTRVRGICIAICALVFWIGDIIVTYSLPVLLNSVGLAGVFGMYAVVC  693

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISWIFVF++VPETKGMPLEVITEFFAVGA QA+ AKN 
Sbjct  694  VISWIFVFIKVPETKGMPLEVITEFFAVGASQADAAKNN  732



>ref|XP_006577928.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=738

 Score =   241 bits (614),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MDVSGRR LLL+TIPVLI SL++LV+G+++N G+VAHA +ST+CV++YFC FVMG
Sbjct  580  VAMKLMDVSGRRQLLLTTIPVLIGSLIILVIGSLVNFGNVAHAAISTVCVVVYFCCFVMG  639

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFWI D+I+TYSLPVML S+GL GVF IYAVVC
Sbjct  640  YGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIITYSLPVMLGSLGLGGVFAIYAVVC  699

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISWIFVFL+VPETKGMPLEVI+EFF+VGA+QA  AKNE
Sbjct  700  FISWIFVFLKVPETKGMPLEVISEFFSVGAKQAASAKNE  738



>gb|KDO68402.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68403.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
 gb|KDO68404.1| hypothetical protein CISIN_1g004750mg [Citrus sinensis]
Length=732

 Score =   241 bits (614),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLLSTIP+LI SLVVLVL +VI +GSV HA +ST+ V+LYFC FVMG
Sbjct  574  VAMRLMDISGRRTLLLSTIPILITSLVVLVLSSVIKMGSVVHASISTVSVVLYFCCFVMG  633

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTYSLPV+L+S+GLAGVFG+YAVVC
Sbjct  634  FGPIPNILCSEIFPTRVRGICIAICALVFWIGDIIVTYSLPVLLNSVGLAGVFGMYAVVC  693

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISWIFVF++VPETKGMPLEVITEFFAVGA QA+ AKN 
Sbjct  694  VISWIFVFIKVPETKGMPLEVITEFFAVGASQADAAKNN  732



>emb|CDP07261.1| unnamed protein product [Coffea canephora]
Length=737

 Score =   241 bits (614),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 145/152 (95%), Gaps = 0/152 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM FMD+SGRR LLLSTIPVL  SLV+LV+ NV++LG++AHAV+ST+CV+LYFC FVMG
Sbjct  582  VAMWFMDLSGRRALLLSTIPVLTVSLVILVVANVVDLGTIAHAVMSTLCVVLYFCCFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGP+PNILCAEIFPTRVRG CIAIC+LV+WICDVIVTY+LPV+LSS+GLAGVFGIYAVVC
Sbjct  642  YGPVPNILCAEIFPTRVRGLCIAICSLVYWICDVIVTYTLPVLLSSIGLAGVFGIYAVVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQ  311
            VISW+FVFLRVPETKGMPLEVITEFFAVGA++
Sbjct  702  VISWVFVFLRVPETKGMPLEVITEFFAVGAKK  733



>ref|XP_006422393.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
 gb|ESR35633.1| hypothetical protein CICLE_v10027893mg [Citrus clementina]
Length=732

 Score =   240 bits (613),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLLSTIP+LI SLVVLVL +VI +GSV HA +ST+ V+LYFC FVMG
Sbjct  574  VAMRLMDISGRRTLLLSTIPILITSLVVLVLSSVIKMGSVVHASISTVSVVLYFCCFVMG  633

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTYSLPV+L S+GLAGVFG+YAVVC
Sbjct  634  FGPIPNILCSEIFPTRVRGICIAICALVFWIGDIIVTYSLPVLLKSVGLAGVFGMYAVVC  693

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISWIFVF++VPETKGMPLEVITEFFAVGA QA+ AKN 
Sbjct  694  VISWIFVFIKVPETKGMPLEVITEFFAVGASQADAAKNN  732



>ref|XP_007135975.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
 gb|ESW07969.1| hypothetical protein PHAVU_009G007600g [Phaseolus vulgaris]
Length=736

 Score =   240 bits (612),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AM+ MDVSGRR LLL+TIPVLI SL++LV+G+++N G+V HA +ST CV++YFC FVMG
Sbjct  578  LAMKLMDVSGRRQLLLTTIPVLIVSLIILVIGSLVNFGNVVHAAISTTCVVVYFCCFVMG  637

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFWI D+I+TYSLPVMLSS+GL GVF IYAVVC
Sbjct  638  YGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIITYSLPVMLSSLGLGGVFAIYAVVC  697

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISWIFVFL+VPETKGMPLEVI+EFF+VGARQA  AKNE
Sbjct  698  FISWIFVFLKVPETKGMPLEVISEFFSVGARQAATAKNE  736



>ref|XP_010446942.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446943.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
 ref|XP_010446944.1| PREDICTED: monosaccharide-sensing protein 2 [Camelina sativa]
Length=739

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIP+LI SL+VLV+ N++ + S+ HAVLST+ V+LYFC FVMG
Sbjct  581  VAMRLMDLSGRRTLLLTTIPILIASLLVLVISNIVQMNSIVHAVLSTVSVVLYFCFFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC
Sbjct  641  FGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW+FVF++VPETKGMPLEVITEFF++GARQAE AK++
Sbjct  701  CISWVFVFIKVPETKGMPLEVITEFFSLGARQAEAAKHD  739



>ref|XP_008358445.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=256

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD++GRR+LLL TIPVL+ SLV+LVLG+++N+GSV +A +ST+ V+LYFC FVMG
Sbjct  98   IAMRLMDIAGRRSLLLGTIPVLVASLVILVLGSLVNMGSVVNASVSTVSVVLYFCFFVMG  157

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GLAGVFG+YAVV 
Sbjct  158  FGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKSVGLAGVFGMYAVVS  217

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VI++IF+FL+VPETKGMPLEVITEFF+VGA+QA  AKN 
Sbjct  218  VIAFIFIFLKVPETKGMPLEVITEFFSVGAKQASAAKNN  256



>gb|KJB14185.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=691

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MD+SGRR LLL+TIPVLI SL++LV   +++LG+V +A +ST CVI+YFC FVMG
Sbjct  533  VAMKLMDISGRRRLLLTTIPVLIVSLIILVFSELVDLGTVVNAAISTACVIVYFCCFVMG  592

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LPVMLSS+GLAG+FGIYAVVC
Sbjct  593  YGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLSSIGLAGIFGIYAVVC  652

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            +ISW+FVFL+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  653  LISWVFVFLKVPETKGMPLEVITEFFAVGARQAGATKNE  691



>emb|CDX69128.1| BnaC01g03250D [Brassica napus]
Length=683

 Score =   238 bits (608),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIP+LI SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG
Sbjct  525  VAMRLMDLSGRRTLLLTTIPILIASLIVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMG  584

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC
Sbjct  585  FGPTPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAVVC  644

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW FV+L+VPETKGMPLEVITEFF++GARQAE  KN 
Sbjct  645  CISWAFVYLKVPETKGMPLEVITEFFSLGARQAEAEKNN  683



>gb|KJB14177.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14178.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14179.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14180.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14181.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
 gb|KJB14184.1| hypothetical protein B456_002G113400 [Gossypium raimondii]
Length=739

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MD+SGRR LLL+TIPVLI SL++LV   +++LG+V +A +ST CVI+YFC FVMG
Sbjct  581  VAMKLMDISGRRRLLLTTIPVLIVSLIILVFSELVDLGTVVNAAISTACVIVYFCCFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LPVMLSS+GLAG+FGIYAVVC
Sbjct  641  YGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLSSIGLAGIFGIYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            +ISW+FVFL+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  701  LISWVFVFLKVPETKGMPLEVITEFFAVGARQAGATKNE  739



>gb|KHG10189.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MD+SGRR LLL+TIPVLI SL++LV   +++LG+V +A +ST CVI+YFC FVMG
Sbjct  581  VAMKLMDISGRRRLLLTTIPVLIVSLIILVFSELVDLGTVVNAAISTACVIVYFCCFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LPVMLSS+GLAG+FGIYAVVC
Sbjct  641  YGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLSSIGLAGIFGIYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            +ISW+FVFL+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  701  LISWVFVFLKVPETKGMPLEVITEFFAVGARQAGATKNE  739



>ref|XP_004500833.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500834.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=736

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MDVSGRR LLL TIPVLI SLV+L+LG++++ G+V HA +ST+CV++YFC FVM 
Sbjct  578  LAMRLMDVSGRRQLLLVTIPVLIASLVILILGSIVDFGNVVHAAISTVCVVVYFCFFVMA  637

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTYSLPVMLSS+GL+GVFG+YAVVC
Sbjct  638  YGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIVTYSLPVMLSSLGLSGVFGVYAVVC  697

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            +ISWIFV+L+VPETKGMPLEVITEFF+VG++QA  AKNE
Sbjct  698  LISWIFVYLKVPETKGMPLEVITEFFSVGSKQAASAKNE  736



>ref|XP_010432297.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
 ref|XP_010432298.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIP+LI SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG
Sbjct  581  VAMRLMDLSGRRTLLLTTIPILIASLLVLVISNIVHMNSIVHAVLSTVSVVLYFCFFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YA+VC
Sbjct  641  FGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAIVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW+FVF++VPETKGMPLEVITEFF++GARQAE AK++
Sbjct  701  CISWVFVFIKVPETKGMPLEVITEFFSLGARQAEAAKHD  739



>gb|KJB79729.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=526

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRR+LLL+T+PVLI SLVVLV+ +V+ +GSV HA +ST+ V+LYFC FVMG
Sbjct  368  VAMRLMDIAGRRSLLLNTLPVLIISLVVLVVASVVKMGSVVHASISTVSVVLYFCFFVMG  427

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLP++L S+GLAGVFG+YAVVC
Sbjct  428  FGPIPNILCAEIFPTRVRGICIAICALTFWICDIIVTYSLPLLLKSVGLAGVFGMYAVVC  487

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FVFL+VPETKGMPLEVITEFFAVGA+Q    K+ 
Sbjct  488  VISWVFVFLKVPETKGMPLEVITEFFAVGAKQIAATKDN  526



>emb|CDY65623.1| BnaCnng48010D [Brassica napus]
Length=675

 Score =   238 bits (606),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIP+LI SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG
Sbjct  517  VAMRLMDLSGRRTLLLTTIPILIASLIVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMG  576

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC
Sbjct  577  FGPTPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAVVC  636

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW FV+L+VPETKGMPLEVITEFF++GARQAE  KN 
Sbjct  637  CISWAFVYLKVPETKGMPLEVITEFFSLGARQAEAEKNN  675



>gb|KHG04802.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
 gb|KHG22590.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
Length=690

 Score =   238 bits (607),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRR+LLLST+PVLI SL+VLV+G+V+ +G+V HA +ST+ V+LYFC FVMG
Sbjct  532  VAMRLMDIAGRRSLLLSTLPVLIISLLVLVIGSVVKMGNVVHAAISTVSVVLYFCFFVMG  591

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIA+CAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC
Sbjct  592  FGPIPNILCAEIFPTRVRGLCIAMCALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAVVC  651

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN 
Sbjct  652  VISWVFVFLKVPETKGMPLEVITEFFSVGAKQVAAAKNN  690



>ref|XP_003603869.1| Monosaccharide-sensing protein [Medicago truncatula]
Length=689

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MDV+GRR LLL TIPVLI SLV+LVLG+VI+ GSV HA +ST+CV++YFC FVMG
Sbjct  531  LAMRLMDVTGRRQLLLVTIPVLIVSLVILVLGSVIDFGSVVHAAISTVCVVVYFCFFVMG  590

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTYSLPVMLSS+GLAGVFG+YA+VC
Sbjct  591  YGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIVTYSLPVMLSSLGLAGVFGVYAIVC  650

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW+FV+L+VPETKGMPLEVITEFF+VG++Q+  AKNE
Sbjct  651  CISWVFVYLKVPETKGMPLEVITEFFSVGSKQSAAAKNE  689



>ref|XP_003603868.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74119.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=730

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MDV+GRR LLL TIPVLI SLV+LVLG+VI+ GSV HA +ST+CV++YFC FVMG
Sbjct  572  LAMRLMDVTGRRQLLLVTIPVLIVSLVILVLGSVIDFGSVVHAAISTVCVVVYFCFFVMG  631

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTYSLPVMLSS+GLAGVFG+YA+VC
Sbjct  632  YGPIPNILCSEIFPTRVRGLCIAICALVFWIGDIIVTYSLPVMLSSLGLAGVFGVYAIVC  691

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW+FV+L+VPETKGMPLEVITEFF+VG++Q+  AKNE
Sbjct  692  CISWVFVYLKVPETKGMPLEVITEFFSVGSKQSAAAKNE  730



>ref|XP_006283193.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 ref|XP_006283194.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16091.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
 gb|EOA16092.1| hypothetical protein CARUB_v10004225mg [Capsella rubella]
Length=740

 Score =   238 bits (608),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/157 (77%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIP+LI SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG
Sbjct  582  VAMRLMDLSGRRTLLLTTIPILIASLLVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YA+VC
Sbjct  642  FGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAIVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
             ISW+FVF++VPETKGMPLEVITEFF+VGARQAE AK
Sbjct  702  CISWVFVFMKVPETKGMPLEVITEFFSVGARQAEAAK  738



>gb|KHG04801.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
 gb|KHG22589.1| Monosaccharide-sensing protein 2 [Gossypium arboreum]
Length=740

 Score =   238 bits (608),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRR+LLLST+PVLI SL+VLV+G+V+ +G+V HA +ST+ V+LYFC FVMG
Sbjct  582  VAMRLMDIAGRRSLLLSTLPVLIISLLVLVIGSVVKMGNVVHAAISTVSVVLYFCFFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIA+CAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC
Sbjct  642  FGPIPNILCAEIFPTRVRGLCIAMCALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAVVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN 
Sbjct  702  VISWVFVFLKVPETKGMPLEVITEFFSVGAKQVAAAKNN  740



>ref|XP_009103100.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 ref|XP_009103156.1| PREDICTED: monosaccharide-sensing protein 2 [Brassica rapa]
 emb|CDX75492.1| BnaA01g02100D [Brassica napus]
Length=740

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIP+LI SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG
Sbjct  582  VAMRLMDLSGRRTLLLTTIPILIASLIVLVISNLVHMNSIVHAVLSTVSVVLYFCFFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC
Sbjct  642  FGPTPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAVVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW FV+L VPETKGMPLEVITEFF+VGARQAE  KN 
Sbjct  702  CISWAFVYLEVPETKGMPLEVITEFFSVGARQAEAEKNN  740



>gb|KJB77472.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
 gb|KJB77475.1| hypothetical protein B456_012G139000 [Gossypium raimondii]
Length=740

 Score =   238 bits (607),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRR+LLLST+PVLI SL+VLV+G+V+ +G+V HA +ST+ V+LYFC FVMG
Sbjct  582  VAMRLMDIAGRRSLLLSTLPVLIISLLVLVIGSVVKMGNVVHAAISTVSVVLYFCFFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIA+CAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC
Sbjct  642  FGPIPNILCAEIFPTRVRGICIAMCALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAVVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN 
Sbjct  702  VISWVFVFLKVPETKGMPLEVITEFFSVGAKQVAAAKNN  740



>ref|XP_010094525.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB56279.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=739

 Score =   237 bits (605),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR LLL+TIPVLI +LV+LV+GN +++GSV HAV+ST+CV++YFC F M 
Sbjct  581  VAMRLMDVSGRRRLLLTTIPVLIVALVILVIGNFLSMGSVIHAVISTVCVVVYFCCFAMA  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALVFW+ D+IVTY+LPVMLSS+GLAG+FGIYA+VC
Sbjct  641  YGPIPNILCSEIFPTRVRGLCIAICALVFWVGDIIVTYTLPVMLSSIGLAGIFGIYAIVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            +ISWIFVFL+VPETKGMPLEVITEFFA+GAR+   AK +
Sbjct  701  IISWIFVFLKVPETKGMPLEVITEFFAIGAREVAEAKKD  739



>ref|XP_007018119.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018120.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 ref|XP_007018121.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15344.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15345.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
 gb|EOY15346.1| Tonoplast monosaccharide transporter2 isoform 1 [Theobroma cacao]
Length=739

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MD+SGRR LLL+TIPVLI SL++LV   +++LG+V +A +ST CVI+YFC FVMG
Sbjct  581  VAMKLMDISGRRRLLLTTIPVLIVSLIILVFSEIVDLGTVVNAAISTACVIIYFCCFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LPVMLSS+GLAGVFGIYAVVC
Sbjct  641  YGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLSSIGLAGVFGIYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VIS +FVFL+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  701  VISLVFVFLKVPETKGMPLEVITEFFAVGARQAAATKNE  739



>ref|XP_007018122.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
 gb|EOY15347.1| Tonoplast monosaccharide transporter2 isoform 4 [Theobroma cacao]
Length=740

 Score =   237 bits (604),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MD+SGRR LLL+TIPVLI SL++LV   +++LG+V +A +ST CVI+YFC FVMG
Sbjct  582  VAMKLMDISGRRRLLLTTIPVLIVSLIILVFSEIVDLGTVVNAAISTACVIIYFCCFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LPVMLSS+GLAGVFGIYAVVC
Sbjct  642  YGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLSSIGLAGVFGIYAVVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VIS +FVFL+VPETKGMPLEVITEFFAVGARQA   KNE
Sbjct  702  VISLVFVFLKVPETKGMPLEVITEFFAVGARQAAATKNE  740



>ref|XP_010437493.1| PREDICTED: monosaccharide-sensing protein 2-like [Camelina sativa]
Length=739

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIP+LI SL+VLV+ N++ + S+ HAVLST  V+LYFC FVMG
Sbjct  581  VAMRLMDLSGRRTLLLTTIPILIASLLVLVVSNIVQMNSIVHAVLSTASVVLYFCFFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YA+VC
Sbjct  641  FGPAPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAIVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
             ISW+FVF++VPETKGMPLEVITEFF++GARQAE AK
Sbjct  701  CISWVFVFIKVPETKGMPLEVITEFFSLGARQAEAAK  737



>ref|XP_010061214.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW68134.1| hypothetical protein EUGRSUZ_F01805 [Eucalyptus grandis]
Length=735

 Score =   236 bits (601),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            V MR MD SGRRTLLL+TIPVLI +LVVLV+  ++ + +V +A++ST CVI+YFC FVM 
Sbjct  577  VGMRLMDTSGRRTLLLTTIPVLIVTLVVLVIFEMLTISTVVNAIISTACVIIYFCCFVMA  636

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGP+PNILC+EIFPTRVRG CIAICALV+WICD+IVTY+LPVMLS+ GLAG+FGIYAVVC
Sbjct  637  YGPVPNILCSEIFPTRVRGLCIAICALVYWICDIIVTYTLPVMLSAFGLAGIFGIYAVVC  696

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FVFL+VPETKGMPLEVITEFF+VGARQ   AKNE
Sbjct  697  VISWVFVFLKVPETKGMPLEVITEFFSVGARQVAAAKNE  735



>dbj|BAJ87413.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=431

 Score =   229 bits (583),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR LLL TIP+LI SL+VLV+ NVI L +V HAVLST+ VI+YFC FVMG
Sbjct  274  VAMRLMDISGRRFLLLGTIPILIASLIVLVVSNVITLSTVPHAVLSTVSVIVYFCCFVMG  333

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLPVML+++GLAGVFGIYA+VC
Sbjct  334  FGPIPNILCAEIFPTRVRGVCIAICALTFWICDIIVTYSLPVMLNAIGLAGVFGIYAIVC  393

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  305
             I+++FV+L+VPETKGMPLEVITEFFAVGA+QA+
Sbjct  394  CIAFVFVYLKVPETKGMPLEVITEFFAVGAKQAQ  427



>ref|XP_007043079.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
 gb|EOX98910.1| Tonoplast monosaccharide transporter2 [Theobroma cacao]
Length=739

 Score =   235 bits (599),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRR+LLL+TIPVLI SL++LV+G+V+ +G+V HA +ST+ V+LYFC FVMG
Sbjct  581  VAMRLMDIAGRRSLLLTTIPVLIISLLILVIGSVVKMGNVVHAAISTVSVVLYFCFFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC
Sbjct  641  FGPIPNILCAEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSVGLAGVFGMYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FVFL+VPETKGMPLEVITEFF+VGARQ   AKN 
Sbjct  701  VISWVFVFLKVPETKGMPLEVITEFFSVGARQVAAAKNN  739



>gb|AJO70165.1| tonoplast monosaccharide transporters 1 [Camellia sinensis]
Length=736

 Score =   234 bits (598),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRRTLLL+TIPVL+ SLV+LV+  +I+LGSV  AV+STICV++YFC FV G
Sbjct  578  VAMRLMDIAGRRTLLLTTIPVLVVSLVILVITELIDLGSVPEAVISTICVVVYFCCFVTG  637

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGP+PNILCAEIFPTRVRG CI ICALV+WI D+IVTYSLPV+L+S+GL GVFGIYA+VC
Sbjct  638  YGPVPNILCAEIFPTRVRGLCITICALVYWIGDIIVTYSLPVLLTSIGLDGVFGIYAIVC  697

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISWIF++L+VPETKGMPLEVITEFFAVGARQAE AK E
Sbjct  698  VISWIFIYLKVPETKGMPLEVITEFFAVGARQAEAAKTE  736



>ref|XP_007137297.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
 gb|ESW09291.1| hypothetical protein PHAVU_009G115500g [Phaseolus vulgaris]
Length=739

 Score =   234 bits (598),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 145/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIPVLI SL++LVLG++++LGS A+A +STI VI+YFC FVMG
Sbjct  579  VAMRLMDISGRRTLLLTTIPVLIASLLILVLGSLVDLGSTANASISTISVIVYFCFFVMG  638

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GLAGVFGIYAVVC
Sbjct  639  FGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSIGLAGVFGIYAVVC  698

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
             I+W+FVFL+VPETKGMPLEVI EFF+VGA+Q + AK
Sbjct  699  FIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQVDDAK  735



>ref|XP_003604104.1| Monosaccharide-sensing protein [Medicago truncatula]
 gb|AES74355.1| tonoplast monosaccharide transporter 2 [Medicago truncatula]
Length=744

 Score =   234 bits (598),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIPVLI SL +LVLG++++LG  A+A +STI V++YFCSFVMG
Sbjct  582  VAMRLMDISGRRTLLLTTIPVLIVSLFILVLGSLVDLGDTANASISTISVVVYFCSFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLPVML+S+GL GVFG+YAVVC
Sbjct  642  FGPVPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYSLPVMLNSVGLGGVFGLYAVVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             I+W+FVFL+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  702  CIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQIDAAKHN  740



>gb|KJB79728.1| hypothetical protein B456_013G064200 [Gossypium raimondii]
Length=739

