BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9802

Length=1449
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009615489.1|  PREDICTED: transmembrane and coiled-coil dom...    298   2e-124   Nicotiana tomentosiformis
ref|XP_009615490.1|  PREDICTED: transmembrane and coiled-coil dom...    298   3e-124   Nicotiana tomentosiformis
ref|XP_009757146.1|  PREDICTED: transmembrane and coiled-coil dom...    298   3e-124   Nicotiana sylvestris
ref|XP_009757147.1|  PREDICTED: transmembrane and coiled-coil dom...    297   3e-124   Nicotiana sylvestris
ref|XP_009615488.1|  PREDICTED: transmembrane and coiled-coil dom...    297   4e-124   Nicotiana tomentosiformis
ref|XP_009757145.1|  PREDICTED: transmembrane and coiled-coil dom...    297   7e-124   Nicotiana sylvestris
ref|XP_010317701.1|  PREDICTED: transmembrane and coiled-coil dom...    296   3e-122   
ref|XP_010317700.1|  PREDICTED: transmembrane and coiled-coil dom...    295   4e-122   Solanum lycopersicum
ref|XP_004234544.1|  PREDICTED: transmembrane and coiled-coil dom...    295   4e-122   Solanum lycopersicum
ref|XP_010317702.1|  PREDICTED: transmembrane and coiled-coil dom...    295   5e-122   Solanum lycopersicum
ref|XP_006343380.1|  PREDICTED: transmembrane and coiled-coil dom...    295   5e-121   Solanum tuberosum [potatoes]
ref|XP_006343379.1|  PREDICTED: transmembrane and coiled-coil dom...    294   7e-121   
ref|XP_006343378.1|  PREDICTED: transmembrane and coiled-coil dom...    294   9e-121   Solanum tuberosum [potatoes]
gb|EYU31146.1|  hypothetical protein MIMGU_mgv1a002490mg                283   3e-120   Erythranthe guttata [common monkey flower]
ref|XP_009600610.1|  PREDICTED: transmembrane and coiled-coil dom...    292   7e-120   
ref|XP_009789382.1|  PREDICTED: transmembrane and coiled-coil dom...    290   7e-120   Nicotiana sylvestris
ref|XP_009600609.1|  PREDICTED: transmembrane and coiled-coil dom...    291   7e-120   Nicotiana tomentosiformis
ref|XP_009789372.1|  PREDICTED: transmembrane and coiled-coil dom...    289   1e-119   Nicotiana sylvestris
gb|EYU24080.1|  hypothetical protein MIMGU_mgv1a002505mg                281   3e-119   Erythranthe guttata [common monkey flower]
ref|XP_011090424.1|  PREDICTED: transmembrane and coiled-coil dom...    276   4e-116   Sesamum indicum [beniseed]
ref|XP_010649080.1|  PREDICTED: transmembrane and coiled-coil dom...    273   1e-115   
ref|XP_010649079.1|  PREDICTED: transmembrane and coiled-coil dom...    271   2e-115   Vitis vinifera
ref|XP_006340700.1|  PREDICTED: transmembrane and coiled-coil dom...    282   1e-114   Solanum tuberosum [potatoes]
ref|XP_010316399.1|  PREDICTED: transmembrane and coiled-coil dom...    281   1e-114   
ref|XP_010113393.1|  hypothetical protein L484_026725                   270   7e-114   
emb|CDP01935.1|  unnamed protein product                                266   2e-113   Coffea canephora [robusta coffee]
ref|XP_008453712.1|  PREDICTED: transmembrane and coiled-coil dom...    273   5e-113   Cucumis melo [Oriental melon]
ref|XP_011653146.1|  PREDICTED: transmembrane and coiled-coil dom...    273   8e-113   Cucumis sativus [cucumbers]
ref|XP_010033460.1|  PREDICTED: transmembrane and coiled-coil dom...    262   1e-112   Eucalyptus grandis [rose gum]
ref|XP_002533809.1|  conserved hypothetical protein                     259   2e-112   Ricinus communis
gb|KDO71087.1|  hypothetical protein CISIN_1g006082mg                   264   3e-111   Citrus sinensis [apfelsine]
ref|XP_006425555.1|  hypothetical protein CICLE_v10025097mg             264   3e-111   
ref|XP_006466894.1|  PREDICTED: transmembrane and coiled-coil dom...    264   3e-111   
gb|KDO71090.1|  hypothetical protein CISIN_1g006082mg                   263   3e-111   Citrus sinensis [apfelsine]
gb|KDO71091.1|  hypothetical protein CISIN_1g006082mg                   263   3e-111   Citrus sinensis [apfelsine]
ref|XP_010271492.1|  PREDICTED: transmembrane and coiled-coil dom...    268   4e-111   Nelumbo nucifera [Indian lotus]
ref|XP_010271491.1|  PREDICTED: transmembrane and coiled-coil dom...    267   7e-111   Nelumbo nucifera [Indian lotus]
ref|XP_011100949.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    265   2e-110   Sesamum indicum [beniseed]
ref|XP_010679841.1|  PREDICTED: transmembrane and coiled-coil dom...    259   3e-110   Beta vulgaris subsp. vulgaris [field beet]
gb|AES95070.2|  transmembrane and coiled-coil protein                   261   3e-110   Medicago truncatula
ref|XP_002869040.1|  hypothetical protein ARALYDRAFT_912740             268   4e-110   
ref|XP_009411496.1|  PREDICTED: transmembrane and coiled-coil dom...    265   6e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010526787.1|  PREDICTED: transmembrane and coiled-coil dom...    256   2e-109   Tarenaya hassleriana [spider flower]
ref|XP_010526790.1|  PREDICTED: transmembrane and coiled-coil dom...    256   2e-109   Tarenaya hassleriana [spider flower]
ref|NP_001078500.2|  uncharacterized protein                            267   3e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010446814.1|  PREDICTED: transmembrane and coiled-coil dom...    265   3e-109   Camelina sativa [gold-of-pleasure]
ref|XP_008241785.1|  PREDICTED: transmembrane and coiled-coil dom...    260   3e-109   Prunus mume [ume]
ref|NP_849505.2|  uncharacterized protein                               267   3e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007204629.1|  hypothetical protein PRUPE_ppa002119mg             260   4e-109   Prunus persica
ref|XP_010432190.1|  PREDICTED: transmembrane and coiled-coil dom...    265   5e-109   
ref|XP_010437365.1|  PREDICTED: transmembrane and coiled-coil dom...    265   6e-109   Camelina sativa [gold-of-pleasure]
ref|NP_001048731.1|  Os03g0112800                                       261   1e-108   
gb|EAY88253.1|  hypothetical protein OsI_09705                          261   1e-108   Oryza sativa Indica Group [Indian rice]
ref|XP_004509335.1|  PREDICTED: transmembrane and coiled-coil dom...    259   1e-108   Cicer arietinum [garbanzo]
ref|XP_010933751.1|  PREDICTED: transmembrane and coiled-coil dom...    262   1e-108   Elaeis guineensis
ref|XP_007156109.1|  hypothetical protein PHAVU_003G259400g             260   2e-108   Phaseolus vulgaris [French bean]
ref|XP_003520272.1|  PREDICTED: transmembrane and coiled-coil dom...    259   3e-108   Glycine max [soybeans]
ref|XP_003517195.1|  PREDICTED: transmembrane and coiled-coil dom...    265   3e-108   Glycine max [soybeans]
ref|XP_007156108.1|  hypothetical protein PHAVU_003G259400g             260   3e-108   Phaseolus vulgaris [French bean]
ref|XP_006283267.1|  hypothetical protein CARUB_v10004298mg             267   3e-108   Capsella rubella
ref|XP_012065270.1|  PREDICTED: transmembrane and coiled-coil dom...    254   4e-108   Jatropha curcas
ref|XP_002310840.1|  hypothetical protein POPTR_0007s13750g             262   4e-108   
ref|XP_003548861.1|  PREDICTED: transmembrane and coiled-coil dom...    257   4e-108   Glycine max [soybeans]
ref|XP_012065275.1|  PREDICTED: transmembrane and coiled-coil dom...    254   5e-108   
gb|EPS66741.1|  hypothetical protein M569_08033                         254   5e-108   Genlisea aurea
ref|XP_008796875.1|  PREDICTED: transmembrane and coiled-coil dom...    260   5e-108   Phoenix dactylifera
ref|XP_006650970.1|  PREDICTED: transmembrane and coiled-coil dom...    258   6e-108   
ref|XP_004512100.1|  PREDICTED: transmembrane and coiled-coil dom...    258   8e-108   Cicer arietinum [garbanzo]
gb|KCW53100.1|  hypothetical protein EUGRSUZ_J02394                     246   8e-108   Eucalyptus grandis [rose gum]
ref|XP_006829156.1|  PREDICTED: transmembrane and coiled-coil dom...    264   1e-107   Amborella trichopoda
ref|XP_003558988.1|  PREDICTED: transmembrane and coiled-coil dom...    257   1e-107   Brachypodium distachyon [annual false brome]
ref|XP_011015560.1|  PREDICTED: transmembrane and coiled-coil dom...    258   2e-107   Populus euphratica
ref|XP_004287838.1|  PREDICTED: transmembrane and coiled-coil dom...    258   2e-107   Fragaria vesca subsp. vesca
dbj|BAJ94309.1|  predicted protein                                      254   3e-107   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011025906.1|  PREDICTED: transmembrane and coiled-coil dom...    256   5e-107   Populus euphratica
ref|XP_009338652.1|  PREDICTED: transmembrane and coiled-coil dom...    255   9e-107   Pyrus x bretschneideri [bai li]
ref|XP_006412018.1|  hypothetical protein EUTSA_v10024597mg             258   1e-106   
gb|KHN41681.1|  Transmembrane and coiled-coil domain-containing p...    253   1e-106   Glycine soja [wild soybean]
emb|CDX69212.1|  BnaC01g02410D                                          268   1e-106   
ref|XP_009146060.1|  PREDICTED: transmembrane and coiled-coil dom...    268   1e-106   Brassica rapa
emb|CDX75561.1|  BnaA01g01410D                                          267   1e-106   
ref|XP_008372754.1|  PREDICTED: transmembrane and coiled-coil dom...    255   1e-106   Malus domestica [apple tree]
ref|XP_006297155.1|  hypothetical protein CARUB_v10013157mg             259   2e-106   Capsella rubella
ref|XP_009378211.1|  PREDICTED: transmembrane and coiled-coil dom...    254   2e-106   Pyrus x bretschneideri [bai li]
gb|KFK30255.1|  hypothetical protein AALP_AA7G237500                    267   4e-106   Arabis alpina [alpine rockcress]
ref|NP_179401.2|  uncharacterized protein                               259   1e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AET03833.2|  transmembrane and coiled-coil protein                   252   1e-105   Medicago truncatula
gb|KFK40188.1|  hypothetical protein AALP_AA3G341700                    257   1e-105   Arabis alpina [alpine rockcress]
gb|KFK40189.1|  hypothetical protein AALP_AA3G341700                    257   1e-105   Arabis alpina [alpine rockcress]
ref|XP_010933753.1|  PREDICTED: transmembrane and coiled-coil dom...    262   1e-105   
ref|XP_010467612.1|  PREDICTED: transmembrane and coiled-coil dom...    257   1e-105   Camelina sativa [gold-of-pleasure]
ref|XP_003629357.1|  Transmembrane and coiled-coil domain-contain...    252   2e-105   
ref|XP_007046758.1|  Transmembrane and coiled-coil domain-contain...    254   2e-105   
gb|EMS45711.1|  hypothetical protein TRIUR3_14318                       250   3e-105   Triticum urartu
ref|XP_010413917.1|  PREDICTED: transmembrane and coiled-coil dom...    256   4e-105   
ref|XP_006409198.1|  hypothetical protein EUTSA_v10022586mg             257   4e-105   Eutrema salsugineum [saltwater cress]
gb|AAO42809.1|  At2g18100                                               255   1e-104   Arabidopsis thaliana [mouse-ear cress]
gb|KHN00498.1|  Transmembrane and coiled-coil domain-containing p...    248   3e-104   Glycine soja [wild soybean]
ref|NP_001132355.1|  uncharacterized protein LOC100193799               256   3e-104   Zea mays [maize]
ref|XP_007157950.1|  hypothetical protein PHAVU_002G111800g             256   3e-104   Phaseolus vulgaris [French bean]
ref|XP_002465997.1|  hypothetical protein SORBIDRAFT_01g049760          254   3e-104   
ref|XP_004986015.1|  PREDICTED: transmembrane and coiled-coil dom...    255   3e-104   Setaria italica
emb|CDY53279.1|  BnaC09g09640D                                          254   5e-104   Brassica napus [oilseed rape]
ref|XP_002884114.1|  hypothetical protein ARALYDRAFT_480715             253   5e-104   
gb|ABF93615.1|  expressed protein                                       245   6e-104   Oryza sativa Japonica Group [Japonica rice]
gb|KJB43387.1|  hypothetical protein B456_007G197400                    254   6e-104   Gossypium raimondii
gb|KJB43386.1|  hypothetical protein B456_007G197400                    253   2e-103   Gossypium raimondii
gb|AFW89819.1|  putative DUF26 domain receptor-like protein kinase      253   2e-103   
ref|XP_008658122.1|  PREDICTED: uncharacterized protein LOC100193...    253   3e-103   Zea mays [maize]
gb|AAD20116.1|  unknown protein                                         259   9e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007226229.1|  hypothetical protein PRUPE_ppa016746mg             258   1e-102   
emb|CDY30329.1|  BnaA09g09480D                                          254   1e-102   Brassica napus [oilseed rape]
gb|ACN33345.1|  unknown                                                 251   1e-102   Zea mays [maize]
gb|KCW67917.1|  hypothetical protein EUGRSUZ_F01619                     252   1e-102   Eucalyptus grandis [rose gum]
ref|XP_010061018.1|  PREDICTED: transmembrane and coiled-coil dom...    252   1e-102   Eucalyptus grandis [rose gum]
ref|XP_009112467.1|  PREDICTED: transmembrane and coiled-coil dom...    254   2e-102   Brassica rapa
ref|XP_008221322.1|  PREDICTED: transmembrane and coiled-coil dom...    258   2e-102   Prunus mume [ume]
ref|XP_009112468.1|  PREDICTED: transmembrane and coiled-coil dom...    254   2e-102   Brassica rapa
ref|XP_010263882.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    251   2e-102   
ref|XP_010489507.1|  PREDICTED: transmembrane and coiled-coil dom...    243   2e-101   
gb|KHG22516.1|  Transmembrane and coiled-coil domain-containing 4       253   5e-101   Gossypium arboreum [tree cotton]
ref|XP_007017690.1|  Transmembrane and coiled-coil domain-contain...    253   1e-100   
ref|XP_009335556.1|  PREDICTED: transmembrane and coiled-coil dom...    256   4e-100   Pyrus x bretschneideri [bai li]
ref|XP_004982627.1|  PREDICTED: transmembrane and coiled-coil dom...    248   7e-100   Setaria italica
emb|CAN59788.1|  hypothetical protein VITISV_012480                     224   1e-99    Vitis vinifera
ref|XP_004291817.1|  PREDICTED: transmembrane and coiled-coil dom...    257   2e-99    Fragaria vesca subsp. vesca
ref|XP_006661949.1|  PREDICTED: transmembrane and coiled-coil dom...    243   1e-98    Oryza brachyantha
ref|XP_009420791.1|  PREDICTED: transmembrane and coiled-coil dom...    235   2e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010934560.1|  PREDICTED: transmembrane and coiled-coil dom...    234   2e-97    Elaeis guineensis
ref|XP_010934563.1|  PREDICTED: transmembrane and coiled-coil dom...    234   2e-97    
ref|XP_010934564.1|  PREDICTED: transmembrane and coiled-coil dom...    233   2e-97    
ref|NP_001130514.1|  putative DUF726-domain family protein              243   5e-97    Zea mays [maize]
ref|NP_001176237.1|  Os10g0512100                                       239   1e-96    
gb|EAY79183.1|  hypothetical protein OsI_34294                          239   1e-96    Oryza sativa Indica Group [Indian rice]
ref|XP_010934561.1|  PREDICTED: transmembrane and coiled-coil dom...    234   2e-96    
ref|XP_004500958.1|  PREDICTED: transmembrane and coiled-coil dom...    260   6e-96    Cicer arietinum [garbanzo]
ref|XP_003574182.1|  PREDICTED: transmembrane and coiled-coil dom...    242   7e-96    Brachypodium distachyon [annual false brome]
ref|XP_002510477.1|  conserved hypothetical protein                     247   8e-96    
ref|XP_003603726.1|  Transmembrane and coiled-coil domain-contain...    258   2e-95    Medicago truncatula
gb|KHN36057.1|  Transmembrane and coiled-coil domain-containing p...    265   5e-95    Glycine soja [wild soybean]
gb|EMT23841.1|  hypothetical protein F775_21532                         235   3e-94    
gb|KHN09111.1|  Transmembrane and coiled-coil domain-containing p...    247   1e-93    Glycine soja [wild soybean]
ref|XP_010933752.1|  PREDICTED: transmembrane and coiled-coil dom...    212   2e-93    
ref|XP_003527670.1|  PREDICTED: transmembrane and coiled-coil dom...    246   3e-93    
ref|XP_002976085.1|  hypothetical protein SELMODRAFT_104378             225   3e-93    Selaginella moellendorffii
ref|XP_002968294.1|  hypothetical protein SELMODRAFT_170005             224   1e-92    
ref|XP_007136056.1|  hypothetical protein PHAVU_009G014300g             237   2e-90    Phaseolus vulgaris [French bean]
gb|KJB29621.1|  hypothetical protein B456_005G110800                    239   4e-89    Gossypium raimondii
gb|KJB29620.1|  hypothetical protein B456_005G110800                    239   4e-89    Gossypium raimondii
gb|KJB29619.1|  hypothetical protein B456_005G110800                    240   5e-89    Gossypium raimondii
gb|KDO71092.1|  hypothetical protein CISIN_1g006082mg                   177   2e-85    Citrus sinensis [apfelsine]
ref|XP_008668853.1|  PREDICTED: putative DUF726-domain family pro...    202   1e-84    
ref|XP_008668907.1|  PREDICTED: putative DUF726-domain family pro...    199   5e-84    
gb|KEH20390.1|  transmembrane and coiled-coil protein                   174   3e-82    Medicago truncatula
gb|KHN01737.1|  Transmembrane and coiled-coil domain-containing p...    222   3e-82    Glycine soja [wild soybean]
ref|XP_004512101.1|  PREDICTED: transmembrane and coiled-coil dom...    171   7e-82    
ref|XP_006380790.1|  hypothetical protein POPTR_0007s13750g             174   1e-81    
ref|XP_002464384.1|  hypothetical protein SORBIDRAFT_01g017280          189   1e-81    
ref|XP_006297154.1|  hypothetical protein CARUB_v10013157mg             177   1e-81    
gb|KJB29622.1|  hypothetical protein B456_005G110800                    240   1e-80    Gossypium raimondii
ref|NP_195344.1|  uncharacterized protein                               167   3e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489506.1|  PREDICTED: transmembrane and coiled-coil dom...    166   2e-78    
ref|XP_008387987.1|  PREDICTED: transmembrane and coiled-coil dom...    253   6e-78    
ref|XP_010489505.1|  PREDICTED: transmembrane and coiled-coil dom...    165   8e-78    
gb|EMT20138.1|  hypothetical protein F775_14016                         163   1e-77    
gb|KDP46691.1|  hypothetical protein JCGZ_06479                         156   3e-73    Jatropha curcas
ref|XP_006601464.1|  PREDICTED: transmembrane and coiled-coil dom...    192   2e-72    
gb|KEH36226.1|  transmembrane and coiled-coil protein                   176   7e-71    Medicago truncatula
ref|XP_003612112.1|  Transmembrane and coiled-coil domain-contain...    240   3e-67    
gb|KHN41922.1|  Transmembrane and coiled-coil domain-containing p...    137   2e-63    Glycine soja [wild soybean]
gb|AFW89820.1|  putative DUF26 domain receptor-like protein kinase      152   2e-57    
gb|KHG10124.1|  Transmembrane and coiled-coil domain-containing 4       130   3e-56    Gossypium arboreum [tree cotton]
ref|XP_006435098.1|  hypothetical protein CICLE_v10003998mg             117   3e-50    
ref|XP_010933754.1|  PREDICTED: uncharacterized membrane protein ...    160   1e-47    
ref|XP_006573571.1|  PREDICTED: transmembrane and coiled-coil dom...    156   3e-45    
gb|KEF52411.1|  hypothetical protein A1O9_11652                         155   2e-42    Exophiala aquamarina CBS 119918
ref|XP_004512102.1|  PREDICTED: transmembrane and coiled-coil dom...    162   2e-40    
gb|EKV12492.1|  hypothetical protein PDIG_44160                         145   4e-40    Penicillium digitatum PHI26
gb|KIV92973.1|  hypothetical protein PV10_04223                         150   1e-39    Exophiala mesophila
ref|XP_010085832.1|  PREDICTED: transmembrane and coiled-coil dom...    136   3e-39    Pterocles gutturalis
gb|KFV05358.1|  Transmembrane and coiled-coil domain-containing p...    136   3e-39    Pterocles gutturalis
ref|XP_008796876.1|  PREDICTED: uncharacterized membrane protein ...    159   4e-39    
gb|KJJ22224.1|  hypothetical protein U727_00432610121                   144   5e-39    
gb|KGO72173.1|  Protein of unknown function DUF726                      144   5e-39    Penicillium italicum
gb|KGO46963.1|  Protein of unknown function DUF726                      143   6e-39    Penicillium expansum
gb|EPS33767.1|  hypothetical protein PDE_08729                          140   6e-39    Penicillium oxalicum 114-2
ref|XP_009927110.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    136   7e-39    Haliaeetus albicilla
ref|XP_009487437.1|  PREDICTED: transmembrane and coiled-coil dom...    134   8e-39    Pelecanus crispus
ref|XP_009323520.1|  PREDICTED: transmembrane and coiled-coil dom...    136   9e-39    Pygoscelis adeliae
ref|XP_011583445.1|  PREDICTED: transmembrane and coiled-coil dom...    136   9e-39    Aquila chrysaetos canadensis
ref|XP_009986511.1|  PREDICTED: transmembrane and coiled-coil dom...    135   1e-38    Tauraco erythrolophus
ref|XP_010575570.1|  PREDICTED: transmembrane and coiled-coil dom...    135   1e-38    Haliaeetus leucocephalus
ref|XP_002557597.1|  Pc12g07620                                         144   1e-38    Penicillium rubens Wisconsin 54-1255
ref|XP_004347299.1|  hypothetical protein CAOG_04552                    141   1e-38    Capsaspora owczarzaki ATCC 30864
ref|XP_007779876.1|  hypothetical protein W97_03792                     149   1e-38    Coniosporium apollinis CBS 100218
ref|XP_009287859.1|  PREDICTED: transmembrane and coiled-coil dom...    135   1e-38    Aptenodytes forsteri
emb|CCX32722.1|  Similar to Uncharacterized membrane protein C6F6...    135   2e-38    Pyronema omphalodes CBS 100304
ref|XP_009888268.1|  PREDICTED: transmembrane and coiled-coil dom...    135   2e-38    Charadrius vociferus
ref|XP_005444038.1|  PREDICTED: transmembrane and coiled-coil dom...    135   2e-38    
ref|XP_005229681.1|  PREDICTED: transmembrane and coiled-coil dom...    135   2e-38    
ref|XP_008925547.1|  PREDICTED: transmembrane and coiled-coil dom...    134   3e-38    
ref|XP_009994063.1|  PREDICTED: transmembrane and coiled-coil dom...    134   3e-38    Chaetura pelagica
ref|XP_010280036.1|  PREDICTED: transmembrane and coiled-coil dom...    134   4e-38    Phaethon lepturus
ref|XP_009644771.1|  PREDICTED: transmembrane and coiled-coil dom...    132   4e-38    Egretta garzetta
gb|EMC84630.1|  Transmembrane and coiled-coil domain-containing p...    134   5e-38    
ref|XP_010410793.1|  PREDICTED: transmembrane and coiled-coil dom...    133   5e-38    Corvus cornix cornix
ref|XP_009897800.1|  PREDICTED: transmembrane and coiled-coil dom...    130   5e-38    Picoides pubescens
ref|XP_009502643.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    129   5e-38    Phalacrocorax carbo [common cormorant]
ref|XP_005508013.1|  PREDICTED: transmembrane and coiled-coil dom...    134   5e-38    
ref|XP_006696222.1|  hypothetical protein CTHT_0059030                  134   5e-38    Chaetomium thermophilum var. thermophilum DSM 1495
gb|EDP54788.1|  DUF726 domain protein                                   143   7e-38    Aspergillus fumigatus A1163
ref|XP_755617.1|  DUF726 domain protein                                 143   7e-38    Aspergillus fumigatus Af293
ref|XP_009707318.1|  PREDICTED: transmembrane and coiled-coil dom...    133   8e-38    Cariama cristata
emb|CDM35337.1|  Protein of unknown function DUF726                     141   8e-38    Penicillium roqueforti FM164
gb|KFP61470.1|  Transmembrane and coiled-coil domain-containing p...    133   9e-38    Cariama cristata
ref|XP_009940062.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    133   9e-38    Opisthocomus hoazin [hoatzin]
ref|XP_417632.4|  PREDICTED: transmembrane and coiled-coil domain...    133   9e-38    
ref|XP_005015051.1|  PREDICTED: transmembrane and coiled-coil dom...    134   9e-38    
ref|XP_009808720.1|  PREDICTED: transmembrane and coiled-coil dom...    134   1e-37    Gavia stellata
ref|XP_004947540.1|  PREDICTED: transmembrane and coiled-coil dom...    133   1e-37    
ref|XP_006004344.1|  PREDICTED: transmembrane and coiled-coil dom...    128   1e-37    
ref|XP_005015050.1|  PREDICTED: transmembrane and coiled-coil dom...    134   1e-37    
ref|XP_005015052.1|  PREDICTED: transmembrane and coiled-coil dom...    134   1e-37    
ref|XP_009461663.1|  PREDICTED: transmembrane and coiled-coil dom...    132   1e-37    Nipponia nippon
ref|XP_009076642.1|  PREDICTED: transmembrane and coiled-coil dom...    133   1e-37    Acanthisitta chloris
emb|CCX32946.1|  Similar to Uncharacterized membrane protein C6F6...    140   1e-37    Pyronema omphalodes CBS 100304
ref|XP_010152926.1|  PREDICTED: transmembrane and coiled-coil dom...    132   1e-37    Eurypyga helias
gb|KFP70804.1|  Transmembrane and coiled-coil domain-containing p...    132   2e-37    Acanthisitta chloris
ref|XP_010171576.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    131   2e-37    
ref|XP_007579866.1|  putative duf726 domain-containing protein          147   2e-37    
ref|XP_003212354.1|  PREDICTED: transmembrane and coiled-coil dom...    132   2e-37    Meleagris gallopavo [common turkey]