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRR+LLL+T+PVLI SLVVLV+ +V+ +GSV HA +ST+ V+LYFC FVMG
Sbjct  581  VAMRLMDIAGRRSLLLNTLPVLIISLVVLVVASVVKMGSVVHASISTVSVVLYFCFFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLP++L S+GLAGVFG+YAVVC
Sbjct  641  FGPIPNILCAEIFPTRVRGICIAICALTFWICDIIVTYSLPLLLKSVGLAGVFGMYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FVFL+VPETKGMPLEVITEFFAVGA+Q    K+ 
Sbjct  701  VISWVFVFLKVPETKGMPLEVITEFFAVGAKQIAATKDN  739



>ref|XP_004500684.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500685.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Cicer 
arietinum]
Length=740

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIPVLI SL++LVLG+ ++LGS A+A +STI V++YFC FVMG
Sbjct  582  VAMRLMDISGRRTLLLTTIPVLIVSLLILVLGSFVDLGSTANASISTISVVIYFCFFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLPVML+SMGL GVFG+YAVVC
Sbjct  642  FGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYSLPVMLNSMGLGGVFGLYAVVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             I+W+FV+L+VPETKGMPLEVI EFF+VGA+QAE AK+ 
Sbjct  702  FIAWVFVYLKVPETKGMPLEVIIEFFSVGAKQAETAKHN  740



>gb|KHG05233.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=739

 Score =   233 bits (595),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRR+LLL+T+PVLI SLVVLV+ +V+ +GSV HA +ST+ V+LYFC FVMG
Sbjct  581  VAMRLMDIAGRRSLLLNTLPVLIISLVVLVVASVVKMGSVVHASISTVSVVLYFCFFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLP++L S+GLAGVFG+YAVVC
Sbjct  641  FGPIPNILCAEIFPTRVRGICIAICALTFWICDIIVTYSLPLLLKSVGLAGVFGMYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FVFL+VPETKGMPLEVITEFFAVGA+Q    K+ 
Sbjct  701  VISWVFVFLKVPETKGMPLEVITEFFAVGAKQIAATKDN  739



>ref|XP_010066352.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066353.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066354.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 ref|XP_010066355.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW64228.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=740

 Score =   233 bits (595),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD++GRR+LLLSTIP+LI SL++LVL +VI++GSV HAV+ST+ V+LYFC FVMG
Sbjct  582  IAMRLMDIAGRRSLLLSTIPILIASLIILVLSSVISMGSVVHAVISTVSVVLYFCFFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTRVRG CIAICAL FWI D++VTYSLPVML S+GLAGVFG+YA+VC
Sbjct  642  FGPVPNILCAEIFPTRVRGLCIAICALTFWIGDIVVTYSLPVMLKSVGLAGVFGMYAIVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            +ISW FVF++VPETKGMPLEVITEFF+VGARQA  A+N 
Sbjct  702  LISWGFVFMKVPETKGMPLEVITEFFSVGARQAVAARNN  740



>ref|XP_008237926.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=739

 Score =   233 bits (594),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +A++ MD++GRRTLLL+TIPVL+ SL++L++ N+++LG+V HA LSTICVI+YFC FVM 
Sbjct  581  IAIKLMDIAGRRTLLLTTIPVLVVSLIILIIANLVSLGTVLHAALSTICVIIYFCVFVMA  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTYSLP +L S+GLAGVFGIYAVVC
Sbjct  641  YGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYSLPDLLDSIGLAGVFGIYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VIS+IF+FL+VPETKGMPLEVITEFFAVGARQ   AK+E
Sbjct  701  VISFIFIFLKVPETKGMPLEVITEFFAVGARQVAAAKSE  739



>ref|XP_008373385.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=739

 Score =   232 bits (592),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +A++ MD++GRR LLL+TIPVLI +L++LV+ N++ LGSV HAVLST CVI+YFC FVM 
Sbjct  581  LAIKLMDITGRRMLLLTTIPVLIVALIILVVTNLLTLGSVLHAVLSTTCVIVYFCVFVMA  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTYSLPVML SMGL+G FGIYA VC
Sbjct  641  YGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYSLPVMLDSMGLSGAFGIYAAVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VIS++F+FL+VPETKGMPLEVITEFF+VGARQ   AKNE
Sbjct  701  VISFVFIFLKVPETKGMPLEVITEFFSVGARQVAAAKNE  739



>ref|XP_003518591.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006575765.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Glycine 
max]
 ref|XP_006575766.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Glycine 
max]
 gb|KHN29885.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=711

 Score =   231 bits (590),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIPVLI SL++LV+G+++ L S  +A +ST  VI+YFC FVMG
Sbjct  551  VAMRLMDISGRRTLLLTTIPVLIVSLLILVIGSLVELDSTINAFISTSSVIVYFCCFVMG  610

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GL GVFG+YAVVC
Sbjct  611  FGPIPNILCSEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSVGLGGVFGMYAVVC  670

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +I+W+FVFL+VPETKGMPLEVI EFF+VGA+QA++A N
Sbjct  671  IIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQAQVANN  708



>gb|KHN46863.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=717

 Score =   231 bits (590),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIPVLI SL++LV+G+++ L S  +A +ST  VI+YFC FVMG
Sbjct  559  VAMRLMDISGRRTLLLTTIPVLIVSLLILVIGSLVELDSTINAFISTSSVIVYFCCFVMG  618

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GL GVFG+YAVVC
Sbjct  619  FGPIPNILCSEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSVGLGGVFGMYAVVC  678

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +I+W+FVFL+VPETKGMPLEVI EFF+VGA+QA++A N
Sbjct  679  IIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQAQVANN  716



>ref|XP_007210337.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 ref|XP_007210338.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11536.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
 gb|EMJ11537.1| hypothetical protein PRUPE_ppa001932mg [Prunus persica]
Length=739

 Score =   232 bits (591),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +A++ MD+SGRRTLLL+TIPVL+ +L++L++ N++ LG+V HA LS ICVI+YFC FVM 
Sbjct  581  IAIKLMDISGRRTLLLATIPVLVVTLIILIIANLVTLGTVLHAALSVICVIVYFCCFVMA  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LPV+L S+GLAG+FGIYAVVC
Sbjct  641  YGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVLLDSIGLAGIFGIYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VIS+IF+FL+VPETKGMPLEVITEFFAVGARQ   AK+E
Sbjct  701  VISFIFIFLKVPETKGMPLEVITEFFAVGARQVAAAKSE  739



>ref|XP_008440928.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Cucumis melo]
Length=725

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MDV+GRR+LLLSTIPVLI SL+VLV+G+++++GSVA+A +STI VI YFC FVMG
Sbjct  569  IAMRLMDVAGRRSLLLSTIPVLIISLIVLVVGSMVDMGSVANATISTISVIAYFCCFVMG  628

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILC+EIFPTRVRG CIA+CAL FWI D+IVTYSLPVML+S+GL GVFG YA++C
Sbjct  629  FGPVPNILCSEIFPTRVRGLCIAMCALTFWIGDIIVTYSLPVMLNSIGLGGVFGAYAIIC  688

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
            +ISWIFVFL+VPETKGMPLEVI++FFAVGA+QA+ A 
Sbjct  689  IISWIFVFLKVPETKGMPLEVISDFFAVGAKQADNAD  725



>gb|EMS49950.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=686

 Score =   229 bits (585),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR LLL TIP+LI SL+VLV+ NVINL +V HAVLST+ VI+YFC FVMG
Sbjct  529  VAMRLMDISGRRFLLLGTIPILIASLIVLVVSNVINLSTVPHAVLSTVSVIVYFCCFVMG  588

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLPVML+++GLAGVFGIYAVVC
Sbjct  589  FGPIPNILCAEIFPTRVRGVCIAICALTFWICDIIVTYSLPVMLNAIGLAGVFGIYAVVC  648

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  305
             I+++FV+L+VPETKGMPLEVITEFFAVGA+QA+
Sbjct  649  CIAFVFVYLKVPETKGMPLEVITEFFAVGAKQAQ  682



>ref|XP_010266257.1| PREDICTED: monosaccharide-sensing protein 2 isoform X1 [Nelumbo 
nucifera]
Length=742

 Score =   230 bits (587),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 125/159 (79%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR LLL+TIP+LI SLVVLV+ N++ + SV HA+LSTI V++YFC FV G
Sbjct  585  VAMRLMDISGRRRLLLTTIPILIVSLVVLVVSNIVTMNSVVHAILSTISVVVYFCCFVTG  644

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTY+LPVML+S+GLAGVFGIYAVVC
Sbjct  645  FGPIPNILCSEIFPTRVRGVCIAICALVFWIGDIIVTYTLPVMLTSIGLAGVFGIYAVVC  704

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW+FVFL+VPETKGMPLEVITEFFAVGARQA  AKN+
Sbjct  705  CISWVFVFLKVPETKGMPLEVITEFFAVGARQA-AAKND  742



>gb|KHN19961.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=723

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRRTLLLSTIPVLI +L++LVLG++++LG+ A+A +STI VI+YFC FVMG
Sbjct  565  IAMRLMDISGRRTLLLSTIPVLIVALLILVLGSLVDLGTTANASISTISVIVYFCFFVMG  624

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GLAGVFGIYAV C
Sbjct  625  FGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSLGLAGVFGIYAVAC  684

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             I+W+FVFL+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  685  FIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQVDDAKHN  723



>ref|XP_003526737.1| PREDICTED: monosaccharide-sensing protein 2-like isoform 1 [Glycine 
max]
Length=738

 Score =   230 bits (587),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRRTLLLSTIPVLI +L++LVLG++++LG+ A+A +STI VI+YFC FVMG
Sbjct  580  IAMRLMDISGRRTLLLSTIPVLIVALLILVLGSLVDLGTTANASISTISVIVYFCFFVMG  639

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GLAGVFGIYAV C
Sbjct  640  FGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSLGLAGVFGIYAVAC  699

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             I+W+FVFL+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  700  FIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQVDDAKHN  738



>ref|XP_010686712.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=735

 Score =   230 bits (587),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR+LLL+TIPVLI SLV+LV+   +++GSV HAV+S ICVI+YFC+FVM 
Sbjct  577  VAMRLMDISGRRSLLLATIPVLIASLVILVISCTVSMGSVIHAVISIICVIVYFCTFVMA  636

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAIC LVFWICD+IVTYSLPVML+S+GL G+F IYAVVC
Sbjct  637  YGPIPNILCSEIFPTRVRGVCIAICGLVFWICDIIVTYSLPVMLNSIGLGGIFAIYAVVC  696

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VIS +FV+L+VPETKGMPLEVITEFF+V  +Q E AK E
Sbjct  697  VISLVFVYLKVPETKGMPLEVITEFFSVDPKQLEAAKAE  735



>ref|XP_010090703.1| Monosaccharide-sensing protein 2 [Morus notabilis]
 gb|EXB40422.1| Monosaccharide-sensing protein 2 [Morus notabilis]
Length=740

 Score =   230 bits (587),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR+LLL+TIP+LI SL+VLVLG+V+NLG V HA +ST  V+LYFC FVMG
Sbjct  582  VAMRLMDISGRRSLLLNTIPILIVSLLVLVLGSVVNLGKVFHATISTASVVLYFCFFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML ++GLAGVFG+YAVVC
Sbjct  642  FGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKAVGLAGVFGMYAVVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            +ISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN+
Sbjct  702  IISWVFVFLKVPETKGMPLEVITEFFSVGAKQVAAAKND  740



>ref|XP_010539774.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010539775.1| PREDICTED: monosaccharide-sensing protein 1-like isoform X2 [Tarenaya 
hassleriana]
Length=723

 Score =   230 bits (586),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR LLL+TIPVLI SL+VLVL  ++++ +V +A +ST CV++YFC FVMG
Sbjct  565  VAMRLMDVSGRRALLLATIPVLIASLLVLVLSELVHISTVINAAISTACVVIYFCCFVMG  624

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFW+ D+IVTYSLPV+LSS+GL GVF IYA VC
Sbjct  625  YGPIPNILCSEIFPTRVRGLCIAICAMVFWVGDIIVTYSLPVLLSSIGLVGVFSIYAAVC  684

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            V+SWIFVFL+VPETKGMPLEVITEFFA GA+Q + AK+
Sbjct  685  VVSWIFVFLKVPETKGMPLEVITEFFAYGAQQDQSAKD  722



>ref|XP_003543932.1| PREDICTED: monosaccharide-sensing protein 2-like [Glycine max]
Length=734

 Score =   230 bits (586),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRRTLLLSTIPVLI +L++LVLG++++LGS A+A +STI VI+YFC FVMG
Sbjct  576  IAMRLMDISGRRTLLLSTIPVLIAALLILVLGSLVDLGSTANASISTISVIVYFCFFVMG  635

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GLAGVFGIYAVVC
Sbjct  636  FGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSVGLAGVFGIYAVVC  695

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             I+W+FVFL+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  696  FIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQFDDAKHN  734



>gb|KHN33643.1| Monosaccharide-sensing protein 2 [Glycine soja]
Length=734

 Score =   230 bits (586),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 122/159 (77%), Positives = 146/159 (92%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRRTLLLSTIPVLI +L++LVLG++++LGS A+A +STI VI+YFC FVMG
Sbjct  576  IAMRLMDISGRRTLLLSTIPVLIAALLILVLGSLVDLGSTANASISTISVIVYFCFFVMG  635

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GLAGVFGIYAVVC
Sbjct  636  FGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSVGLAGVFGIYAVVC  695

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             I+W+FVFL+VPETKGMPLEVI EFF+VGA+Q + AK+ 
Sbjct  696  FIAWVFVFLKVPETKGMPLEVIIEFFSVGAKQFDDAKHN  734



>ref|XP_006412119.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412120.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 ref|XP_006412121.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53572.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53573.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
 gb|ESQ53574.1| hypothetical protein EUTSA_v10024517mg [Eutrema salsugineum]
Length=734

 Score =   229 bits (585),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIP+LI SL+VLV+ N++++ S+ HAVLST+ V+LYFC FVMG
Sbjct  578  VAMRLMDLSGRRTLLLTTIPILIASLIVLVISNLVHMNSILHAVLSTVSVVLYFCFFVMG  637

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PNILC+EIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GLAGVFG+YAVVC
Sbjct  638  FGPTPNILCSEIFPTRVRGICIAICALTFWICDIIVTYSLPVLLKSIGLAGVFGMYAVVC  697

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
             ISW+FV+++VPETKGMPLEVITEFF++GARQA
Sbjct  698  CISWVFVYIQVPETKGMPLEVITEFFSLGARQA  730



>ref|XP_002510716.1| sugar transporter, putative [Ricinus communis]
 gb|EEF52903.1| sugar transporter, putative [Ricinus communis]
Length=739

 Score =   229 bits (585),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            V MR MDVSGRR LLL+TIPVLI SLV+L++G  I+LG+VA+A +ST CV++YFC FV  
Sbjct  581  VGMRLMDVSGRRALLLTTIPVLIGSLVILIIGESIDLGTVANAAVSTACVVIYFCCFVTA  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LPVML+S+GL G+F I+AV+C
Sbjct  641  YGPIPNILCSEIFPTRVRGLCIAICALVYWIADIIVTYTLPVMLTSIGLEGIFIIFAVMC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW+FVFL+VPETKGMPLEVITEFFAVGARQA+ AKNE
Sbjct  701  AISWVFVFLKVPETKGMPLEVITEFFAVGARQADAAKNE  739



>ref|XP_004289029.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
 ref|XP_011461449.1| PREDICTED: monosaccharide-sensing protein 2-like [Fragaria vesca 
subsp. vesca]
Length=760

 Score =   230 bits (586),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MDV+GRR+LLL T+P+L  +L+VL+ G ++N+GSV +A +STI V+LYFC+FVMG
Sbjct  600  LAMRLMDVAGRRSLLLGTLPILTVTLLVLIFGQLVNMGSVVNATISTISVVLYFCTFVMG  659

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP++L+S+GLAGVF IYAVVC
Sbjct  660  FGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTLPILLTSIGLAGVFAIYAVVC  719

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
             ISW+FVFL+VPETKGMPLEVI+EFFAVGA+QAEMA+
Sbjct  720  TISWVFVFLKVPETKGMPLEVISEFFAVGAKQAEMAE  756



>dbj|BAJ89532.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=744

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR LLL TIP+LI SL+VLV+ NVI L +V HAVLST+ VI+YFC FVMG
Sbjct  587  VAMRLMDISGRRFLLLGTIPILIASLIVLVVSNVITLSTVPHAVLSTVSVIVYFCCFVMG  646

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLPVML+++GLAGVFGIYA+VC
Sbjct  647  FGPIPNILCAEIFPTRVRGVCIAICALTFWICDIIVTYSLPVMLNAIGLAGVFGIYAIVC  706

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  305
             I+++FV+L+VPETKGMPLEVITEFFAVGA+QA+
Sbjct  707  CIAFVFVYLKVPETKGMPLEVITEFFAVGAKQAQ  740



>emb|CDI66591.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   229 bits (583),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 143/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL TIP+LI SLV+LV+ NVI+LG+VAHAVLST+ VI+YFC FVMG
Sbjct  589  LAMRLMDLSGRRFLLLGTIPILIASLVILVVSNVIDLGTVAHAVLSTVSVIIYFCCFVMG  648

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC
Sbjct  649  FGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVC  708

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
            +I+++FVFL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  709  LIAFVFVFLKVPETKGMPLEVITEFFAVGAKQA  741



>emb|CDY31497.1| BnaC05g16060D [Brassica napus]
Length=632

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR LLL TIPVLI SLV L +  ++ +  V +A LST+CV+LY C FVMG
Sbjct  473  VAMRLMDVSGRRALLLWTIPVLIVSLVALFISELVQISKVVNAALSTVCVVLYICFFVMG  532

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFWICD+IVTYSLPV+LSS+GL GVF IYA VC
Sbjct  533  YGPIPNILCSEIFPTRVRGLCIAICAMVFWICDIIVTYSLPVLLSSIGLVGVFSIYAAVC  592

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FV+L+VPETKGMPLEVIT++FA GA+ +  +K++
Sbjct  593  VISWVFVYLKVPETKGMPLEVITDYFAFGAQASAPSKDD  631



>gb|EAY85098.1| hypothetical protein OsI_06450 [Oryza sativa Indica Group]
Length=689

 Score =   228 bits (580),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL TIPVLI SLVVLV+ NVI+LG+VAHA LSTI VI+YFC FVMG
Sbjct  532  LAMRLMDISGRRFLLLGTIPVLIASLVVLVVSNVIDLGTVAHAALSTISVIIYFCCFVMG  591

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC
Sbjct  592  FGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVC  651

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
             I+++FVFL+VPETKGMPLEVITEFFAVGA+Q +  K
Sbjct  652  SIAFVFVFLKVPETKGMPLEVITEFFAVGAKQMQATK  688



>ref|XP_006647093.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Oryza 
brachyantha]
 ref|XP_006647094.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Oryza 
brachyantha]
Length=746

 Score =   228 bits (582),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 143/157 (91%), Gaps = 0/157 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL TIPVLI SLV+LV+ NVI+LG+V HA LST+ VI+YFC FVMG
Sbjct  589  LAMRLMDISGRRFLLLGTIPVLIASLVILVVSNVIDLGTVPHAALSTVSVIIYFCCFVMG  648

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC
Sbjct  649  FGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVC  708

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
            +I+++FVFL+VPETKGMPLEVITEFFAVGA+Q + AK
Sbjct  709  LIAFVFVFLKVPETKGMPLEVITEFFAVGAKQMQAAK  745



>ref|XP_010909820.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909821.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909822.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909823.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909824.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909825.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909826.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909827.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909828.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
 ref|XP_010909829.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=747

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 142/158 (90%), Gaps = 2/158 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLLSTIP+LI SL+VLV+ N+++LG+V HAVLST+ VI YFC FVMG
Sbjct  592  IAMRLMDISGRRFLLLSTIPILIASLLVLVVSNLVDLGTVVHAVLSTVSVIAYFCCFVMG  651

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FW  D+IVTY+LPVMLSS+GLAGVFGIYA VC
Sbjct  652  FGPIPNILCAEIFPTRVRGVCIAICALTFWFGDIIVTYTLPVMLSSIGLAGVFGIYACVC  711

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +IS +FVFL+VPETKGMPLEVITEFFAVGA+QA  AKN
Sbjct  712  IISLVFVFLKVPETKGMPLEVITEFFAVGAKQA--AKN  747



>emb|CDY29502.1| BnaA06g14680D [Brassica napus]
Length=659

 Score =   226 bits (577),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR LLL TIPVLI SLV L +  ++ +  V +A LST+CV+LY C FVMG
Sbjct  500  VAMRLMDVSGRRALLLWTIPVLIVSLVALFISELVQISKVVNAALSTVCVVLYICFFVMG  559

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFWICD+IVTYSLPV+LSS+GL GVF IYA VC
Sbjct  560  YGPIPNILCSEIFPTRVRGLCIAICAMVFWICDIIVTYSLPVLLSSIGLVGVFSIYAAVC  619

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FV+L+VPETKGMPLEVIT++FA GA+ +  +K++
Sbjct  620  VISWVFVYLKVPETKGMPLEVITDYFAFGAQASAPSKDD  658



>ref|NP_001046359.1| Os02g0229400 [Oryza sativa Japonica Group]
 dbj|BAD26163.1| putative hexose transporter [Oryza sativa Japonica Group]
 dbj|BAF08273.1| Os02g0229400 [Oryza sativa Japonica Group]
 gb|ADG21983.1| tonoplast monosaccharide transporter 2 [Oryza sativa Japonica 
Group]
Length=746

 Score =   228 bits (581),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL TIPVLI SLVVLV+ NVI+LG+VAHA LSTI VI+YFC FVMG
Sbjct  589  LAMRLMDISGRRFLLLGTIPVLIASLVVLVVSNVIDLGTVAHAALSTISVIIYFCCFVMG  648

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC
Sbjct  649  FGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVC  708

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
             I+++FVFL+VPETKGMPLEVITEFFAVGA+Q +  K
Sbjct  709  SIAFVFVFLKVPETKGMPLEVITEFFAVGAKQMQATK  745



>gb|KDO85210.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=523

 Score =   223 bits (569),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVA-HAVLSTICVILYFCSFVM  590
            VAM+ MDV+GRR LLL+TIPVLI SL++LV+   + L S    A +ST CVI+YFC FV 
Sbjct  366  VAMKLMDVAGRRKLLLTTIPVLIVSLIILVISETLQLISPVLKAGISTACVIIYFCCFVA  425

Query  589  GYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVV  410
             YGPIPNILCAEIFPT+VRG CIAICA+ +WICD+IVTY+LPVMLSS+GLAG FG+YAVV
Sbjct  426  AYGPIPNILCAEIFPTKVRGICIAICAMAYWICDIIVTYTLPVMLSSIGLAGAFGVYAVV  485

Query  409  CVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
            C ISW+FVFLRVPETKGMPLEVITEFFAVGARQA  A 
Sbjct  486  CFISWVFVFLRVPETKGMPLEVITEFFAVGARQATKAD  523



>ref|XP_009608796.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608797.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009608798.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=734

 Score =   227 bits (579),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR+LLL TIP+LI +L+VLV+G+++++GSVA A +ST+CV++YFCSFVMG
Sbjct  577  VAMRLMDISGRRSLLLGTIPILIIALIVLVIGSLVSMGSVAKAAISTVCVVMYFCSFVMG  636

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTY+LPVMLSS+GLAGVFGIYA+VC
Sbjct  637  FGPIPNILCSEIFPTRVRGICIAICALVFWIGDIIVTYTLPVMLSSIGLAGVFGIYAIVC  696

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            VISWIFVFL+VPETKGMPLEVI+EFFA+GARQA  AKN
Sbjct  697  VISWIFVFLKVPETKGMPLEVISEFFALGARQAAAAKN  734



>emb|CDI66586.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
 emb|CDI66607.1| putative sugar transporter type 2a protein [Saccharum hybrid 
cultivar R570]
Length=745

 Score =   227 bits (579),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 142/153 (93%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL TIP+LI SLV+LV+ NVI+LG+VAHA LST+ VI+YFC FVMG
Sbjct  589  LAMRLMDLSGRRFLLLGTIPILIASLVILVVSNVIDLGTVAHAALSTVSVIIYFCCFVMG  648

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC
Sbjct  649  FGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVC  708

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
            +I+++FVFL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  709  LIAFVFVFLKVPETKGMPLEVITEFFAVGAKQA  741



>gb|EAZ22316.1| hypothetical protein OsJ_05971 [Oryza sativa Japonica Group]
Length=775

 Score =   228 bits (580),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 142/157 (90%), Gaps = 0/157 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL TIPVLI SLVVLV+ NVI+LG+VAHA LSTI VI+YFC FVMG
Sbjct  618  LAMRLMDISGRRFLLLGTIPVLIASLVVLVVSNVIDLGTVAHAALSTISVIIYFCCFVMG  677

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC
Sbjct  678  FGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVC  737

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
             I+++FVFL+VPETKGMPLEVITEFFAVGA+Q +  K
Sbjct  738  SIAFVFVFLKVPETKGMPLEVITEFFAVGAKQMQATK  774



>ref|XP_009763350.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763351.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009763352.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=734

 Score =   227 bits (579),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR+LLL TIP+LI +L+VLV+GN++++G+VA A +ST+CV++YFCSFVMG
Sbjct  577  VAMRLMDISGRRSLLLGTIPILIIALIVLVIGNLVSMGTVAKAAISTVCVVMYFCSFVMG  636

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICALVFWI D+IVTY+LPVMLSS+GLAGVFGIYA+VC
Sbjct  637  FGPIPNILCSEIFPTRVRGICIAICALVFWIGDIIVTYTLPVMLSSIGLAGVFGIYAIVC  696

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            VISWIFVFL+VPETKGMPLEVI+EFFA+GARQA  AKN
Sbjct  697  VISWIFVFLKVPETKGMPLEVISEFFALGARQAAAAKN  734



>ref|XP_011658085.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis sativus]
Length=734

 Score =   227 bits (579),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MDV+GRR+LLLSTIPVLI SL+VLV+G+++++GSVA+A +STI VI YFC FVMG
Sbjct  581  IAMRLMDVAGRRSLLLSTIPVLIISLIVLVIGSMVDMGSVANATISTISVIAYFCCFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILC+EIFPTRVRG CIA+CAL FW  D+IVTYSLPVML+S+GL GVFG YA++C
Sbjct  641  FGPVPNILCSEIFPTRVRGLCIAMCALTFWTGDIIVTYSLPVMLNSIGLGGVFGAYAIIC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  305
            +ISWIFVFL+VPETKGMPLEVI++FFAVGA+QA+
Sbjct  701  IISWIFVFLKVPETKGMPLEVISDFFAVGAKQAD  734



>gb|EMT06669.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=787

 Score =   228 bits (580),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR LLL TIP+LI SL+VLV+ NVINL +V HAVLST+ VI+YFC FVMG
Sbjct  630  VAMRLMDISGRRFLLLGTIPILIASLIVLVVSNVINLSTVPHAVLSTVSVIVYFCCFVMG  689

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTR RG CIAICAL FWICD+IVTYSLPVML+++GLAGVFGIYAVVC
Sbjct  690  FGPIPNILCAEIFPTRARGVCIAICALTFWICDIIVTYSLPVMLNAIGLAGVFGIYAVVC  749

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  305
             I+++FV+L+VPETKGMPLEVITEFFAVGA+QA+
Sbjct  750  CIAFVFVYLKVPETKGMPLEVITEFFAVGAKQAQ  783



>ref|XP_010548175.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548176.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548177.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
 ref|XP_010548178.1| PREDICTED: monosaccharide-sensing protein 2 [Tarenaya hassleriana]
Length=742

 Score =   227 bits (578),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR+LLL TIP+LI SL+VLV+ N++++ +V HA LST+ ++LYFC FVMG
Sbjct  584  VAMRLMDISGRRSLLLGTIPILIGSLIVLVVSNLVHMDNVVHAALSTVSIVLYFCFFVMG  643

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTRVRG CIAICAL FW  ++I+TY+LPV+L S+GLAGVFG+YA+VC
Sbjct  644  FGPVPNILCAEIFPTRVRGICIAICALAFWTGNIIITYTLPVLLKSIGLAGVFGMYAIVC  703

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             +SWIFVF++VPETKGMPLEVI+EFF+VGARQA  AK++
Sbjct  704  CVSWIFVFVKVPETKGMPLEVISEFFSVGARQAAAAKDD  742



>ref|XP_009340799.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
 ref|XP_009340800.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   227 bits (578),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD++GRR+LLL TIPVLI SLV+LVLG+++N+GSV +A +ST+ V+LYFC FVMG
Sbjct  578  IAMRLMDIAGRRSLLLGTIPVLIVSLVILVLGSLVNMGSVVNASVSTVSVVLYFCFFVMG  637

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GLAGVFG+YAVV 
Sbjct  638  FGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKSVGLAGVFGMYAVVS  697

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VI++IF+FL+VPETKGMPLEVITEFF+VGA+QA  AKN 
Sbjct  698  VIAFIFIFLKVPETKGMPLEVITEFFSVGAKQASAAKNN  736



>gb|KGN49001.1| hypothetical protein Csa_6G509700 [Cucumis sativus]
Length=768

 Score =   227 bits (579),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MDV+GRR+LLLSTIPVLI SL+VLV+G+++++GSVA+A +STI VI YFC FVMG
Sbjct  615  IAMRLMDVAGRRSLLLSTIPVLIISLIVLVIGSMVDMGSVANATISTISVIAYFCCFVMG  674

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILC+EIFPTRVRG CIA+CAL FW  D+IVTYSLPVML+S+GL GVFG YA++C
Sbjct  675  FGPVPNILCSEIFPTRVRGLCIAMCALTFWTGDIIVTYSLPVMLNSIGLGGVFGAYAIIC  734

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  305
            +ISWIFVFL+VPETKGMPLEVI++FFAVGA+QA+
Sbjct  735  IISWIFVFLKVPETKGMPLEVISDFFAVGAKQAD  768



>ref|XP_010680636.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=728

 Score =   227 bits (578),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL+T+PVLI SL++LVL NVI +G+V HA LSTI V++YFC FVMG
Sbjct  570  LAMRLMDISGRRFLLLNTLPVLIGSLIILVLSNVIEMGTVLHATLSTISVVVYFCCFVMG  629

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAIC+L FW  D+IVTYSLP +LSS+GLAGVFGIYAVVC
Sbjct  630  FGPIPNILCSEIFPTRVRGLCIAICSLTFWFGDIIVTYSLPALLSSIGLAGVFGIYAVVC  689

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            ++SW FV+  VPETKGMPLEVI+EFF VGARQAE  KN
Sbjct  690  IVSWFFVYFMVPETKGMPLEVISEFFNVGARQAEAEKN  727



>ref|XP_010690557.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010690558.1| PREDICTED: monosaccharide-sensing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=739

 Score =   227 bits (578),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIPVL  SLVVL+LGN+I + +  HAV+ST+ V+LYFC FVMG
Sbjct  581  VAMRLMDISGRRTLLLTTIPVLFLSLVVLILGNIIKMSTTVHAVISTVSVVLYFCFFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTR+RG CIAICAL FWI D+IVT +LP+ML+++GLAGVFG YAVV 
Sbjct  641  FGPIPNILCAEIFPTRIRGVCIAICALTFWIGDIIVTDTLPIMLNAVGLAGVFGFYAVVS  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VI+WIF+FL+VPETKGMPLEVITEFFA+GARQ    K+ 
Sbjct  701  VIAWIFIFLKVPETKGMPLEVITEFFALGARQPSEDKDN  739



>ref|XP_009149562.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
 ref|XP_009149563.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=721

 Score =   226 bits (577),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR LLL TIPVLI SLV L +  ++ +  V +A LST+CV+LY C FVMG
Sbjct  562  VAMRLMDVSGRRALLLWTIPVLIVSLVALFISELVQISKVVNAALSTVCVVLYICFFVMG  621

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFWICD+IVTYSLPV+LSS+GL GVF IYA VC
Sbjct  622  YGPIPNILCSEIFPTRVRGLCIAICAMVFWICDIIVTYSLPVLLSSIGLVGVFSIYAAVC  681

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FV+L+VPETKGMPLEVIT++FA GA+ +  +K++
Sbjct  682  VISWVFVYLKVPETKGMPLEVITDYFAFGAQASAPSKDD  720



>emb|CBI40753.3| unnamed protein product [Vitis vinifera]
Length=662

 Score =   226 bits (575),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MD+ GRR LLL+TIPVLI +L+VLV+G+++   +V HA +ST CVI+YFC FV  
Sbjct  504  VAMKLMDIVGRRRLLLTTIPVLIVTLLVLVIGDLVTTTTVIHAAISTACVIIYFCCFVTA  563

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LPVML+S+GL G+FGIYAVVC
Sbjct  564  YGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLTSIGLTGIFGIYAVVC  623

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FVFL+VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  624  VISWVFVFLKVPETKGMPLEVIAEFFAVGARQVTAAKND  662



>ref|XP_008464819.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464820.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464821.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
 ref|XP_008464822.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis melo]
Length=729

 Score =   226 bits (577),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR LLL+TIPVLI SL+VLV+  +I + ++ +A +STICV++YFC FVMG
Sbjct  571  VAMRLMDISGRRRLLLATIPVLIVSLLVLVVFELITVSTIVNAAISTICVVVYFCIFVMG  630

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFW  D+IVTYSLPVMLS++GLAGVFGIYAVVC
Sbjct  631  YGPIPNILCSEIFPTRVRGLCIAICAMVFWTGDIIVTYSLPVMLSAIGLAGVFGIYAVVC  690

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
            +ISWIFV+L+VPETKGMPLEVI EFF+VGARQA
Sbjct  691  IISWIFVYLKVPETKGMPLEVIAEFFSVGARQA  723



>ref|XP_010029562.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW56480.1| hypothetical protein EUGRSUZ_I02208 [Eucalyptus grandis]
Length=731

 Score =   226 bits (577),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR+LLLSTIPVLIFSL +LVL +VIN+ ++ +A++ST  VI+YFC FVMG
Sbjct  574  IAMRLMDLSGRRSLLLSTIPVLIFSLFILVLSSVINISTMVNAMISTTSVIVYFCFFVMG  633

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP+MLSS+GL GVF IYAVVC
Sbjct  634  FGPIPNILCSEIFPTRVRGICIAICALTFWIGDIIVTYTLPLMLSSIGLIGVFAIYAVVC  693

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            + SW FVFL+VPETKGMPLEVI+EFFAVGA+QA  A +
Sbjct  694  IASWFFVFLKVPETKGMPLEVISEFFAVGAKQASTATD  731



>ref|XP_008448165.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448166.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448167.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448168.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448169.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448170.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
 ref|XP_008448171.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis melo]
Length=733

 Score =   226 bits (577),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL TIP LI SL++LV+G+++ +GS+ +A +ST+ V++YFC FVMG
Sbjct  575  VAMRLMDISGRRTLLLWTIPALIASLIILVIGSLVQMGSIVNASISTVSVVVYFCFFVMG  634

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LPV+L+S+GL GVFG+YAVVC
Sbjct  635  FGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYTLPVLLNSIGLGGVFGMYAVVC  694

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +ISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN
Sbjct  695  IISWVFVFLKVPETKGMPLEVITEFFSVGAKQLLAAKN  732



>emb|CBI37732.3| unnamed protein product [Vitis vinifera]
Length=644

 Score =   225 bits (573),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR+LLLSTIPVLI +L +LVLG+++N+G V HA +ST  VI+YFC FVMG
Sbjct  488  VAMRLMDISGRRSLLLSTIPVLIIALSILVLGSLVNMGDVVHAAISTASVIIYFCCFVMG  547

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP+ML+S+GLAGVFG+YAVVC
Sbjct  548  FGPVPNILCAEIFPTRVRGLCIAICALSFWIGDIIVTYTLPLMLTSVGLAGVFGMYAVVC  607

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +ISW+FVFL+VPETKGMPLEVI+EFFAVGA  A   KN
Sbjct  608  LISWVFVFLKVPETKGMPLEVISEFFAVGA-SAGQKKN  644



>gb|KCW64229.1| hypothetical protein EUGRSUZ_G01880 [Eucalyptus grandis]
Length=739

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD++GR +LLLSTIP+LI SL++LVL +VI++GSV HAV+ST+ V+LYFC FVMG
Sbjct  582  IAMRLMDIAGR-SLLLSTIPILIASLIILVLSSVISMGSVVHAVISTVSVVLYFCFFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTRVRG CIAICAL FWI D++VTYSLPVML S+GLAGVFG+YA+VC
Sbjct  641  FGPVPNILCAEIFPTRVRGLCIAICALTFWIGDIVVTYSLPVMLKSVGLAGVFGMYAIVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            +ISW FVF++VPETKGMPLEVITEFF+VGARQA  A+N 
Sbjct  701  LISWGFVFMKVPETKGMPLEVITEFFSVGARQAVAARNN  739



>ref|XP_011656904.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis sativus]
 ref|XP_011656905.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis sativus]
 ref|XP_011656906.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis sativus]
 ref|XP_011656908.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis sativus]
 ref|XP_011656909.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis sativus]
 ref|XP_011656910.1| PREDICTED: monosaccharide-sensing protein 2 [Cucumis sativus]
 gb|KGN46648.1| hypothetical protein Csa_6G118280 [Cucumis sativus]
Length=733

 Score =   226 bits (576),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL TIP LI SLV+LV+G+++ +GS+ +A +ST+ V++YFC FVMG
Sbjct  575  VAMRLMDISGRRTLLLWTIPALIASLVILVIGSLVQMGSILNASISTVSVVVYFCFFVMG  634

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LPV+L+S+GL GVFG+YAVVC
Sbjct  635  FGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYTLPVLLNSIGLGGVFGMYAVVC  694

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +ISW+FVFL+VPETKGMPLEVITEFF+VGA+Q   AKN
Sbjct  695  IISWVFVFLKVPETKGMPLEVITEFFSVGAKQLLSAKN  732



>ref|XP_004300112.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011465026.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=738

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 141/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AM+ MD++GRR LLLST+PVLI SL++LV+ N+++L SV  A +ST CV++YFC FVM 
Sbjct  580  LAMKLMDIAGRRMLLLSTLPVLIVSLILLVIANLVSLSSVVEAAISTTCVVIYFCVFVMA  639

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+I+TYSLPV+L S+GLAG+FG+YA+VC
Sbjct  640  YGPIPNILCSEIFPTRVRGLCIAICALVYWISDIIITYSLPVLLDSIGLAGIFGLYAIVC  699

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VIS +F++L+VPETKGMPLEVITEFF+VGARQ   AKNE
Sbjct  700  VISLVFIYLKVPETKGMPLEVITEFFSVGARQIAAAKNE  738



>emb|CAN59780.1| hypothetical protein VITISV_024656 [Vitis vinifera]
Length=740

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MD+ GRR LLL+TIPVLI +L+VLV+G+++   +V HA +ST CVI+YFC FV  
Sbjct  582  VAMKLMDIVGRRRLLLTTIPVLIVTLLVLVIGDLVTTTTVIHAAISTACVIIYFCCFVTA  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LPVML+S+GL G+FGIYAVVC
Sbjct  642  YGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLTSIGLTGIFGIYAVVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FVFL+VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  702  VISWVFVFLKVPETKGMPLEVIAEFFAVGARQVTAAKND  740



>ref|XP_002282975.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37148.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=739

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR+LLLSTIPVLI +L +LVLG+++N+G V HA +ST  VI+YFC FVMG
Sbjct  583  VAMRLMDISGRRSLLLSTIPVLIIALSILVLGSLVNMGDVVHAAISTASVIIYFCCFVMG  642

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP+ML+S+GLAGVFG+YAVVC
Sbjct  643  FGPVPNILCAEIFPTRVRGLCIAICALSFWIGDIIVTYTLPLMLTSVGLAGVFGMYAVVC  702

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +ISW+FVFL+VPETKGMPLEVI+EFFAVGA  A   KN
Sbjct  703  LISWVFVFLKVPETKGMPLEVISEFFAVGA-SAGQKKN  739



>ref|XP_008778122.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778123.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778124.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778125.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008778126.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=747

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLLSTIP+LI +L+VLV+ N++++G+VAHAVLST  VI YFC FVMG
Sbjct  592  IAMRLMDISGRRFLLLSTIPILIAALLVLVVANLVDIGTVAHAVLSTFSVIAYFCCFVMG  651

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTRVRG CIAICAL FW  D+IVTY+LPVML+S+GLAGVFGIYA VC
Sbjct  652  FGPVPNILCAEIFPTRVRGVCIAICALTFWFGDIIVTYTLPVMLTSIGLAGVFGIYACVC  711

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
            VIS +FVFL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  712  VISLVFVFLKVPETKGMPLEVITEFFAVGAKQA  744



>ref|XP_009392211.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=732

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR+LLL+TIPVLI SLV LVL N+++LGSVAHA+ STICV++YFC FVMG
Sbjct  577  VAMRLMDVSGRRSLLLATIPVLIVSLVGLVLTNLVDLGSVAHAIFSTICVVVYFCCFVMG  636

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAIC+L FW CD+IVTYSLPVML+++GLAGVFGIYA+VC
Sbjct  637  FGPIPNILCSEIFPTRVRGVCIAICSLTFWFCDIIVTYSLPVMLNTIGLAGVFGIYAIVC  696

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQ  311
            VI+ +FVFL++PETKGMPLEVI EFF VG++Q
Sbjct  697  VIALVFVFLKIPETKGMPLEVIIEFFNVGSKQ  728



>ref|NP_001267873.1| hexose transporter-like [Vitis vinifera]
 gb|AAY40466.1| putative hexose transporter [Vitis vinifera]
 gb|ADP37147.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=740

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MD+ GRR LLL+TIPVLI +L+VLV+G+++   +V HA +ST CVI+YFC FV  
Sbjct  582  VAMKLMDIVGRRRLLLTTIPVLIVTLLVLVIGDLVTTTTVIHAAISTACVIIYFCCFVTA  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LPVML+S+GL G+FGIYAVVC
Sbjct  642  YGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLTSIGLTGIFGIYAVVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FVFL+VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  702  VISWVFVFLKVPETKGMPLEVIAEFFAVGARQVTAAKND  740



>ref|XP_009390770.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=741

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 143/158 (91%), Gaps = 1/158 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL TIP+LI SL+VLV+ N++ LG+V HAVLST+ VI+YFC FVMG
Sbjct  585  IAMRLMDMSGRRFLLLFTIPILIASLIVLVVANLVELGNVVHAVLSTVSVIVYFCCFVMG  644

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LPVML ++GLAGVFGIYA+VC
Sbjct  645  FGPVPNILCAEIFPTRVRGVCIAICALTFWIGDIIVTYTLPVMLDTIGLAGVFGIYAIVC  704

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            VI+++FVFL+VPETKGMPLEVITEFFAVGA+QA  A+N
Sbjct  705  VIAFVFVFLKVPETKGMPLEVITEFFAVGAKQA-AARN  741



>gb|AFP89954.1| tonoplastic transporter 2 [Vitis vinifera]
Length=739

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 141/158 (89%), Gaps = 1/158 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR+LLLSTIPVLI +L +LVLG+++N+G V HA +ST  VI+YFC FVMG
Sbjct  583  VAMRLMDISGRRSLLLSTIPVLIIALAILVLGSLVNMGDVVHAAISTASVIIYFCCFVMG  642

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP+ML+S+GLAGVFG+YA+VC
Sbjct  643  FGPVPNILCAEIFPTRVRGLCIAICALSFWIGDIIVTYTLPLMLTSVGLAGVFGMYAIVC  702

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +ISW+FVFL+VPETKGMPLEVI+EFFAVGA  A   KN
Sbjct  703  LISWVFVFLKVPETKGMPLEVISEFFAVGA-SAGQKKN  739



>ref|XP_011040809.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040810.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011040811.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 145/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIPVLI SL++LVLG++++LGSV +A +ST+ V+LYFC FVMG
Sbjct  580  VAMRLMDISGRRTLLLTTIPVLIVSLILLVLGSMVDLGSVVNASISTVSVVLYFCFFVMG  639

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML S+GLAGVFG+YAVVC
Sbjct  640  FGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLKSVGLAGVFGLYAVVC  699

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            +IS++FV+L+VPETKGMPLEVI+EFFAVGA+Q   AK  
Sbjct  700  IISFVFVYLKVPETKGMPLEVISEFFAVGAKQVAAAKEN  738



>gb|AAX47312.1| hexose transporter 6 [Vitis vinifera]
Length=740

 Score =   225 bits (573),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 139/159 (87%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MD+ GRR +LL+TIPVLI +L+VLV+G+++   +V HA +ST CVI+YFC FV  
Sbjct  582  VAMKLMDIVGRRRMLLTTIPVLIVTLLVLVIGDLVTTTTVIHAAISTACVIIYFCCFVTA  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LPVML+S+GL G+FGIYAVVC
Sbjct  642  YGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLTSIGLTGIFGIYAVVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FVFL+VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  702  VISWVFVFLKVPETKGMPLEVIAEFFAVGARQVTAAKND  740



>ref|XP_007142576.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
 gb|ESW14570.1| hypothetical protein PHAVU_008G292400g [Phaseolus vulgaris]
Length=732

 Score =   224 bits (572),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 142/156 (91%), Gaps = 2/156 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIPVL+ SL++LV+G++I+  S  +A +ST+ VI+YFC FVMG
Sbjct  572  VAMRLMDISGRRTLLLTTIPVLVASLLILVVGSLIDFNSGVNAFISTLSVIVYFCCFVMG  631

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICAL FWICD+IVTY+LPVML+S+GL GVFG+YAVVC
Sbjct  632  FGPIPNILCSEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLNSVGLGGVFGMYAVVC  691

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVG--ARQAE  305
            +++W+FVFL+VPETKGMPLEVITEFF+VG  A+QAE
Sbjct  692  IVAWVFVFLKVPETKGMPLEVITEFFSVGAKAKQAE  727