ref|XP_010187070.1|  PREDICTED: transmembrane and coiled-coil dom...    131   2e-37    Mesitornis unicolor
gb|KEY75495.1|  hypothetical protein BA78_1654                          141   2e-37    Aspergillus fumigatus var. RP-2014
ref|XP_010303750.1|  PREDICTED: transmembrane and coiled-coil dom...    133   2e-37    Balearica regulorum gibbericeps
ref|XP_005528440.1|  PREDICTED: transmembrane and coiled-coil dom...    131   2e-37    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_008714926.1|  hypothetical protein HMPREF1541_02349              144   2e-37    Cyphellophora europaea CBS 101466
gb|KKA18762.1|  DUF726 domain protein                                   142   3e-37    Rasamsonia emersonii CBS 393.64
emb|CCA73020.1|  hypothetical protein PIIN_06975                        144   3e-37    Serendipita indica DSM 11827
ref|XP_005145526.1|  PREDICTED: transmembrane and coiled-coil dom...    131   3e-37    Melopsittacus undulatus
ref|XP_006031545.1|  PREDICTED: transmembrane and coiled-coil dom...    131   3e-37    Alligator sinensis
ref|XP_008945640.1|  PREDICTED: transmembrane and coiled-coil dom...    133   3e-37    Merops nubicus
ref|XP_005495905.1|  PREDICTED: transmembrane and coiled-coil dom...    130   3e-37    Zonotrichia albicollis
ref|XP_002190164.2|  PREDICTED: transmembrane and coiled-coil dom...    130   3e-37    Taeniopygia guttata
ref|XP_005428211.1|  PREDICTED: transmembrane and coiled-coil dom...    130   3e-37    
ref|XP_006115110.1|  PREDICTED: transmembrane and coiled-coil dom...    130   4e-37    
ref|XP_663872.1|  hypothetical protein AN6268.2                         140   4e-37    Aspergillus nidulans FGSC A4
ref|XP_006115111.1|  PREDICTED: transmembrane and coiled-coil dom...    130   4e-37    
ref|XP_005057822.1|  PREDICTED: transmembrane and coiled-coil dom...    130   4e-37    Ficedula albicollis
ref|XP_004377237.1|  PREDICTED: transmembrane and coiled-coil dom...    135   4e-37    Trichechus manatus latirostris
ref|XP_010121688.1|  PREDICTED: transmembrane and coiled-coil dom...    130   4e-37    Chlamydotis macqueenii
ref|XP_008611500.1|  hypothetical protein SDRG_07445                    153   5e-37    Saprolegnia diclina VS20
emb|CEI98227.1|  hypothetical protein RMCBS344292_12342                 133   6e-37    Rhizopus microsporus
ref|XP_002716101.1|  PREDICTED: transmembrane and coiled-coil dom...    136   6e-37    Oryctolagus cuniculus [domestic rabbit]
ref|XP_008501977.1|  PREDICTED: transmembrane and coiled-coil dom...    131   7e-37    Calypte anna
ref|XP_007067793.1|  PREDICTED: transmembrane and coiled-coil dom...    129   8e-37    
ref|XP_004741366.1|  PREDICTED: transmembrane and coiled-coil dom...    136   8e-37    Mustela putorius furo [black ferret]
ref|XP_003891291.1|  PREDICTED: transmembrane and coiled-coil dom...    134   9e-37    
ref|XP_001260744.1|  hypothetical protein NFIA_088030                   139   1e-36    Aspergillus fischeri NRRL 181
ref|XP_007683036.1|  hypothetical protein COCMIDRAFT_32305              146   1e-36    Bipolaris oryzae ATCC 44560
ref|XP_007978440.1|  PREDICTED: transmembrane and coiled-coil dom...    135   1e-36    Chlorocebus sabaeus
ref|XP_009097848.1|  PREDICTED: transmembrane and coiled-coil dom...    130   1e-36    Serinus canaria [canary]
ref|XP_010203254.1|  PREDICTED: transmembrane and coiled-coil dom...    129   1e-36    Colius striatus
ref|XP_008998864.1|  PREDICTED: transmembrane and coiled-coil dom...    135   1e-36    
ref|XP_010011865.1|  PREDICTED: transmembrane and coiled-coil dom...    129   1e-36    Nestor notabilis
ref|XP_001275560.1|  DUF726 domain protein                              141   1e-36    Aspergillus clavatus NRRL 1
emb|CEG66634.1|  hypothetical protein RMATCC62417_03177                 133   1e-36    Rhizopus microsporus
ref|XP_007978430.1|  PREDICTED: transmembrane and coiled-coil dom...    135   1e-36    Chlorocebus sabaeus
ref|XP_005645359.1|  DUF726-domain-containing protein                   146   1e-36    Coccomyxa subellipsoidea C-169
ref|XP_011935759.1|  PREDICTED: transmembrane and coiled-coil dom...    134   1e-36    Cercocebus atys
ref|XP_010591348.1|  PREDICTED: transmembrane and coiled-coil dom...    137   1e-36    Loxodonta africana [African bush elephant]
gb|EHH14398.1|  hypothetical protein EGK_00318                          135   1e-36    Macaca mulatta [rhesus macaque]
ref|XP_006883644.1|  PREDICTED: transmembrane and coiled-coil dom...    135   1e-36    Elephantulus edwardii [Cape long-eared elephant shrew]
gb|KEZ42347.1|  Transmembrane and coiled-coil domain-containing p...    134   1e-36    Scedosporium apiospermum
ref|XP_011848539.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-36    Mandrillus leucophaeus
gb|EUN30679.1|  hypothetical protein COCVIDRAFT_90048                   146   2e-36    Bipolaris victoriae FI3
gb|KFP28003.1|  Transmembrane and coiled-coil domain-containing p...    129   2e-36    Colius striatus
ref|XP_010343810.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-36    Saimiri boliviensis boliviensis
ref|XP_011789398.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-36    Colobus angolensis palliatus
ref|XP_006275517.1|  PREDICTED: transmembrane and coiled-coil dom...    129   2e-36    
ref|XP_011935760.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-36    
gb|EHH49600.1|  hypothetical protein EGM_00289                          134   2e-36    
ref|XP_011742053.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-36    
ref|XP_005544629.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-36    
dbj|GAA82478.1|  DUF726 domain protein                                  142   2e-36    
ref|XP_011935758.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-36    
ref|XP_002811408.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-36    
ref|XP_008632527.1|  PREDICTED: transmembrane and coiled-coil dom...    128   2e-36    
ref|XP_003934977.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-36    
ref|XP_004705194.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-36    
ref|XP_007175108.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-36    
ref|XP_010383843.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-36    
ref|XP_001094008.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-36    
ref|XP_010995946.1|  PREDICTED: transmembrane and coiled-coil dom...    133   2e-36    
ref|XP_007175106.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-36    
gb|AIC58045.1|  TMCO4                                                   134   3e-36    
gb|KDO19864.1|  hypothetical protein SPRG_21471                         151   3e-36    
ref|XP_008165544.1|  PREDICTED: transmembrane and coiled-coil dom...    128   3e-36    
ref|XP_008165542.1|  PREDICTED: transmembrane and coiled-coil dom...    128   3e-36    
ref|XP_009972345.1|  PREDICTED: transmembrane and coiled-coil dom...    127   3e-36    
gb|AAH53600.1|  Transmembrane and coiled-coil domains 4                 134   3e-36    
emb|CEF71266.1|  Protein of unknown function DUF726 family-contai...    132   3e-36    
ref|XP_001160112.1|  PREDICTED: transmembrane and coiled-coil dom...    134   3e-36    
emb|CAE45994.1|  hypothetical protein                                   134   3e-36    
ref|XP_006188341.1|  PREDICTED: transmembrane and coiled-coil dom...    133   3e-36    
ref|XP_011539481.1|  PREDICTED: transmembrane and coiled-coil dom...    134   3e-36    
ref|XP_006642181.1|  PREDICTED: transmembrane and coiled-coil dom...    128   4e-36    
ref|XP_006196779.1|  PREDICTED: transmembrane and coiled-coil dom...    133   4e-36    
ref|XP_011539485.1|  PREDICTED: transmembrane and coiled-coil dom...    134   4e-36    
ref|NP_859070.3|  transmembrane and coiled-coil domain-containing...    134   4e-36    
gb|EEQ87579.1|  DUF726 domain-containing protein                        140   4e-36    
ref|XP_007706697.1|  hypothetical protein COCCADRAFT_31971              144   4e-36    
ref|XP_003814466.1|  PREDICTED: transmembrane and coiled-coil dom...    134   4e-36    
ref|XP_007104645.1|  PREDICTED: transmembrane and coiled-coil dom...    133   4e-36    
gb|EAW94898.1|  transmembrane and coiled-coil domains 4, isoform ...    134   4e-36    
gb|EGE77830.1|  DUF726 domain-containing protein                        140   4e-36    
ref|XP_002942004.2|  PREDICTED: transmembrane and coiled-coil dom...    128   5e-36    
ref|XP_008560315.1|  PREDICTED: transmembrane and coiled-coil dom...    135   5e-36    
ref|XP_004092315.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    132   5e-36    
ref|XP_002899563.1|  conserved hypothetical protein                     149   5e-36    
ref|XP_006094054.1|  PREDICTED: transmembrane and coiled-coil dom...    132   6e-36    
ref|XP_006766704.1|  PREDICTED: transmembrane and coiled-coil dom...    133   6e-36    
ref|XP_009554539.1|  PREDICTED: transmembrane and coiled-coil dom...    130   6e-36    
gb|ELK27919.1|  Transmembrane and coiled-coil domain-containing p...    133   6e-36    
emb|CEG82162.1|  hypothetical protein RMATCC62417_16275                 131   6e-36    
gb|EMD96013.1|  hypothetical protein COCHEDRAFT_1127385                 143   6e-36    
gb|EPB88617.1|  hypothetical protein HMPREF1544_04610                   132   6e-36    
ref|XP_004397112.1|  PREDICTED: transmembrane and coiled-coil dom...    132   6e-36    
ref|XP_007694636.1|  hypothetical protein COCSADRAFT_166249             144   6e-36    
ref|XP_002624046.1|  DUF726 domain-containing protein                   140   6e-36    
ref|XP_007459302.1|  PREDICTED: transmembrane and coiled-coil dom...    134   6e-36    
ref|XP_009952089.1|  PREDICTED: transmembrane and coiled-coil dom...    128   6e-36    
ref|XP_003356223.2|  PREDICTED: transmembrane and coiled-coil dom...    132   7e-36    
emb|CCU74968.1|  DUF726 domain-containing protein                       137   7e-36    
ref|XP_008122123.1|  PREDICTED: transmembrane and coiled-coil dom...    128   7e-36    
ref|XP_004024853.1|  PREDICTED: transmembrane and coiled-coil dom...    133   7e-36    
ref|XP_008587886.1|  PREDICTED: transmembrane and coiled-coil dom...    134   7e-36    
ref|XP_001935672.1|  hypothetical protein PTRG_05339                    141   8e-36    
gb|KIW43860.1|  hypothetical protein PV06_04919                         132   8e-36    
ref|XP_004272628.1|  PREDICTED: transmembrane and coiled-coil dom...    134   8e-36    
gb|EKG21875.1|  hypothetical protein MPH_00795                          142   9e-36    
ref|XP_003989669.1|  PREDICTED: transmembrane and coiled-coil dom...    132   9e-36    
ref|XP_010137690.1|  PREDICTED: transmembrane and coiled-coil dom...    128   9e-36    
ref|XP_005883097.1|  PREDICTED: transmembrane and coiled-coil dom...    132   9e-36    
ref|XP_008820065.1|  PREDICTED: transmembrane and coiled-coil dom...    133   1e-35    
ref|XP_005317591.1|  PREDICTED: transmembrane and coiled-coil dom...    132   1e-35    
ref|XP_011356313.1|  PREDICTED: transmembrane and coiled-coil dom...    132   1e-35    
ref|XP_004603732.1|  PREDICTED: transmembrane and coiled-coil dom...    132   1e-35    
emb|CCG83907.1|  protein of unknown function                            141   1e-35    
gb|KFP47210.1|  Transmembrane and coiled-coil domain-containing p...    126   1e-35    
ref|XP_005815550.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    137   1e-35    
gb|KFQ64558.1|  Transmembrane and coiled-coil domain-containing p...    124   1e-35    
gb|KEQ60587.1|  DUF726-domain-containing protein                        150   1e-35    
gb|KFW67980.1|  Transmembrane and coiled-coil domain-containing p...    125   1e-35    
ref|XP_007799403.1|  putative duf726 domain-containing protein          150   1e-35    
ref|XP_006924558.1|  PREDICTED: transmembrane and coiled-coil dom...    132   1e-35    
gb|ETI45782.1|  hypothetical protein F443_09723                         150   1e-35    
gb|KFV90196.1|  Transmembrane and coiled-coil domain-containing p...    124   1e-35    
ref|XP_005957119.1|  PREDICTED: transmembrane and coiled-coil dom...    132   1e-35    
ref|XP_008892727.1|  hypothetical protein PPTG_01245                    150   1e-35    
ref|XP_008692882.1|  PREDICTED: transmembrane and coiled-coil dom...    132   1e-35    
gb|KFV19207.1|  Transmembrane and coiled-coil domain-containing p...    125   1e-35    
emb|CEI93287.1|  hypothetical protein RMCBS344292_07526                 134   1e-35    
gb|ELK02202.1|  Transmembrane and coiled-coil domain-containing p...    131   1e-35    
ref|XP_009571439.1|  PREDICTED: transmembrane and coiled-coil dom...    124   1e-35    
ref|XP_008517354.1|  PREDICTED: transmembrane and coiled-coil dom...    131   1e-35    
ref|XP_006732522.1|  PREDICTED: transmembrane and coiled-coil dom...    132   2e-35    
ref|XP_001541680.1|  conserved hypothetical protein                     140   2e-35    
gb|EYE97744.1|  DUF726-domain-containing protein                        144   2e-35    
ref|XP_001501787.2|  PREDICTED: transmembrane and coiled-coil dom...    131   2e-35    
ref|XP_009526727.1|  hypothetical protein PHYSODRAFT_503375             148   2e-35    
ref|XP_004458683.1|  PREDICTED: transmembrane and coiled-coil dom...    132   2e-35    
ref|XP_011218585.1|  PREDICTED: transmembrane and coiled-coil dom...    132   2e-35    
ref|XP_006031546.1|  PREDICTED: transmembrane and coiled-coil dom...    125   2e-35    
gb|KIW11625.1|  hypothetical protein PV08_10927                         132   2e-35    
emb|CAK96374.1|  unnamed protein product                                139   2e-35    
ref|XP_002915697.1|  PREDICTED: transmembrane and coiled-coil dom...    132   2e-35    
gb|EFB18615.1|  hypothetical protein PANDA_003708                       132   2e-35    
gb|EHA22656.1|  hypothetical protein ASPNIDRAFT_173432                  139   2e-35    
ref|XP_004458679.1|  PREDICTED: transmembrane and coiled-coil dom...    132   2e-35    
ref|XP_544527.2|  PREDICTED: transmembrane and coiled-coil domain...    132   2e-35    
ref|XP_004425715.1|  PREDICTED: transmembrane and coiled-coil dom...    131   2e-35    
ref|XP_004458681.1|  PREDICTED: transmembrane and coiled-coil dom...    132   2e-35    
gb|KFM01894.1|  Transmembrane and coiled-coil domain-containing p...    125   2e-35    
ref|XP_001399297.2|  hypothetical protein ANI_1_2282024                 138   2e-35    
ref|XP_003449185.1|  PREDICTED: transmembrane and coiled-coil dom...    134   2e-35    
gb|KIM25042.1|  hypothetical protein M408DRAFT_26624                    138   2e-35    
gb|KFV60031.1|  Transmembrane and coiled-coil domain-containing p...    125   2e-35    
gb|KFV66615.1|  Transmembrane and coiled-coil domain-containing p...    121   2e-35    
gb|KFQ74841.1|  Transmembrane and coiled-coil domain-containing p...    124   2e-35    
gb|KGL97218.1|  Transmembrane and coiled-coil domain-containing p...    124   2e-35    
gb|EPQ65285.1|  integral membrane protein                               136   2e-35    
ref|XP_004637713.1|  PREDICTED: transmembrane and coiled-coil dom...    132   3e-35    
ref|XP_008146362.1|  PREDICTED: transmembrane and coiled-coil dom...    131   3e-35    
gb|KFV85261.1|  Transmembrane and coiled-coil domain-containing p...    125   3e-35    
ref|XP_003303142.1|  hypothetical protein PTT_15240                     140   3e-35    
ref|XP_007276064.1|  transmembrane and coiled-coil domain-contain...    131   3e-35    
ref|XP_004903385.1|  PREDICTED: transmembrane and coiled-coil dom...    130   3e-35    
ref|XP_006068159.1|  PREDICTED: transmembrane and coiled-coil dom...    131   3e-35    
gb|KFU88231.1|  Transmembrane and coiled-coil domain-containing p...    124   3e-35    
ref|XP_007785674.1|  hypothetical protein EPUS_06878                    135   3e-35    
ref|XP_010825023.1|  PREDICTED: transmembrane and coiled-coil dom...    130   3e-35    
ref|XP_004679417.1|  PREDICTED: transmembrane and coiled-coil dom...    132   4e-35    
ref|XP_007540933.1|  PREDICTED: transmembrane and coiled-coil dom...    135   4e-35    
gb|KEQ69715.1|  DUF726-domain-containing protein                        149   4e-35    
gb|ELU07125.1|  hypothetical protein CAPTEDRAFT_150011                  135   4e-35    
ref|XP_007083816.1|  PREDICTED: transmembrane and coiled-coil dom...    130   4e-35    
emb|CCF38090.1|  hypothetical protein CH063_09267                       133   4e-35    
ref|XP_001208609.1|  conserved hypothetical protein                     134   4e-35    
ref|XP_003585846.1|  PREDICTED: transmembrane and coiled-coil dom...    130   4e-35    
ref|XP_010828245.1|  PREDICTED: transmembrane and coiled-coil dom...    130   4e-35    
ref|XP_009680914.1|  PREDICTED: transmembrane and coiled-coil dom...    124   4e-35    
ref|XP_004070302.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    132   4e-35    
ref|XP_010800982.1|  PREDICTED: transmembrane and coiled-coil dom...    130   4e-35    
ref|XP_010612542.1|  PREDICTED: transmembrane and coiled-coil dom...    131   4e-35    
ref|XP_010825020.1|  PREDICTED: transmembrane and coiled-coil dom...    130   4e-35    
gb|EOB04741.1|  Transmembrane and coiled-coil domain-containing p...    125   5e-35    
ref|XP_003471411.1|  PREDICTED: transmembrane and coiled-coil dom...    130   5e-35    
ref|XP_007580064.1|  putative duf726 domain-containing protein          148   5e-35    
ref|XP_005941682.1|  PREDICTED: transmembrane and coiled-coil dom...    133   5e-35    
gb|ELR47346.1|  Transmembrane and coiled-coil domain-containing p...    130   5e-35    
gb|KFV52443.1|  Transmembrane and coiled-coil domain-containing p...    125   5e-35    
ref|XP_005677092.1|  PREDICTED: transmembrane and coiled-coil dom...    131   5e-35    
ref|XP_005908165.1|  PREDICTED: transmembrane and coiled-coil dom...    130   5e-35    
gb|KFQ71066.1|  Transmembrane and coiled-coil domain-containing p...    124   5e-35    
ref|XP_006785393.1|  PREDICTED: transmembrane and coiled-coil dom...    133   5e-35    
ref|XP_005730844.1|  PREDICTED: transmembrane and coiled-coil dom...    133   5e-35    
gb|KFQ36469.1|  Transmembrane and coiled-coil domain-containing p...    125   5e-35    
ref|NP_084133.1|  transmembrane and coiled-coil domain-containing...    132   5e-35    
gb|KFP22316.1|  Transmembrane and coiled-coil domain-containing p...    122   6e-35    
ref|XP_011248656.1|  PREDICTED: transmembrane and coiled-coil dom...    132   6e-35    
ref|XP_010612541.1|  PREDICTED: transmembrane and coiled-coil dom...    131   6e-35    
gb|AAH13471.1|  Transmembrane and coiled-coil domains 4                 132   6e-35    
ref|XP_006980966.1|  PREDICTED: transmembrane and coiled-coil dom...    131   6e-35    
gb|EMF16256.1|  DUF726-domain-containing protein                        141   7e-35    
ref|XP_007441490.1|  PREDICTED: transmembrane and coiled-coil dom...    125   7e-35    
ref|XP_007296900.1|  hypothetical protein MBM_09011                     140   7e-35    
ref|XP_011445954.1|  PREDICTED: transmembrane and coiled-coil dom...    122   7e-35    
ref|XP_011445963.1|  PREDICTED: transmembrane and coiled-coil dom...    122   7e-35    
ref|XP_007246297.1|  PREDICTED: transmembrane and coiled-coil dom...    129   7e-35    
emb|CEP13103.1|  hypothetical protein                                   131   8e-35    
gb|EGC46501.1|  DUF726 domain-containing protein                        137   8e-35    
ref|XP_010751048.1|  PREDICTED: transmembrane and coiled-coil dom...    133   8e-35    
ref|XP_006145264.1|  PREDICTED: transmembrane and coiled-coil dom...    132   8e-35    
ref|XP_005394721.1|  PREDICTED: transmembrane and coiled-coil dom...    129   8e-35    
gb|EEH11518.1|  DUF726 domain-containing protein                        138   9e-35    
ref|XP_006145265.1|  PREDICTED: transmembrane and coiled-coil dom...    132   9e-35    
gb|EER39338.1|  DUF726 domain-containing protein                        137   9e-35    
emb|CDS13322.1|  hypothetical protein LRAMOSA05500                      131   9e-35    
ref|XP_008316476.1|  PREDICTED: transmembrane and coiled-coil dom...    132   9e-35    
gb|KFQ95677.1|  Transmembrane and coiled-coil domain-containing p...    122   1e-34    
ref|XP_008316475.1|  PREDICTED: transmembrane and coiled-coil dom...    132   1e-34    
gb|KFW83765.1|  Transmembrane and coiled-coil domain-containing p...    122   1e-34    
gb|KFV94450.1|  Transmembrane and coiled-coil domain-containing p...    122   1e-34    
ref|XP_010721257.1|  PREDICTED: transmembrane and coiled-coil dom...    122   1e-34    
gb|KEQ97752.1|  hypothetical protein AUEXF2481DRAFT_27109               147   1e-34    
ref|XP_004572800.1|  PREDICTED: transmembrane and coiled-coil dom...    133   1e-34    
ref|XP_010220059.1|  PREDICTED: transmembrane and coiled-coil dom...    122   1e-34    
gb|KEQ83486.1|  DUF726-domain-containing protein                        147   1e-34    
ref|XP_012024671.1|  PREDICTED: transmembrane and coiled-coil dom...    130   1e-34    
ref|XP_012024670.1|  PREDICTED: transmembrane and coiled-coil dom...    130   1e-34    
ref|XP_008081772.1|  alpha/beta-Hydrolase                               139   1e-34    
ref|XP_002379590.1|  DUF726 domain protein                              134   1e-34    
gb|KFQ48621.1|  Transmembrane and coiled-coil domain-containing p...    122   1e-34    
gb|EIT79029.1|  hypothetical protein Ao3042_04551                       134   2e-34    
gb|KFZ63467.1|  Transmembrane and coiled-coil domain-containing p...    122   2e-34    
gb|ERE84022.1|  transmembrane and coiled-coil domain-containing p...    129   2e-34    
ref|XP_001821819.2|  hypothetical protein AOR_1_654014                  134   2e-34    
gb|KFY16564.1|  hypothetical protein V492_01239                         137   2e-34    
ref|XP_007626014.1|  PREDICTED: transmembrane and coiled-coil dom...    129   2e-34    
ref|XP_003506941.1|  PREDICTED: transmembrane and coiled-coil dom...    129   2e-34    
gb|KFO07232.1|  Transmembrane and coiled-coil domain-containing p...    123   2e-34    
ref|XP_004325129.1|  PREDICTED: transmembrane and coiled-coil dom...    130   2e-34    
dbj|BAE59817.1|  unnamed protein product                                134   2e-34    
gb|KFX46852.1|  putative membrane protein C6F6.13c                      138   2e-34    
ref|XP_002148825.1|  DUF726 domain protein                              138   2e-34    
ref|XP_007908917.1|  PREDICTED: transmembrane and coiled-coil dom...    131   2e-34    
ref|XP_007908915.1|  PREDICTED: transmembrane and coiled-coil dom...    131   2e-34    
ref|XP_007908916.1|  PREDICTED: transmembrane and coiled-coil dom...    131   2e-34    
ref|XP_003836416.1|  hypothetical protein LEMA_P039520.1                138   2e-34    
ref|XP_010955746.1|  PREDICTED: transmembrane and coiled-coil dom...    127   2e-34    
ref|XP_011301607.1|  PREDICTED: transmembrane and coiled-coil dom...    126   3e-34    
gb|KFO59608.1|  Transmembrane and coiled-coil domain-containing p...    121   3e-34    
gb|KFY38463.1|  hypothetical protein V494_04359                         136   3e-34    
ref|XP_011301605.1|  PREDICTED: transmembrane and coiled-coil dom...    126   3e-34    
ref|XP_010762608.1|  hypothetical protein PADG_12224                    136   3e-34    
gb|KFQ24464.1|  Transmembrane and coiled-coil domain-containing p...    120   3e-34    
ref|XP_007805894.1|  hypothetical protein EPUS_03720                    139   3e-34    
ref|XP_007920508.1|  hypothetical protein MYCFIDRAFT_78465              135   3e-34    
dbj|GAM37624.1|  hypothetical protein TCE0_024r07696                    139   4e-34    
gb|EKG11129.1|  hypothetical protein MPH_11747                          145   4e-34    
ref|XP_002791969.1|  transmembrane and coiled-coil domain contain...    136   4e-34    
gb|EMP28308.1|  Transmembrane and coiled-coil domain-containing p...    120   4e-34    
ref|XP_011619939.1|  PREDICTED: transmembrane and coiled-coil dom...    134   4e-34    
ref|XP_003857494.1|  hypothetical protein MYCGRDRAFT_65706              137   4e-34    
gb|KGY15010.1|  hypothetical protein PABG_12124                         136   4e-34    
gb|ELR07668.1|  hypothetical protein GMDG_02690                         136   5e-34    
ref|XP_003963036.1|  PREDICTED: transmembrane and coiled-coil dom...    134   5e-34    
gb|KJY00160.1|  DUF726-domain-containing protein                        136   5e-34    
ref|XP_008289637.1|  PREDICTED: transmembrane and coiled-coil dom...    132   5e-34    
gb|KFP43374.1|  Transmembrane and coiled-coil domain-containing p...    120   5e-34    