>ref|XP_004951395.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=745

 Score =   224 bits (572),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 141/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL TIP+LI SLVVLV+ NV++LG+V HA LST+ VI+YFC FVMG
Sbjct  589  LAMRLMDLSGRRFLLLGTIPILIASLVVLVISNVVDLGTVPHAALSTVSVIIYFCCFVMG  648

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC
Sbjct  649  FGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVC  708

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
            +IS++FVFL+VPETKGMPLEVI+EFFAVGA+QA
Sbjct  709  MISFVFVFLKVPETKGMPLEVISEFFAVGAKQA  741



>ref|XP_003571780.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=749

 Score =   224 bits (572),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 123/157 (78%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL TIP+LI SLVVLV+ NVINL +V HAVLST+ VI+YFC FVMG
Sbjct  592  LAMRLMDISGRRFLLLGTIPILIASLVVLVVSNVINLSTVPHAVLSTVSVIVYFCCFVMG  651

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML+++GLAGVFGIYAVVC
Sbjct  652  FGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVC  711

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
             I+++FV+L+VPETKGMPLEVITEFFAVGA+QA   K
Sbjct  712  CIAFVFVYLKVPETKGMPLEVITEFFAVGAKQAMTNK  748



>gb|AIN39841.1| hypothetical protein [Zoysia matrella]
Length=744

 Score =   224 bits (571),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL TIPVLI SL++LV+ NVI+ G+V HA LST+ VI+YFC FVMG
Sbjct  588  LAMRLMDISGRRFLLLGTIPVLIASLIILVVSNVIDFGTVPHAALSTVSVIIYFCCFVMG  647

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICA+ FWI D+IVTYSLPVML+++GLAGVFGIYAVVC
Sbjct  648  FGPIPNILCAEIFPTRVRGLCIAICAMTFWIGDIIVTYSLPVMLNAIGLAGVFGIYAVVC  707

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
             I+++FVFL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  708  AIAFVFVFLKVPETKGMPLEVITEFFAVGAKQA  740



>ref|XP_010537220.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537221.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
 ref|XP_010537222.1| PREDICTED: monosaccharide-sensing protein 1-like [Tarenaya hassleriana]
Length=735

 Score =   224 bits (571),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR LLLSTIPVLI SL+VLVL  ++++ +V +A +ST CV++YFC FVMG
Sbjct  577  VAMRLMDVSGRRALLLSTIPVLIVSLLVLVLSELVHISTVVNAAISTGCVVIYFCCFVMG  636

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFW+ D+IVTYSLPV+L S+GL GVFGIYA VC
Sbjct  637  YGPIPNILCSEIFPTRVRGLCIAICAIVFWVGDIIVTYSLPVLLGSIGLVGVFGIYAAVC  696

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            ++SWIFVFL+VPETKGMPLEVITEFFA GA+Q   AK+
Sbjct  697  IVSWIFVFLKVPETKGMPLEVITEFFAYGAQQDLSAKD  734



>gb|AIQ77649.1| tonoplastic transporter 1 [Vitis vinifera]
Length=740

 Score =   224 bits (571),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  763  AMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGY  584
            AM+ MD+ GRR LLL+TIPVLI +L+VLV+G+++   +V HA +ST CVI+YFC FV  Y
Sbjct  583  AMKLMDIVGRRRLLLTTIPVLIVTLLVLVIGDLVTTTTVIHAAISTACVIIYFCCFVTAY  642

Query  583  GPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCV  404
            GPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY+LPVML+S+GL G+FGIYAVVCV
Sbjct  643  GPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIVTYTLPVMLTSIGLTGIFGIYAVVCV  702

Query  403  ISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            ISW+FVFL+VPETKGMPLEVI EFFAVGARQ   AKN+
Sbjct  703  ISWVFVFLKVPETKGMPLEVIAEFFAVGARQVTAAKND  740



>ref|XP_010678631.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010678632.1| PREDICTED: monosaccharide-sensing protein 2-like [Beta vulgaris 
subsp. vulgaris]
Length=735

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 138/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIPVL  SLVVL+L NVI + +  +AV+ST+ V+LYFC FVMG
Sbjct  581  VAMRLMDLSGRRTLLLTTIPVLFLSLVVLILANVIKMNTTVYAVVSTVAVVLYFCFFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPT++RG CIAICAL FWICD+IVTY+LP+ML ++GLAG+FG YAVV 
Sbjct  641  FGPIPNILCAEIFPTKIRGVCIAICALTFWICDIIVTYTLPMMLKAVGLAGLFGFYAVVI  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
            +I+WIF+FL+VPETKGMPLEVITEFFA+GARQA
Sbjct  701  LIAWIFIFLKVPETKGMPLEVITEFFALGARQA  733



>gb|KDO85208.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=706

 Score =   223 bits (567),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVA-HAVLSTICVILYFCSFVM  590
            VAM+ MDV+GRR LLL+TIPVLI SL++LV+   + L S    A +ST CVI+YFC FV 
Sbjct  549  VAMKLMDVAGRRKLLLTTIPVLIVSLIILVISETLQLISPVLKAGISTACVIIYFCCFVA  608

Query  589  GYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVV  410
             YGPIPNILCAEIFPT+VRG CIAICA+ +WICD+IVTY+LPVMLSS+GLAG FG+YAVV
Sbjct  609  AYGPIPNILCAEIFPTKVRGICIAICAMAYWICDIIVTYTLPVMLSSIGLAGAFGVYAVV  668

Query  409  CVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
            C ISW+FVFLRVPETKGMPLEVITEFFAVGARQA  A 
Sbjct  669  CFISWVFVFLRVPETKGMPLEVITEFFAVGARQATKAD  706



>ref|XP_002467580.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
 gb|EER94578.1| hypothetical protein SORBIDRAFT_01g030430 [Sorghum bicolor]
Length=740

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL+TIP+LI +L +LV+ N++++G++ HA LSTI VI+YFC FVMG
Sbjct  582  IAMRLMDMSGRRFLLLATIPILIVALAILVVVNIVDVGTMVHAALSTISVIVYFCFFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYAVVC
Sbjct  642  FGPIPNILCAEIFPTTVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAVVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            +++ +FVF++VPETKGMPLEVITEFF+VGA+QA+ A+ +
Sbjct  702  ILALVFVFIKVPETKGMPLEVITEFFSVGAKQAKEARED  740



>dbj|BAJ90138.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   223 bits (569),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLLSTIPVLI +L +LVL NV+++G++ HA LSTI VI+YFC FVMG
Sbjct  586  IAMRLMDMSGRRFLLLSTIPVLIVALAILVLVNVLDVGTMVHAALSTISVIVYFCFFVMG  645

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYAVVC
Sbjct  646  FGPIPNILCAEIFPTSVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAVVC  705

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +I+++FV+++VPETKGMPLEVITEFF+VGA+Q + A +
Sbjct  706  MIAFVFVYMKVPETKGMPLEVITEFFSVGAKQGKEATD  743



>emb|CAD58958.1| hexose transporter [Hordeum vulgare subsp. vulgare]
Length=743

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLLSTIPVLI +L +LVL NV+++G++ HA LSTI VI+YFC FVMG
Sbjct  586  IAMRLMDMSGRRFLLLSTIPVLIVALAILVLVNVLDVGTMVHAALSTISVIVYFCFFVMG  645

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYAVVC
Sbjct  646  FGPIPNILCAEIFPTSVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAVVC  705

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +I+++FV+++VPETKGMPLEVITEFF+VGA+Q + A +
Sbjct  706  MIAFVFVYMKVPETKGMPLEVITEFFSVGAKQGKEATD  743



>ref|XP_006435423.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 ref|XP_006473839.1| PREDICTED: monosaccharide-sensing protein 2-like [Citrus sinensis]
 gb|ESR48663.1| hypothetical protein CICLE_v10000400mg [Citrus clementina]
 gb|KDO85209.1| hypothetical protein CISIN_1g004673mg [Citrus sinensis]
Length=738

 Score =   223 bits (568),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVA-HAVLSTICVILYFCSFVM  590
            VAM+ MDV+GRR LLL+TIPVLI SL++LV+   + L S    A +ST CVI+YFC FV 
Sbjct  581  VAMKLMDVAGRRKLLLTTIPVLIVSLIILVISETLQLISPVLKAGISTACVIIYFCCFVA  640

Query  589  GYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVV  410
             YGPIPNILCAEIFPT+VRG CIAICA+ +WICD+IVTY+LPVMLSS+GLAG FG+YAVV
Sbjct  641  AYGPIPNILCAEIFPTKVRGICIAICAMAYWICDIIVTYTLPVMLSSIGLAGAFGVYAVV  700

Query  409  CVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
            C ISW+FVFLRVPETKGMPLEVITEFFAVGARQA  A 
Sbjct  701  CFISWVFVFLRVPETKGMPLEVITEFFAVGARQATKAD  738



>ref|XP_006416357.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 ref|XP_006416358.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34710.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
 gb|ESQ34711.1| hypothetical protein EUTSA_v10006916mg [Eutrema salsugineum]
Length=733

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR LLL TIPVLI SL+VLV   ++++  V +A LST CV+LYFC FVMG
Sbjct  575  VAMRLMDVSGRRALLLWTIPVLIISLIVLVFSELVHISKVINAALSTACVVLYFCFFVMG  634

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VC
Sbjct  635  YGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVC  694

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            VISWIFV+L+VPETKGMPLEVIT++FA GA+ +  +K+
Sbjct  695  VISWIFVYLKVPETKGMPLEVITDYFAFGAQASAPSKD  732



>dbj|BAJ33724.1| unnamed protein product [Thellungiella halophila]
Length=733

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR LLL TIPVLI SL+VLV   ++++  V +A LST CV+LYFC FVMG
Sbjct  575  VAMRLMDVSGRRALLLWTIPVLIISLIVLVFSELVHISKVINAALSTACVVLYFCFFVMG  634

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VC
Sbjct  635  YGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVC  694

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            VISWIFV+L+VPETKGMPLEVIT++FA GA+ +  +K+
Sbjct  695  VISWIFVYLKVPETKGMPLEVITDYFAFGAQASAPSKD  732



>ref|XP_009401004.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401005.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   223 bits (567),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLLSTIPVLI SLVVLV+ N++++G+V HAVLST+ V++YFC FVMG
Sbjct  583  LAMRLMDISGRRFLLLSTIPVLISSLVVLVVANLVDMGTVVHAVLSTVSVVIYFCCFVMG  642

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LPVML+S+GLAGVFGIYAVVC
Sbjct  643  FGPIPNILCAEIFPTRVRGVCIAICALTFWIGDIIVTYTLPVMLNSIGLAGVFGIYAVVC  702

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
             I+ +FVFL+VPETKGMPLEVI E FAVGA+QA
Sbjct  703  TIALVFVFLKVPETKGMPLEVIMEIFAVGAKQA  735



>ref|XP_009397963.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397964.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009397965.1| PREDICTED: monosaccharide-sensing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/155 (76%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR LLLSTIPVLI SLVVLV+ N++++G+V HAVLST+ V++YFC FVMG
Sbjct  583  VAMRLMDISGRRFLLLSTIPVLIASLVVLVVANLVDMGTVVHAVLSTVSVVVYFCCFVMG  642

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FW  D+IVTY+LPV+L+ +GLAGVFGIYAVVC
Sbjct  643  FGPIPNILCAEIFPTRVRGVCIAICALTFWFGDIIVTYTLPVLLNMIGLAGVFGIYAVVC  702

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEM  302
             ++ +FVFL+VPETKGMPLEVITEFFAVGA+QA +
Sbjct  703  TLALVFVFLKVPETKGMPLEVITEFFAVGAKQAAL  737



>ref|XP_003574265.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=741

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL+TIP+LI +L +LVL N++++G++ HA LSTI VI+YFC FVMG
Sbjct  584  IAMRLMDMSGRRFLLLTTIPILIVALAILVLVNILDVGTMVHAALSTISVIVYFCFFVMG  643

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYAVVC
Sbjct  644  FGPIPNILCAEIFPTSVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAVVC  703

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +++++FV+++VPETKGMPLEVITEFF+VGA+Q + A++
Sbjct  704  ILAFVFVYMKVPETKGMPLEVITEFFSVGAKQGKEARD  741



>ref|XP_008382498.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008382499.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   222 bits (566),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD++GRR+LLL TIPVL+ SLV+LVLG+++N+GSV +A +ST+ V+LYFC FVMG
Sbjct  578  IAMRLMDIAGRRSLLLGTIPVLVXSLVILVLGSLVNMGSVVNASVSTVSVVLYFCFFVMG  637

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GLAGVFG+YAVV 
Sbjct  638  FGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKSVGLAGVFGMYAVVS  697

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VI++IF+FL+VPETKGMPLEVITEFF+VGA+QA  AKN 
Sbjct  698  VIAFIFIFLKVPETKGMPLEVITEFFSVGAKQASAAKNN  736



>emb|CAN80213.1| hypothetical protein VITISV_042076 [Vitis vinifera]
Length=739

 Score =   222 bits (565),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 139/158 (88%), Gaps = 1/158 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR+LLLSTIPVLI +L +LVLG+++N+G V HA +ST  VI+YFC FVMG
Sbjct  583  VAMRLMDISGRRSLLLSTIPVLIIALAILVLGSLVNMGDVVHAAISTASVIIYFCCFVMG  642

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP+ML+S+GLAGVFG+YA VC
Sbjct  643  FGPVPNILCAEIFPTRVRGLCIAICALSFWIGDIIVTYTLPLMLTSVGLAGVFGMYAXVC  702

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +ISW+FVFL+VPETKGMPLEVI+EFFAVG   A   KN
Sbjct  703  LISWVFVFLKVPETKGMPLEVISEFFAVGX-SAGQKKN  739



>ref|XP_010459775.1| PREDICTED: monosaccharide-sensing protein 1-like [Camelina sativa]
Length=655

 Score =   221 bits (562),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR+LLL TIPVLI SL++LV+  ++++  V +A LST CV+LYFC FVMG
Sbjct  495  VAMRLMDVSGRRSLLLWTIPVLIVSLIILVISELVHISKVVNAALSTSCVVLYFCFFVMG  554

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VC
Sbjct  555  YGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVC  614

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISWIFV+++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  615  VISWIFVYMKVPETKGMPLEVITDYFAFGAQAQASAPSK  653



>emb|CDP14489.1| unnamed protein product [Coffea canephora]
Length=742

 Score =   222 bits (565),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 142/160 (89%), Gaps = 1/160 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR +D++GRR+LLL TIPVL+ +LV+LV+G+V+N+G V +A +ST+CV+LYFC FVMG
Sbjct  583  IAMRLVDIAGRRSLLLWTIPVLLITLVILVIGSVVNMGKVGNAAVSTVCVVLYFCFFVMG  642

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILC+EIFPTRVRG CIA+C L +WI D+IVTY+LPVMLSSMGL GVFG YAVVC
Sbjct  643  FGPVPNILCSEIFPTRVRGVCIALCCLTYWIGDIIVTYTLPVMLSSMGLGGVFGTYAVVC  702

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA-EMAKNE  290
            +ISW F FL+VPETKGMPLEVI+EFF+VGARQA  +AKN 
Sbjct  703  IISWFFAFLKVPETKGMPLEVISEFFSVGARQAVAIAKNN  742



>ref|XP_010477336.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
 ref|XP_010477338.1| PREDICTED: monosaccharide-sensing protein 1 [Camelina sativa]
Length=734

 Score =   221 bits (563),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR+LLL TIPVLI SL++LV+  ++++  V +A LST CV+LYFC FVMG
Sbjct  574  VAMRLMDVSGRRSLLLWTIPVLIVSLIILVISELVHISKVVNAALSTSCVVLYFCFFVMG  633

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VC
Sbjct  634  YGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVC  693

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISWIFV+++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  694  VISWIFVYMKVPETKGMPLEVITDYFAFGAQAQASAPSK  732



>ref|XP_002520608.1| sugar transporter, putative [Ricinus communis]
 gb|EEF41781.1| sugar transporter, putative [Ricinus communis]
Length=740

 Score =   221 bits (563),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR+LLL TIPVLI SL+VLVLG+ +NLGSV +A +ST  VI+YFC FVMG
Sbjct  582  VAMRLMDISGRRSLLLCTIPVLIVSLLVLVLGSAVNLGSVINASISTASVIVYFCCFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GLAGVFG+YAVVC
Sbjct  642  FGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKSIGLAGVFGLYAVVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            +IS +FV+L+VPETKGMPLEVITEFF+VGARQA  AK+ 
Sbjct  702  IISLVFVYLKVPETKGMPLEVITEFFSVGARQAAAAKDN  740



>ref|XP_010270527.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
 ref|XP_010270528.1| PREDICTED: monosaccharide-sensing protein 2 [Nelumbo nucifera]
Length=740

 Score =   221 bits (562),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 137/153 (90%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRR+LLLSTIP+LI SLVVLV+ N + + SV HAVLST  V++YFC FVMG
Sbjct  583  VAMRLMDIAGRRSLLLSTIPILIVSLVVLVISNALTMSSVVHAVLSTASVLVYFCCFVMG  642

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICALVFW  D+IVTYSLP+ML+S+GL+GVFGIY+ VC
Sbjct  643  FGPIPNILCSEIFPTRVRGLCIAICALVFWTGDIIVTYSLPMMLNSIGLSGVFGIYSAVC  702

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
             I+ +FVFL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  703  CIALVFVFLKVPETKGMPLEVITEFFAVGAKQA  735



>ref|NP_001065182.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|AAG46115.1|AC073166_13 putative sugar transporter [Oryza sativa Japonica Group]
 gb|ABB47937.2| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27096.1| Os10g0539900 [Oryza sativa Japonica Group]
 gb|EAZ16837.1| hypothetical protein OsJ_32308 [Oryza sativa Japonica Group]
 gb|ADG21982.1| tonoplast monosaccharide transporter 1 [Oryza sativa Japonica 
Group]
Length=740

 Score =   220 bits (561),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL+TIP+LI +L +L+L N++++G++ HA LST+ VILYFC FVMG
Sbjct  585  IAMRLMDMSGRRFLLLATIPILIVALAILILVNILDVGTMVHASLSTVSVILYFCFFVMG  644

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYAVVC
Sbjct  645  FGPIPNILCAEIFPTTVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAVVC  704

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  305
            +++++FVF++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  705  ILAFLFVFMKVPETKGMPLEVITEFFSVGAKQAK  738



>gb|AFW59276.1| hypothetical protein ZEAMMB73_154299 [Zea mays]
Length=640

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  763  AMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGY  584
            AM  MD+SGRR LLL TIP+LI SLV+LV+ N+I+LG++AHA+LST+ VI+YFC FVMG+
Sbjct  485  AMLLMDLSGRRFLLLGTIPILIASLVILVVSNLIDLGTLAHALLSTVSVIVYFCCFVMGF  544

Query  583  GPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCV  404
            GPIPNILCAEIFPTRVRG CIAICA  FWI D+IVTYSLPVML+++GLAGVF IYAVVC+
Sbjct  545  GPIPNILCAEIFPTRVRGLCIAICAFTFWIGDIIVTYSLPVMLNAIGLAGVFSIYAVVCL  604

Query  403  ISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
            IS++FVFL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  605  ISFVFVFLKVPETKGMPLEVITEFFAVGAKQA  636



>gb|EEC67373.1| hypothetical protein OsI_34495 [Oryza sativa Indica Group]
Length=718

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL+TIP+LI +L +L+L N++++G++ HA LST+ VILYFC FVMG
Sbjct  563  IAMRLMDMSGRRFLLLATIPILIVALAILILVNILDVGTMVHASLSTVSVILYFCFFVMG  622

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYAVVC
Sbjct  623  FGPIPNILCAEIFPTTVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAVVC  682

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  305
            +++++FVF++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  683  ILAFLFVFMKVPETKGMPLEVITEFFSVGAKQAK  716



>emb|CDP01766.1| unnamed protein product [Coffea canephora]
Length=724

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 126/152 (83%), Positives = 142/152 (93%), Gaps = 0/152 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MDV+GRR LLLST+P L+ SLV+LVLGNVINLG+ AHAV+STI V++YFC FVMG
Sbjct  567  VAMKLMDVAGRRLLLLSTLPFLLLSLVILVLGNVINLGNTAHAVVSTISVVVYFCCFVMG  626

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTR RG CIAICALVFWICD+IVTYSLPVMLSS+GLAGVFGIYAVVC
Sbjct  627  FGPVPNILCAEIFPTRTRGLCIAICALVFWICDIIVTYSLPVMLSSIGLAGVFGIYAVVC  686

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQ  311
             ISW+FVFL+VPETKGMPLEVITEFFAVGA+Q
Sbjct  687  AISWVFVFLKVPETKGMPLEVITEFFAVGAKQ  718



>ref|XP_008645619.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 ref|XP_008645620.1| PREDICTED: monosaccharide-sensing protein 2-like [Zea mays]
 gb|AFW59275.1| LOW QUALITY PROTEIN: hypothetical protein ZEAMMB73_154299 [Zea 
mays]
 gb|AFW71237.1| hypothetical protein ZEAMMB73_210614 [Zea mays]
Length=745

 Score =   220 bits (560),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = -2

Query  763  AMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGY  584
            AM  MD+SGRR LLL TIP+LI SLV+LV+ N+I+LG++AHA+LST+ VI+YFC FVMG+
Sbjct  590  AMLLMDLSGRRFLLLGTIPILIASLVILVVSNLIDLGTLAHALLSTVSVIVYFCCFVMGF  649

Query  583  GPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCV  404
            GPIPNILCAEIFPTRVRG CIAICA  FWI D+IVTYSLPVML+++GLAGVF IYAVVC+
Sbjct  650  GPIPNILCAEIFPTRVRGLCIAICAFTFWIGDIIVTYSLPVMLNAIGLAGVFSIYAVVCL  709

Query  403  ISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
            IS++FVFL+VPETKGMPLEVITEFFAVGA+QA
Sbjct  710  ISFVFVFLKVPETKGMPLEVITEFFAVGAKQA  741



>gb|EPS57524.1| hypothetical protein M569_17293, partial [Genlisea aurea]
Length=693

 Score =   219 bits (558),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = -2

Query  763  AMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGY  584
            AMR MD++GRR LLLSTIP+L+ +L++LV+GNV++LGS+ HAV+ST+ VI+YFC FVMG+
Sbjct  543  AMRLMDIAGRRWLLLSTIPILLATLILLVVGNVVDLGSMVHAVVSTLSVIVYFCCFVMGF  602

Query  583  GPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCV  404
            GP+PNILCAEIFPTRVRG CI ICAL FWI D+IVTYSLPVML S+GLAGVFGIYA VC 
Sbjct  603  GPVPNILCAEIFPTRVRGLCIGICALTFWIGDIIVTYSLPVMLGSIGLAGVFGIYAAVCT  662