>ref|XP_009615489.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Nicotiana tomentosiformis]
Length=565

 Score =   298 bits (762),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IAVDRSDKAG+LLAEVL+KGLQGHRPVTLVGFSLGARVIFKCLQILA + NN+
Sbjct  398  FIDSTWSIAVDRSDKAGVLLAEVLKKGLQGHRPVTLVGFSLGARVIFKCLQILAETENNS  457

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D+NWEA RKVVAGRF+N YSTNDWMLG+ FRASLL+QGLAGIQP
Sbjct  458  GLVERVVLLGAPIAIKDMNWEAARKVVAGRFVNAYSTNDWMLGVAFRASLLTQGLAGIQP  517

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGR  347
            V+VPGVENVDVTE I+GHS+YLW +QEILELL+LDTYYPVFG 
Sbjct  518  VEVPGVENVDVTEFIEGHSSYLWATQEILELLELDTYYPVFGE  560


 Score =   177 bits (450),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S  S WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTL+PVIGASG
Sbjct  195   QSPDSSWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLIPVIGASG  254

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVATAAGSV GSVAVAASFGAAGAGLTG+K+ARR+GDVDEFEFK IG+NHN+GRLAV+
Sbjct  255   FAAVATAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGDVDEFEFKAIGENHNQGRLAVQ  314

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+G VFEE DF RPWEG+Y+N ERY LQWESK+L+AVS AI++WLTS IALELMK+GA
Sbjct  315   ILISGLVFEEEDFIRPWEGQYDNSERYILQWESKNLIAVSTAIQDWLTSRIALELMKQGA  374

Query  906   MMTVLSSFLTALA  868
             MMTVL + LTALA
Sbjct  375   MMTVLHTLLTALA  387



>ref|XP_009615490.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Nicotiana tomentosiformis]
Length=561

 Score =   298 bits (762),  Expect(2) = 3e-124, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IAVDRSDKAG+LLAEVL+KGLQGHRPVTLVGFSLGARVIFKCLQILA + NN+
Sbjct  394  FIDSTWSIAVDRSDKAGVLLAEVLKKGLQGHRPVTLVGFSLGARVIFKCLQILAETENNS  453

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D+NWEA RKVVAGRF+N YSTNDWMLG+ FRASLL+QGLAGIQP
Sbjct  454  GLVERVVLLGAPIAIKDMNWEAARKVVAGRFVNAYSTNDWMLGVAFRASLLTQGLAGIQP  513

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGR  347
            V+VPGVENVDVTE I+GHS+YLW +QEILELL+LDTYYPVFG 
Sbjct  514  VEVPGVENVDVTEFIEGHSSYLWATQEILELLELDTYYPVFGE  556


 Score =   177 bits (448),  Expect(2) = 3e-124, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S  S WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTL+PVIGASG
Sbjct  191   QSPDSSWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLIPVIGASG  250

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVATAAGSV GSVAVAASFGAAGAGLTG+K+ARR+GDVDEFEFK IG+NHN+GRLAV+
Sbjct  251   FAAVATAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGDVDEFEFKAIGENHNQGRLAVQ  310

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+G VFEE DF RPWEG+Y+N ERY LQWESK+L+AVS AI++WLTS IALELMK+GA
Sbjct  311   ILISGLVFEEEDFIRPWEGQYDNSERYILQWESKNLIAVSTAIQDWLTSRIALELMKQGA  370

Query  906   MMTVLSSFLTALA  868
             MMTVL + LTALA
Sbjct  371   MMTVLHTLLTALA  383



>ref|XP_009757146.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Nicotiana sylvestris]
Length=581

 Score =   298 bits (762),  Expect(2) = 3e-124, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 160/180 (89%), Gaps = 8/180 (4%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IAVDRSDKAG+LLAEVL+KGLQGHRPVTLVGFSLGARVIFKCLQILA + NN+
Sbjct  398  FIDSTWSIAVDRSDKAGVLLAEVLKKGLQGHRPVTLVGFSLGARVIFKCLQILAETENNS  457

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D+NWEA RKVVAGRF+N YSTNDWMLG+ FRASLL+QGLAGIQP
Sbjct  458  GLVERVVLLGAPIAIKDMNWEAARKVVAGRFVNAYSTNDWMLGVAFRASLLTQGLAGIQP  517

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRASR*DLRHILPLIFSLQ  296
            V+VPGVENVDVTE I+GHS+YLW +QEILELL+LDTY+PVFG+ S        P +F+L 
Sbjct  518  VEVPGVENVDVTEFIEGHSSYLWATQEILELLELDTYFPVFGQRS--------PRLFALN  569


 Score =   177 bits (448),  Expect(2) = 3e-124, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S  S WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTL+PVIGASG
Sbjct  195   QSPDSSWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLIPVIGASG  254

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVATAAGSV GSVAVAASFGAAGAGLTG+K+ARR+GDVDEFEFK IG+NHN+GRLAV+
Sbjct  255   FAAVATAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGDVDEFEFKAIGENHNQGRLAVQ  314

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+G VFEE DF RPWEG+Y+N ERY LQWESK+L+AVS AI++WLTS IALELMK+GA
Sbjct  315   ILISGLVFEEEDFLRPWEGQYDNSERYILQWESKNLIAVSTAIQDWLTSRIALELMKQGA  374

Query  906   MMTVLSSFLTALA  868
             MMTVL + LTALA
Sbjct  375   MMTVLHTLLTALA  387



>ref|XP_009757147.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Nicotiana sylvestris]
Length=577

 Score =   297 bits (761),  Expect(2) = 3e-124, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 160/180 (89%), Gaps = 8/180 (4%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IAVDRSDKAG+LLAEVL+KGLQGHRPVTLVGFSLGARVIFKCLQILA + NN+
Sbjct  394  FIDSTWSIAVDRSDKAGVLLAEVLKKGLQGHRPVTLVGFSLGARVIFKCLQILAETENNS  453

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D+NWEA RKVVAGRF+N YSTNDWMLG+ FRASLL+QGLAGIQP
Sbjct  454  GLVERVVLLGAPIAIKDMNWEAARKVVAGRFVNAYSTNDWMLGVAFRASLLTQGLAGIQP  513

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRASR*DLRHILPLIFSLQ  296
            V+VPGVENVDVTE I+GHS+YLW +QEILELL+LDTY+PVFG+ S        P +F+L 
Sbjct  514  VEVPGVENVDVTEFIEGHSSYLWATQEILELLELDTYFPVFGQRS--------PRLFALN  565


 Score =   177 bits (448),  Expect(2) = 3e-124, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S  S WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTL+PVIGASG
Sbjct  191   QSPDSSWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLIPVIGASG  250

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVATAAGSV GSVAVAASFGAAGAGLTG+K+ARR+GDVDEFEFK IG+NHN+GRLAV+
Sbjct  251   FAAVATAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGDVDEFEFKAIGENHNQGRLAVQ  310

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+G VFEE DF RPWEG+Y+N ERY LQWESK+L+AVS AI++WLTS IALELMK+GA
Sbjct  311   ILISGLVFEEEDFLRPWEGQYDNSERYILQWESKNLIAVSTAIQDWLTSRIALELMKQGA  370

Query  906   MMTVLSSFLTALA  868
             MMTVL + LTALA
Sbjct  371   MMTVLHTLLTALA  383



>ref|XP_009615488.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nicotiana tomentosiformis]
Length=662

 Score =   297 bits (760),  Expect(2) = 4e-124, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IAVDRSDKAG+LLAEVL+KGLQGHRPVTLVGFSLGARVIFKCLQILA + NN+
Sbjct  495  FIDSTWSIAVDRSDKAGVLLAEVLKKGLQGHRPVTLVGFSLGARVIFKCLQILAETENNS  554

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D+NWEA RKVVAGRF+N YSTNDWMLG+ FRASLL+QGLAGIQP
Sbjct  555  GLVERVVLLGAPIAIKDMNWEAARKVVAGRFVNAYSTNDWMLGVAFRASLLTQGLAGIQP  614

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGR  347
            V+VPGVENVDVTE I+GHS+YLW +QEILELL+LDTYYPVFG 
Sbjct  615  VEVPGVENVDVTEFIEGHSSYLWATQEILELLELDTYYPVFGE  657


 Score =   177 bits (449),  Expect(2) = 4e-124, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S  S WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTL+PVIGASG
Sbjct  292   QSPDSSWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLIPVIGASG  351

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVATAAGSV GSVAVAASFGAAGAGLTG+K+ARR+GDVDEFEFK IG+NHN+GRLAV+
Sbjct  352   FAAVATAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGDVDEFEFKAIGENHNQGRLAVQ  411

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+G VFEE DF RPWEG+Y+N ERY LQWESK+L+AVS AI++WLTS IALELMK+GA
Sbjct  412   ILISGLVFEEEDFIRPWEGQYDNSERYILQWESKNLIAVSTAIQDWLTSRIALELMKQGA  471

Query  906   MMTVLSSFLTALA  868
             MMTVL + LTALA
Sbjct  472   MMTVLHTLLTALA  484



>ref|XP_009757145.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nicotiana sylvestris]
Length=678

 Score =   297 bits (760),  Expect(2) = 7e-124, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 160/180 (89%), Gaps = 8/180 (4%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IAVDRSDKAG+LLAEVL+KGLQGHRPVTLVGFSLGARVIFKCLQILA + NN+
Sbjct  495  FIDSTWSIAVDRSDKAGVLLAEVLKKGLQGHRPVTLVGFSLGARVIFKCLQILAETENNS  554

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D+NWEA RKVVAGRF+N YSTNDWMLG+ FRASLL+QGLAGIQP
Sbjct  555  GLVERVVLLGAPIAIKDMNWEAARKVVAGRFVNAYSTNDWMLGVAFRASLLTQGLAGIQP  614

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRASR*DLRHILPLIFSLQ  296
            V+VPGVENVDVTE I+GHS+YLW +QEILELL+LDTY+PVFG+ S        P +F+L 
Sbjct  615  VEVPGVENVDVTEFIEGHSSYLWATQEILELLELDTYFPVFGQRS--------PRLFALN  666


 Score =   176 bits (447),  Expect(2) = 7e-124, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S  S WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTL+PVIGASG
Sbjct  292   QSPDSSWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLIPVIGASG  351

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVATAAGSV GSVAVAASFGAAGAGLTG+K+ARR+GDVDEFEFK IG+NHN+GRLAV+
Sbjct  352   FAAVATAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGDVDEFEFKAIGENHNQGRLAVQ  411

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+G VFEE DF RPWEG+Y+N ERY LQWESK+L+AVS AI++WLTS IALELMK+GA
Sbjct  412   ILISGLVFEEEDFLRPWEGQYDNSERYILQWESKNLIAVSTAIQDWLTSRIALELMKQGA  471

Query  906   MMTVLSSFLTALA  868
             MMTVL + LTALA
Sbjct  472   MMTVLHTLLTALA  484



>ref|XP_010317701.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X3 [Solanum lycopersicum]
Length=561

 Score =   296 bits (757),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IAVDRSDKAG+LLAEVL+KGLQGHRPVTLVGFSLGARVIFKCLQ+LA S NN+
Sbjct  394  FIDSTWSIAVDRSDKAGVLLAEVLKKGLQGHRPVTLVGFSLGARVIFKCLQVLAESENNS  453

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D++WEA RKVVAGRF+N YSTNDWMLG+ FRASLL+QGLAGIQP
Sbjct  454  GLVERVVLLGAPIAIKDMDWEAARKVVAGRFVNAYSTNDWMLGVAFRASLLTQGLAGIQP  513

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFG  350
            V++PGVENVDVTE I+GHS+YLW +QEILELL+LDTYYPVFG
Sbjct  514  VEIPGVENVDVTEFIEGHSSYLWATQEILELLELDTYYPVFG  555


 Score =   172 bits (436),  Expect(2) = 3e-122, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S    WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTL+PVIGASG
Sbjct  191   QSPDGSWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLIPVIGASG  250

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVATAAGSV GSVAVAASFGAAGAGLTG+K+ARR GDVDEFEFK IG+NHN+GRLAV+
Sbjct  251   FAAVATAAGSVAGSVAVAASFGAAGAGLTGTKMARRTGDVDEFEFKAIGENHNQGRLAVQ  310

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+G VFEE DF RPWEG+++N ERY LQWESK+L+AVS AI++WLTS IA+ELMK+GA
Sbjct  311   ILISGLVFEEEDFIRPWEGQHDNSERYILQWESKNLIAVSTAIQDWLTSRIAMELMKQGA  370