Query  403  ISWIFVFLRVPETKGMPLEVITEFFAVGARQ  311
             +W FVFL+VPETKGMPLEVIT+FFAVGAR+
Sbjct  663  AAWFFVFLKVPETKGMPLEVITDFFAVGARR  693



>ref|XP_009110209.1| PREDICTED: monosaccharide-sensing protein 1 [Brassica rapa]
Length=726

 Score =   219 bits (558),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR LLL TIPVLI SL+VLV+  ++++  V +A LST CVILYFC FVMG
Sbjct  566  VAMRLMDVSGRRALLLWTIPVLILSLIVLVISELVHISKVVNAALSTACVILYFCFFVMG  625

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IY  VC
Sbjct  626  YGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFIIYGAVC  685

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISWIFV+++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  686  VISWIFVYMKVPETKGMPLEVITDYFAFGAQAQASAPSK  724



>emb|CDX96618.1| BnaA08g21610D [Brassica napus]
Length=725

 Score =   219 bits (558),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR LLL TIPVLI SL+VLV+  ++++  V +A LST CVILYFC FVMG
Sbjct  565  VAMRLMDVSGRRALLLWTIPVLILSLIVLVISELVHISKVVNAALSTACVILYFCFFVMG  624

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IY  VC
Sbjct  625  YGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFIIYGAVC  684

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISWIFV+++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  685  VISWIFVYMKVPETKGMPLEVITDYFAFGAQAQASAPSK  723



>gb|AAO37640.1| putative sugar transporter type 2a [Saccharum hybrid cultivar 
Q117]
Length=745

 Score =   219 bits (558),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 119/153 (78%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MDVSGRR LLLSTIPVLI SL+VLV+ NVI LG+V HAVLSTI VI Y C F MG
Sbjct  589  LAMRLMDVSGRRFLLLSTIPVLIASLIVLVVSNVIELGTVVHAVLSTISVITYLCCFKMG  648

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAE FPTRVRG CIAICAL+FW+ D+IVTYSLPVML+++GL GVFGIYAV C
Sbjct  649  FGPIPNILCAEFFPTRVRGICIAICALIFWVGDIIVTYSLPVMLNAIGLEGVFGIYAVAC  708

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
             I+++FV+L+VPETKGMPLEVITEFFAVGA+QA
Sbjct  709  AIAFVFVYLKVPETKGMPLEVITEFFAVGAKQA  741



>emb|CDY33650.1| BnaC08g19500D [Brassica napus]
Length=697

 Score =   218 bits (556),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR LLL TIPVLI SL+VLV+  ++++  V +A LST CVILYFC FVMG
Sbjct  537  VAMRLMDVSGRRALLLWTIPVLIVSLIVLVISELVHISKVVNAALSTACVILYFCFFVMG  596

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IY  VC
Sbjct  597  YGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFIIYGAVC  656

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISWIFV+++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  657  VISWIFVYMKVPETKGMPLEVITDYFAFGAQAQASAPSK  695



>ref|XP_012073594.1| PREDICTED: monosaccharide-sensing protein 2 [Jatropha curcas]
 ref|XP_012073595.1| PREDICTED: monosaccharide-sensing protein 2 [Jatropha curcas]
 ref|XP_012073596.1| PREDICTED: monosaccharide-sensing protein 2 [Jatropha curcas]
 ref|XP_012073597.1| PREDICTED: monosaccharide-sensing protein 2 [Jatropha curcas]
 ref|XP_012073598.1| PREDICTED: monosaccharide-sensing protein 2 [Jatropha curcas]
 gb|KDP36756.1| hypothetical protein JCGZ_08047 [Jatropha curcas]
Length=739

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 144/159 (91%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            V MR MDVSGRRTLLL+T+PVLI SLV+L++G +++LG+VA+A +ST+CV++YFC FVM 
Sbjct  581  VGMRLMDVSGRRTLLLTTLPVLIGSLVILLIGQLVDLGTVANAAISTVCVVIYFCCFVMA  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+IVTY++PVML+S+GL G+F I+A++C
Sbjct  641  YGPIPNILCSEIFPTRVRGLCIAICALVYWIADIIVTYTVPVMLNSIGLTGIFIIFAIMC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ISW+FVFL+VPETKGMPLEVITEFFAVGARQ   AKNE
Sbjct  701  AISWVFVFLKVPETKGMPLEVITEFFAVGARQVAAAKNE  739



>tpg|DAA46101.1| TPA: hypothetical protein ZEAMMB73_051534 [Zea mays]
Length=336

 Score =   209 bits (532),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL+TIPVLI +L+VLV+ N++++G VAHA LST  VI+YFC FVMG
Sbjct  173  IAMRLMDMSGRRFLLLATIPVLIVALLVLVVSNIVDVGDVAHAALSTASVIVYFCFFVMG  232

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPT VRG CIAICAL FW+ D+IVTY+LPVML+ +GLAGVFG+YAVVC
Sbjct  233  FGPVPNILCAEIFPTTVRGVCIAICALAFWLGDIIVTYTLPVMLNVVGLAGVFGVYAVVC  292

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  305
            V++  FVF++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  293  VLALAFVFVKVPETKGMPLEVITEFFSVGAKQAK  326



>gb|EMS63940.1| Monosaccharide-sensing protein 2 [Triticum urartu]
Length=743

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLLSTIPVLI +L VLVL NV+++G++ HA LSTI VI+YFC FVMG
Sbjct  586  IAMRLMDMSGRRFLLLSTIPVLIVALAVLVLVNVLDVGTMVHAALSTISVIVYFCFFVMG  645

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYA+VC
Sbjct  646  FGPIPNILCAEIFPTSVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAIVC  705

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            V++++FV+++VPETKGMPLEVITEFF+VGA+Q + A +
Sbjct  706  VLAFVFVYMKVPETKGMPLEVITEFFSVGAKQGKEATD  743



>ref|XP_006306868.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306869.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 ref|XP_006306870.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39766.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39767.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
 gb|EOA39768.1| hypothetical protein CARUB_v10008415mg [Capsella rubella]
Length=736

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR+LLL TIPVLI SL+VLV+  ++++  V +A LST CV+LYFC FVMG
Sbjct  574  VAMRLMDVSGRRSLLLWTIPVLIVSLIVLVISELVHISKVVNAALSTSCVVLYFCFFVMG  633

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VC
Sbjct  634  YGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVC  693

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVG  320
            VISWIFV+++VPETKGMPLEVIT++FA G
Sbjct  694  VISWIFVYMKVPETKGMPLEVITDYFAFG  722



>ref|XP_007201798.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201799.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 ref|XP_007201800.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02997.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02998.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
 gb|EMJ02999.1| hypothetical protein PRUPE_ppa001957mg [Prunus persica]
Length=736

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR+LLL+TIP+LI SLV+LVLG+++N+GSV +A +ST+ V+LYFC FVMG
Sbjct  578  VAMRLMDISGRRSLLLTTIPILIASLVILVLGSLVNMGSVVNASVSTVSVVLYFCFFVMG  637

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GL GVFG+YAVVC
Sbjct  638  FGPVPNILCAEIFPTRVRGLCIAICALAFWIGDIIVTYSLPVMLKSVGLGGVFGMYAVVC  697

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVG  320
            VI+W+FVFL+VPETKGMPLEVI EFF+VG
Sbjct  698  VIAWVFVFLKVPETKGMPLEVIIEFFSVG  726



>gb|EMT29091.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=743

 Score =   217 bits (553),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLLSTIPVLI +L VLVL NV+++G++ HA LSTI VI+YFC FVMG
Sbjct  586  IAMRLMDMSGRRFLLLSTIPVLIVALAVLVLVNVLDVGTMVHAALSTISVIIYFCFFVMG  645

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYA+VC
Sbjct  646  FGPIPNILCAEIFPTSVRGICIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAIVC  705

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +++++FV+++VPETKGMPLEVITEFF+VGA+Q + A +
Sbjct  706  ILAFVFVYMKVPETKGMPLEVITEFFSVGAKQGKEATD  743



>ref|XP_008235816.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
 ref|XP_008235817.1| PREDICTED: monosaccharide-sensing protein 2 [Prunus mume]
Length=736

 Score =   216 bits (551),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 136/149 (91%), Gaps = 0/149 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR+LLL+TIPVLI SLV+LVLG+++N+GS+ +A +ST+ V+LYFC FVMG
Sbjct  578  VAMRLMDISGRRSLLLTTIPVLIASLVILVLGSLVNMGSIVNASVSTVSVVLYFCFFVMG  637

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GL GVFG+Y VVC
Sbjct  638  FGPVPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKSVGLGGVFGMYGVVC  697

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVG  320
            VI+W+FVFL+VPETKGMPLEVI EFF+VG
Sbjct  698  VIAWVFVFLKVPETKGMPLEVIIEFFSVG  726



>gb|KCW55684.1| hypothetical protein EUGRSUZ_I01534 [Eucalyptus grandis]
Length=282

 Score =   206 bits (524),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR+LLL TIP+LI SL+++VL NV++ GS  HAV+ TI V+LY C FVMG
Sbjct  124  VAMRLMDVSGRRSLLLGTIPMLIVSLIIMVLSNVVDAGSAIHAVICTIGVVLYICFFVMG  183

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PN+LCAEIFPTRVRG C+AIC L FW+ +VIVTYSLP+ML S GLA +FG++ VVC
Sbjct  184  FGPAPNVLCAEIFPTRVRGVCVAICGLAFWMGNVIVTYSLPLMLRSAGLASIFGMFTVVC  243

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            ++SW FVFL+VPETKGMPLEVITEFF +G +Q    K+E
Sbjct  244  LLSWAFVFLKVPETKGMPLEVITEFFCLGMKQTFAVKDE  282



>ref|XP_009372620.1| PREDICTED: monosaccharide-sensing protein 2 [Pyrus x bretschneideri]
Length=739

 Score =   216 bits (550),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 123/159 (77%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VA++ MD+SGRR LLL+TIPVLI SL++LV+ N++ LGSV HA LSTICV++YFC FVM 
Sbjct  581  VAIKLMDISGRRMLLLTTIPVLIVSLIILVVTNLLTLGSVLHAALSTICVVVYFCVFVMA  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICALV+WI D+I+TYSLPVML SMGL+G FGIYAVVC
Sbjct  641  YGPIPNILCSEIFPTRVRGLCIAICALVYWIGDIIITYSLPVMLDSMGLSGAFGIYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VIS++FVFL+VPETKGMPLEVITEFF+VGARQ   AKNE
Sbjct  701  VISFVFVFLKVPETKGMPLEVITEFFSVGARQVAAAKNE  739



>tpg|DAA46100.1| TPA: hypothetical protein ZEAMMB73_051534 [Zea mays]
Length=457

 Score =   211 bits (536),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL+TIPVLI +L+VLV+ N++++G VAHA LST  VI+YFC FVMG
Sbjct  294  IAMRLMDMSGRRFLLLATIPVLIVALLVLVVSNIVDVGDVAHAALSTASVIVYFCFFVMG  353

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPT VRG CIAICAL FW+ D+IVTY+LPVML+ +GLAGVFG+YAVVC
Sbjct  354  FGPVPNILCAEIFPTTVRGVCIAICALAFWLGDIIVTYTLPVMLNVVGLAGVFGVYAVVC  413

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  305
            V++  FVF++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  414  VLALAFVFVKVPETKGMPLEVITEFFSVGAKQAK  447



>ref|XP_002307812.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
 gb|EEE94808.1| hypothetical protein POPTR_0005s27680g [Populus trichocarpa]
Length=738

 Score =   216 bits (550),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRRTLLL+TIPVLI SL+VL++  ++ + SV +A + T CVI++ C FV  
Sbjct  581  VAMRLMDIAGRRTLLLTTIPVLILSLIVLIIFELVTVSSVVNAAILTACVIIFICCFVSA  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+V+WI D+IVTY+LPVMLSS+GL G+FGIYAVVC
Sbjct  641  YGPIPNILCSEIFPTRVRGLCIAICAMVYWIGDIIVTYTLPVMLSSIGLVGIFGIYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
             ISWIFVFL+VPETKGMPLEVITEFFAVGA+QA   K 
Sbjct  701  AISWIFVFLKVPETKGMPLEVITEFFAVGAKQAAAKKE  738



>ref|XP_008377843.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
 ref|XP_008377844.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=736

 Score =   216 bits (549),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 116/149 (78%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD++GRR+LLL TIPVLI SL +LVLG+++N+GSV +A +ST+ V+LYFC FVMG
Sbjct  578  IAMRLMDLAGRRSLLLGTIPVLIVSLAILVLGSLVNMGSVVNASVSTVSVVLYFCFFVMG  637

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GLAGVFG+YAVVC
Sbjct  638  FGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKSVGLAGVFGMYAVVC  697

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVG  320
            VI++IFVFL+VPETKGMPLEVITEFF+VG
Sbjct  698  VIAFIFVFLKVPETKGMPLEVITEFFSVG  726



>ref|XP_009333794.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   216 bits (549),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 138/149 (93%), Gaps = 0/149 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD++GRR+LLL TIPVLI SLV+LVLG+++N+GSV +A +ST+ V+LYFC FVMG
Sbjct  578  IAMRLMDLAGRRSLLLGTIPVLIVSLVILVLGSLVNMGSVVNASVSTVSVVLYFCFFVMG  637

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GLAGVFG+YAVVC
Sbjct  638  FGPIPNILCAEIFPTRVRGLCIAICALTFWIGDIIVTYSLPVMLKSVGLAGVFGMYAVVC  697

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVG  320
            VI++IFVFL+VPETKGMPLEVITEFF+VG
Sbjct  698  VIAFIFVFLKVPETKGMPLEVITEFFSVG  726



>emb|CBI21577.3| unnamed protein product [Vitis vinifera]
Length=627

 Score =   214 bits (544),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = -2

Query  763  AMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGY  584
            AMR MDVSGRR LLL+T+P+L+ SL++LVLGN+I +GS+ HA++ST+ V++YFC FVM +
Sbjct  469  AMRLMDVSGRRWLLLTTLPILLLSLIILVLGNIIPMGSLVHAIISTVSVVVYFCCFVMAF  528

Query  583  GPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCV  404
            GPIPNILC+EIFPTRVRG CIA+CAL FWICD+IVTYSLPVMLSS+GLAGVFGIYA+VC+
Sbjct  529  GPIPNILCSEIFPTRVRGLCIAVCALTFWICDIIVTYSLPVMLSSVGLAGVFGIYAIVCI  588

Query  403  ISWIFVFLRVPETKGMPLEVITEFFAVGARQAEM-AKNE  290
            +SWIFVFL+VPETKGMPLEVI+EFFAVGA+QA   AKN 
Sbjct  589  LSWIFVFLKVPETKGMPLEVISEFFAVGAKQAATDAKNN  627



>ref|XP_010503840.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=740

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            V+MR MDV+GRR+LLLSTIPVLI SLV LV+G+++ LG   +A++ST  V +Y   FVMG
Sbjct  578  VSMRLMDVAGRRSLLLSTIPVLILSLVTLVIGSLVKLGGTTNALISTASVTVYLSCFVMG  637

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYAVVC
Sbjct  638  FGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAVVC  697

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  299
             +SW+FV+L+VPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  698  AVSWVFVYLKVPETKGMPLEVISEFFSVGAKQQDAA  733



>ref|NP_173508.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
 sp|Q96290.2|MSSP1_ARATH RecName: Full=Monosaccharide-sensing protein 1; AltName: Full=Monosaccharide 
transporter 1; AltName: Full=Sugar transporter 
MSSP1; AltName: Full=Sugar transporter MT1 [Arabidopsis thaliana]
 gb|AAF80627.1|AC069251_20 F2D10.36 [Arabidopsis thaliana]
 gb|AEE30030.1| tonoplast monosaccharide transporter1 [Arabidopsis thaliana]
Length=734

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR+LLL TIPVLI SLVVLV+  +I++  V +A LST CV+LYFC FVMG
Sbjct  574  VAMRLMDVSGRRSLLLWTIPVLIVSLVVLVISELIHISKVVNAALSTGCVVLYFCFFVMG  633

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VC
Sbjct  634  YGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVC  693

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISWIFV+++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  694  VISWIFVYMKVPETKGMPLEVITDYFAFGAQAQASAPSK  732



>ref|XP_004290074.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
 ref|XP_011458100.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=740

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIPVLI SLV+LVLG+++N GSV +A +ST  V++YFCSFVMG
Sbjct  581  VAMRLMDISGRRTLLLTTIPVLILSLVILVLGSLVNFGSVVNAAISTGSVVIYFCSFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTRVRG CIAICAL FWICD+IVTYSLPV+L S+GL+GVFG+YAVVC
Sbjct  641  FGPVPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYSLPVLLKSVGLSGVFGMYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFF  329
            VI+WIFVF++VPETKGMPLEVITEFF
Sbjct  701  VIAWIFVFIKVPETKGMPLEVITEFF  726



>gb|AAD30608.1|AC007369_18 Sugar transporter [Arabidopsis thaliana]
Length=734

 Score =   215 bits (548),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 137/159 (86%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR+LLL TIPVLI SLVVLV+  +I++  V +A LST CV+LYFC FVMG
Sbjct  574  VAMRLMDVSGRRSLLLWTIPVLIVSLVVLVISELIHISKVVNAALSTGCVVLYFCFFVMG  633

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VC
Sbjct  634  YGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVC  693

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISWIFV+++VPETKGMPLEVIT++FA GA+    A ++
Sbjct  694  VISWIFVYMKVPETKGMPLEVITDYFAFGAQAQASAPSK  732



>ref|XP_009341490.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   215 bits (547),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 137/149 (92%), Gaps = 0/149 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD++GRR+LLL TIPVLI SLV+LVLG ++N+GSV +A +ST+ V+LYFC FVMG
Sbjct  578  IAMRLMDLAGRRSLLLGTIPVLIVSLVILVLGGLVNMGSVVNASVSTVSVVLYFCFFVMG  637

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPVML S+GLAGVFG+YAVVC
Sbjct  638  FGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSLPVMLKSVGLAGVFGMYAVVC  697

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVG  320
            VI++IFVFL+VPETKGMPLEVITEFF+VG
Sbjct  698  VIAFIFVFLKVPETKGMPLEVITEFFSVG  726



>ref|XP_009115837.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=731

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            V+MR MDVSGRR+L+LSTIP+LI SL+ LV+G+++ LG  A+A++ST  V++Y   FVMG
Sbjct  571  VSMRLMDVSGRRSLMLSTIPILILSLLTLVIGSLVKLGGTANALISTASVMVYLSCFVMG  630

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC
Sbjct  631  FGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVC  690

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  299
             ++W+FV+L+VPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  691  AVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQDAA  726



>ref|XP_012073160.1| PREDICTED: monosaccharide-sensing protein 2 [Jatropha curcas]
 ref|XP_012073241.1| PREDICTED: monosaccharide-sensing protein 2 [Jatropha curcas]
 ref|XP_012073319.1| PREDICTED: monosaccharide-sensing protein 2 [Jatropha curcas]
 ref|XP_012073392.1| PREDICTED: monosaccharide-sensing protein 2 [Jatropha curcas]
 ref|XP_012073460.1| PREDICTED: monosaccharide-sensing protein 2 [Jatropha curcas]
 gb|KDP47010.1| hypothetical protein JCGZ_10737 [Jatropha curcas]
Length=740

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/159 (75%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRR+LLL TIP+LI SL++LVLG+ +NLG+V +A +ST  VI+YFC FVMG
Sbjct  582  VAMRLMDISGRRSLLLCTIPILIVSLLILVLGSAVNLGNVVNASISTASVIIYFCCFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LPVML SMGLAGVFG+YAVVC
Sbjct  642  FGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTLPVMLKSMGLAGVFGLYAVVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            +IS  FV+L+VPETKGMPLEVITEFF++GA+QA  AKN+
Sbjct  702  IISLGFVYLKVPETKGMPLEVITEFFSLGAKQAAAAKND  740



>ref|XP_010515555.1| PREDICTED: monosaccharide-sensing protein 3 [Camelina sativa]
Length=738

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            V+MR MDV+GRR+LLLSTIPVLI SLV LV+G+++ LG   +A++ST  V +Y   FVMG
Sbjct  576  VSMRLMDVAGRRSLLLSTIPVLILSLVTLVIGSLVKLGGTTNALISTASVTVYLSCFVMG  635

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYAVVC
Sbjct  636  FGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAVVC  695

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  299
             ++W+FV+L+VPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  696  AVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQDAA  731



>ref|XP_004978456.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Setaria 
italica]
 ref|XP_004978457.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Setaria 
italica]
 ref|XP_004978458.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Setaria 
italica]
Length=710

 Score =   214 bits (545),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/154 (72%), Positives = 137/154 (89%), Gaps = 0/154 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMRFMD+SGRR LLL+TIP+LI +LVVLV+ N++++G+  HA LSTI +ILYFC FVMG
Sbjct  555  IAMRFMDMSGRRFLLLATIPILIVALVVLVMVNIVDVGTTVHAALSTISLILYFCFFVMG  614

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPT VRG CIAICA   WI D+IVTY+LPVML+S+GLAGVFGIYAV C
Sbjct  615  FGPIPNILCAEIFPTTVRGICIAICAFTSWIGDIIVTYTLPVMLNSIGLAGVFGIYAVFC  674

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  305
            +I+ +FV+++VPETKGMPLEVI EFF+VGA+QA+
Sbjct  675  IIALVFVYMKVPETKGMPLEVIIEFFSVGAKQAK  708



>ref|XP_010426703.1| PREDICTED: monosaccharide-sensing protein 3-like [Camelina sativa]
Length=738

 Score =   214 bits (545),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            V+MR MDV+GRR+LLLSTIP+LI SLV LV+G+++ LG   +A+LST  V +Y   FVMG
Sbjct  576  VSMRLMDVAGRRSLLLSTIPILILSLVTLVIGSLVKLGGTTNALLSTASVTVYLSCFVMG  635

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC
Sbjct  636  FGSIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVC  695

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  299
             ++W+FV+LRVPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  696  AVAWVFVYLRVPETKGMPLEVISEFFSVGAKQQDAA  731



>ref|XP_010063149.1| PREDICTED: monosaccharide-sensing protein 2-like [Eucalyptus 
grandis]
 gb|KCW70342.1| hypothetical protein EUGRSUZ_F03585 [Eucalyptus grandis]
Length=740

 Score =   214 bits (545),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            V MR MD SGRRTLLL+TIPVLI +LVVLV+  +IN  S   + ++TICV++YFC F+  
Sbjct  582  VGMRLMDSSGRRTLLLTTIPVLIVTLVVLVIVELINSSSTVFSYIATICVVVYFCCFMTA  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CI ICALVFW+ D+IVT +LPV+L S+GLAG+FGIYA VC
Sbjct  642  YGPIPNILCSEIFPTRVRGLCITICALVFWLGDIIVTDTLPVLLESIGLAGIFGIYAAVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            VISW+FVFL+VPETKGMPLEVITEFF+VGA+Q    KNE
Sbjct  702  VISWVFVFLKVPETKGMPLEVITEFFSVGAKQIATTKNE  740



>ref|XP_010940242.1| PREDICTED: monosaccharide-sensing protein 2-like [Elaeis guineensis]
Length=745

 Score =   214 bits (545),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/158 (74%), Positives = 141/158 (89%), Gaps = 2/158 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR+LLL+TIPVLI SL+VLV+ N++++G++ HAVLSTI VI+YFC FVMG
Sbjct  590  VAMRLMDVSGRRSLLLATIPVLIVSLIVLVVVNLVHMGTMVHAVLSTISVIVYFCCFVMG  649

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAE+FPTRVRG CIAIC+L FW  D+IVTY+LPVML ++GLAGVFGIYAVVC
Sbjct  650  FGPIPNILCAELFPTRVRGMCIAICSLTFWFGDIIVTYTLPVMLKTVGLAGVFGIYAVVC  709

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            VI+ +F+FL+VPETKGMPLEVI EFF VGA+ A  A+N
Sbjct  710  VIALVFIFLKVPETKGMPLEVIIEFFNVGAKLA--ARN  745



>ref|XP_002276373.1| PREDICTED: monosaccharide-sensing protein 2 [Vitis vinifera]
 gb|ADP37149.1| putative tonoplastic monosaccharide transporter [Vitis vinifera]
Length=742

 Score =   214 bits (545),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = -2

Query  763  AMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGY  584
            AMR MDVSGRR LLL+T+P+L+ SL++LVLGN+I +GS+ HA++ST+ V++YFC FVM +
Sbjct  584  AMRLMDVSGRRWLLLTTLPILLLSLIILVLGNIIPMGSLVHAIISTVSVVVYFCCFVMAF  643

Query  583  GPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCV  404
            GPIPNILC+EIFPTRVRG CIA+CAL FWICD+IVTYSLPVMLSS+GLAGVFGIYA+VC+
Sbjct  644  GPIPNILCSEIFPTRVRGLCIAVCALTFWICDIIVTYSLPVMLSSVGLAGVFGIYAIVCI  703

Query  403  ISWIFVFLRVPETKGMPLEVITEFFAVGARQAEM-AKNE  290
            +SWIFVFL+VPETKGMPLEVI+EFFAVGA+QA   AKN 
Sbjct  704  LSWIFVFLKVPETKGMPLEVISEFFAVGAKQAATDAKNN  742



>gb|ACG25339.1| hexose transporter [Zea mays]
Length=763

 Score =   214 bits (545),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDV+GRR+LLL TIPVLI SL VLVL NV+ + +  HA+LST CV++YFC FVMG
Sbjct  599  VAMRLMDVAGRRSLLLRTIPVLIVSLAVLVLANVVPMAAKVHALLSTACVVVYFCCFVMG  658

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIA+C+L FWICD+IVT SLPVML ++GLAGVFG YA VC
Sbjct  659  FGPIPNILCAEIFPTRVRGICIAVCSLTFWICDIIVTNSLPVMLRTIGLAGVFGSYAFVC  718

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             +S +FV+LRVPETKG PLEVI EFF VGA+  +  ++E
Sbjct  719  CLSLVFVYLRVPETKGFPLEVIIEFFNVGAKAQKPEQHE  757



>ref|NP_001147067.1| hexose transporter [Zea mays]
 gb|ACN33422.1| unknown [Zea mays]
 gb|AFW69612.1| hexose transporter [Zea mays]
Length=763

 Score =   214 bits (545),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 133/159 (84%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDV+GRR+LLL TIPVLI SL VLVL NV+ + +  HA+LST CV++YFC FVMG
Sbjct  599  VAMRLMDVAGRRSLLLRTIPVLIVSLAVLVLANVVPMAAKVHALLSTACVVVYFCCFVMG  658

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIA+C+L FWICD+IVT SLPVML ++GLAGVFG YA VC
Sbjct  659  FGPIPNILCAEIFPTRVRGICIAVCSLTFWICDIIVTNSLPVMLRTIGLAGVFGSYAFVC  718

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             +S +FV+LRVPETKG PLEVI EFF VGA+  +  ++E
Sbjct  719  CLSLVFVYLRVPETKGFPLEVIIEFFNVGAKAQKPEQHE  757



>ref|XP_004983796.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=739

 Score =   214 bits (544),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 110/154 (71%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL+TIP+LI +L+VLV+ N++++G++ HA LSTI VI+YFC FVMG
Sbjct  584  IAMRLMDMSGRRFLLLATIPILIVALLVLVVVNIVDVGTMVHAALSTISVIVYFCFFVMG  643

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPT VRG CIAICAL FWI D+IVTY+LPVML+++GLAGVFGIYAVVC
Sbjct  644  FGPVPNILCAEIFPTTVRGLCIAICALTFWIGDIIVTYTLPVMLNAIGLAGVFGIYAVVC  703

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  305
            +++ +FV+++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  704  ILALVFVYMKVPETKGMPLEVITEFFSVGAKQAK  737



>ref|XP_006403910.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
 gb|ESQ45363.1| hypothetical protein EUTSA_v10011113mg [Eutrema salsugineum]
Length=739

 Score =   213 bits (542),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            V+MR +DV+GRR+L+LSTIP+LI SL+ LV+G+++ LG   +A++STI V++Y   FVMG
Sbjct  577  VSMRLIDVTGRRSLMLSTIPILILSLLTLVIGSLVKLGGTTNALMSTISVMVYLSCFVMG  636

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC
Sbjct  637  FGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVC  696

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  299
             ++W+FV+L+VPETKGMPLEVI+EFF+VGA+Q ++A
Sbjct  697  AVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQDLA  732



>gb|KFK34392.1| hypothetical protein AALP_AA5G139300 [Arabis alpina]
Length=739

 Score =   213 bits (541),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 134/154 (87%), Gaps = 0/154 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            V+MR MDV+GRR+L+LSTIP+LI SL+ LV+G+++ LG  A+A+LST  V++Y   FVMG
Sbjct  577  VSMRLMDVAGRRSLMLSTIPILILSLITLVIGSLVKLGGTANALLSTASVMVYLSCFVMG  636

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC
Sbjct  637  FGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVC  696

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  305
             ++W+FV+L+VPETKGMPLEVI+EFF+VGA+Q +
Sbjct  697  AVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQD  730



>ref|XP_006384856.1| transporter-related family protein [Populus trichocarpa]
 gb|ERP62653.1| transporter-related family protein [Populus trichocarpa]
Length=739

 Score =   212 bits (540),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/146 (79%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIPVLI SL++LVLG++++LGSV +A +ST+ V+LYFC FVMG
Sbjct  581  VAMRLMDISGRRTLLLTTIPVLIVSLILLVLGSMVDLGSVVNASISTVSVVLYFCFFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML S+GLAGVFG+YAVVC
Sbjct  641  FGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLKSVGLAGVFGLYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFF  329
            VIS++FV+L+VPETKGMPLEVI+EFF
Sbjct  701  VISFVFVYLKVPETKGMPLEVISEFF  726



>ref|XP_002893133.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69392.1| hypothetical protein ARALYDRAFT_472320 [Arabidopsis lyrata subsp. 
lyrata]
Length=735

 Score =   212 bits (539),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 114/149 (77%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR+LLL TIPVLI SLVVLV+  ++++  V +A LST CV+LYFC FVMG
Sbjct  573  VAMRLMDVSGRRSLLLWTIPVLIVSLVVLVISELVHISKVVNAALSTGCVVLYFCFFVMG  632

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+VFWI D+IVTYSLPV+LSS+GL GVF IYA VC
Sbjct  633  YGPIPNILCSEIFPTRVRGLCIAICAMVFWIGDIIVTYSLPVLLSSIGLVGVFSIYAAVC  692

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVG  320
            VISWIFV+++VPETKGMPLEVIT++FA G
Sbjct  693  VISWIFVYMKVPETKGMPLEVITDYFAFG  721



>ref|XP_011098017.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098018.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011098019.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=711

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 145/159 (91%), Gaps = 1/159 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRR LLLST+PVL+ +L++LVLGNVI+LG+V HAV+ST+ VI+YFC FVMG
Sbjct  553  VAMRLMDIAGRRWLLLSTLPVLLLTLILLVLGNVIDLGTVVHAVISTVSVIVYFCCFVMG  612

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTYSLPVML+S+GLAGVF IYAVVC
Sbjct  613  FGPIPNILCSEIFPTRVRGICIAICALTFWIGDIIVTYSLPVMLNSIGLAGVFSIYAVVC  672

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQ-AEMAKN  293
             I+W+FVFL+VPETKGMPLEVITEFFAVGA+Q A  AKN
Sbjct  673  TIAWVFVFLKVPETKGMPLEVITEFFAVGAKQTAASAKN  711



>ref|XP_009359631.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X3 [Pyrus 
x bretschneideri]
Length=742

 Score =   211 bits (536),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD SGRR+LLL+T+PVL  +L+VL+ G +++LGSV +A +STI V++YFC+FVMG
Sbjct  583  IAMRLMDTSGRRSLLLTTLPVLTGTLLVLIFGQLVHLGSVVNATISTISVVVYFCTFVMG  642

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP+ML+S+GLAGVF IYAVVC
Sbjct  643  FGPIPNILCSEIFPTRVRGMCIAICALTFWIGDIIVTYTLPIMLTSIGLAGVFAIYAVVC  702

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
             ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QAE+ + 
Sbjct  703  TISWVFVFLKVPETKGMPLEVISEFFSVGAKQAEIDEK  740



>ref|NP_001151936.1| LOC100285573 [Zea mays]
 ref|XP_008680244.1| PREDICTED: LOC100285573 isoform X1 [Zea mays]
 gb|ACG45075.1| hexose transporter [Zea mays]
 tpg|DAA46098.1| TPA: hexose transporter isoform 1 [Zea mays]
 tpg|DAA46099.1| TPA: hexose transporter isoform 2 [Zea mays]
Length=747

 Score =   211 bits (536),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 138/154 (90%), Gaps = 0/154 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL+TIPVLI +L+VLV+ N++++G VAHA LST  VI+YFC FVMG
Sbjct  584  IAMRLMDMSGRRFLLLATIPVLIVALLVLVVSNIVDVGDVAHAALSTASVIVYFCFFVMG  643

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPT VRG CIAICAL FW+ D+IVTY+LPVML+ +GLAGVFG+YAVVC
Sbjct  644  FGPVPNILCAEIFPTTVRGVCIAICALAFWLGDIIVTYTLPVMLNVVGLAGVFGVYAVVC  703

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE  305
            V++  FVF++VPETKGMPLEVITEFF+VGA+QA+
Sbjct  704  VLALAFVFVKVPETKGMPLEVITEFFSVGAKQAK  737



>ref|XP_009359629.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Pyrus 
x bretschneideri]
Length=753

 Score =   211 bits (536),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD SGRR+LLL+T+PVL  +L+VL+ G +++LGSV +A +STI V++YFC+FVMG
Sbjct  594  IAMRLMDTSGRRSLLLTTLPVLTGTLLVLIFGQLVHLGSVVNATISTISVVVYFCTFVMG  653

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP+ML+S+GLAGVF IYAVVC
Sbjct  654  FGPIPNILCSEIFPTRVRGMCIAICALTFWIGDIIVTYTLPIMLTSIGLAGVFAIYAVVC  713

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
             ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QAE+ + 
Sbjct  714  TISWVFVFLKVPETKGMPLEVISEFFSVGAKQAEIDEK  751



>ref|XP_009359630.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Pyrus 
x bretschneideri]
Length=743

 Score =   210 bits (535),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD SGRR+LLL+T+PVL  +L+VL+ G +++LGSV +A +STI V++YFC+FVMG
Sbjct  584  IAMRLMDTSGRRSLLLTTLPVLTGTLLVLIFGQLVHLGSVVNATISTISVVVYFCTFVMG  643

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP+ML+S+GLAGVF IYAVVC
Sbjct  644  FGPIPNILCSEIFPTRVRGMCIAICALTFWIGDIIVTYTLPIMLTSIGLAGVFAIYAVVC  703

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
             ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QAE+ + 
Sbjct  704  TISWVFVFLKVPETKGMPLEVISEFFSVGAKQAEIDEK  741



>ref|XP_009148978.1| PREDICTED: monosaccharide-sensing protein 3 [Brassica rapa]
Length=741

 Score =   210 bits (535),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 133/156 (85%), Gaps = 0/156 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            V+MR MDVSGRR+L+LSTIP+LI SL+ LV+G+++ LG  A+A++ST  V++Y   FVMG
Sbjct  578  VSMRLMDVSGRRSLMLSTIPILILSLITLVIGSLVKLGGTANALISTASVMVYLSCFVMG  637

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
             G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC
Sbjct  638  LGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVC  697

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  299
             ++W+FV+L+VPETKGMPLEVI+EFF+VGA+  + +
Sbjct  698  AVAWVFVYLKVPETKGMPLEVISEFFSVGAKHQDAS  733



>ref|NP_001190054.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 gb|AEE78799.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=737

 Score =   210 bits (535),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            V+MR MDV+GRR+L+LSTIP+LI SLV LV+G+++NLG   +A++ST  V +Y   FVMG
Sbjct  575  VSMRLMDVTGRRSLMLSTIPILILSLVTLVIGSLVNLGGSINALISTASVTVYLSCFVMG  634

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNILC+EIFPT VRG CI ICAL FWICD+IVTY+LPVML S+G+AGVFGIYA+VC
Sbjct  635  FGAIPNILCSEIFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSIGIAGVFGIYAIVC  694

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMA  299
             ++W+FV+L+VPETKGMPLEVI+EFF+VGA+Q + A
Sbjct  695  AVAWVFVYLKVPETKGMPLEVISEFFSVGAKQQDAA  730



>gb|EMT28528.1| Monosaccharide-sensing protein 3 [Aegilops tauschii]
Length=531

 Score =   207 bits (526),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AM  MD+SGRRTLLL+TIPVLIFSLV+L++ NV+ + +  HA LST  VI+YFC FVMG
Sbjct  374  LAMWLMDLSGRRTLLLTTIPVLIFSLVILIVANVVPMATTVHAALSTGSVIIYFCCFVMG  433

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIA+C+L FWI D+IVTYSLPVML+S+GLAGVFGIYA VC
Sbjct  434  FGPIPNILCAEIFPTRVRGLCIALCSLTFWIGDIIVTYSLPVMLNSIGLAGVFGIYACVC  493

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGAR  314
             ++ +FV L+VPETKG+PLEVI EFF VGA+
Sbjct  494  CLALVFVALKVPETKGLPLEVIIEFFNVGAK  524



>ref|XP_004144248.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 ref|XP_011657332.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 ref|XP_011657333.1| PREDICTED: monosaccharide-sensing protein 2-like [Cucumis sativus]
 gb|KGN47521.1| hypothetical protein Csa_6G355400 [Cucumis sativus]
Length=729

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 138/159 (87%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR LLL+TIPVLI SL++L++  ++ + ++ +A +STICV++YFC FVM 
Sbjct  571  VAMRLMDVSGRRWLLLATIPVLIVSLLILIVFKLVTVSTIVNAAISTICVVVYFCVFVMA  630

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAIC++VFW  D+IVTYSLPVMLS++GLAGVFGIYA VC
Sbjct  631  YGPIPNILCSEIFPTRVRGLCIAICSMVFWTGDIIVTYSLPVMLSAIGLAGVFGIYAFVC  690

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            +ISWIFV+L+VPETKGMPLEVI EFF+VGARQA    N 
Sbjct  691  IISWIFVYLKVPETKGMPLEVIAEFFSVGARQAAKGSNN  729



>dbj|BAI94493.1| sugar transporter [Dianthus caryophyllus]
Length=733

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDV+GRRTLLL+TIP L+ SL+VL++ NVI   S+ HAVLST+ ++LY C F+MG
Sbjct  579  VAMRLMDVAGRRTLLLTTIPPLVLSLLVLIIVNVIETSSIVHAVLSTLSLVLYICFFMMG  638

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            + P+PNILCAEIFPTRVRG CIAICAL FWI D+IVT +LP++L+S+GLAGVFGIYAV  
Sbjct  639  FAPVPNILCAEIFPTRVRGVCIAICALTFWISDIIVTDTLPLLLNSVGLAGVFGIYAVFS  698

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQ  311
            VI+W+F+FL+VPETKGMPLEVITEFFA+GAR+
Sbjct  699  VIAWVFIFLKVPETKGMPLEVITEFFALGARK  730



>gb|EYU30848.1| hypothetical protein MIMGU_mgv1a001984mg [Erythranthe guttata]
Length=730

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 118/159 (74%), Positives = 143/159 (90%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRR LLLST+PVL+ +L++LVLGNVI+LG+V HAV+ST  VI+YFC+FVMG
Sbjct  572  VAMRLMDIAGRRWLLLSTLPVLLTTLILLVLGNVIHLGTVTHAVISTGSVIVYFCTFVMG  631

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTYSLPV+L+S+GL GVFGIYA VC
Sbjct  632  FGPVPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYSLPVLLNSIGLGGVFGIYAAVC  691

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ++W FV+L+VPETKGMPLEVITEFFAVGA+Q+  A+N 
Sbjct  692  TVAWFFVYLKVPETKGMPLEVITEFFAVGAKQSLAAENN  730



>ref|XP_008812559.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812567.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812574.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008812580.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=745

 Score =   209 bits (532),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 139/158 (88%), Gaps = 2/158 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR+LLL+TIPVLI SL+VLV+ N++++G++ HAVLST  VI+YFC FVMG
Sbjct  590  VAMRLMDVSGRRSLLLATIPVLIVSLIVLVVVNLVHMGTMVHAVLSTFSVIIYFCCFVMG  649

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAE+FPTRVRG CIAIC+L FW  D+IVTY+LPVML++ GLAG FGIYAVVC
Sbjct  650  FGPIPNILCAELFPTRVRGVCIAICSLAFWFGDIIVTYTLPVMLNTTGLAGAFGIYAVVC  709

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            VI+ +FVFL+VPETKGMPLEVI EFF+VG + A  A+N
Sbjct  710  VIALVFVFLKVPETKGMPLEVIIEFFSVGTKLA--ARN  745



>ref|XP_007204446.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
 gb|EMJ05645.1| hypothetical protein PRUPE_ppa026426mg [Prunus persica]
Length=742

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/158 (71%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD SGRR+LLL+T+PVL  +L+VL+ G ++++GSV +A +STI V++YFC FVMG
Sbjct  583  IAMRLMDTSGRRSLLLTTLPVLTGTLLVLIFGQLVHMGSVVNATISTISVVVYFCCFVMG  642

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP+ML+S+GLAGVF IYAVVC
Sbjct  643  FGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTLPIMLTSIGLAGVFAIYAVVC  702

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
             ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QA++A++
Sbjct  703  TISWVFVFLKVPETKGMPLEVISEFFSVGAKQADIAES  740



>ref|XP_008392888.1| PREDICTED: monosaccharide-sensing protein 2-like [Malus domestica]
Length=471

 Score =   204 bits (518),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 142/166 (86%), Gaps = 7/166 (4%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD SGRR+LLL+T+PVL  +L+VL+ G +++LG+V +A +STI V++YFC+FV+G
Sbjct  312  IAMRLMDTSGRRSLLLTTLPVLTGTLLVLIFGQLVHLGAVVNATISTISVVVYFCTFVLG  371

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP+ML+S+GLAGVF IYAVVC
Sbjct  372  FGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTLPIMLTSIGLAGVFAIYAVVC  431

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE*MNERKL  269
             ISW+FVFL+VPETKGMPLEVI+EFF+VGA+  E       N+ KL
Sbjct  432  TISWVFVFLKVPETKGMPLEVISEFFSVGAKHTE-------NDEKL  470



>ref|XP_008242106.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=742

 Score =   208 bits (529),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD SGRR+LLL+T+PVL  +L+VL+ G ++++GSV +A +STI V++YFC FVMG
Sbjct  583  IAMRLMDTSGRRSLLLTTLPVLTGTLLVLIFGQLVHMGSVVNATISTISVVVYFCCFVMG  642

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP+ML+++GLAGVF IYAVVC
Sbjct  643  FGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTLPIMLTTIGLAGVFAIYAVVC  702

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
             ISW+FVFL+VPETKGMPLEVI+EFF+VGA+QA++A++
Sbjct  703  TISWVFVFLKVPETKGMPLEVISEFFSVGAKQADIAES  740



>ref|XP_004977696.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=198

 Score =   195 bits (496),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMRFMD+SGRR LLL+TIP+LI +LVVLV+ N++++G+  HA LSTI +ILYFC FVMG
Sbjct  54   IAMRFMDMSGRRFLLLATIPILIVALVVLVMVNIVDVGTTVHAALSTISLILYFCFFVMG  113

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPT VRG CIAICA   WI D+IVTY+LPVML+S+GLAGVFGIYAV C
Sbjct  114  FGPIPNILCAEIFPTTVRGICIAICAFTSWIGDIIVTYTLPVMLNSIGLAGVFGIYAVFC  173

Query  406  VISWIFVFLRVPETKGMPLEVITE  335
            +I+ +FV+++VPETKGMPLEV+ +
Sbjct  174  IIALVFVYMKVPETKGMPLEVLVK  197



>gb|ABK29442.1| sugar transport protein, partial [Coffea canephora]
Length=134

 Score =   193 bits (490),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 106/120 (88%), Gaps = 1/120 (1%)
 Frame = -2

Query  646  AHAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSL  467
             +A +ST+CV+LYFC FVMG+GP+PNILC+EIFPTRVRG CIA+C L +WI D+IVTY+L
Sbjct  15   GNAAVSTVCVVLYFCFFVMGFGPVPNILCSEIFPTRVRGVCIALCCLTYWIGDIIVTYTL  74

Query  466  PVMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQA-EMAKNE  290
            PVMLSSMGL GVFG YAVVC+ISW F FL+VPETKGMPLEVI+EFF+VGARQA  +AKN 
Sbjct  75   PVMLSSMGLGGVFGTYAVVCIISWFFAFLKVPETKGMPLEVISEFFSVGARQAVAIAKNN  134



>ref|XP_004964709.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=748

 Score =   207 bits (528),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MDVSGRR+LLLSTIPVLI SL+VL++ NV+ + +  HA LST  VI+YFC FVMG
Sbjct  584  LAMRLMDVSGRRSLLLSTIPVLIASLLVLIVANVLPMATTLHAALSTGSVIVYFCCFVMG  643

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAIC+L FW+ D+ VTYSLPVMLSS+GLAGVFG YAVVC
Sbjct  644  FGPIPNILCAEIFPTRVRGLCIAICSLTFWLGDIAVTYSLPVMLSSVGLAGVFGFYAVVC  703

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGAR  314
             ++ IFV+++VPETKG PLEVI EFF +GA+
Sbjct  704  CLALIFVYIKVPETKGFPLEVIIEFFNIGAK  734