Query  906   MMTVLSSFLTALA  868
             MMTVL + LTALA
Sbjct  371   MMTVLHTLLTALA  383



>ref|XP_010317700.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X2 [Solanum lycopersicum]
Length=631

 Score =   295 bits (756),  Expect(2) = 4e-122, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IAVDRSDKAG+LLAEVL+KGLQGHRPVTLVGFSLGARVIFKCLQ+LA S NN+
Sbjct  464  FIDSTWSIAVDRSDKAGVLLAEVLKKGLQGHRPVTLVGFSLGARVIFKCLQVLAESENNS  523

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D++WEA RKVVAGRF+N YSTNDWMLG+ FRASLL+QGLAGIQP
Sbjct  524  GLVERVVLLGAPIAIKDMDWEAARKVVAGRFVNAYSTNDWMLGVAFRASLLTQGLAGIQP  583

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGR  347
            V++PGVENVDVTE I+GHS+YLW +QEILELL+LDTYYPVFG 
Sbjct  584  VEIPGVENVDVTEFIEGHSSYLWATQEILELLELDTYYPVFGH  626


 Score =   172 bits (436),  Expect(2) = 4e-122, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S    WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTL+PVIGASG
Sbjct  261   QSPDGSWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLIPVIGASG  320

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVATAAGSV GSVAVAASFGAAGAGLTG+K+ARR GDVDEFEFK IG+NHN+GRLAV+
Sbjct  321   FAAVATAAGSVAGSVAVAASFGAAGAGLTGTKMARRTGDVDEFEFKAIGENHNQGRLAVQ  380

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+G VFEE DF RPWEG+++N ERY LQWESK+L+AVS AI++WLTS IA+ELMK+GA
Sbjct  381   ILISGLVFEEEDFIRPWEGQHDNSERYILQWESKNLIAVSTAIQDWLTSRIAMELMKQGA  440

Query  906   MMTVLSSFLTALA  868
             MMTVL + LTALA
Sbjct  441   MMTVLHTLLTALA  453



>ref|XP_004234544.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Solanum lycopersicum]
Length=661

 Score =   295 bits (756),  Expect(2) = 4e-122, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 153/163 (94%), Gaps = 0/163 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IAVDRSDKAG+LLAEVL+KGLQGHRPVTLVGFSLGARVIFKCLQ+LA S NN+
Sbjct  494  FIDSTWSIAVDRSDKAGVLLAEVLKKGLQGHRPVTLVGFSLGARVIFKCLQVLAESENNS  553

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D++WEA RKVVAGRF+N YSTNDWMLG+ FRASLL+QGLAGIQP
Sbjct  554  GLVERVVLLGAPIAIKDMDWEAARKVVAGRFVNAYSTNDWMLGVAFRASLLTQGLAGIQP  613

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGR  347
            V++PGVENVDVTE I+GHS+YLW +QEILELL+LDTYYPVFG 
Sbjct  614  VEIPGVENVDVTEFIEGHSSYLWATQEILELLELDTYYPVFGH  656


 Score =   172 bits (435),  Expect(2) = 4e-122, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S    WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTL+PVIGASG
Sbjct  291   QSPDGSWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLIPVIGASG  350

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVATAAGSV GSVAVAASFGAAGAGLTG+K+ARR GDVDEFEFK IG+NHN+GRLAV+
Sbjct  351   FAAVATAAGSVAGSVAVAASFGAAGAGLTGTKMARRTGDVDEFEFKAIGENHNQGRLAVQ  410

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+G VFEE DF RPWEG+++N ERY LQWESK+L+AVS AI++WLTS IA+ELMK+GA
Sbjct  411   ILISGLVFEEEDFIRPWEGQHDNSERYILQWESKNLIAVSTAIQDWLTSRIAMELMKQGA  470

Query  906   MMTVLSSFLTALA  868
             MMTVL + LTALA
Sbjct  471   MMTVLHTLLTALA  483



>ref|XP_010317702.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X4 [Solanum lycopersicum]
Length=542

 Score =   295 bits (756),  Expect(2) = 5e-122, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 153/162 (94%), Gaps = 0/162 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IAVDRSDKAG+LLAEVL+KGLQGHRPVTLVGFSLGARVIFKCLQ+LA S NN+
Sbjct  375  FIDSTWSIAVDRSDKAGVLLAEVLKKGLQGHRPVTLVGFSLGARVIFKCLQVLAESENNS  434

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D++WEA RKVVAGRF+N YSTNDWMLG+ FRASLL+QGLAGIQP
Sbjct  435  GLVERVVLLGAPIAIKDMDWEAARKVVAGRFVNAYSTNDWMLGVAFRASLLTQGLAGIQP  494

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFG  350
            V++PGVENVDVTE I+GHS+YLW +QEILELL+LDTYYPVFG
Sbjct  495  VEIPGVENVDVTEFIEGHSSYLWATQEILELLELDTYYPVFG  536


 Score =   172 bits (435),  Expect(2) = 5e-122, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S    WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTL+PVIGASG
Sbjct  172   QSPDGSWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLIPVIGASG  231

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVATAAGSV GSVAVAASFGAAGAGLTG+K+ARR GDVDEFEFK IG+NHN+GRLAV+
Sbjct  232   FAAVATAAGSVAGSVAVAASFGAAGAGLTGTKMARRTGDVDEFEFKAIGENHNQGRLAVQ  291

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+G VFEE DF RPWEG+++N ERY LQWESK+L+AVS AI++WLTS IA+ELMK+GA
Sbjct  292   ILISGLVFEEEDFIRPWEGQHDNSERYILQWESKNLIAVSTAIQDWLTSRIAMELMKQGA  351

Query  906   MMTVLSSFLTALA  868
             MMTVL + LTALA
Sbjct  352   MMTVLHTLLTALA  364



>ref|XP_006343380.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Solanum tuberosum]
Length=561

 Score =   295 bits (754),  Expect(2) = 5e-121, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IAVDRSDKAG+LLAEVL+KGLQGHRPVTLVGFSLGARVIFKCLQ+LA S NN+
Sbjct  394  FIDSTWSIAVDRSDKAGVLLAEVLKKGLQGHRPVTLVGFSLGARVIFKCLQVLAESENNS  453

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D++WEA RKVVAGRF+N YSTNDWMLG+ FRASLL+QGLAGIQP
Sbjct  454  GLVERVVLLGAPIAIKDMDWEAARKVVAGRFVNAYSTNDWMLGVAFRASLLTQGLAGIQP  513

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFG  350
            V++PGVENVDVTE I GHS+YLW +QEILELL+LDTYYPVFG
Sbjct  514  VEIPGVENVDVTEFIKGHSSYLWATQEILELLELDTYYPVFG  555


 Score =   169 bits (428),  Expect(2) = 5e-121, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S  S W KW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTL+PVIGASG
Sbjct  191   QSPDSSWVKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLIPVIGASG  250

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVATAAGSV GSVAVAASFGAAGAGLTG+K+ARR GDVDEFEFK IG+NHN+GRLAV+
Sbjct  251   FAAVATAAGSVAGSVAVAASFGAAGAGLTGTKMARRTGDVDEFEFKAIGENHNQGRLAVQ  310

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+G +FEE DF RPWEG+++N ERY LQWESK+L+AVS AI++WLTS IA+ELMK+GA
Sbjct  311   ILISGLIFEEEDFIRPWEGQHDNSERYILQWESKNLIAVSTAIQDWLTSRIAMELMKQGA  370

Query  906   MMTVLSSFLTALA  868
             MMTVL + L ALA
Sbjct  371   MMTVLHTLLIALA  383



>ref|XP_006343379.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Solanum tuberosum]
Length=565

 Score =   294 bits (753),  Expect(2) = 7e-121, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 152/162 (94%), Gaps = 0/162 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IAVDRSDKAG+LLAEVL+KGLQGHRPVTLVGFSLGARVIFKCLQ+LA S NN+
Sbjct  398  FIDSTWSIAVDRSDKAGVLLAEVLKKGLQGHRPVTLVGFSLGARVIFKCLQVLAESENNS  457

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D++WEA RKVVAGRF+N YSTNDWMLG+ FRASLL+QGLAGIQP
Sbjct  458  GLVERVVLLGAPIAIKDMDWEAARKVVAGRFVNAYSTNDWMLGVAFRASLLTQGLAGIQP  517

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFG  350
            V++PGVENVDVTE I GHS+YLW +QEILELL+LDTYYPVFG
Sbjct  518  VEIPGVENVDVTEFIKGHSSYLWATQEILELLELDTYYPVFG  559


 Score =   169 bits (427),  Expect(2) = 7e-121, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S  S W KW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTL+PVIGASG
Sbjct  195   QSPDSSWVKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLIPVIGASG  254

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVATAAGSV GSVAVAASFGAAGAGLTG+K+ARR GDVDEFEFK IG+NHN+GRLAV+
Sbjct  255   FAAVATAAGSVAGSVAVAASFGAAGAGLTGTKMARRTGDVDEFEFKAIGENHNQGRLAVQ  314

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+G +FEE DF RPWEG+++N ERY LQWESK+L+AVS AI++WLTS IA+ELMK+GA
Sbjct  315   ILISGLIFEEEDFIRPWEGQHDNSERYILQWESKNLIAVSTAIQDWLTSRIAMELMKQGA  374

Query  906   MMTVLSSFLTALA  868
             MMTVL + L ALA
Sbjct  375   MMTVLHTLLIALA  387



>ref|XP_006343378.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Solanum tuberosum]
Length=661

 Score =   294 bits (753),  Expect(2) = 9e-121, Method: Compositional matrix adjust.
 Identities = 136/163 (83%), Positives = 152/163 (93%), Gaps = 0/163 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IAVDRSDKAG+LLAEVL+KGLQGHRPVTLVGFSLGARVIFKCLQ+LA S NN+
Sbjct  494  FIDSTWSIAVDRSDKAGVLLAEVLKKGLQGHRPVTLVGFSLGARVIFKCLQVLAESENNS  553

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D++WEA RKVVAGRF+N YSTNDWMLG+ FRASLL+QGLAGIQP
Sbjct  554  GLVERVVLLGAPIAIKDMDWEAARKVVAGRFVNAYSTNDWMLGVAFRASLLTQGLAGIQP  613

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGR  347
            V++PGVENVDVTE I GHS+YLW +QEILELL+LDTYYPVFG 
Sbjct  614  VEIPGVENVDVTEFIKGHSSYLWATQEILELLELDTYYPVFGH  656


 Score =   169 bits (427),  Expect(2) = 9e-121, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S  S W KW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTL+PVIGASG
Sbjct  291   QSPDSSWVKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLIPVIGASG  350

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVATAAGSV GSVAVAASFGAAGAGLTG+K+ARR GDVDEFEFK IG+NHN+GRLAV+
Sbjct  351   FAAVATAAGSVAGSVAVAASFGAAGAGLTGTKMARRTGDVDEFEFKAIGENHNQGRLAVQ  410

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+G +FEE DF RPWEG+++N ERY LQWESK+L+AVS AI++WLTS IA+ELMK+GA
Sbjct  411   ILISGLIFEEEDFIRPWEGQHDNSERYILQWESKNLIAVSTAIQDWLTSRIAMELMKQGA  470

Query  906   MMTVLSSFLTALA  868
             MMTVL + L ALA
Sbjct  471   MMTVLHTLLIALA  483



>gb|EYU31146.1| hypothetical protein MIMGU_mgv1a002490mg [Erythranthe guttata]
Length=667

 Score =   283 bits (725),  Expect(2) = 3e-120, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 151/164 (92%), Gaps = 0/164 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA++RSDKAG LLAEVLQKGLQG RPVTLVGFSLGARV+F+CLQILA S  N 
Sbjct  500  FIDSKWTIALNRSDKAGKLLAEVLQKGLQGQRPVTLVGFSLGARVVFRCLQILAESETNV  559

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D+NWEA RKVVAGR++N YSTNDWMLGI FRA+LL+QGLAGIQP
Sbjct  560  GLVERVVLLGAPISIKDMNWEATRKVVAGRYVNAYSTNDWMLGIAFRANLLTQGLAGIQP  619

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRA  344
            V+VPG+ENVDVTE+I+GHS+YLW +Q+ILE L+LDTYYPVF ++
Sbjct  620  VNVPGIENVDVTEVIEGHSSYLWKTQQILEQLELDTYYPVFNQS  663


 Score =   178 bits (451),  Expect(2) = 3e-120, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A+S KS WAKW+RGGIIGAAALTGGTLMA+TGGLAAPAIAAGF ALAPTLGT++PVIGA 
Sbjct  296   AQSKKSSWAKWKRGGIIGAAALTGGTLMAVTGGLAAPAIAAGFSALAPTLGTIIPVIGAG  355

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAAVATAAGSV GSVAVAASFGAAGAGLTGSK+ARR+GDVDEFEFK IG+NHN+GRL V
Sbjct  356   GFAAVATAAGSVAGSVAVAASFGAAGAGLTGSKMARRIGDVDEFEFKAIGENHNQGRLGV  415

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EI ++GFVFEE DF RPWEG+ NN ERY LQWESKHL+AVS AI++WLTS +A+E+MK+G
Sbjct  416   EISVSGFVFEEEDFIRPWEGQQNNSERYVLQWESKHLIAVSTAIQDWLTSRLAMEMMKQG  475

Query  909   AMMTVLSSFLTALA  868
             AMMTVLSS L ALA
Sbjct  476   AMMTVLSSLLMALA  489



>ref|XP_009600610.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Nicotiana tomentosiformis]
Length=565

 Score =   292 bits (748),  Expect(2) = 7e-120, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 153/164 (93%), Gaps = 1/164 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIAVDRSDKAG LLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILA S +N+
Sbjct  399  FIDSKWTIAVDRSDKAGKLLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAESESNS  458

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D+NWEA RKVVAGRF+N YSTNDWMLGI FRASLL++GLAGIQP
Sbjct  459  GLVERVVLLGAPIAIKDMNWEAARKVVAGRFVNAYSTNDWMLGIAFRASLLTRGLAGIQP  518

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYP-VFGR  347
            VDVPG+ENVDVTELIDGHS+YLW +Q+IL+LL+LD YYP V GR
Sbjct  519  VDVPGIENVDVTELIDGHSSYLWATQKILDLLELDAYYPVVLGR  562


 Score =   168 bits (425),  Expect(2) = 7e-120, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS WAKW+R GIIGAAA+TGGTL+A+TGGLAAPAIAAGFGALAPTLG LVPVIGASGF
Sbjct  197   SPKSSWAKWKRRGIIGAAAVTGGTLLAVTGGLAAPAIAAGFGALAPTLGALVPVIGASGF  256

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AAVA+AAGSV GSVAVAASFGAAGAGLTGSK+ARR GDVDEFEFK IG+NHN+GRL VE+
Sbjct  257   AAVASAAGSVAGSVAVAASFGAAGAGLTGSKMARRTGDVDEFEFKAIGENHNQGRLGVEV  316

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             LI+G VF+E DF RPWEG+Y+N ERY LQWESK+L+AVS AI++WLTS +A+ELMKRGAM
Sbjct  317   LISGLVFKEEDFVRPWEGQYDNSERYVLQWESKNLIAVSTAIQDWLTSRLAMELMKRGAM  376

Query  903   MTVLSSFLTALA  868
             MTVL + L A A
Sbjct  377   MTVLKTLLAAFA  388



>ref|XP_009789382.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Nicotiana sylvestris]
Length=565

 Score =   290 bits (742),  Expect(2) = 7e-120, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 153/166 (92%), Gaps = 1/166 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIAVDRSDKAG LLAEVLQKGLQGHRPVTLVGFSLGARVIFKCL+ILA S +N+
Sbjct  399  FIDSKWTIAVDRSDKAGKLLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLRILAESESNS  458

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D+NWEA RKVVAGRF+N YSTNDWMLGI FRASLL++GLAGIQP
Sbjct  459  GLVERVVLLGAPIAIKDMNWEAARKVVAGRFVNAYSTNDWMLGIAFRASLLTRGLAGIQP  518

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYP-VFGRAS  341
            VDVPG+ENVDVTELIDGHS+YLW +Q+IL LL+LD YYP V GR +
Sbjct  519  VDVPGIENVDVTELIDGHSSYLWATQKILNLLELDAYYPVVLGRVT  564


 Score =   170 bits (431),  Expect(2) = 7e-120, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS WAKW+R GIIGAAA+TGGTL+A+TGGLAAPAIAAGFGALAPTLG LVPVIGASGF
Sbjct  197   SPKSSWAKWKRRGIIGAAAVTGGTLLAVTGGLAAPAIAAGFGALAPTLGALVPVIGASGF  256

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AAVA+AAGSV GSVAVAASFGAAGAGLTGSK+ARR GDVDEFEFK+IG+NHN+GRLAVE+
Sbjct  257   AAVASAAGSVAGSVAVAASFGAAGAGLTGSKMARRTGDVDEFEFKSIGENHNQGRLAVEV  316

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             LI+G VF+E DF RPWEG+Y+N ERY LQWESK+L+AVS AI++WLTS +A+ELMKRGAM
Sbjct  317   LISGLVFKEEDFVRPWEGQYDNSERYVLQWESKNLIAVSTAIQDWLTSRLAMELMKRGAM  376

Query  903   MTVLSSFLTALA  868
             MTVL + L A A
Sbjct  377   MTVLKTLLAAFA  388



>ref|XP_009600609.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nicotiana tomentosiformis]
Length=661

 Score =   291 bits (746),  Expect(2) = 7e-120, Method: Compositional matrix adjust.
 Identities = 139/164 (85%), Positives = 153/164 (93%), Gaps = 1/164 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIAVDRSDKAG LLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILA S +N+
Sbjct  495  FIDSKWTIAVDRSDKAGKLLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAESESNS  554

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D+NWEA RKVVAGRF+N YSTNDWMLGI FRASLL++GLAGIQP
Sbjct  555  GLVERVVLLGAPIAIKDMNWEAARKVVAGRFVNAYSTNDWMLGIAFRASLLTRGLAGIQP  614

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYP-VFGR  347
            VDVPG+ENVDVTELIDGHS+YLW +Q+IL+LL+LD YYP V GR
Sbjct  615  VDVPGIENVDVTELIDGHSSYLWATQKILDLLELDAYYPVVLGR  658


 Score =   168 bits (426),  Expect(2) = 7e-120, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS WAKW+R GIIGAAA+TGGTL+A+TGGLAAPAIAAGFGALAPTLG LVPVIGASGF
Sbjct  293   SPKSSWAKWKRRGIIGAAAVTGGTLLAVTGGLAAPAIAAGFGALAPTLGALVPVIGASGF  352

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AAVA+AAGSV GSVAVAASFGAAGAGLTGSK+ARR GDVDEFEFK IG+NHN+GRL VE+
Sbjct  353   AAVASAAGSVAGSVAVAASFGAAGAGLTGSKMARRTGDVDEFEFKAIGENHNQGRLGVEV  412

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             LI+G VF+E DF RPWEG+Y+N ERY LQWESK+L+AVS AI++WLTS +A+ELMKRGAM
Sbjct  413   LISGLVFKEEDFVRPWEGQYDNSERYVLQWESKNLIAVSTAIQDWLTSRLAMELMKRGAM  472

Query  903   MTVLSSFLTALA  868
             MTVL + L A A
Sbjct  473   MTVLKTLLAAFA  484



>ref|XP_009789372.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nicotiana sylvestris]
Length=661

 Score =   289 bits (740),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 153/166 (92%), Gaps = 1/166 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIAVDRSDKAG LLAEVLQKGLQGHRPVTLVGFSLGARVIFKCL+ILA S +N+
Sbjct  495  FIDSKWTIAVDRSDKAGKLLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLRILAESESNS  554

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+D+NWEA RKVVAGRF+N YSTNDWMLGI FRASLL++GLAGIQP
Sbjct  555  GLVERVVLLGAPIAIKDMNWEAARKVVAGRFVNAYSTNDWMLGIAFRASLLTRGLAGIQP  614

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYP-VFGRAS  341
            VDVPG+ENVDVTELIDGHS+YLW +Q+IL LL+LD YYP V GR +
Sbjct  615  VDVPGIENVDVTELIDGHSSYLWATQKILNLLELDAYYPVVLGRVT  660


 Score =   170 bits (431),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS WAKW+R GIIGAAA+TGGTL+A+TGGLAAPAIAAGFGALAPTLG LVPVIGASGF
Sbjct  293   SPKSSWAKWKRRGIIGAAAVTGGTLLAVTGGLAAPAIAAGFGALAPTLGALVPVIGASGF  352

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AAVA+AAGSV GSVAVAASFGAAGAGLTGSK+ARR GDVDEFEFK+IG+NHN+GRLAVE+
Sbjct  353   AAVASAAGSVAGSVAVAASFGAAGAGLTGSKMARRTGDVDEFEFKSIGENHNQGRLAVEV  412

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             LI+G VF+E DF RPWEG+Y+N ERY LQWESK+L+AVS AI++WLTS +A+ELMKRGAM
Sbjct  413   LISGLVFKEEDFVRPWEGQYDNSERYVLQWESKNLIAVSTAIQDWLTSRLAMELMKRGAM  472

Query  903   MTVLSSFLTALA  868
             MTVL + L A A
Sbjct  473   MTVLKTLLAAFA  484



>gb|EYU24080.1| hypothetical protein MIMGU_mgv1a002505mg [Erythranthe guttata]
Length=665

 Score =   281 bits (718),  Expect(2) = 3e-119, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 149/164 (91%), Gaps = 0/164 (0%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
            +FIDS+WTI +DRSDKAG LLAEVL KGLQG RPVTLVGFSLGARVIF+CLQILA S  N
Sbjct  497  NFIDSKWTIVIDRSDKAGKLLAEVLLKGLQGQRPVTLVGFSLGARVIFRCLQILAESDAN  556

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AGLVERVVLLGAPI I+D+NWEA RKVVAGR+IN YST+DWMLGI FRA+LL++GLAGIQ
Sbjct  557  AGLVERVVLLGAPIAIKDMNWEATRKVVAGRYINAYSTDDWMLGIAFRANLLTKGLAGIQ  616