>ref|XP_006855646.1| PREDICTED: monosaccharide-sensing protein 2 [Amborella trichopoda]
 ref|XP_011627518.1| PREDICTED: monosaccharide-sensing protein 2 [Amborella trichopoda]
 ref|XP_011627519.1| PREDICTED: monosaccharide-sensing protein 2 [Amborella trichopoda]
 gb|ERN17113.1| hypothetical protein AMTR_s00044p00110510 [Amborella trichopoda]
Length=743

 Score =   207 bits (527),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIPVL+ SL+VLV+ +      VA A +S + V++YFC FVMG
Sbjct  586  VAMRLMDISGRRTLLLTTIPVLVVSLLVLVVSDSFLDEGVAQAAISCLGVVVYFCFFVMG  645

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPTRVRG CIAICAL FWI D+IVTY+LP +L+++GL+GVFGIYAVVC
Sbjct  646  FGPIPNILCSEIFPTRVRGLCIAICALTFWIGDIIVTYTLPSLLTAIGLSGVFGIYAVVC  705

Query  406  VISWIFVFLRVPETKGMPLEVITEFF  329
            VISWIFVFL+VPETKGMPLEVITEFF
Sbjct  706  VISWIFVFLKVPETKGMPLEVITEFF  731



>ref|XP_008786687.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786688.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786689.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
 ref|XP_008786690.1| PREDICTED: monosaccharide-sensing protein 2-like [Phoenix dactylifera]
Length=744

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 134/153 (88%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL+TIPVLI SLV+ V+ N++++G+V HAVLST  V+ Y C FVMG
Sbjct  589  IAMRLMDISGRRFLLLATIPVLIASLVLSVVVNLVDMGTVVHAVLSTGSVVAYLCCFVMG  648

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICA+ +W  ++I+TY+LPVML ++GL GVFGIYA VC
Sbjct  649  FGPIPNILCAEIFPTRVRGVCIAICAITYWFGNIIITYTLPVMLDAIGLTGVFGIYAAVC  708

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
            ++S +FV+L+VPETKGMPLEVI+EFFA+G++QA
Sbjct  709  ILSLVFVYLKVPETKGMPLEVISEFFALGSKQA  741



>ref|XP_002312798.1| transporter-related family protein [Populus trichocarpa]
 gb|EEE86753.1| transporter-related family protein [Populus trichocarpa]
Length=740

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/146 (77%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIPVLI SL++LVLG+++++GSV +A +ST+ V+LYFC FVMG
Sbjct  582  VAMRLMDISGRRTLLLTTIPVLIISLILLVLGSLVDMGSVVNASISTVSVVLYFCFFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML S+GLAGVFG+YA+VC
Sbjct  642  FGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLKSIGLAGVFGLYAIVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFF  329
            VIS++FV+L+VPETKGMPLEVI+EFF
Sbjct  702  VISFVFVYLKVPETKGMPLEVISEFF  727



>ref|XP_011099908.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
 ref|XP_011099909.1| PREDICTED: monosaccharide-sensing protein 2-like [Sesamum indicum]
Length=709

 Score =   206 bits (523),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRR LLLST+PVL+ +L++LVLGNVI+LG+V HAV+ST  VI+YFC FVMG
Sbjct  553  VAMRLMDIAGRRWLLLSTLPVLLVTLILLVLGNVIDLGTVMHAVISTASVIVYFCCFVMG  612

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LPVML+ +GLAGVFGIYAVVC
Sbjct  613  FGPIPNILCAEIFPTRVRGICIAICALTFWIGDIIVTYTLPVMLNQIGLAGVFGIYAVVC  672

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQ  311
             ++W+FVF++VPETKGMPLEVITEFFAVGA+Q
Sbjct  673  AVAWVFVFVKVPETKGMPLEVITEFFAVGAKQ  704



>ref|XP_010028861.1| PREDICTED: LOW QUALITY PROTEIN: monosaccharide-sensing protein 
2 [Eucalyptus grandis]
Length=730

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 132/159 (83%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR+LLL TIP+LI SL+++VL NV++ GS  HAV+ TI V+LY C FVMG
Sbjct  572  VAMRLMDVSGRRSLLLGTIPMLIVSLIIMVLSNVVDAGSAIHAVICTIGVVLYICFFVMG  631

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GP PN+LCAEIFPTRVRG C+AIC L FW+ +VIVTYSLP+ML S GLA +FG++ VVC
Sbjct  632  FGPAPNVLCAEIFPTRVRGVCVAICGLAFWMGNVIVTYSLPLMLRSAGLASIFGMFTVVC  691

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
            ++SW FVFL+VPETKGMPLEVITEFF +G +Q    K+E
Sbjct  692  LLSWAFVFLKVPETKGMPLEVITEFFCLGMKQTFAVKDE  730



>ref|XP_011000869.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000870.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011000871.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   206 bits (524),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD+SGRRTLLL+TIPVLI SL++LVLG+++++GSV +A +ST+ V+LYFC FVMG
Sbjct  582  VAMRLMDISGRRTLLLTTIPVLIISLILLVLGSLVDMGSVVNASISTVSVVLYFCFFVMG  641

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAICAL FWICD+IVTY+LPVML S+GLAGVFG+YA+VC
Sbjct  642  FGPIPNILCAEIFPTRVRGLCIAICALTFWICDIIVTYTLPVMLKSIGLAGVFGLYAIVC  701

Query  406  VISWIFVFLRVPETKGMPLEVITEFF  329
            +IS++FV+L+VPETKGMPLEVI+EFF
Sbjct  702  IISFVFVYLKVPETKGMPLEVISEFF  727



>ref|XP_009776539.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009776540.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=722

 Score =   205 bits (522),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD++GRR LLL+T+PVL+ SL+VLVLGNV+ +G+V HAV+STI V++YFC FV G
Sbjct  567  IAMRLMDIAGRRLLLLATLPVLLVSLIVLVLGNVVTMGAVTHAVISTISVVVYFCCFVTG  626

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPT VRG CIAICAL FW  D+IVTYSLPVML+S+GLAGVFGIYA+VC
Sbjct  627  FGPIPNILCSEIFPTSVRGLCIAICALTFWFGDIIVTYSLPVMLTSIGLAGVFGIYAIVC  686

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
             I+W+FVFL+VPETKGMPLEVITEFFAVGA+Q+
Sbjct  687  AIAWVFVFLKVPETKGMPLEVITEFFAVGAKQS  719



>ref|XP_009622210.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622211.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009622212.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=722

 Score =   205 bits (521),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD++GRR LLL+T+PVL+ SL+VLVLGNVI +G+V HAV+STI V++YFC FV G
Sbjct  567  IAMRLMDIAGRRLLLLATLPVLLVSLIVLVLGNVITMGAVTHAVISTISVVVYFCCFVTG  626

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPT VRG CIAICAL FW  D+IVTYSLPVML+S+GLAGVFGIYA+VC
Sbjct  627  FGPIPNILCSEIFPTSVRGLCIAICALTFWFGDIIVTYSLPVMLTSIGLAGVFGIYAIVC  686

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
             I+W+FVFL+VPETKGMPLEVITEFFAVGA+Q+
Sbjct  687  AIAWVFVFLKVPETKGMPLEVITEFFAVGAKQS  719



>ref|XP_006662557.1| PREDICTED: monosaccharide-sensing protein 2-like [Oryza brachyantha]
Length=717

 Score =   204 bits (520),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MD+SGRR LLL+TIP+LI +L +L+L NV+ +G++ HA LST+ VILYFC FVMG
Sbjct  558  IAMRLMDISGRRFLLLATIPILIVALAILILVNVVEVGTMVHASLSTVSVILYFCFFVMG  617

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNI CAEIFPT VRG CIAIC++ FWI D+IVTY+LPVML+S+GLAGVFGIYAVVC
Sbjct  618  FGPIPNIFCAEIFPTTVRGICIAICSMTFWIGDIIVTYTLPVMLNSIGLAGVFGIYAVVC  677

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +++ +FV+ +VPETKGMPLEVITE F++G +     ++
Sbjct  678  ILALLFVYTKVPETKGMPLEVITEVFSLGTQPKHDKED  715



>ref|XP_009589978.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
 ref|XP_009589979.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana tomentosiformis]
Length=721

 Score =   204 bits (520),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD +GRR LLL+T+PVL+ SL+VLV+GNVI++G+V HAV+STI V++YFC+FVMG
Sbjct  566  VAMRLMDFAGRRWLLLATLPVLLASLIVLVIGNVISMGAVMHAVISTISVVVYFCTFVMG  625

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPT VRG CIAICAL FW  D+IVTYSLPVML+S+GL GVFGIYAVVC
Sbjct  626  FGPIPNILCSEIFPTSVRGICIAICALTFWFGDIIVTYSLPVMLTSIGLGGVFGIYAVVC  685

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
             ++W+FV+L+VPETKGMPLEVITEFFAVGA+QA
Sbjct  686  ALAWVFVYLKVPETKGMPLEVITEFFAVGAKQA  718



>ref|XP_002300629.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
 gb|EEE79902.1| hypothetical protein POPTR_0002s00760g [Populus trichocarpa]
Length=738

 Score =   204 bits (520),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MD+SGRRTLLL+TIPVLI SLVVL++  ++ + ++  A + T CVI++ C FV  
Sbjct  581  VAMKLMDISGRRTLLLTTIPVLILSLVVLIIFELVTVSAIVSAAILTACVIIFICCFVSA  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+V+WI D+IVTY+LPVML+S+GL G+F IYA VC
Sbjct  641  YGPIPNILCSEIFPTRVRGLCIAICAMVYWIGDIIVTYTLPVMLTSIGLVGIFSIYAAVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            VISWIFVFL+VPETKGMPLEVITEFFAVGARQA  AKN
Sbjct  701  VISWIFVFLKVPETKGMPLEVITEFFAVGARQAAAAKN  738



>ref|XP_009775817.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775879.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
 ref|XP_009775941.1| PREDICTED: monosaccharide-sensing protein 2-like [Nicotiana sylvestris]
Length=721

 Score =   204 bits (519),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD +GRR LLL+T+PVL+ SLVVLV+GNVI++G+V HAV+ST+ V++YFC+FVMG
Sbjct  566  VAMRLMDFAGRRWLLLATLPVLLASLVVLVIGNVISMGAVMHAVISTVSVVVYFCTFVMG  625

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPT VRG CIAICAL FW  D+IVTYSLPVML+S+GL GVFGIYAVVC
Sbjct  626  FGPIPNILCSEIFPTSVRGICIAICALTFWFGDIIVTYSLPVMLTSIGLGGVFGIYAVVC  685

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
             ++W+FV+L+VPETKGMPLEVITEFFAVGA+QA
Sbjct  686  ALAWVFVYLKVPETKGMPLEVITEFFAVGAKQA  718



>ref|XP_006343319.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343320.1| PREDICTED: monosaccharide-sensing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=722

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 140/153 (92%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRR LLL+T+PVL+ SL+VLVLGNVIN+G V HAV+ST+ V++YFC+FVMG
Sbjct  567  VAMRLMDLAGRRWLLLATLPVLLSSLIVLVLGNVINMGEVMHAVISTVSVVVYFCTFVMG  626

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPT VRG CIAICAL FWI D+IVTYSLP+ML+S+GL GVF IYAVVC
Sbjct  627  FGPIPNILCSEIFPTSVRGICIAICALTFWIGDIIVTYSLPIMLNSIGLGGVFAIYAVVC  686

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
             ++W+FVFL+VPETKGMPLEVITEFFAVGA++A
Sbjct  687  AVAWVFVFLKVPETKGMPLEVITEFFAVGAKRA  719



>ref|NP_001067890.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|ABA93553.1| hexose transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28253.1| Os11g0475600 [Oryza sativa Japonica Group]
 gb|EAZ18344.1| hypothetical protein OsJ_33873 [Oryza sativa Japonica Group]
 dbj|BAH00841.1| unnamed protein product [Oryza sativa Japonica Group]
Length=757

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD SGRR LLL T+PVL+ SL VLV+ NV+ + + AHA LST  VI+YFC FVMG
Sbjct  597  VAMRLMDASGRRALLLWTLPVLVASLAVLVVANVVPMAATAHAALSTGSVIVYFCCFVMG  656

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAIC+L FW+ D+ VTYSLPVMLSS+GLAGVF  YA VC
Sbjct  657  FGPIPNILCAEIFPTRVRGLCIAICSLTFWLGDIAVTYSLPVMLSSVGLAGVFSFYAAVC  716

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ++ +FV L+VPETKG+PLEVI EFF VGA+   +   E
Sbjct  717  CVALVFVALKVPETKGLPLEVIIEFFNVGAKAGTLPDEE  755



>gb|EAY80902.1| hypothetical protein OsI_36080 [Oryza sativa Indica Group]
Length=763

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/159 (68%), Positives = 127/159 (80%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD SGRR LLL T+PVL+ SL VLV+ NV+ + + AHA LST  VI+YFC FVMG
Sbjct  603  VAMRLMDASGRRALLLWTLPVLVASLAVLVVANVVPMAATAHAALSTGSVIVYFCCFVMG  662

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAIC+L FW+ D+ VTYSLPVMLSS+GLAGVF  YA VC
Sbjct  663  FGPIPNILCAEIFPTRVRGLCIAICSLTFWLGDIAVTYSLPVMLSSVGLAGVFSFYAAVC  722

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ++ +FV L+VPETKG+PLEVI EFF VGA+   +   E
Sbjct  723  CVALVFVALKVPETKGLPLEVIIEFFNVGAKAGTLPDEE  761



>ref|NP_001280690.1| monosaccharide-sensing protein 2-like [Solanum lycopersicum]
 dbj|BAO96236.1| tonoplast monosaccharide transporter 1 [Solanum lycopersicum]
Length=725

 Score =   204 bits (518),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 139/153 (91%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRR LLL+T+PVL+ SL+VLVLGNVIN+G V HAV+ST  V++YFC+FVMG
Sbjct  570  VAMRLMDLAGRRWLLLATLPVLLSSLIVLVLGNVINMGEVMHAVISTASVVVYFCTFVMG  629

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC+EIFPT VRG CIAICAL FWI D+IVTYSLPVML+S+GL GVF IYAVVC
Sbjct  630  FGPIPNILCSEIFPTSVRGICIAICALTFWIGDIIVTYSLPVMLNSIGLGGVFAIYAVVC  689

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
             ++W+FVFL+VPETKGMPLEVITEFFAVGA++A
Sbjct  690  AVAWVFVFLKVPETKGMPLEVITEFFAVGAKKA  722



>ref|XP_003560303.1| PREDICTED: monosaccharide-sensing protein 2-like [Brachypodium 
distachyon]
Length=770

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 129/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MDVSGRR+LLL TIPVLI +L+VL++ NV+ + +  HA LST  VI+YFC FVMG
Sbjct  613  IAMRLMDVSGRRSLLLWTIPVLICALLVLIVANVVPMATTLHAALSTGSVIVYFCCFVMG  672

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAIC+L FWI D++VTYSLPVMLSS+GLAGVFG YA VC
Sbjct  673  FGPIPNILCAEIFPTRVRGLCIAICSLTFWIGDIVVTYSLPVMLSSVGLAGVFGFYAFVC  732

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGAR  314
             ++ +FV L+VPETKG+PLEVI EFF VGA+
Sbjct  733  CLALVFVALKVPETKGLPLEVIIEFFNVGAK  763



>ref|XP_011041174.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=740

 Score =   202 bits (514),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 128/146 (88%), Gaps = 0/146 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD++GRRTLLL+TIPVLI SL+VL++  ++ + SV +A + T CVI++ C FV  
Sbjct  581  VAMRLMDIAGRRTLLLTTIPVLILSLIVLIIFELVTVSSVVNAAILTACVIIFICCFVSA  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+V+WI D+IVTY+LPVMLSS+GL G+FGIYAVVC
Sbjct  641  YGPIPNILCSEIFPTRVRGLCIAICAMVYWIGDIIVTYTLPVMLSSIGLVGIFGIYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFF  329
             ISWIFVFL+VPETKGMPLEVITEFF
Sbjct  701  AISWIFVFLKVPETKGMPLEVITEFF  726



>ref|XP_011034826.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034827.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034828.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011034829.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=738

 Score =   201 bits (512),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/158 (72%), Positives = 137/158 (87%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAM+ MD+SGRRTLLL+TIPVLI SL+VL++  ++ + ++  A + T CVI++ C FV  
Sbjct  581  VAMKLMDISGRRTLLLTTIPVLILSLIVLIIFELVTVSAMVSAAILTACVIIFICCFVSA  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            YGPIPNILC+EIFPTRVRG CIAICA+V+WI D+IVTY+LPVML+S+GL G+FGIYA VC
Sbjct  641  YGPIPNILCSEIFPTRVRGLCIAICAMVYWIGDIIVTYTLPVMLTSIGLVGIFGIYAAVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +ISWIFVFL+VPETKGMPLEVITEFFAVGARQA  AKN
Sbjct  701  IISWIFVFLKVPETKGMPLEVITEFFAVGARQAAAAKN  738



>emb|CAN64713.1| hypothetical protein VITISV_043728 [Vitis vinifera]
Length=120

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 105/117 (90%), Gaps = 2/117 (2%)
 Frame = -2

Query  643  HAVLSTICVILYFCSFVMGYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLP  464
            HA +ST  VI+YFC FVMG+GP+PNILCAEIFPTRVRG CIAICAL FWI D+IVTY+LP
Sbjct  6    HAAISTASVIIYFCCFVMGFGPVPNILCAEIFPTRVRGLCIAICALSFWIGDIIVTYTLP  65

Query  463  VMLSSMGLAGVFGIYAVVCVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +ML+S+GLAGVFG+YAVVC+ISW+FVFL+VPETKGMPLEVI+EFFAVG+   +  KN
Sbjct  66   LMLTSVGLAGVFGMYAVVCLISWVFVFLKVPETKGMPLEVISEFFAVGSSAGQ--KN  120



>ref|XP_002439068.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor]
 gb|EER90435.1| hypothetical protein SORBIDRAFT_10g031000 [Sorghum bicolor]
Length=767

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MDV+GRR+LLL TIPVL+ SLVVL++ N++ + +  HAVLST  VI+YFC FVMG
Sbjct  604  LAMRLMDVAGRRSLLLWTIPVLVASLVVLIVANLVPMATTVHAVLSTASVIVYFCCFVMG  663

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAIC+L FW+ D+ VTYSLPVML ++GLAGVFG YA VC
Sbjct  664  FGPIPNILCAEIFPTRVRGLCIAICSLTFWLGDIAVTYSLPVMLKAIGLAGVFGFYAFVC  723

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGAR  314
             ++ IFV+L+VPETKG PLEVI EFF +GA+
Sbjct  724  CLALIFVYLKVPETKGFPLEVIIEFFNIGAK  754



>dbj|BAK02857.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=729

 Score =   200 bits (508),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/159 (66%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDV+GRR+LLL TIPVLI SLV LV  +V+ L +  HA +ST  VI+Y C+FVMG
Sbjct  570  VAMRLMDVAGRRSLLLWTIPVLIVSLVSLVTADVLPLAATVHAAVSTTSVIVYICTFVMG  629

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIP ILC+EIFPTRVRG CIAIC+L FW+ D+ VTYS+PVML S+GLAGVF IYA VC
Sbjct  630  FGPIPGILCSEIFPTRVRGMCIAICSLAFWLSDIAVTYSMPVMLDSLGLAGVFSIYAAVC  689

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ++  FV LRVPETKG+PLEVI EFF VGA+      +E
Sbjct  690  CVALAFVALRVPETKGLPLEVIAEFFNVGAKGMPKLDHE  728



>ref|XP_007203009.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
 gb|EMJ04208.1| hypothetical protein PRUPE_ppa017631mg [Prunus persica]
Length=738

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
             +M  MD +GRR LLLSTIP+LI SL +LV  N++NLGS+ +A +ST  V++Y C FVM 
Sbjct  581  TSMWLMDKAGRRPLLLSTIPILILSLALLVFVNIVNLGSILNATISTASVVVYLCCFVMA  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNILCAEIFPTR+RG CIAICAL FWI D+++TYS PVMLSS+G AGVFGIY   C
Sbjct  641  FGVIPNILCAEIFPTRIRGLCIAICALTFWIGDIVITYSFPVMLSSIGFAGVFGIYVAGC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +I+W FV+L+VPETKGMPLEVI++FFA G +QA  A N
Sbjct  701  IIAWFFVYLKVPETKGMPLEVISDFFAAGVKQAADASN  738



>ref|XP_008242155.1| PREDICTED: monosaccharide-sensing protein 2-like [Prunus mume]
Length=738

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 104/158 (66%), Positives = 127/158 (80%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
             +M  MD +GRR+LLLSTIP+LI SL +LV  N++NLGS+ +A +ST  V++Y C FVM 
Sbjct  581  TSMWLMDKAGRRSLLLSTIPILILSLALLVFVNIVNLGSILNAAISTDSVVVYLCCFVMA  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNILCAEIFPTRVR  CIAICAL FWI D+I+TYS PVMLSS+G AGVFGIY   C
Sbjct  641  FGVIPNILCAEIFPTRVRSLCIAICALTFWIGDIIITYSFPVMLSSIGFAGVFGIYVAGC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            +I+W FV+L+VPETKGMPLEVI++FFA G +QA  A N
Sbjct  701  IIAWFFVYLKVPETKGMPLEVISDFFAAGVKQAADASN  738



>gb|KJB12351.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
 gb|KJB12353.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=734

 Score =   197 bits (500),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDV+GRR+LLL+T+P+LI SL+VLV+G ++ +G+V +A LSTI V+L F  FVMG
Sbjct  581  VAMRLMDVAGRRSLLLTTVPLLIISLLVLVIGTIVKMGNVTNAALSTISVVLCFFFFVMG  640

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC EIFPTRVRG CIA+C L+ WIC++IVTYSLPV+L S+GLAG+FG+YAVVC
Sbjct  641  FGPIPNILCTEIFPTRVRGICIAVCFLISWICNIIVTYSLPVLLKSIGLAGLFGMYAVVC  700

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQ  311
             ISW+FVFL+VPETKGMPLEVI + F+VGA++
Sbjct  701  AISWVFVFLKVPETKGMPLEVIMDVFSVGAKR  732



>gb|KJB12354.1| hypothetical protein B456_002G014400 [Gossypium raimondii]
Length=758

 Score =   197 bits (501),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDV+GRR+LLL+T+P+LI SL+VLV+G ++ +G+V +A LSTI V+L F  FVMG
Sbjct  605  VAMRLMDVAGRRSLLLTTVPLLIISLLVLVIGTIVKMGNVTNAALSTISVVLCFFFFVMG  664

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILC EIFPTRVRG CIA+C L+ WIC++IVTYSLPV+L S+GLAG+FG+YAVVC
Sbjct  665  FGPIPNILCTEIFPTRVRGICIAVCFLISWICNIIVTYSLPVLLKSIGLAGLFGMYAVVC  724

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQ  311
             ISW+FVFL+VPETKGMPLEVI + F+VGA++
Sbjct  725  AISWVFVFLKVPETKGMPLEVIMDVFSVGAKR  756



>ref|XP_006292750.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
 gb|EOA25648.1| hypothetical protein CARUB_v10018997mg [Capsella rubella]
Length=729

 Score =   196 bits (498),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/145 (68%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -2

Query  733  RTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  554
            R+LLLSTIP+LI SLV LV+G+++ LG   +A++ST  V +Y   FVMG+G IPNILC+E
Sbjct  578  RSLLLSTIPILILSLVTLVVGSLVKLGGTTNALISTASVTVYLSCFVMGFGAIPNILCSE  637

Query  553  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  374
            IFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA+VC ++W+FV+L+V
Sbjct  638  IFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAIVCAVAWVFVYLKV  697

Query  373  PETKGMPLEVITEFFAVGARQAEMA  299
            PETKGMPLEVI+EFF+VGA+Q + A
Sbjct  698  PETKGMPLEVISEFFSVGAKQQDAA  722



>emb|CDX78009.1| BnaA09g32040D [Brassica napus]
Length=669

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -2

Query  733  RTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  554
            R+L+LSTIP+LI SL+ LV+G+++ LG  A+A++ST  V++Y   FVMG+G IPNILC+E
Sbjct  520  RSLMLSTIPILILSLLTLVIGSLVKLGGTANALISTASVMVYLSCFVMGFGAIPNILCSE  579

Query  553  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  374
            IFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC ++W+FV+L+V
Sbjct  580  IFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVCAVAWVFVYLKV  639

Query  373  PETKGMPLEVITEFFAVGARQAEMA  299
            PETKGMPLEVI+EFF+VGA+Q + A
Sbjct  640  PETKGMPLEVISEFFSVGAKQQDAA  664



>emb|CDX73717.1| BnaC08g22860D [Brassica napus]
Length=681

 Score =   195 bits (496),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -2

Query  733  RTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  554
            R+L+LSTIP+LI SL+ LV+G+++ LG  A+A++ST  V++Y   FVMG+G IPNILC+E
Sbjct  532  RSLMLSTIPILILSLLTLVIGSLVKLGGTANALISTASVMVYLSCFVMGFGAIPNILCSE  591

Query  553  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  374
            IFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC ++W+FV+L+V
Sbjct  592  IFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVCAVAWVFVYLKV  651

Query  373  PETKGMPLEVITEFFAVGARQAEMA  299
            PETKGMPLEVI+EFF+VGA+Q + A
Sbjct  652  PETKGMPLEVISEFFSVGAKQQDAA  676



>gb|EMS60524.1| Monosaccharide-sensing protein 3 [Triticum urartu]
Length=407

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 123/159 (77%), Gaps = 0/159 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDV+GRR+LLL TIPVLI SLV LV  +V+ L +  HA +ST  +I+Y C+FVMG
Sbjct  248  VAMRLMDVAGRRSLLLWTIPVLIVSLVSLVTADVLPLATTMHAAVSTTSIIVYICTFVMG  307

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIP ILC+EIFPTRVRG CIAIC+L FW+ ++ VTYS+PVML  +GL GVF IYA VC
Sbjct  308  FGPIPGILCSEIFPTRVRGMCIAICSLAFWLSNIAVTYSMPVMLDYLGLTGVFSIYAAVC  367

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE  290
             ++ +FV LRVPETKG+PLEVI EFF V ++      ++
Sbjct  368  CVALVFVALRVPETKGLPLEVIAEFFNVASKGMPKLDHD  406



>gb|EYU40481.1| hypothetical protein MIMGU_mgv1a001997mg [Erythranthe guttata]
Length=728

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 124/159 (78%), Gaps = 1/159 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVL-IFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVM  590
            +AMR MDVSGRR+LLL+T PVL +  +++++   +    ++  A +ST+ VI Y C F M
Sbjct  569  IAMRLMDVSGRRSLLLNTNPVLTVSLVILVMTRYIEVGSNIGKAAVSTVSVITYSCFFAM  628

Query  589  GYGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVV  410
            G+GPIPNILCAEIFPTRVRG CI IC + FWIC++++TYSLP+MLS +GL GVF I+AV 
Sbjct  629  GFGPIPNILCAEIFPTRVRGVCIGICGITFWICNIMITYSLPMMLSWIGLGGVFSIFAVA  688

Query  409  CVISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
             ++SW FV+L+VPETKGMPLEVITEFF++GA+ A    N
Sbjct  689  SLVSWGFVYLKVPETKGMPLEVITEFFSLGAKPAAAPPN  727



>ref|XP_002877807.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54066.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=730

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  733  RTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  554
            R+L+LSTIP+LI SLV LV+G+++ LG   +A++ST  V +Y   FVMG+G IPNILC+E
Sbjct  579  RSLMLSTIPILILSLVTLVIGSLVKLGGTTNALISTASVTVYLSCFVMGFGAIPNILCSE  638

Query  553  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  374
            IFPT VRG CI ICAL FWICD+IVTY+LPVML S+G+AGVFGIYA+VC ++W+FV+LRV
Sbjct  639  IFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSIGIAGVFGIYAIVCAVAWVFVYLRV  698

Query  373  PETKGMPLEVITEFFAVGARQAE  305
            PETKGMPLEVI+EFF+VGA+Q +
Sbjct  699  PETKGMPLEVISEFFSVGAKQQD  721



>emb|CDY16303.1| BnaC01g23380D [Brassica napus]
Length=670

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -2

Query  733  RTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  554
            R+L+LSTIP+LI SL+ LV+G+++ L   A+A++ST  V++Y   FVMG+G IPNILC+E
Sbjct  518  RSLMLSTIPILILSLITLVIGSLVKLEGTANALISTASVMVYLSCFVMGFGAIPNILCSE  577

Query  553  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  374
            IFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC ++W+FV+L+V
Sbjct  578  IFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVCAVAWVFVYLKV  637

Query  373  PETKGMPLEVITEFFAVGARQAEMA  299
            PETKGMPLEVI+EFF+VGA+  + +
Sbjct  638  PETKGMPLEVISEFFSVGAKHQDAS  662



>emb|CDY33276.1| BnaA01g19430D [Brassica napus]
Length=668

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/145 (66%), Positives = 124/145 (86%), Gaps = 0/145 (0%)
 Frame = -2

Query  733  RTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  554
            R+L+LSTIP+LI SL+ LV+G+++ LG  A+A++ST  V++Y   FVMG+G IPNILC+E
Sbjct  516  RSLMLSTIPILILSLITLVIGSLVKLGGTANALISTASVMVYLSCFVMGFGAIPNILCSE  575

Query  553  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  374
            IFPT VRG CI ICAL FWICD+IVTY+LPVML S+GLAGVFGIYA VC ++W+FV+L+V
Sbjct  576  IFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSLGLAGVFGIYAFVCAVAWVFVYLKV  635

Query  373  PETKGMPLEVITEFFAVGARQAEMA  299
            PETKGMPLEVI+EFF+VGA+  + +
Sbjct  636  PETKGMPLEVISEFFSVGAKHQDAS  660



>ref|NP_190717.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
 sp|Q9SD00.1|MSSP3_ARATH RecName: Full=Monosaccharide-sensing protein 3; AltName: Full=Sugar 
transporter MSSP3 [Arabidopsis thaliana]
 emb|CAB63013.1| sugar transporter-like protein [Arabidopsis thaliana]
 emb|CAD58693.1| monosaccharide sensing protein 3 [Arabidopsis thaliana]
 gb|AEE78798.1| tonoplast monosaccharide transporter3 [Arabidopsis thaliana]
Length=729

 Score =   192 bits (489),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 125/145 (86%), Gaps = 0/145 (0%)
 Frame = -2

Query  733  RTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMGYGPIPNILCAE  554
            R+L+LSTIP+LI SLV LV+G+++NLG   +A++ST  V +Y   FVMG+G IPNILC+E
Sbjct  578  RSLMLSTIPILILSLVTLVIGSLVNLGGSINALISTASVTVYLSCFVMGFGAIPNILCSE  637

Query  553  IFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVCVISWIFVFLRV  374
            IFPT VRG CI ICAL FWICD+IVTY+LPVML S+G+AGVFGIYA+VC ++W+FV+L+V
Sbjct  638  IFPTSVRGLCITICALTFWICDIIVTYTLPVMLKSIGIAGVFGIYAIVCAVAWVFVYLKV  697

Query  373  PETKGMPLEVITEFFAVGARQAEMA  299
            PETKGMPLEVI+EFF+VGA+Q + A
Sbjct  698  PETKGMPLEVISEFFSVGAKQQDAA  722



>ref|XP_011022133.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
 ref|XP_011022134.1| PREDICTED: monosaccharide-sensing protein 2-like [Populus euphratica]
Length=719

 Score =   192 bits (487),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MDVSGRR++LL TIP+L+ +LV  VLG+++N+ S   AV+ST  V++Y   FVMG
Sbjct  567  LAMRLMDVSGRRSILLYTIPILVATLVAFVLGSIVNMDSSLKAVISTGSVMMYLSCFVMG  626

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNILCAEIFPTRVRG CI IC+L +WI ++ +TYSLPVML+  GL+GVF IYA+ C
Sbjct  627  FGVIPNILCAEIFPTRVRGICITICSLTYWIGNITITYSLPVMLNFFGLSGVFTIYAIGC  686

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQ  311
             +SWIFVFL+VPETKGMPLEVITEFFAVG++ 
Sbjct  687  AVSWIFVFLKVPETKGMPLEVITEFFAVGSKN  718



>ref|XP_002306419.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
 gb|EEE93415.1| hypothetical protein POPTR_0005s10180g [Populus trichocarpa]
Length=719

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AMR MDVSGRR++LL TIP+L+ SLV  VLG+++N+ S   AV+ST  V++Y   FVMG
Sbjct  567  LAMRLMDVSGRRSILLYTIPILVASLVAFVLGSIVNMDSSLKAVISTGSVMIYLSCFVMG  626

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNILCAEIFPTRVRG CI IC+L +WI ++ +TYSLPVML+  GL+GVF IYA+ C
Sbjct  627  FGVIPNILCAEIFPTRVRGICITICSLTYWIGNITITYSLPVMLNFFGLSGVFTIYAIGC  686

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQ  311
             +SWIFVFL+VPETKGMPLEVITEFFAVG++ 
Sbjct  687  AVSWIFVFLKVPETKGMPLEVITEFFAVGSKN  718



>ref|XP_006649210.1| PREDICTED: monosaccharide-sensing protein 2-like [Oryza brachyantha]
Length=668

 Score =   191 bits (486),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 122/151 (81%), Gaps = 0/151 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MD SGRR+LLL TIPVLI SL  LV+ +V  + + AHA L T  V++Y C FVMG
Sbjct  504  VAMRLMDASGRRSLLLWTIPVLIASLAALVVASVAPMAAAAHAALCTGSVVVYLCCFVMG  563

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAIC+L FW+ D+ VTYSLPVMLSS+GLAGVF IYA VC
Sbjct  564  FGPIPNILCAEIFPTRVRGLCIAICSLAFWLADIAVTYSLPVMLSSLGLAGVFAIYAAVC  623

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGAR  314
             ++  FV LRVPETKG+PLEVI +FF VGA+
Sbjct  624  CVALAFVALRVPETKGLPLEVIIDFFNVGAK  654



>gb|KHG14026.1| Monosaccharide-sensing 2 -like protein [Gossypium arboreum]
Length=737

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMRF+DV+GRR LLL T+P+L   L +LV+G+++ +GSV  + +ST+ V+L  C + MG
Sbjct  574  VAMRFVDVAGRRRLLLITVPLLALCLFILVIGSIVKMGSVVRSAISTVSVVLSCCVYAMG  633

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIP+ILCAEIFPTRVRG CIAI +LV+WI ++IV YSLPV+L ++GLAGVFG++  VC
Sbjct  634  FGPIPSILCAEIFPTRVRGTCIAIVSLVYWISNIIVAYSLPVLLKTVGLAGVFGMFGTVC  693

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            + S++FVFL+VPETKGMPLEVITEFF+VG++QA  AKN
Sbjct  694  LASFVFVFLKVPETKGMPLEVITEFFSVGSKQAITAKN  731



>gb|KJB31963.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31964.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31965.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31966.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
 gb|KJB31967.1| hypothetical protein B456_005G216600 [Gossypium raimondii]
Length=737

 Score =   191 bits (485),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            V MRF+DV+GRR LLL T+P+L   L +LV+G+ + +GSV  + +ST+ V+L  C +VMG
Sbjct  574  VVMRFVDVAGRRRLLLITVPLLALCLFILVIGSFVKMGSVVRSAISTVSVVLSCCVYVMG  633

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIP+ILCAEIFPTRVRG CIAI +LV+WI ++IV YSLPV+L ++GLAGVFG++  VC
Sbjct  634  FGPIPSILCAEIFPTRVRGTCIAIVSLVYWISNIIVAYSLPVLLKTIGLAGVFGMFGTVC  693

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKN  293
            + S++FVFL+VPETKGMPLEVITEFF+VG++QA  AKN
Sbjct  694  LASFVFVFLKVPETKGMPLEVITEFFSVGSKQAITAKN  731



>ref|XP_004289030.1| PREDICTED: monosaccharide-sensing protein 2 [Fragaria vesca subsp. 
vesca]
Length=714

 Score =   191 bits (484),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/153 (65%), Positives = 127/153 (83%), Gaps = 0/153 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
             +M  MD++GRR+LLLST+P+LI +L +LVL +++NLG+   A +ST  V++Y C FVMG
Sbjct  559  TSMWLMDIAGRRSLLLSTLPILIVALALLVLSSIVNLGTTLTATISTASVVIYLCCFVMG  618

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNILCAEIFPT VRG CIAICAL +WI D+I+TYS PVMLSS+G AGVFG+Y + C
Sbjct  619  FGVIPNILCAEIFPTPVRGLCIAICALTYWIGDIIITYSFPVMLSSIGFAGVFGVYVLGC  678

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQA  308
            +ISWIFV+L+VPETKGMPLEVI+EFFA G + A
Sbjct  679  IISWIFVYLKVPETKGMPLEVISEFFAAGVKPA  711



>gb|EMT01868.1| Monosaccharide-sensing protein 2 [Aegilops tauschii]
Length=532

 Score =   188 bits (478),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDV+GRR+LLL TIPVLI SLV LV  +V+ L +  HA +ST  +I+Y C+FVMG
Sbjct  373  VAMRLMDVAGRRSLLLWTIPVLIVSLVSLVTADVLPLATTLHAAVSTTSIIIYICTFVMG  432

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIP ILC+EIFPTRVRG CIAIC+L FW+ ++ VTYS+PVML  +GL GVF IYA VC
Sbjct  433  FGPIPGILCSEIFPTRVRGMCIAICSLAFWLSNIAVTYSMPVMLDYLGLTGVFSIYAAVC  492

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGAR  314
             ++  FV LRVPETKG+PLEVI EFF V ++
Sbjct  493  CVALAFVALRVPETKGLPLEVIAEFFNVASK  523



>gb|EAY88138.1| hypothetical protein OsI_09573 [Oryza sativa Indica Group]
Length=643

 Score =   187 bits (474),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR+LLL TIP+L+ SL VLV  +V  + + AHA + T  V++Y C FVMG
Sbjct  480  VAMRLMDVSGRRSLLLWTIPLLVASLAVLVAASVAPMAAAAHAAVCTGSVVVYLCCFVMG  539

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAIC+L FW+ D+ VTY+LPVML+S+GLAG+F IYA VC
Sbjct  540  FGPIPNILCAEIFPTRVRGLCIAICSLAFWLADIAVTYTLPVMLASLGLAGLFAIYAAVC  599

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGAR  314
             ++ +FV LRVPETKG+PLEVI +FF VGA+
Sbjct  600  CVALVFVALRVPETKGLPLEVIIDFFNVGAK  630



>dbj|BAD23011.1| putative hexose transporter [Oryza sativa Japonica Group]
 gb|EAZ25202.1| hypothetical protein OsJ_09002 [Oryza sativa Japonica Group]
Length=652

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/151 (67%), Positives = 124/151 (82%), Gaps = 0/151 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR+LLL TIP+L+ SL VLV  +V  + + AHA + T  V++Y C FVMG
Sbjct  489  VAMRLMDVSGRRSLLLWTIPLLVASLAVLVAASVAPMAAAAHAAVCTGSVVVYLCCFVMG  548

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAIC+L FW+ D+ VTY+LPVML+S+GLAG+F IYA VC
Sbjct  549  FGPIPNILCAEIFPTRVRGLCIAICSLAFWLADIAVTYTLPVMLASLGLAGLFAIYAAVC  608

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGAR  314
             ++ +FV LRVPETKG+PLEVI +FF VGA+
Sbjct  609  CVALVFVALRVPETKGLPLEVIIDFFNVGAK  639



>ref|XP_004954530.1| PREDICTED: monosaccharide-sensing protein 2-like [Setaria italica]
Length=707

 Score =   187 bits (475),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDVSGRR+LLL TIPVLI SLVVLV+ +V+ + +  HA ++T  V+ Y C FVMG
Sbjct  533  VAMRLMDVSGRRSLLLWTIPVLIVSLVVLVVASVVPMAAAVHAAVATGSVMTYLCCFVMG  592

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNILCAEIFPTRVRG CIAIC+L FW+ D+ VTYSLPVML+ +GLAGVFG YAVVC
Sbjct  593  FGPIPNILCAEIFPTRVRGLCIAICSLAFWLADIAVTYSLPVMLNCVGLAGVFGFYAVVC  652

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGAR  314
             ++  FV LRVPETKG+PLEVITEFF VGAR
Sbjct  653  CLALAFVALRVPETKGLPLEVITEFFNVGAR  683



>ref|XP_010097645.1| Monosaccharide-sensing protein 3 [Morus notabilis]
 gb|EXB70345.1| Monosaccharide-sensing protein 3 [Morus notabilis]
Length=737

 Score =   187 bits (474),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/151 (65%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
             +M  MDVSGRR+LLLSTIP+LI SL +LVLG+++N GS  +A++ST  VI+Y C FVM 
Sbjct  587  TSMWLMDVSGRRSLLLSTIPILIVSLFLLVLGSIVNFGSTMNALISTSSVIVYECCFVMA  646

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNILCAEIFPTRVRG+CIA+C+L +WI ++++TYS P M   +GLAGV GIYA+ C
Sbjct  647  FGVIPNILCAEIFPTRVRGRCIALCSLTYWIGNILITYSFPTMFKLIGLAGVIGIYAIGC  706

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGAR  314
            ++SWIFVFL+VPETKGMPLEVI+EFFA+  +
Sbjct  707  IVSWIFVFLKVPETKGMPLEVISEFFALETK  737



>ref|XP_009359632.1| PREDICTED: monosaccharide-sensing protein 2-like [Pyrus x bretschneideri]
Length=736

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 132/164 (80%), Gaps = 0/164 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
             +M  MD++GRR+LLLST+P+LI SL +LVL N++NLG+V +A +ST  V++Y C FVM 
Sbjct  573  TSMWLMDIAGRRSLLLSTLPILILSLTLLVLVNIVNLGTVVNATISTASVVVYLCCFVMA  632

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNILCAEIFPTRVRG CIAICAL  WI D+I+TYS PV+LSS+G AGVFGIY V C
Sbjct  633  FGVIPNILCAEIFPTRVRGLCIAICALALWIGDIIITYSFPVLLSSVGFAGVFGIYVVGC  692

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAKNE*MNER  275
            ++SW+FV+L+VPETKGMPLEVI+EFFA G + A    +   N++
Sbjct  693  IVSWVFVYLKVPETKGMPLEVISEFFAAGVKPATADTSADSNDK  736



>gb|EMT02609.1| Monosaccharide-sensing protein 3 [Aegilops tauschii]
Length=760

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AM  MD SGRR +LL TIP+L+ SL+VLV  N++NL +  HA+LST+ V +YFC FVMG
Sbjct  545  IAMWLMDRSGRRRILLVTIPILVVSLIVLVTVNIVNLSAELHALLSTMSVGIYFCIFVMG  604

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNI C+EIFP +VR  C+AIC+L+FWICD+IVTY+LPV+L  +GLAGVFG+YA+VC
Sbjct  605  FGPIPNIFCSEIFPNKVRAICLAICSLIFWICDIIVTYTLPVLLRYIGLAGVFGVYAIVC  664

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAEMAK  296
            V++++FV L+VPETK +P+EVI EF+A+G      AK
Sbjct  665  VLAFVFVCLKVPETKNIPIEVIAEFYALGGSDYVKAK  701



>ref|XP_012065453.1| PREDICTED: monosaccharide-sensing protein 2-like [Jatropha curcas]
 gb|KDP43790.1| hypothetical protein JCGZ_22417 [Jatropha curcas]
Length=729

 Score =   186 bits (471),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            VAMR MDV+GRR ++L TIPVLI SL+ LVL N++N+GSV HA++ST  V+ Y   FVMG
Sbjct  573  VAMRLMDVAGRRAIMLYTIPVLIVSLLALVLSNIVNIGSVLHAIISTGSVMFYISFFVMG  632

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +G IPNI+C+EIFPT VRG CI ICA+ +W+ D+ +TY LP+ML S+GL+GVF  +++ C
Sbjct  633  FGAIPNIICSEIFPTSVRGLCITICAMTYWLGDITITYMLPIMLKSIGLSGVFTFFSIGC  692

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGA  317
            ++SWIFVFL+VPETKGMPLEVI+EFFAVGA
Sbjct  693  IVSWIFVFLKVPETKGMPLEVISEFFAVGA  722



>gb|EMS63099.1| Monosaccharide-sensing protein 3 [Triticum urartu]
Length=714

 Score =   185 bits (469),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 133/167 (80%), Gaps = 1/167 (1%)
 Frame = -2

Query  766  VAMRFMDVSGRRTLLLSTIPVLIFslvvlvlgnvinlgsVAHAVLSTICVILYFCSFVMG  587
            +AM  MD SGRR +LL TIP+L+ SL+VLV  N++NL +  HA+LST+ V +YFC FVMG
Sbjct  546  MAMWLMDRSGRRRILLVTIPILVVSLIVLVTVNIVNLSAELHALLSTMSVGIYFCIFVMG  605

Query  586  YGPIPNILCAEIFPTRVRGQCIAICALVFWICDVIVTYSLPVMLSSMGLAGVFGIYAVVC  407
            +GPIPNI C+EIFP +VR  C+AIC+L+FWICD+IVTY+LPV+L  +GLAGVFG+YA+VC
Sbjct  606  FGPIPNIFCSEIFPNKVRAICLAICSLIFWICDIIVTYTLPVLLRYIGLAGVFGVYAIVC  665

Query  406  VISWIFVFLRVPETKGMPLEVITEFFAVGARQAE-MAKNE*MNERKL  269
            V++++FV L+VPETK +P+EVI EF+A+G    + + + +  N  KL
Sbjct  666  VLAFVFVCLKVPETKNIPIEVIAEFYALGGSGTQIIQERQKENSEKL  712



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1710808110896