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGR  347
            PVDVPG+ENVDVTE+I+GHS+YLW +Q ILE L+LDTYYPVF R
Sbjct  617  PVDVPGIENVDVTEIIEGHSSYLWGTQHILEQLELDTYYPVFNR  660


 Score =   177 bits (448),  Expect(2) = 3e-119, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S +S WAKW+RGGIIGAAA+TGGTLMAITGGLAAPAIAAGFGALAPTLGT++PVIGASG
Sbjct  295   KSPESTWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGASG  354

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVA+AAGSVVGSVAVAASFGAAGAGLTG+KVARR+GDV+EFEFKTIG+NHN+GRLAVE
Sbjct  355   FAAVASAAGSVVGSVAVAASFGAAGAGLTGTKVARRIGDVEEFEFKTIGENHNQGRLAVE  414

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             I I+GFVFEE DF RPWEG+++NLERYA+QWESK+L+AVS AI++WLTS IA E+MK+GA
Sbjct  415   ISISGFVFEEQDFIRPWEGQHDNLERYAIQWESKNLIAVSTAIQDWLTSKIATEMMKQGA  474

Query  906   MMTVLSSFLTALA  868
             MMTVLS+ +TALA
Sbjct  475   MMTVLSTLMTALA  487



>ref|XP_011090424.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Sesamum indicum]
 ref|XP_011090425.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Sesamum indicum]
Length=672

 Score =   276 bits (705),  Expect(2) = 4e-116, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 150/163 (92%), Gaps = 0/163 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA++RSDKAG LLAEVL KGLQG RPVTLVGFSLGARVIF+CLQIL+ S  NA
Sbjct  505  FIDSKWSIALNRSDKAGKLLAEVLLKGLQGQRPVTLVGFSLGARVIFRCLQILSESEANA  564

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VERVVLLGAPI I+D++WEA RKVVAGR++N YSTNDWMLGI FRA+LL+QGLAGIQP
Sbjct  565  GIVERVVLLGAPIAIKDMDWEATRKVVAGRYVNAYSTNDWMLGIAFRANLLTQGLAGIQP  624

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGR  347
            V+VPG+ENVDVTE+I+GHS+YLW +Q+ILE L+LDTYYPVF R
Sbjct  625  VNVPGIENVDVTEVIEGHSSYLWRTQQILEQLELDTYYPVFNR  667


 Score =   172 bits (435),  Expect(2) = 4e-116, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  1302  LGTLVPVIgasgfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTI  1123
             LGT++PVIGASGFAAVATAAGSV GSVAVAAS GAAGAGLTGSK+ARR+G+VDEFEFK I
Sbjct  350   LGTIIPVIGASGFAAVATAAGSVAGSVAVAASLGAAGAGLTGSKMARRIGEVDEFEFKAI  409

Query  1122  GQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLT  943
             G+NHN+GRL VEI ++GFVFEE DF RPWEG+++NLERY LQWESKHL+AVS AI+++LT
Sbjct  410   GENHNQGRLGVEISVSGFVFEEEDFVRPWEGQHDNLERYVLQWESKHLIAVSTAIQDYLT  469

Query  942   SSIALELMKRGAMMTVLSSFLTALA  868
             S IA+ELMK+GAMMTVLSS LTALA
Sbjct  470   SRIAMELMKQGAMMTVLSSLLTALA  494



>ref|XP_010649080.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X2 [Vitis vinifera]
Length=662

 Score =   273 bits (698),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA+DRSDKAG LLAEVLQKGLQG+RPVTLVG+SLGARVIFKCLQ LA +  NA
Sbjct  493  FIDSKWTIALDRSDKAGKLLAEVLQKGLQGNRPVTLVGYSLGARVIFKCLQYLAETEQNA  552

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI  RD NWE  RK+VAGRF+N +STNDW LG+ FRASLL++GLAGIQP
Sbjct  553  ELVERVVLLGAPISFRDENWEVARKMVAGRFVNAFSTNDWTLGVAFRASLLTKGLAGIQP  612

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            VDVPG+ENVDVTELI+GHS+YLW +++IL+ L+LDTYYPVF
Sbjct  613  VDVPGIENVDVTELIEGHSSYLWVTEDILDRLELDTYYPVF  653


 Score =   173 bits (439),  Expect(2) = 1e-115, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S KS+W KW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGF ALAPTLGT++PVIGASG
Sbjct  290   QSPKSQWTKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTIIPVIGASG  349

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAG+V GSVA+AASFGAAGAGLTGSK+ARR G VDEFEFK IG+NHN+GRLAVE
Sbjct  350   FAAAASAAGTVAGSVAIAASFGAAGAGLTGSKMARRTGSVDEFEFKAIGENHNQGRLAVE  409

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             IL++GFVF+E DF  PWEG+ NNLERYALQWESK+L+AVS AI++WLTSSIAL +MK+GA
Sbjct  410   ILVSGFVFQEEDFISPWEGQNNNLERYALQWESKNLIAVSTAIQDWLTSSIALSMMKQGA  469

Query  906   MMTVLSSFLTALA  868
             M+TVLS+ +TALA
Sbjct  470   MLTVLSTLMTALA  482



>ref|XP_010649079.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Vitis vinifera]
 emb|CBI17412.3| unnamed protein product [Vitis vinifera]
Length=662

 Score =   271 bits (694),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA+DRSDKAG LLAEVLQKGLQG+RPVTLVG+SLGARVIFKCLQ LA +  NA
Sbjct  493  FIDSKWTIALDRSDKAGKLLAEVLQKGLQGNRPVTLVGYSLGARVIFKCLQYLAETEQNA  552

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI  RD NWE  RK+VAGRF+N +STNDW LG+ FRA+LL++GLAGIQP
Sbjct  553  ELVERVVLLGAPISFRDENWEVARKMVAGRFVNAFSTNDWTLGVAFRANLLTKGLAGIQP  612

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            VDVPG+ENVDVTELI+GHS+YLW +++IL+ L+LDTYYPVF
Sbjct  613  VDVPGIENVDVTELIEGHSSYLWVTEDILDRLELDTYYPVF  653


 Score =   173 bits (439),  Expect(2) = 2e-115, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S KS+W KW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGF ALAPTLGT++PVIGASG
Sbjct  290   QSPKSQWTKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTIIPVIGASG  349

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAG+V GSVA+AASFGAAGAGLTGSK+ARR G VDEFEFK IG+NHN+GRLAVE
Sbjct  350   FAAAASAAGTVAGSVAIAASFGAAGAGLTGSKMARRTGSVDEFEFKAIGENHNQGRLAVE  409

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             IL++GFVF+E DF  PWEG+ NNLERYALQWESK+L+AVS AI++WLTSSIAL +MK+GA
Sbjct  410   ILVSGFVFQEEDFISPWEGQNNNLERYALQWESKNLIAVSTAIQDWLTSSIALSMMKQGA  469

Query  906   MMTVLSSFLTALA  868
             M+TVLS+ +TALA
Sbjct  470   MLTVLSTLMTALA  482



>ref|XP_006340700.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Solanum tuberosum]
Length=679

 Score =   282 bits (722),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 131/160 (82%), Positives = 149/160 (93%), Gaps = 0/160 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W IAVDRSDKAG LLAEVLQKGLQG+RPVTLVGFSLGARVIFKCLQ+L+ S N +
Sbjct  513  FIDSKWAIAVDRSDKAGKLLAEVLQKGLQGNRPVTLVGFSLGARVIFKCLQVLSESENTS  572

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+++NWEA RKVVAGRF+N Y+TNDWMLGI FRASLL++GLAGIQP
Sbjct  573  GLVERVVLLGAPIAIKNMNWEAARKVVAGRFVNAYATNDWMLGIAFRASLLTRGLAGIQP  632

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPV  356
            VDVPG+ENVDVTELIDGHS+YLW +Q+IL+LL+LD YYPV
Sbjct  633  VDVPGIENVDVTELIDGHSSYLWATQKILDLLELDAYYPV  672


 Score =   160 bits (405),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS  AKW+R GIIGAAA+TGGTL+A+TGGLAAPAIAAGFGALAPTLGTLVPVIGASGF
Sbjct  311   SPKSSLAKWKRRGIIGAAAVTGGTLLAVTGGLAAPAIAAGFGALAPTLGTLVPVIGASGF  370

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AAVA AAGSV GSVAVAASFGAAGAGLTGSK+ARR+GDVDEFEFK IG+NHN+GRLAVE+
Sbjct  371   AAVAGAAGSVAGSVAVAASFGAAGAGLTGSKMARRIGDVDEFEFKAIGENHNQGRLAVEV  430

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             LI+G VF+E DF RPWEG+++N ERY LQWESK+L+AVS AI++WLTS +A+ELMKRGAM
Sbjct  431   LISGLVFKEEDFVRPWEGQHDNSERYVLQWESKNLIAVSTAIQDWLTSRLAMELMKRGAM  490

Query  903   MTVL  892
             MTV+
Sbjct  491   MTVI  494



>ref|XP_010316399.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Solanum lycopersicum]
Length=382

 Score =   281 bits (719),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 134/164 (82%), Positives = 149/164 (91%), Gaps = 1/164 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W IAVDRSDKAG LLAEVLQKGLQG+RPVTLVGFSLGARVIFKCLQ+LA S N +
Sbjct  216  FIDSKWAIAVDRSDKAGKLLAEVLQKGLQGNRPVTLVGFSLGARVIFKCLQVLAESANTS  275

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAPI I+ +NWEA RKVVAGRF+N Y+TNDWMLGI FRASLL++GLAGIQP
Sbjct  276  GLVERVVLLGAPIAIKSMNWEAARKVVAGRFVNAYTTNDWMLGIAFRASLLTRGLAGIQP  335

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYP-VFGR  347
            VDVPG+ENVDVTELIDGHS+YLW +Q+IL+LL LD YYP V GR
Sbjct  336  VDVPGIENVDVTELIDGHSSYLWATQKILDLLDLDAYYPVVLGR  379


 Score =   161 bits (408),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 169/185 (91%), Gaps = 0/185 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             + S KS  AKW+R GIIGAAA+TGGTL+A+TGGLAAPAIAAGF ALAPTLGTLVPVIGAS
Sbjct  12    SRSPKSSLAKWKRRGIIGAAAVTGGTLLAVTGGLAAPAIAAGFVALAPTLGTLVPVIGAS  71

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAAVA AAGS  GSVAVAASFGAAGAGLTGSK+ARRMGDVDEFEFK+IG+NHN+GRLAV
Sbjct  72    GFAAVAGAAGSAAGSVAVAASFGAAGAGLTGSKMARRMGDVDEFEFKSIGENHNQGRLAV  131

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             E+LI+G VF+E DF RPWEG+++N ERY LQWESK+L+AVS AI++WLTS +A+ELMKRG
Sbjct  132   EVLISGLVFKEEDFVRPWEGQHDNSERYVLQWESKNLIAVSTAIQDWLTSRLAMELMKRG  191

Query  909   AMMTV  895
             AMMTV
Sbjct  192   AMMTV  196



>ref|XP_010113393.1| hypothetical protein L484_026725 [Morus notabilis]
 gb|EXC35400.1| hypothetical protein L484_026725 [Morus notabilis]
Length=663

 Score =   270 bits (690),  Expect(2) = 7e-114, Method: Compositional matrix adjust.
 Identities = 127/166 (77%), Positives = 145/166 (87%), Gaps = 0/166 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIAVDRSDKAG LLAEVL KG  G+RPVTLVG+SLGARVIFKCLQ LA + NNA
Sbjct  496  FIDSKWTIAVDRSDKAGRLLAEVLLKGFHGNRPVTLVGYSLGARVIFKCLQFLAETENNA  555

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I+D  W A RK+VAGRF+N YSTNDW LG+ FRASLL+QGLAGIQP
Sbjct  556  ELVERVVLLGAPISIKDEKWGAARKMVAGRFVNAYSTNDWTLGVAFRASLLTQGLAGIQP  615

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRASR  338
            +DVPG+ENVDVT+LI+GHS+YLWT+Q I+ELL+LD YYPVF  + R
Sbjct  616  IDVPGIENVDVTDLIEGHSSYLWTTQRIIELLELDAYYPVFRGSKR  661


 Score =   170 bits (430),  Expect(2) = 7e-114, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +SS S+WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAG GALAPTLGTL+PVIGASG
Sbjct  293   QSSDSKWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGLGALAPTLGTLIPVIGASG  352

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A AAG+V GSVAVAASFGAAGAGLTGSK+ARR G+VDEFEF+ +G+NHN+GRLAVE
Sbjct  353   FAAAAGAAGTVAGSVAVAASFGAAGAGLTGSKMARRTGNVDEFEFRPLGENHNQGRLAVE  412

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             I+++GFVF++ DF RPWEG+ +NLERYALQWESK+L+AVS AI++WLTS IA+ELMK+GA
Sbjct  413   IMVSGFVFDKEDFVRPWEGQDDNLERYALQWESKNLIAVSTAIQDWLTSRIAMELMKQGA  472

Query  906   MMTVLSSFLTALA  868
             M+TVLS+ L ALA
Sbjct  473   MLTVLSTLLAALA  485



>emb|CDP01935.1| unnamed protein product [Coffea canephora]
Length=656

 Score =   266 bits (680),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 144/165 (87%), Gaps = 3/165 (2%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
            +FIDS+WTIA+DRSDKAG LLAEVL  GLQG+RPVTLVGFSLGARVIFKCLQ LA    +
Sbjct  491  NFIDSKWTIALDRSDKAGTLLAEVLLNGLQGNRPVTLVGFSLGARVIFKCLQTLAEKDRS  550

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AGLVERV+LLGAP+ I+DVNWEA RKVVAGRF+N YSTNDWMLGI FRASLL+QGLAGIQ
Sbjct  551  AGLVERVILLGAPLAIKDVNWEAARKVVAGRFVNAYSTNDWMLGIAFRASLLTQGLAGIQ  610

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRA  344
            PVDVPG   VDVTELIDGHS+YLW + +I+E L+LDT YPV  RA
Sbjct  611  PVDVPG---VDVTELIDGHSSYLWATPQIIEQLELDTPYPVLNRA  652


 Score =   172 bits (437),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +  +S W+KW+RGGIIGAAALTGGTL+AITGGLAAPAIAAGF ALAPTLGTLVPVIGASG
Sbjct  289   QPPRSSWSKWKRGGIIGAAALTGGTLLAITGGLAAPAIAAGFSALAPTLGTLVPVIGASG  348

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAAVA+AAG V GSVAVAASFGAAGAGLTG+K+ARRMGDVDEFEFK IGQNHN+GRLAVE
Sbjct  349   FAAVASAAGGVAGSVAVAASFGAAGAGLTGTKMARRMGDVDEFEFKAIGQNHNQGRLAVE  408

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+GFV EE DF +PWEG   NLERYALQWESKHL+AVS AI++WLTS I+ ELM++GA
Sbjct  409   ILISGFVCEEEDFVKPWEGIDGNLERYALQWESKHLLAVSTAIQDWLTSKISTELMRQGA  468

Query  906   MMTVLSSFLTALA  868
             M+TVLSS + ALA
Sbjct  469   MLTVLSSLVAALA  481



>ref|XP_008453712.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Cucumis melo]
Length=666

 Score =   273 bits (699),  Expect(2) = 5e-113, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIAVDRSDKAG +LA+VL KGLQG+RPVTLVG+SLGARVIFKCLQ LA +  NA
Sbjct  499  FIDSKWTIAVDRSDKAGRILADVLLKGLQGNRPVTLVGYSLGARVIFKCLQYLAETEKNA  558

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I+D NWEA RK+VAGRF+NVYSTNDWMLGI FRASLL+QGLAGIQP
Sbjct  559  ELVERVVLLGAPISIKDQNWEAARKMVAGRFVNVYSTNDWMLGIAFRASLLTQGLAGIQP  618

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRAS  341
            +DVPG+ENVDVT++I+GHS+YLW +++ILE L+L+TYYPVF  +S
Sbjct  619  IDVPGIENVDVTDVIEGHSSYLWATRQILEQLELETYYPVFRSSS  663


 Score =   163 bits (413),  Expect(2) = 5e-113, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             + + +S W KW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGF ALAPTLGT++PVIGAS
Sbjct  295   SPTKESNWNKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTIIPVIGAS  354

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+G +DEFEFK IG+NHN+GRLAV
Sbjct  355   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGSIDEFEFKAIGENHNQGRLAV  414

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EI ++GF F++ DF RPWEG  +NLERYALQWESK+++AVS AI++WLTS +A+ELMKRG
Sbjct  415   EITVSGFAFDDKDFIRPWEGLTDNLERYALQWESKNIIAVSTAIQDWLTSRLAMELMKRG  474

Query  909   AMMTVLSSFLTALA  868
             AMMTVLSS L ALA
Sbjct  475   AMMTVLSSLLVALA  488



>ref|XP_011653146.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Cucumis sativus]
 gb|KGN53277.1| hypothetical protein Csa_4G043930 [Cucumis sativus]
Length=673

 Score =   273 bits (698),  Expect(2) = 8e-113, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 150/165 (91%), Gaps = 0/165 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIAVDRSDKAG +LA+VL KGLQG+RPVTLVG+SLGARVIFKCLQ LA +  NA
Sbjct  506  FIDSKWTIAVDRSDKAGRILADVLLKGLQGNRPVTLVGYSLGARVIFKCLQYLAETEKNA  565

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVE+VVLLGAPI I+D NWEA RK+VAGRF+NVYSTNDWMLGI FRASLL+QGLAGIQP
Sbjct  566  ELVEKVVLLGAPISIKDQNWEAARKMVAGRFVNVYSTNDWMLGIAFRASLLTQGLAGIQP  625

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRAS  341
            +D+PG+ENVDVT++I+GHS+YLW +++ILE L+L+TYYPVF  +S
Sbjct  626  IDIPGIENVDVTDVIEGHSSYLWATRQILEQLELETYYPVFRSSS  670


 Score =   164 bits (414),  Expect(2) = 8e-113, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = -1

Query  1302  LGTLVPVIgasgfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTI  1123
             LGT++PVIGASGFAA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+G VDEFEFK I
Sbjct  351   LGTIIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGSVDEFEFKAI  410

Query  1122  GQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLT  943
             G+NHN+GRLAVEI ++GF F++ DF RPWEG  +NLERYALQWESK+++AVS AI++WLT
Sbjct  411   GENHNQGRLAVEITVSGFAFDDKDFVRPWEGLTDNLERYALQWESKNIIAVSTAIQDWLT  470

Query  942   SSIALELMKRGAMMTVLSSFLTALA  868
             S +A+ELMKRGAMMTVLSS L ALA
Sbjct  471   SRLAMELMKRGAMMTVLSSLLVALA  495



>ref|XP_010033460.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Eucalyptus grandis]
 gb|KCW53099.1| hypothetical protein EUGRSUZ_J02394 [Eucalyptus grandis]
Length=675

 Score =   262 bits (669),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 143/166 (86%), Gaps = 0/166 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA++RSDKAG LLAEVL KGLQG+RPVTL+G+SLGARVIFKCLQ LA +   A
Sbjct  509  FIDSKWTIAINRSDKAGKLLAEVLGKGLQGNRPVTLIGYSLGARVIFKCLQFLAETEQTA  568

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI IRD NW+A RK+V+GRFIN YSTNDWMLG+ FRAS+ +QGLAGIQ 
Sbjct  569  ELVERVVLLGAPISIRDENWKAARKMVSGRFINAYSTNDWMLGLAFRASMFTQGLAGIQA  628

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRASR  338
             D PG+ENVD+T+LI+GHS+YLW +Q+IL+ L+LDTYYP F   SR
Sbjct  629  TDHPGIENVDITDLIEGHSSYLWATQDILDRLELDTYYPTFRCPSR  674


 Score =   174 bits (441),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A+S K  WAKW+RGGIIGAAALTGG LMAITGGLAAPAIAAG  ALAPTLGTL+PVIGAS
Sbjct  305   AQSPKKSWAKWKRGGIIGAAALTGGALMAITGGLAAPAIAAGLSALAPTLGTLIPVIGAS  364

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+G VDEFEFK+IG+N N+GRLAV
Sbjct  365   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGGVDEFEFKSIGENQNQGRLAV  424

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EIL++GFVF+E DF +PW+G+ +NLERYALQWESKHL+AVS AI++WLTS +A+ELMK+G
Sbjct  425   EILVSGFVFDEEDFVKPWQGQNDNLERYALQWESKHLIAVSTAIQDWLTSRVAMELMKQG  484

Query  909   AMMTVLSSFLTALA  868
             AM+TVLS+ LTALA
Sbjct  485   AMLTVLSTLLTALA  498



>ref|XP_002533809.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28578.1| conserved hypothetical protein [Ricinus communis]
Length=713

 Score =   259 bits (662),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W++A+DRSDKAG LLAEVL KGLQG+RPVTLVG+SLGARVIFKCL+ LA +  NA
Sbjct  546  FIDSRWSVAIDRSDKAGKLLAEVLLKGLQGNRPVTLVGYSLGARVIFKCLETLAETERNA  605

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I++  W A RKVVAGRF+N YSTNDW+LG+ FRASLL+QGLAGIQP
Sbjct  606  EVVERVVLLGAPISIKNEKWAAARKVVAGRFVNAYSTNDWILGVAFRASLLTQGLAGIQP  665

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +DVPG+EN+DVT++I+GHS+YLW +Q++L+ L+LD YYPVF
Sbjct  666  IDVPGIENIDVTDIIEGHSSYLWATQKVLDKLELDAYYPVF  706


 Score =   176 bits (446),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S+KS+WAKW+RGGIIGAAA+TGGTL+AITGGLAAPAIAAGFGALAPTLGTL+PVIGASGF
Sbjct  344   STKSKWAKWKRGGIIGAAAITGGTLLAITGGLAAPAIAAGFGALAPTLGTLIPVIGASGF  403

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A+AAG+V GSVAVAASFGAAGAGL G+K+ARR G+VDEFEFK IG+NHN+GRLAVEI
Sbjct  404   AAAASAAGTVAGSVAVAASFGAAGAGLAGTKMARRTGNVDEFEFKAIGENHNQGRLAVEI  463

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GFVF+E DF RPWEG+ +NLERY LQWESK+L+AVS AI++WLTSSIAL LMK+GAM
Sbjct  464   LVSGFVFDEEDFIRPWEGQIDNLERYVLQWESKNLIAVSTAIQDWLTSSIALGLMKQGAM  523

Query  903   MTVLSSFLTALA  868
             MTVLS+ L ALA
Sbjct  524   MTVLSTLLAALA  535



>gb|KDO71087.1| hypothetical protein CISIN_1g006082mg [Citrus sinensis]
 gb|KDO71088.1| hypothetical protein CISIN_1g006082mg [Citrus sinensis]
 gb|KDO71089.1| hypothetical protein CISIN_1g006082mg [Citrus sinensis]
Length=662

 Score =   264 bits (674),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             IDS+WTIAVDRSDKAG LLAEVL +GLQG+RPVTL+G+SLGARVIFKCL+ LA +  NA
Sbjct  498  LIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNA  557

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VERVVLLGAPI I+D NWEAVRK+VAGRFIN Y+TNDW L I FRASLLSQGLAGIQP
Sbjct  558  GIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRASLLSQGLAGIQP  617

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRA  344
            ++  G+EN+DVT LI+GHS+YLW SQ ILE L+LDTYYPVF RA
Sbjct  618  INGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVFRRA  661


 Score =   167 bits (424),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A SS+S+WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGF ALAPTLGTL+PVIGAS
Sbjct  294   ATSSESKWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGAS  353

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+G VDEFEFK IG+N N+GRLAV
Sbjct  354   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAV  413

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EILI+G VF++ DF RPWEG+ +N+ERY LQWESK+L+AVS AI++WLTS IA+ELMK+G
Sbjct  414   EILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQG  473

Query  909   AMMTVLSSFLTALA  868
             AMMTVL + L ALA
Sbjct  474   AMMTVLKTLLAALA  487



>ref|XP_006425555.1| hypothetical protein CICLE_v10025097mg [Citrus clementina]
 ref|XP_006425556.1| hypothetical protein CICLE_v10025097mg [Citrus clementina]
 gb|ESR38795.1| hypothetical protein CICLE_v10025097mg [Citrus clementina]
 gb|ESR38796.1| hypothetical protein CICLE_v10025097mg [Citrus clementina]
Length=662

 Score =   264 bits (674),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             IDS+WTIAVDRSDKAG LLAEVL +GLQG+RPVTL+G+SLGARVIFKCL+ LA +  NA
Sbjct  498  LIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNA  557

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VERVVLLGAPI I+D NWEAVRK+VAGRFIN Y+TNDW L I FRASLLSQGLAGIQP
Sbjct  558  GIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRASLLSQGLAGIQP  617

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRA  344
            ++  G+EN+DVT LI+GHS+YLW SQ ILE L+LDTYYPVF RA
Sbjct  618  INGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVFRRA  661


 Score =   167 bits (424),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A SS+S+WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGF ALAPTLGTL+PVIGAS
Sbjct  294   ATSSESKWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGAS  353

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+G VDEFEFK IG+N N+GRLAV
Sbjct  354   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAV  413

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EILI+G VF++ DF RPWEG+ +N+ERY LQWESK+L+AVS AI++WLTS IA+ELMK+G
Sbjct  414   EILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQG  473

Query  909   AMMTVLSSFLTALA  868
             AMMTVL + L ALA
Sbjct  474   AMMTVLKTLLAALA  487



>ref|XP_006466894.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Citrus sinensis]
 ref|XP_006466895.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Citrus sinensis]
 ref|XP_006466896.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Citrus sinensis]
 ref|XP_006466897.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X4 [Citrus sinensis]
 ref|XP_006466898.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X5 [Citrus sinensis]
Length=662

 Score =   264 bits (674),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             IDS+WTIAVDRSDKAG LLAEVL +GLQG+RPVTL+G+SLGARVIFKCL+ LA +  NA
Sbjct  498  LIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNA  557

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VERVVLLGAPI I+D NWEAVRK+VAGRFIN Y+TNDW L I FRASLLSQGLAGIQP
Sbjct  558  GIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRASLLSQGLAGIQP  617

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRA  344
            ++  G+EN+DVT LI+GHS+YLW SQ ILE L+LDTYYPVF RA
Sbjct  618  INGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVFRRA  661


 Score =   167 bits (424),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A SS+S+WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGF ALAPTLGTL+PVIGAS
Sbjct  294   ATSSESKWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGAS  353

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+G VDEFEFK IG+N N+GRLAV
Sbjct  354   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAV  413

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EILI+G VF++ DF RPWEG+ +N+ERY LQWESK+L+AVS AI++WLTS IA+ELMK+G
Sbjct  414   EILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQG  473

Query  909   AMMTVLSSFLTALA  868
             AMMTVL + L ALA
Sbjct  474   AMMTVLKTLLAALA  487



>gb|KDO71090.1| hypothetical protein CISIN_1g006082mg [Citrus sinensis]
Length=518

 Score =   263 bits (673),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             IDS+WTIAVDRSDKAG LLAEVL +GLQG+RPVTL+G+SLGARVIFKCL+ LA +  NA
Sbjct  354  LIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNA  413

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VERVVLLGAPI I+D NWEAVRK+VAGRFIN Y+TNDW L I FRASLLSQGLAGIQP
Sbjct  414  GIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRASLLSQGLAGIQP  473

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRA  344
            ++  G+EN+DVT LI+GHS+YLW SQ ILE L+LDTYYPVF RA
Sbjct  474  INGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVFRRA  517


 Score =   167 bits (424),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A SS+S+WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGF ALAPTLGTL+PVIGAS
Sbjct  150   ATSSESKWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGAS  209

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+G VDEFEFK IG+N N+GRLAV
Sbjct  210   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAV  269

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EILI+G VF++ DF RPWEG+ +N+ERY LQWESK+L+AVS AI++WLTS IA+ELMK+G
Sbjct  270   EILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQG  329

Query  909   AMMTVLSSFLTALA  868
             AMMTVL + L ALA
Sbjct  330   AMMTVLKTLLAALA  343



>gb|KDO71091.1| hypothetical protein CISIN_1g006082mg [Citrus sinensis]
Length=389

 Score =   263 bits (672),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 144/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             IDS+WTIAVDRSDKAG LLAEVL +GLQG+RPVTL+G+SLGARVIFKCL+ LA +  NA
Sbjct  225  LIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNA  284

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VERVVLLGAPI I+D NWEAVRK+VAGRFIN Y+TNDW L I FRASLLSQGLAGIQP
Sbjct  285  GIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRASLLSQGLAGIQP  344

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRA  344
            ++  G+EN+DVT LI+GHS+YLW SQ ILE L+LDTYYPVF RA
Sbjct  345  INGLGIENIDVTHLIEGHSSYLWASQLILERLELDTYYPVFRRA  388


 Score =   168 bits (425),  Expect(2) = 3e-111, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A SS+S+WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGF ALAPTLGTL+PVIGAS
Sbjct  21    ATSSESKWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGAS  80

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+G VDEFEFK IG+N N+GRLAV
Sbjct  81    GFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAV  140

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EILI+G VF++ DF RPWEG+ +N+ERY LQWESK+L+AVS AI++WLTS IA+ELMK+G
Sbjct  141   EILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQG  200

Query  909   AMMTVLSSFLTALA  868
             AMMTVL + L ALA
Sbjct  201   AMMTVLKTLLAALA  214



>ref|XP_010271492.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Nelumbo nucifera]
Length=669

 Score =   268 bits (686),  Expect(2) = 4e-111, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 148/169 (88%), Gaps = 1/169 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAA-SGNN  659
            +IDS+WTIAVDRSDKAG LLAEVL KGLQG+RPVTL+ FSLGAR++FKCLQ LA    N 
Sbjct  494  YIDSKWTIAVDRSDKAGKLLAEVLVKGLQGNRPVTLIAFSLGARIVFKCLQCLAEIEDNG  553

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AG+VERVVLLGAPI IRD NW+ VR++VAGRF+N YSTNDW LGI FRASLLS+GLAGIQ
Sbjct  554  AGIVERVVLLGAPISIRDENWDTVRRMVAGRFVNAYSTNDWTLGIAFRASLLSEGLAGIQ  613

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRASR*D  332
            PV+V G+ENVDVTELI+GHS+YLWT+QEILE L+LDTYYP+F  + + D
Sbjct  614  PVEVQGIENVDVTELIEGHSSYLWTTQEILERLELDTYYPIFRSSDKSD  662


 Score =   162 bits (411),  Expect(2) = 4e-111, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -1

Query  1302  LGTLVPVIgasgfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTI  1123
             LGTLVPVIGASGFAA A+AAGSV GSVAVAASFG AGAGL+G K+ARR+GDVDEFEFK I
Sbjct  339   LGTLVPVIGASGFAAAASAAGSVAGSVAVAASFGVAGAGLSGMKMARRIGDVDEFEFKAI  398

Query  1122  GQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLT  943
             G NHN+GRLA+ ILI+G  FEE DF RPWEG  +NLERY LQWES++L+AVS AI++WLT
Sbjct  399   GPNHNQGRLAISILISGIAFEEEDFIRPWEGLEDNLERYVLQWESENLIAVSKAIQDWLT  458

Query  942   SSIALELMKRGAMMTVLSSFLTALA  868
             S I  ELMKRGAMMTVLSS +TALA
Sbjct  459   SKITSELMKRGAMMTVLSSLVTALA  483



>ref|XP_010271491.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Nelumbo nucifera]
Length=670

 Score =   267 bits (683),  Expect(2) = 7e-111, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN-  659
            +IDS+WTIAVDRSDKAG LLAEVL KGLQG+RPVTL+ FSLGAR++FKCLQ LA   +N 
Sbjct  494  YIDSKWTIAVDRSDKAGKLLAEVLVKGLQGNRPVTLIAFSLGARIVFKCLQCLAEIEDNG  553

Query  658  -AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGI  482
             AG+VERVVLLGAPI IRD NW+ VR++VAGRF+N YSTNDW LGI FRASLLS+GLAGI
Sbjct  554  AAGIVERVVLLGAPISIRDENWDTVRRMVAGRFVNAYSTNDWTLGIAFRASLLSEGLAGI  613

Query  481  QPVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRASR*D  332
            QPV+V G+ENVDVTELI+GHS+YLWT+QEILE L+LDTYYP+F  + + D
Sbjct  614  QPVEVQGIENVDVTELIEGHSSYLWTTQEILERLELDTYYPIFRSSDKSD  663


 Score =   163 bits (412),  Expect(2) = 7e-111, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = -1

Query  1302  LGTLVPVIgasgfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTI  1123
             LGTLVPVIGASGFAA A+AAGSV GSVAVAASFG AGAGL+G K+ARR+GDVDEFEFK I
Sbjct  339   LGTLVPVIGASGFAAAASAAGSVAGSVAVAASFGVAGAGLSGMKMARRIGDVDEFEFKAI  398

Query  1122  GQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLT  943
             G NHN+GRLA+ ILI+G  FEE DF RPWEG  +NLERY LQWES++L+AVS AI++WLT
Sbjct  399   GPNHNQGRLAISILISGIAFEEEDFIRPWEGLEDNLERYVLQWESENLIAVSKAIQDWLT  458

Query  942   SSIALELMKRGAMMTVLSSFLTALA  868
             S I  ELMKRGAMMTVLSS +TALA
Sbjct  459   SKITSELMKRGAMMTVLSSLVTALA  483



>ref|XP_011100949.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane and coiled-coil 
domain-containing protein 4-like [Sesamum indicum]
Length=661

 Score =   265 bits (676),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA+DRSDKAG LLAE L KGLQGHRPVTLVGFSLGARVIF+CLQ LA S  NA
Sbjct  494  FIDSKWTIAIDRSDKAGKLLAEALLKGLQGHRPVTLVGFSLGARVIFRCLQFLAESEANA  553

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VER VLLGAP+ I D NW A RKVVAGR++N YST DWMLGI FRASLL++GLAGIQP
Sbjct  554  GIVEREVLLGAPVAIEDENWGATRKVVAGRYVNAYSTKDWMLGIAFRASLLTKGLAGIQP  613

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V+VPG+ENVDVT++I+GHS+YLW SQ IL+ L+LDT+YPVF
Sbjct  614  VEVPGIENVDVTDIIEGHSSYLWGSQLILDQLELDTHYPVF  654


 Score =   164 bits (414),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S +S W KW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGT++PVIGASGF
Sbjct  292   SPESTWGKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGASGF  351

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AAVA+AAGSV GSVAVAASFGAAGAGL+G+K+ARR+G VDEFEFK IG+NHN+GRLAVEI
Sbjct  352   AAVASAAGSVAGSVAVAASFGAAGAGLSGTKMARRIGGVDEFEFKAIGENHNQGRLAVEI  411

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
              ++GF+FEE DF RPWE +++ LERYALQWES+HL+AVS AI++WLTSSIA E+MKRGAM
Sbjct  412   SVSGFIFEEEDFIRPWEEQHDKLERYALQWESQHLIAVSTAIQDWLTSSIAREVMKRGAM  471

Query  903   MTVLSSFLTALA  868
             MTVL +   ALA
Sbjct  472   MTVLGTLTAALA  483



>ref|XP_010679841.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Beta vulgaris subsp. vulgaris]
Length=671

 Score =   259 bits (663),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 145/161 (90%), Gaps = 1/161 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIAVDRSDKAG LLAEVL KGLQG+RPVTLVG+SLGARVIF+CL+ L+ +   A
Sbjct  505  FIDSKWTIAVDRSDKAGKLLAEVLLKGLQGNRPVTLVGYSLGARVIFRCLEFLSKT-EQA  563

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I+D NWEAVRKVVAGRFINVYS NDW+LGI FRASLLS+GLAGIQ 
Sbjct  564  NLVERVVLLGAPISIKDENWEAVRKVVAGRFINVYSRNDWILGIAFRASLLSKGLAGIQA  623

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V+VPG+ENVD T++I+GHS+YLW +QEI++ L+LDTY+PVF
Sbjct  624  VEVPGIENVDATDIIEGHSSYLWATQEIMDRLELDTYFPVF  664


 Score =   168 bits (426),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S KS WAKWRRGGIIGAAA+TGG LMAITGGLAAPAIAAGF AL PTLGT++PVIGA G
Sbjct  302   DSEKSSWAKWRRGGIIGAAAVTGGALMAITGGLAAPAIAAGFSALVPTLGTIIPVIGAGG  361

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+ AGSV GSVA+AASFGAAGAGLTG+KVARR+G++DEFEFK +G+NH +GRLAV 
Sbjct  362   FAAAASVAGSVAGSVAIAASFGAAGAGLTGTKVARRIGNIDEFEFKAVGENHGQGRLAVG  421

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             IL++GFVF+E D+  PWEG  NNLERY L WESKHL+AVS AI++WLTSSIAL LMK+GA
Sbjct  422   ILVSGFVFDEGDYIMPWEGLANNLERYVLVWESKHLIAVSTAIQDWLTSSIALGLMKQGA  481

Query  906   MMTVLSSFLTALA  868
             MMTVLS+ LTALA
Sbjct  482   MMTVLSTLLTALA  494



>gb|AES95070.2| transmembrane and coiled-coil protein [Medicago truncatula]
Length=672

 Score =   261 bits (666),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IA+DRSDKAG LLAEVL  GLQG+RPVTL+G+SLGARVIFKCL+ LA + N+A
Sbjct  505  FIDSTWSIAIDRSDKAGKLLAEVLLGGLQGNRPVTLIGYSLGARVIFKCLECLAETENHA  564

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I+DVNWEA RK+VAGRFIN YS  DWMLG+ FRASLLSQGLAGIQP
Sbjct  565  ELVERVVLLGAPIAIKDVNWEAARKMVAGRFINAYSRTDWMLGVAFRASLLSQGLAGIQP  624

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +D+PG++NVDVT+ I+GHS+YLW +Q+IL+ L+L+TYYPV+
Sbjct  625  IDIPGIQNVDVTDRIEGHSSYLWATQQILDELELETYYPVY  665


 Score =   167 bits (423),  Expect(2) = 3e-110, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A+S++S WAKW+RGGIIGAAALTGG LMAITGGLAAPAIAAG GALAPTLGTL+PVIGA 
Sbjct  301   AQSNESGWAKWKRGGIIGAAALTGGALMAITGGLAAPAIAAGLGALAPTLGTLIPVIGAG  360

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+G VDEFEF+ IG NHN+GRLAV
Sbjct  361   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRVGSVDEFEFRAIGDNHNQGRLAV  420

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EIL++GFVFEE DF RPWEG+ +NLERYALQWESK+L+AVS AI++WLTS IA+ELMK+G
Sbjct  421   EILVSGFVFEEDDFVRPWEGQNDNLERYALQWESKNLIAVSTAIQDWLTSRIAMELMKQG  480

Query  909   AMMTVLS  889
             AMMTVLS
Sbjct  481   AMMTVLS  487



>ref|XP_002869040.1| hypothetical protein ARALYDRAFT_912740 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45299.1| hypothetical protein ARALYDRAFT_912740 [Arabidopsis lyrata subsp. 
lyrata]
Length=550

 Score =   268 bits (684),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAEVLQKGLQG+RP+TLVGFSLGARVIFKCLQ LA +  NA
Sbjct  386  FIDSKWSIAIDRSDKAGRLLAEVLQKGLQGNRPITLVGFSLGARVIFKCLQALAETEQNA  445

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I + NW  VRK+VAGRFINVY+TNDW LGI FRASL SQGLAGIQP
Sbjct  446  ELVERVVLLGAPISINNENWRDVRKMVAGRFINVYATNDWTLGIAFRASLFSQGLAGIQP  505

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + +PG+ENVDVT++++GHS+YLW +Q+ILE L++DTYYPVF
Sbjct  506  ICIPGIENVDVTDMVEGHSSYLWKTQQILERLEIDTYYPVF  546


 Score =   160 bits (404),  Expect(2) = 4e-110, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 174/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A S+ + WAKW+RGGIIGAAA+TGGTLMAITGGLAAPAIAAGFGALAPTLGTL+PVIGA 
Sbjct  182   ALSTTTSWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALAPTLGTLIPVIGAG  241

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+GD+DEFEFK IG+NHN+GRLAV
Sbjct  242   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLDEFEFKAIGENHNQGRLAV  301

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             E+L+ G VFEE DF +PWEG  +NLERY LQWESK+L+ VS AI++WLTS +A+ELMK+G
Sbjct  302   EVLVAGVVFEEEDFVKPWEGLTSNLERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQG  361

Query  909   AMMTVLSSFLTALA  868
             AM TVL+S L ALA
Sbjct  362   AMHTVLASLLMALA  375



>ref|XP_009411496.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Musa acuminata subsp. malaccensis]
Length=685

 Score =   265 bits (678),  Expect(2) = 6e-110, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAEVL KGLQG+RPVTL+GFSLGARVI+KCLQ LA SG+N 
Sbjct  507  FIDSKWSIAIDRSDKAGKLLAEVLLKGLQGNRPVTLIGFSLGARVIYKCLQALAVSGDNE  566

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   W+  RKVVAGRFINVYSTNDW+LG+ FRASL SQGLAGIQP
Sbjct  567  GLVERVVLLGAPLSVKGEQWDIARKVVAGRFINVYSTNDWILGVAFRASLFSQGLAGIQP  626

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +D+PGVEN+D T+ IDGHS+YLWTS+ ILE L+LD Y+PVF
Sbjct  627  IDIPGVENIDATDYIDGHSSYLWTSRRILEQLELDAYFPVF  667


 Score =   161 bits (408),  Expect(2) = 6e-110, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             +ES+KS+W+KW+RGGIIGAAALTGG L+AITGGLAAPAIAAGF ALAPTLGTLVP++GAS
Sbjct  303   SESTKSKWSKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFSALAPTLGTLVPIVGAS  362

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA+A+AAGSV GSVAVAASFGAAGAGLTGSK+ARR+G ++EF+FK IG+NHN+GRL V
Sbjct  363   GFAAIASAAGSVAGSVAVAASFGAAGAGLTGSKMARRIGGIEEFDFKQIGENHNQGRLGV  422

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
              I ++GFVF+E DF RPWEG  +NLERY LQWESK+L+++S AI++WLTS +A+ LMK+G
Sbjct  423   GIFVSGFVFQEEDFVRPWEGPKDNLERYVLQWESKNLISLSTAIQDWLTSRLAMGLMKQG  482

Query  909   AMMTVLSSFLTALA  868
             AMMTVLS+ +TALA
Sbjct  483   AMMTVLSTLITALA  496



>ref|XP_010526787.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526788.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Tarenaya hassleriana]
 ref|XP_010526789.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Tarenaya hassleriana]
Length=693

 Score =   256 bits (653),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG LLAEVL KGLQG+RPVTLVG+SLGARVIFKCLQ LA +  NA
Sbjct  529  FIDSKWSVAIDRSDKAGRLLAEVLLKGLQGNRPVTLVGYSLGARVIFKCLQALAETEENA  588

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I +  W+ VRK+VAGRFINVY+TNDW LG+ FRASL SQGLAGIQP
Sbjct  589  EIVERVVLLGAPISINNETWQEVRKMVAGRFINVYATNDWTLGVAFRASLFSQGLAGIQP  648

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + +PG+ENVDVT+ ++GHS+YLW +Q+ILE L+LD YYPVF
Sbjct  649  IRLPGIENVDVTDTVEGHSSYLWKTQQILESLELDAYYPVF  689


 Score =   169 bits (429),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S +SRWAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGASGF
Sbjct  327   SPQSRWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGASGF  386

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+GD+DEFEFK IG++HN+GRLAVE+
Sbjct  387   AAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGDIDEFEFKAIGEHHNEGRLAVEV  446

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GFVF+E DF RPWEG ++NLERY LQWE+K+L+AVS AI++WLTS +ALELMK+GAM
Sbjct  447   LVSGFVFKEEDFVRPWEGLHDNLERYTLQWETKNLVAVSTAIQDWLTSRLALELMKQGAM  506

Query  903   MTVLSSFLTALA  868
              TVLS+ L ALA
Sbjct  507   HTVLSTLLAALA  518



>ref|XP_010526790.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X2 [Tarenaya hassleriana]
Length=690

 Score =   256 bits (653),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG LLAEVL KGLQG+RPVTLVG+SLGARVIFKCLQ LA +  NA
Sbjct  526  FIDSKWSVAIDRSDKAGRLLAEVLLKGLQGNRPVTLVGYSLGARVIFKCLQALAETEENA  585

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I +  W+ VRK+VAGRFINVY+TNDW LG+ FRASL SQGLAGIQP
Sbjct  586  EIVERVVLLGAPISINNETWQEVRKMVAGRFINVYATNDWTLGVAFRASLFSQGLAGIQP  645

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + +PG+ENVDVT+ ++GHS+YLW +Q+ILE L+LD YYPVF
Sbjct  646  IRLPGIENVDVTDTVEGHSSYLWKTQQILESLELDAYYPVF  686


 Score =   169 bits (429),  Expect(2) = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S +SRWAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGASGF
Sbjct  324   SPQSRWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGASGF  383

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+GD+DEFEFK IG++HN+GRLAVE+
Sbjct  384   AAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGDIDEFEFKAIGEHHNEGRLAVEV  443

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GFVF+E DF RPWEG ++NLERY LQWE+K+L+AVS AI++WLTS +ALELMK+GAM
Sbjct  444   LVSGFVFKEEDFVRPWEGLHDNLERYTLQWETKNLVAVSTAIQDWLTSRLALELMKQGAM  503

Query  903   MTVLSSFLTALA  868
              TVLS+ L ALA
Sbjct  504   HTVLSTLLAALA  515



>ref|NP_001078500.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE86635.1| uncharacterized protein AT4G36210 [Arabidopsis thaliana]
Length=672

 Score =   267 bits (682),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAEVLQKGLQG+RP+TLVGFSLGARVIFKCLQ LA +  NA
Sbjct  508  FIDSKWSIAIDRSDKAGRLLAEVLQKGLQGNRPITLVGFSLGARVIFKCLQALAETEQNA  567

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I   NW  VRK+VAGRFINVY+TNDW LGI FRASL+SQGLAGIQP
Sbjct  568  ELVERVVLLGAPISINSENWRDVRKMVAGRFINVYATNDWTLGIAFRASLISQGLAGIQP  627

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + +PG+ENVDVT++++GHS+YLW +Q+ILE L++DTYYPVF
Sbjct  628  ICIPGIENVDVTDMVEGHSSYLWKTQQILERLEIDTYYPVF  668


 Score =   158 bits (399),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             +  + WAKW+RGGIIGAAA+TGGTLMAITGGLAAPAIAAGFGALAPTLGT++PVIGA GF
Sbjct  306   TPTTSWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGAGGF  365

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+GD+DEFEFK IG+NHN+GRLAVE+
Sbjct  366   AAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLDEFEFKAIGENHNQGRLAVEV  425

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ G VFEE DF +PWEG  +NLERY LQWESK+L+ VS AI++WLTS +A+ELMK+GAM
Sbjct  426   LVAGVVFEEEDFVKPWEGLTSNLERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQGAM  485

Query  903   MTVLSSFLTALA  868
              TVL+S L ALA
Sbjct  486   HTVLASLLMALA  497



>ref|XP_010446814.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=672

 Score =   265 bits (678),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG +LAE LQKGLQG+RP+TLVGFSLGARVIFKCLQ LA +  NA
Sbjct  508  FIDSKWSIAIDRSDKAGRVLAEALQKGLQGNRPITLVGFSLGARVIFKCLQTLAETEQNA  567

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I + NW  VRK+VAGRFINVY+TNDW LGI FRASL SQGLAGIQP
Sbjct  568  DLVERVVLLGAPISINNENWRDVRKMVAGRFINVYATNDWTLGIAFRASLFSQGLAGIQP  627

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + +PG+ENVDVT++++GHS+YLW +Q+ILE L++DTYYPVF
Sbjct  628  ICIPGIENVDVTDMVEGHSSYLWKTQQILERLEIDTYYPVF  668


 Score =   159 bits (403),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A S  S WAKW+RGGIIGAAA+TGGTLMAITGGLAAPAIAAGFGALAPTLGT++PVIGA 
Sbjct  304   ALSPSSSWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGAG  363

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+GD+DEFEFK IG+NHN+GRLAV
Sbjct  364   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLDEFEFKAIGENHNQGRLAV  423

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             E+LI G VFEE DF +PWEG  +N+ERY LQWESK+L+ VS AI++WLTS +A+ELMK+G
Sbjct  424   EVLIAGVVFEEEDFVKPWEGLTSNMERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQG  483

Query  909   AMMTVLSSFLTALA  868
             AM TVL+S L ALA
Sbjct  484   AMHTVLASLLMALA  497



>ref|XP_008241785.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Prunus mume]
Length=713

 Score =   260 bits (665),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W IAVDRSDKAG LLAEVL KG+ G+RPVTLVGFSLGARVIFKCLQ LA +  NA
Sbjct  546  FIDSKWAIAVDRSDKAGRLLAEVLLKGIHGNRPVTLVGFSLGARVIFKCLQCLAETEKNA  605

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I D  WEA RK+VAGRF+N YSTNDWMLGI FRASLLS+GLAGIQP
Sbjct  606  ELVERVVLLGAPISITDEKWEAARKMVAGRFVNAYSTNDWMLGIAFRASLLSRGLAGIQP  665

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + V G+ENVDVT++ID HS+YLW +Q+IL+LL+L+ YYPVF
Sbjct  666  IKVEGIENVDVTDVIDAHSSYLWGAQQILDLLELEAYYPVF  706


 Score =   164 bits (415),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S K++WAKW+RGGIIGAAA+TGGTL+ ITGGLAAPAIAAG GALAPTLGTL+P+IGASG
Sbjct  343   QSPKNKWAKWKRGGIIGAAAITGGTLLTITGGLAAPAIAAGLGALAPTLGTLIPIIGASG  402

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAG+V GSV VAASFGAAGAGLTGSK+ARR G VDEFEF  IG+NHN+GRLAVE
Sbjct  403   FAAAASAAGTVAGSVVVAASFGAAGAGLTGSKMARRTGSVDEFEFSAIGENHNQGRLAVE  462

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             IL++GFVF++ DF RPWEG+ +NLERYAL WESK+L+AVS AI++WLTS IA+ LMK+GA
Sbjct  463   ILVSGFVFDKEDFVRPWEGQDDNLERYALVWESKNLIAVSTAIQDWLTSRIAMGLMKQGA  522

Query  906   MMTVLSSFLTALA  868
             MMTVL + +TALA
Sbjct  523   MMTVLGTLVTALA  535



>ref|NP_849505.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE86633.1| uncharacterized protein AT4G36210 [Arabidopsis thaliana]
Length=550

 Score =   267 bits (682),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAEVLQKGLQG+RP+TLVGFSLGARVIFKCLQ LA +  NA
Sbjct  386  FIDSKWSIAIDRSDKAGRLLAEVLQKGLQGNRPITLVGFSLGARVIFKCLQALAETEQNA  445

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I   NW  VRK+VAGRFINVY+TNDW LGI FRASL+SQGLAGIQP
Sbjct  446  ELVERVVLLGAPISINSENWRDVRKMVAGRFINVYATNDWTLGIAFRASLISQGLAGIQP  505

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + +PG+ENVDVT++++GHS+YLW +Q+ILE L++DTYYPVF
Sbjct  506  ICIPGIENVDVTDMVEGHSSYLWKTQQILERLEIDTYYPVF  546


 Score =   157 bits (398),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             +  + WAKW+RGGIIGAAA+TGGTLMAITGGLAAPAIAAGFGALAPTLGT++PVIGA GF
Sbjct  184   TPTTSWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGAGGF  243

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+GD+DEFEFK IG+NHN+GRLAVE+
Sbjct  244   AAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLDEFEFKAIGENHNQGRLAVEV  303

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ G VFEE DF +PWEG  +NLERY LQWESK+L+ VS AI++WLTS +A+ELMK+GAM
Sbjct  304   LVAGVVFEEEDFVKPWEGLTSNLERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQGAM  363

Query  903   MTVLSSFLTALA  868
              TVL+S L ALA
Sbjct  364   HTVLASLLMALA  375



>ref|XP_007204629.1| hypothetical protein PRUPE_ppa002119mg [Prunus persica]
 gb|EMJ05828.1| hypothetical protein PRUPE_ppa002119mg [Prunus persica]
Length=713

 Score =   260 bits (665),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W IAVDRSDKAG LLAEVL KG+ G+RPVTLVGFSLGARVIFKCLQ LA +  NA
Sbjct  546  FIDSKWAIAVDRSDKAGRLLAEVLLKGIHGNRPVTLVGFSLGARVIFKCLQCLAETEKNA  605

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I D  WEA RK+VAGRF+N YSTNDWMLGI FRASLLS+GLAGIQP
Sbjct  606  ELVERVVLLGAPISIADEKWEAARKMVAGRFVNAYSTNDWMLGIAFRASLLSRGLAGIQP  665

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + V G+ENVDVT++ID HS+YLW +Q+IL+LL+L+ YYPVF
Sbjct  666  IKVEGIENVDVTDVIDAHSSYLWGAQQILDLLELEAYYPVF  706


 Score =   164 bits (415),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S K++WAKW+RGGIIGAAA+TGGTL+ ITGGLAAPAIAAG GALAPTLGTL+P+IGASG
Sbjct  343   QSPKNKWAKWKRGGIIGAAAITGGTLLTITGGLAAPAIAAGLGALAPTLGTLIPIIGASG  402

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAG+V GSV VAASFGAAGAGLTGSK+ARR G VDEFEF  IG+NHN+GRLAVE
Sbjct  403   FAAAASAAGTVAGSVVVAASFGAAGAGLTGSKMARRTGSVDEFEFSAIGENHNQGRLAVE  462

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             IL++GFVF++ DF RPWEG+ +NLERYAL WESK+L+AVS AI++WLTS IA+ LMK+GA
Sbjct  463   ILVSGFVFDKEDFVRPWEGQDDNLERYALVWESKNLIAVSTAIQDWLTSRIAMGLMKQGA  522

Query  906   MMTVLSSFLTALA  868
             MMTVL + +TALA
Sbjct  523   MMTVLGTLVTALA  535



>ref|XP_010432190.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=729

 Score =   265 bits (676),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG +LAE LQKGLQG+RP+TLVGFSLGARVIFKCLQ LA +  NA
Sbjct  565  FIDSKWSIAIDRSDKAGRVLAEALQKGLQGNRPITLVGFSLGARVIFKCLQTLAETEQNA  624

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I + NW  VRK+VAGRFINVY+TNDW LGI FRASL SQGLAGIQP
Sbjct  625  DLVERVVLLGAPISINNENWRDVRKMVAGRFINVYATNDWTLGIAFRASLFSQGLAGIQP  684

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + +PG+ENVDVT++++GHS+YLW +Q+ILE L++DTYYPVF
Sbjct  685  ICIPGIENVDVTDMVEGHSSYLWKTQQILERLEIDTYYPVF  725


 Score =   159 bits (403),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A S  S WAKW+RGGIIGAAA+TGGTLMAITGGLAAPAIAAGFGALAPTLGT++PVIGA 
Sbjct  361   ALSPTSSWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGAG  420

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+GD+DEFEFK IG+NHN+GRLAV
Sbjct  421   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLDEFEFKAIGENHNQGRLAV  480

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             E+LI G VFEE DF +PWEG  +N+ERY LQWESK+L+ VS AI++WLTS +A+ELMK+G
Sbjct  481   EVLIAGVVFEEEDFVKPWEGLTSNMERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQG  540

Query  909   AMMTVLSSFLTALA  868
             AM TVL+S L ALA
Sbjct  541   AMHTVLASLLMALA  554



>ref|XP_010437365.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=672

 Score =   265 bits (677),  Expect(2) = 6e-109, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG +LAE LQKGLQG+RP+TLVGFSLGARVIFKCLQ LA +  NA
Sbjct  508  FIDSKWSIAIDRSDKAGRVLAEALQKGLQGNRPITLVGFSLGARVIFKCLQTLAETEQNA  567

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I + NW  VRK+VAGRFINVY+TNDW LGI FRASL SQGLAGIQP
Sbjct  568  DLVERVVLLGAPISINNENWRDVRKMVAGRFINVYATNDWTLGIAFRASLFSQGLAGIQP  627

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + +PG+ENVDVT++++GHS+YLW +Q+ILE L++DTYYPVF
Sbjct  628  ICIPGIENVDVTDMVEGHSSYLWKTQQILERLEIDTYYPVF  668


 Score =   158 bits (400),  Expect(2) = 6e-109, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 173/194 (89%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A S  S WAKW+RGGIIGAAA+TGGTLMAITGGLAAPAIAAGFGALAPTLGT++PVIGA 
Sbjct  304   ALSPTSSWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGAG  363

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+GD+DEFEFK IG+NHN+GRLAV
Sbjct  364   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLDEFEFKAIGENHNQGRLAV  423

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             E+LI G VF+E DF +PWEG  +N+ERY LQWESK+L+ VS AI++WLTS +A+ELMK+G
Sbjct  424   EVLIAGVVFDEEDFVKPWEGLTSNMERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQG  483

Query  909   AMMTVLSSFLTALA  868
             AM TVL+S L ALA
Sbjct  484   AMHTVLASLLMALA  497



>ref|NP_001048731.1| Os03g0112800 [Oryza sativa Japonica Group]
 gb|ABF93614.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF10645.1| Os03g0112800 [Oryza sativa Japonica Group]
 gb|EAZ25332.1| hypothetical protein OsJ_09144 [Oryza sativa Japonica Group]
 dbj|BAG94661.1| unnamed protein product [Oryza sativa Japonica Group]
Length=661

 Score =   261 bits (666),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LAEVL KGLQG+RPVTL+GFSLGARVIFKCLQ LA S +N 
Sbjct  485  FIDSKWSVAIDRSDKAGKMLAEVLLKGLQGNRPVTLIGFSLGARVIFKCLQELALSSDNE  544

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WEA RK+VAGRF+NVYST+DW+LG+ FRASLL+QGLAGIQ 
Sbjct  545  GLVERVVLLGAPVSVKGERWEAARKMVAGRFVNVYSTDDWILGVTFRASLLTQGLAGIQA  604

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +DVPGVENVDVTEL+DGHS+YL  +Q+ILE L+L+TYYPVF
Sbjct  605  IDVPGVENVDVTELVDGHSSYLSAAQQILEHLELNTYYPVF  645


 Score =   162 bits (410),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS+W KW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGTLVPVIGASGF
Sbjct  283   SPKSKWEKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTLVPVIGASGF  342

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+ATAAGSV GSVAVAASFGAAGAGLTGSK+ARR+G V EFEFK IG+NHN+GRLAV I
Sbjct  343   AAMATAAGSVAGSVAVAASFGAAGAGLTGSKMARRIGSVKEFEFKPIGENHNQGRLAVGI  402

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             LI+GF F+E DF RPWEG  +NLERY LQWESKH++AVS AI++WLTS +A+ELMK+GAM
Sbjct  403   LISGFAFDEDDFCRPWEGWQDNLERYILQWESKHIIAVSTAIQDWLTSRLAMELMKQGAM  462

Query  903   MTVLSSFLTALA  868
              TVLS  L A A
Sbjct  463   RTVLSGLLAAFA  474



>gb|EAY88253.1| hypothetical protein OsI_09705 [Oryza sativa Indica Group]
Length=661

 Score =   261 bits (666),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LAEVL KGLQG+RPVTL+GFSLGARVIFKCLQ LA S +N 
Sbjct  485  FIDSKWSVAIDRSDKAGKMLAEVLLKGLQGNRPVTLIGFSLGARVIFKCLQELALSSDNE  544

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WEA RK+VAGRF+NVYST+DW+LG+ FRASLL+QGLAGIQ 
Sbjct  545  GLVERVVLLGAPVSVKGERWEAARKMVAGRFVNVYSTDDWILGVTFRASLLTQGLAGIQA  604

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +DVPGVENVDVTEL+DGHS+YL  +Q+ILE L+L+TYYPVF
Sbjct  605  IDVPGVENVDVTELVDGHSSYLSAAQQILEHLELNTYYPVF  645


 Score =   162 bits (409),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS+W KW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGTLVPVIGASGF
Sbjct  283   SPKSKWEKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTLVPVIGASGF  342

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+ATAAGSV GSVAVAASFGAAGAGLTGSK+ARR+G V EFEFK IG+NHN+GRLAV I
Sbjct  343   AAMATAAGSVAGSVAVAASFGAAGAGLTGSKMARRIGSVKEFEFKPIGENHNQGRLAVGI  402

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             LI+GF F+E DF RPWEG  +NLERY LQWESKH++AVS AI++WLTS +A+ELMK+GAM
Sbjct  403   LISGFAFDEDDFCRPWEGWQDNLERYILQWESKHIIAVSTAIQDWLTSRLAMELMKQGAM  462

Query  903   MTVLSSFLTALA  868
              TVLS  L A A
Sbjct  463   RTVLSGLLAAFA  474



>ref|XP_004509335.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Cicer arietinum]
Length=697

 Score =   259 bits (663),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA++RS+KAG LLAEVL KGLQG+RPVTLVG+SLGARVIFKCLQ LA + N A
Sbjct  513  FIDSKWTIAINRSNKAGKLLAEVLLKGLQGNRPVTLVGYSLGARVIFKCLQCLAQTENGA  572

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I+D NWEA RK+VAGRF+N YS  DWMLG+ FRASLL++GLAGI+P
Sbjct  573  ELVERVVLLGAPIPIKDENWEAARKMVAGRFVNAYSRKDWMLGVAFRASLLTKGLAGIEP  632

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            VD+PG++NVDVT+ I+GHS+YLW +Q+IL+ LQLDTY+PV+
Sbjct  633  VDIPGIQNVDVTDYIEGHSSYLWATQQILDQLQLDTYFPVY  673


 Score =   163 bits (412),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  1302  LGTLVPVIgasgfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTI  1123
             LGTL+PVIGASGFAA A AAG+V GSVAVAASFGAAGAGLTGSK+ARR+G VDEF+FK I
Sbjct  358   LGTLIPVIGASGFAAAAGAAGTVAGSVAVAASFGAAGAGLTGSKMARRVGGVDEFDFKPI  417

Query  1122  GQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLT  943
             G+NHN+GRL VEILI+GFVFE+ DF RPWEG  +NLERY+LQWESK+L+AVS AI++WLT
Sbjct  418   GENHNQGRLGVEILISGFVFEKEDFIRPWEGLNDNLERYSLQWESKNLIAVSTAIQDWLT  477

Query  942   SSIALELMKRGAMMTVLSSFLTALA  868
             S +A++LMK+GAMMTVLS+ +TALA
Sbjct  478   SRLAMQLMKQGAMMTVLSTLVTALA  502



>ref|XP_010933751.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Elaeis guineensis]
Length=673

 Score =   262 bits (669),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WT+A+DRSDKAG LLAEVL KGLQG+RPVTL+GFSLGARVIF+CL+ LA SG+N 
Sbjct  505  FIDSKWTMAIDRSDKAGKLLAEVLSKGLQGNRPVTLIGFSLGARVIFRCLRKLAESGDNE  564

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WE  RK+VAGRF+NVYSTNDW+LG+ FRASLL+QGLAGIQ 
Sbjct  565  GLVERVVLLGAPVSVKGEQWEIARKIVAGRFVNVYSTNDWILGVTFRASLLTQGLAGIQA  624

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            VDVPG+ENVDVT+ IDGHS+YL   Q+ILE L+LDTYYPVF
Sbjct  625  VDVPGIENVDVTDFIDGHSSYLSGVQQILEQLELDTYYPVF  665


 Score =   160 bits (405),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             ++S KS+WA+W+RGGIIGAAALTGG L+AITGGLAAPAIAAGF ALAPTLGTLVPVIGAS
Sbjct  301   SQSEKSKWARWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFSALAPTLGTLVPVIGAS  360

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA+A+AAGSV GSVAVAASFGAAGAGL+GSK+ARR G V+EFEFK IG NHN+GRLAV
Sbjct  361   GFAAIASAAGSVAGSVAVAASFGAAGAGLSGSKMARRTGSVEEFEFKPIGDNHNQGRLAV  420

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
              IL+TGF FE+ DF +PWEG  +NLERY LQWESK+++AVS AI++W+TSS+ + LMK+G
Sbjct  421   GILVTGFAFEKEDFIKPWEGLEDNLERYVLQWESKYIIAVSTAIQDWITSSVTMGLMKQG  480

Query  909   AMMTVLSSFLTALA  868
             AM+TVLS+ ++ALA
Sbjct  481   AMLTVLSTLVSALA  494



>ref|XP_007156109.1| hypothetical protein PHAVU_003G259400g [Phaseolus vulgaris]
 gb|ESW28103.1| hypothetical protein PHAVU_003G259400g [Phaseolus vulgaris]
Length=668

 Score =   260 bits (664),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA+ RS+KAG LLAEVL KGLQG+RPVTL+G+SLGARVIFKCLQ LA + N+A
Sbjct  501  FIDSKWTIAISRSNKAGKLLAEVLLKGLQGNRPVTLIGYSLGARVIFKCLQCLAKTENSA  560

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I+D NWEA RK+VAGRF+N YS NDWMLG+ FRASLL++GLAGIQP
Sbjct  561  ELVERVVLLGAPIPIKDENWEAARKMVAGRFVNAYSRNDWMLGLAFRASLLTKGLAGIQP  620

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRAS  341
            VD+PG++NVDVT+ I+GHS+YLW +  IL+ LQLDTYYPV+   S
Sbjct  621  VDIPGIQNVDVTDHIEGHSSYLWATPRILDQLQLDTYYPVYNNIS  665


 Score =   161 bits (408),  Expect(2) = 2e-108, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  1302  LGTLVPVIgasgfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTI  1123
             LGTL+PVIGASGFAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+G VDEFEFK I
Sbjct  346   LGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRVGGVDEFEFKAI  405

Query  1122  GQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLT  943
             G+NHN+GRL VEIL++GFVFE+ DF RPWEG  +NLERYALQWESK+L+AVS AI++WLT
Sbjct  406   GENHNQGRLGVEILVSGFVFEKEDFIRPWEGCNDNLERYALQWESKNLIAVSTAIQDWLT  465

Query  942   SSIALELMKRGAMMTVLSS  886
             S +A+ELMKRGAMMTVLSS
Sbjct  466   SRLAMELMKRGAMMTVLSS  484



>ref|XP_003520272.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Glycine max]
Length=680

 Score =   259 bits (663),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA++RS+KAG LLAEVL KGLQG+RPVTL+G+SLGARVIFKCLQ LA + N A
Sbjct  511  FIDSKWTIAINRSNKAGKLLAEVLLKGLQGNRPVTLIGYSLGARVIFKCLQYLAKTENGA  570

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVE+VVLLGAPI I D NWEA RK+VAGRF+N YS  DWMLG+ FRASLL++GLAGIQP
Sbjct  571  ELVEKVVLLGAPIPIMDENWEATRKMVAGRFVNAYSRTDWMLGVAFRASLLTKGLAGIQP  630

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            VD+PG++NVDVTE I+GHS+YLW +Q+IL+ LQLDTYYPV+
Sbjct  631  VDIPGIQNVDVTEHIEGHSSYLWATQKILDQLQLDTYYPVY  671


 Score =   162 bits (410),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  1302  LGTLVPVIgasgfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTI  1123
             LGTL+PVIGASGFAA A AAG+V GSVAVAASFGAAGAGLTGSK+ARR+G VDEFEFK I
Sbjct  356   LGTLIPVIGASGFAAAAGAAGTVAGSVAVAASFGAAGAGLTGSKMARRVGGVDEFEFKAI  415

Query  1122  GQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLT  943
             G+NHN+GRL VEIL++GFVFE+ DF RPWEG+ +NLERYALQWES++L+AVS AI++WLT
Sbjct  416   GENHNQGRLGVEILVSGFVFEKEDFIRPWEGQNDNLERYALQWESENLIAVSTAIQDWLT  475

Query  942   SSIALELMKRGAMMTVLSS  886
             S +A+ELMKRGAMMTVLSS
Sbjct  476   SKLAMELMKRGAMMTVLSS  494



>ref|XP_003517195.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Glycine max]
Length=667

 Score =   265 bits (678),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
             FIDS WTIA+DRSDKAG LLAEVL  GLQG+RPVTLVG+SLGARVIFKCL+ LA + N+
Sbjct  499  EFIDSTWTIAIDRSDKAGKLLAEVLLGGLQGNRPVTLVGYSLGARVIFKCLEFLAETENS  558

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            A LVERVVLLGAPI I+D NWEA RK+VAGRF+N YS NDWMLG+ FRASLLSQGLAGIQ
Sbjct  559  AELVERVVLLGAPIAIKDENWEAARKMVAGRFVNAYSRNDWMLGVAFRASLLSQGLAGIQ  618

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGR  347
            PVD+PG++NVDVT+ I+GHS+YLW +Q++L+ L+LDTYYPV+ +
Sbjct  619  PVDIPGIQNVDVTDHIEGHSSYLWATQQVLDELELDTYYPVYNK  662


 Score =   156 bits (394),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S + +WAKW+RGGIIGAAALTGGTLMA+TGGLAAPAIAAG GALAPTLGTL+PVIGASG
Sbjct  297   QSKEDKWAKWKRGGIIGAAALTGGTLMAVTGGLAAPAIAAGLGALAPTLGTLIPVIGASG  356

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+GDV+EFEFK +G+NHN+GRL VE
Sbjct  357   FAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRVGDVEEFEFKAVGENHNQGRLGVE  416

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             I+I+GFVFE+ DF RPWEG  +NLERYAL+WESK+L A+S AI++WLTS IA ELMK+GA
Sbjct  417   IMISGFVFEDDDFIRPWEGLDDNLERYALKWESKNLFALSTAIQDWLTSRIATELMKQGA  476

Query  906   MMTVL  892
             MMTVL
Sbjct  477   MMTVL  481



>ref|XP_007156108.1| hypothetical protein PHAVU_003G259400g [Phaseolus vulgaris]
 gb|ESW28102.1| hypothetical protein PHAVU_003G259400g [Phaseolus vulgaris]
Length=528

 Score =   260 bits (664),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA+ RS+KAG LLAEVL KGLQG+RPVTL+G+SLGARVIFKCLQ LA + N+A
Sbjct  361  FIDSKWTIAISRSNKAGKLLAEVLLKGLQGNRPVTLIGYSLGARVIFKCLQCLAKTENSA  420

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I+D NWEA RK+VAGRF+N YS NDWMLG+ FRASLL++GLAGIQP
Sbjct  421  ELVERVVLLGAPIPIKDENWEAARKMVAGRFVNAYSRNDWMLGLAFRASLLTKGLAGIQP  480

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRAS  341
            VD+PG++NVDVT+ I+GHS+YLW +  IL+ LQLDTYYPV+   S
Sbjct  481  VDIPGIQNVDVTDHIEGHSSYLWATPRILDQLQLDTYYPVYNNIS  525


 Score =   161 bits (408),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = -1

Query  1302  LGTLVPVIgasgfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTI  1123
             LGTL+PVIGASGFAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+G VDEFEFK I
Sbjct  206   LGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRVGGVDEFEFKAI  265

Query  1122  GQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLT  943
             G+NHN+GRL VEIL++GFVFE+ DF RPWEG  +NLERYALQWESK+L+AVS AI++WLT
Sbjct  266   GENHNQGRLGVEILVSGFVFEKEDFIRPWEGCNDNLERYALQWESKNLIAVSTAIQDWLT  325

Query  942   SSIALELMKRGAMMTVLSS  886
             S +A+ELMKRGAMMTVLSS
Sbjct  326   SRLAMELMKRGAMMTVLSS  344



>ref|XP_006283267.1| hypothetical protein CARUB_v10004298mg [Capsella rubella]
 gb|EOA16165.1| hypothetical protein CARUB_v10004298mg [Capsella rubella]
Length=672

 Score =   267 bits (682),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAEVLQKGLQG+RPVTLVGFSLGARVIFKCLQ LA +  NA
Sbjct  508  FIDSKWSIAIDRSDKAGRLLAEVLQKGLQGNRPVTLVGFSLGARVIFKCLQTLAETEQNA  567

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVV+LGAPI I + NW  VRK+VAGRFINVY+TNDW LGI FRASL SQGLAGIQP
Sbjct  568  ELVERVVILGAPISINNENWRDVRKMVAGRFINVYATNDWTLGIAFRASLFSQGLAGIQP  627

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + +PG+ENVDVT++++GHS+YLW +Q+ILE L++DTYYPVF
Sbjct  628  ICIPGIENVDVTDMVEGHSSYLWKTQQILERLEIDTYYPVF  668


 Score =   154 bits (390),  Expect(2) = 3e-108, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A S  S W KW+RGGIIGAAA+TGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGA 
Sbjct  304   ALSPTSSWDKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGAG  363

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+GD+D FEFK IG+NHN+GRLAV
Sbjct  364   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLDGFEFKAIGENHNQGRLAV  423

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             E+LI G VF+E DF +PWEG  +N+ERY LQWESK+L+ VS AI++WLTS +A+ELMK+G
Sbjct  424   EVLIAGVVFDEEDFVKPWEGLTSNMERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQG  483

Query  909   AMMTVLSSFLTALA  868
             AM TVL+S L ALA
Sbjct  484   AMHTVLASLLMALA  497



>ref|XP_012065270.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Jatropha curcas]
Length=674

 Score =   254 bits (650),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W IA+DRSDKAG LLA+VL KGLQG+RPVTLVG+SLGARVIFKCL+ LA +   A
Sbjct  506  FIDSTWPIAIDRSDKAGKLLADVLLKGLQGNRPVTLVGYSLGARVIFKCLETLAETEYGA  565

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I++  WEA RK+VAGRFIN YS NDW LG+ FRASL +QGLAGIQP
Sbjct  566  ELVERVVLLGAPISIKNEKWEAARKMVAGRFINAYSRNDWTLGVAFRASLFTQGLAGIQP  625

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +DVPG+ENVDVT +I+GHS+YLW +Q+ILE L+LD YYPVF
Sbjct  626  IDVPGIENVDVTGIIEGHSSYLWATQQILEQLELDAYYPVF  666


 Score =   166 bits (421),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             ++SS+S+WAKW+RGGIIGAAA+TGGTLMAITGGLAAPAIAAGF ALAPTLGTLVPVIG S
Sbjct  302   SQSSRSKWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFSALAPTLGTLVPVIGVS  361

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGL G+K+ARR G VDEFEFK IG+NHN+GRLAV
Sbjct  362   GFAAAASAAGTVAGSVAVAASFGAAGAGLAGTKMARRTGSVDEFEFKAIGENHNQGRLAV  421

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
              I+++GFVF+E DF RPWEG+ + LERY LQWESK+L+AVS AI++ LTSSIAL LMK+G
Sbjct  422   GIMVSGFVFDEGDFVRPWEGQNDILERYVLQWESKNLIAVSTAIQDLLTSSIALGLMKQG  481

Query  909   AMMTVLSSFLTALA  868
             AMMTVLS+ +TALA
Sbjct  482   AMMTVLSTLVTALA  495



>ref|XP_002310840.1| hypothetical protein POPTR_0007s13750g [Populus trichocarpa]
 gb|EEE91290.1| hypothetical protein POPTR_0007s13750g [Populus trichocarpa]
Length=681

 Score =   262 bits (669),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA+DRSDKAG LLAEVL KGLQG+RPVTLVG+SLGARVIFKCL+ LA + ++A
Sbjct  511  FIDSKWTIAIDRSDKAGKLLAEVLLKGLQGNRPVTLVGYSLGARVIFKCLETLAETEHSA  570

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I+D  WEA RK+VAGRF+N YST DW LG+ FRASLL+QGLAGIQP
Sbjct  571  EVVERVVLLGAPISIKDQKWEAARKMVAGRFVNAYSTGDWTLGVAFRASLLTQGLAGIQP  630

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            VDVPG+ENVDVT+L+DGHS+YLW +Q+ILE L+LD YY VF
Sbjct  631  VDVPGIENVDVTDLVDGHSSYLWATQQILEQLELDAYYHVF  671


 Score =   159 bits (401),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S KS+WAKW+RGGIIGAAA+TGGTL+AITGGLAAPAIAAGFGALAPTLGT++PVIGASG
Sbjct  308   KSPKSKWAKWKRGGIIGAAAITGGTLLAITGGLAAPAIAAGFGALAPTLGTIIPVIGASG  367

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAG+V GSVAVAASFGAAGAGL G+K+ARR G VDEFEFK +G NHN+GRLAV 
Sbjct  368   FAAAASAAGTVAGSVAVAASFGAAGAGLAGTKMARRTGSVDEFEFKAVGDNHNQGRLAVG  427

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             I+++G VF+E DF +PWEG+ +NLERYAL WE K+L+AVS AI++WLTS IA+E M++GA
Sbjct  428   IMVSGCVFDEEDFIKPWEGQNDNLERYALHWEPKNLIAVSTAIQDWLTSRIAMEFMRQGA  487

Query  906   MMTVLSSFLTALA  868
             M+TVLS+ L ALA
Sbjct  488   MLTVLSTLLVALA  500



>ref|XP_003548861.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Glycine max]
Length=676

 Score =   257 bits (657),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 145/165 (88%), Gaps = 0/165 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA++RS+KAG LLAEVL +G QG+RPVTL+G+SLGARVIFKCLQ LA + N A
Sbjct  509  FIDSKWTIAINRSNKAGKLLAEVLLRGYQGNRPVTLIGYSLGARVIFKCLQYLAKTENGA  568

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVE+VVLLGAPI I+D NWEA RK+VAGRF+N YS NDWMLG+ FRASLL++GLAGIQP
Sbjct  569  ELVEKVVLLGAPIPIKDENWEAARKMVAGRFVNAYSRNDWMLGVAFRASLLTKGLAGIQP  628

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRAS  341
            VD+PG++NV+VT+ I+GHS+YLW +Q+IL+ LQLDTYYPV+   S
Sbjct  629  VDIPGIQNVEVTDHIEGHSSYLWATQKILDQLQLDTYYPVYNSIS  673


 Score =   163 bits (413),  Expect(2) = 4e-108, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = -1

Query  1302  LGTLVPVIgasgfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTI  1123
             LGTL+PVIGASGFAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+G VDEFEFK I
Sbjct  354   LGTLIPVIGASGFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRVGGVDEFEFKAI  413

Query  1122  GQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLT  943
             G+NHN+GRL VEIL++GFVFE+ DF RPWEG+ +NLERYALQWESK+L+AVS AI++WLT
Sbjct  414   GENHNQGRLGVEILVSGFVFEKEDFIRPWEGQNDNLERYALQWESKNLIAVSTAIQDWLT  473

Query  942   SSIALELMKRGAMMTVLSS  886
             S +A+ELMKRGAMMTVLSS
Sbjct  474   SRLAMELMKRGAMMTVLSS  492



>ref|XP_012065275.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Jatropha curcas]
Length=508

 Score =   254 bits (648),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W IA+DRSDKAG LLA+VL KGLQG+RPVTLVG+SLGARVIFKCL+ LA +   A
Sbjct  340  FIDSTWPIAIDRSDKAGKLLADVLLKGLQGNRPVTLVGYSLGARVIFKCLETLAETEYGA  399

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I++  WEA RK+VAGRFIN YS NDW LG+ FRASL +QGLAGIQP
Sbjct  400  ELVERVVLLGAPISIKNEKWEAARKMVAGRFINAYSRNDWTLGVAFRASLFTQGLAGIQP  459

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +DVPG+ENVDVT +I+GHS+YLW +Q+ILE L+LD YYPVF
Sbjct  460  IDVPGIENVDVTGIIEGHSSYLWATQQILEQLELDAYYPVF  500


 Score =   167 bits (422),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 176/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             ++SS+S+WAKW+RGGIIGAAA+TGGTLMAITGGLAAPAIAAGF ALAPTLGTLVPVIG S
Sbjct  136   SQSSRSKWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFSALAPTLGTLVPVIGVS  195

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGL G+K+ARR G VDEFEFK IG+NHN+GRLAV
Sbjct  196   GFAAAASAAGTVAGSVAVAASFGAAGAGLAGTKMARRTGSVDEFEFKAIGENHNQGRLAV  255

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
              I+++GFVF+E DF RPWEG+ + LERY LQWESK+L+AVS AI++ LTSSIAL LMK+G
Sbjct  256   GIMVSGFVFDEGDFVRPWEGQNDILERYVLQWESKNLIAVSTAIQDLLTSSIALGLMKQG  315

Query  909   AMMTVLSSFLTALA  868
             AMMTVLS+ +TALA
Sbjct  316   AMMTVLSTLVTALA  329



>gb|EPS66741.1| hypothetical protein M569_08033, partial [Genlisea aurea]
Length=659

 Score =   254 bits (649),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 120/159 (75%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W IA+DRSDKAG LLA+V+  GLQG RPVTLVGFSLGARVIF+CLQIL+ +  NA
Sbjct  495  FIDSKWAIAMDRSDKAGKLLADVIANGLQGCRPVTLVGFSLGARVIFRCLQILSENEANA  554

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VERVVLLGAPI IRD+NWEA RKVVAGR+IN YS+NDWMLGI FRASLL+QGLAGIQ 
Sbjct  555  GIVERVVLLGAPIPIRDMNWEATRKVVAGRYINAYSSNDWMLGIAFRASLLTQGLAGIQA  614

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYP  359
            V+V G+ENVDVTE+I+ HS+YLW +Q+IL  LQLD Y+P
Sbjct  615  VEVAGIENVDVTEVIESHSSYLWRTQQILRQLQLDAYFP  653


 Score =   166 bits (421),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             ES +S W+KW+RGGIIGAAALTGGTLMA+TGGLAAPA+AAG  ALAPTLG ++P+IGASG
Sbjct  292   ESKESTWSKWKRGGIIGAAALTGGTLMAVTGGLAAPAVAAGLTALAPTLGGIIPIIGASG  351

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA+A++AGS+ GSVAVAASFGAAGAGLTG+K+ARR+G++DEFEFK +G+ HN+G+L VE
Sbjct  352   FAAIASSAGSIAGSVAVAASFGAAGAGLTGTKMARRIGEIDEFEFKAMGERHNQGQLGVE  411

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             I I+GFVFEE DF RPWEG  +N++RYALQWESKHL+AVS AI++WLTS++ALE+MKRGA
Sbjct  412   IAISGFVFEEEDFIRPWEGLRDNMDRYALQWESKHLIAVSTAIQDWLTSALALEIMKRGA  471

Query  906   MMTVLSSFLTALA  868
             MMTVL S LTALA
Sbjct  472   MMTVLHSLLTALA  484



>ref|XP_008796875.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Phoenix dactylifera]
Length=690

 Score =   260 bits (665),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WT+A+DRSDKAG LLAEVL KGLQG+RPVTL+GFSLGARVIFKCL+ LA SG+N 
Sbjct  522  FIDSKWTMAIDRSDKAGKLLAEVLLKGLQGNRPVTLIGFSLGARVIFKCLRQLAESGDNE  581

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WE  RK+VAGRF+NVYSTNDW+LG+ FRASLL+QGLAGIQ 
Sbjct  582  GLVERVVLLGAPVSLKGEQWETARKMVAGRFVNVYSTNDWILGVTFRASLLTQGLAGIQA  641

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            VDVPG+ENVDVT+ IDGHS+YL   Q+I+E L+LDTYYPVF
Sbjct  642  VDVPGIENVDVTDFIDGHSSYLSGVQQIVEQLELDTYYPVF  682


 Score =   160 bits (405),  Expect(2) = 5e-108, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS+WA+W+RGGIIGAAALTGG L+A+TGGLAAPAIAAGF ALAPTLGTLVPVIGASGF
Sbjct  320   SEKSKWARWKRGGIIGAAALTGGALLAVTGGLAAPAIAAGFSALAPTLGTLVPVIGASGF  379

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+A+AAGSV GSVAVAASFGAAGAGL+GSK+ARR+G V+EFEFK IG NHN+GRLAV I
Sbjct  380   AAIASAAGSVAGSVAVAASFGAAGAGLSGSKMARRIGSVEEFEFKPIGDNHNQGRLAVGI  439

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GF FE+ DF +PWEG  +NLERY LQWESK+++AVS AI++W+TS +  ELMK+GAM
Sbjct  440   LVSGFAFEKEDFIKPWEGLEDNLERYVLQWESKYIIAVSTAIQDWITSRVTTELMKQGAM  499

Query  903   MTVLSSFLTALA  868
             MTVLS+ ++ALA
Sbjct  500   MTVLSTLVSALA  511



>ref|XP_006650970.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Oryza brachyantha]
Length=615

 Score =   258 bits (660),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LAEVL KGLQG+RPVTL+GFSLGARVIFKCLQ LA S +N 
Sbjct  440  FIDSKWSVAIDRSDKAGKMLAEVLLKGLQGNRPVTLIGFSLGARVIFKCLQELALSSDNE  499

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WEA RK+VAGRF+NVYS +DW+LG+ FRASLLSQGLAGIQ 
Sbjct  500  GLVERVVLLGAPVSVKGERWEAARKMVAGRFVNVYSRDDWILGVTFRASLLSQGLAGIQN  559

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +DVPGVEN+DVTEL+DGHS+YL  +Q+ILE L+L+TYYPVF
Sbjct  560  IDVPGVENIDVTELVDGHSSYLSAAQQILEHLELNTYYPVF  600


 Score =   162 bits (409),  Expect(2) = 6e-108, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS+W KW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGTLVPVIGASGF
Sbjct  238   SPKSKWEKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTLVPVIGASGF  297

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+ATAAGSV GSVAVAASFGAAGAGLTGSK+ARR+G V EFEFK IG+NHN+GRLAV I
Sbjct  298   AAMATAAGSVAGSVAVAASFGAAGAGLTGSKMARRIGSVKEFEFKPIGENHNQGRLAVGI  357

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             LI+GF F+E DF RPWEG  +NLERY LQWESKH++AVS AI++WLTS +A+ELMK+GAM
Sbjct  358   LISGFTFDEDDFCRPWEGWKDNLERYILQWESKHIIAVSTAIQDWLTSRLAMELMKQGAM  417

Query  903   MTVLSSFLTALA  868
              TVLS  L A A
Sbjct  418   RTVLSGLLAAFA  429



>ref|XP_004512100.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Cicer arietinum]
Length=666

 Score =   258 bits (658),  Expect(2) = 8e-108, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 144/163 (88%), Gaps = 0/163 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IA+DRSDKAG LLAEVL  GLQG+RPVTL+G+SLGARVIFKCL++LA + N+A
Sbjct  497  FIDSTWSIAIDRSDKAGKLLAEVLLGGLQGNRPVTLIGYSLGARVIFKCLEVLAETENHA  556

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I++ NW+A RK+VAGRFIN YS  DWMLG+ FRASLLSQGLAGIQP
Sbjct  557  ELVERVVLLGAPIAIKNENWKAARKMVAGRFINAYSRTDWMLGVAFRASLLSQGLAGIQP  616

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGR  347
            +D+PG++NVDVT+ I+GHS+YLW +Q IL+ L+L+TYYPV+ R
Sbjct  617  IDIPGIQNVDVTDHIEGHSSYLWATQRILDELELETYYPVYNR  659


 Score =   162 bits (410),  Expect(2) = 8e-108, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S +S WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAG GALAPTLGTL+PVIGASG
Sbjct  294   QSKESSWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGLGALAPTLGTLIPVIGASG  353

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAG+VVGSVAVAASFGAAGAGLTGSK+ARR+G VDEFEF+ IG+NHN+GRL VE
Sbjct  354   FAAAASAAGTVVGSVAVAASFGAAGAGLTGSKMARRVGSVDEFEFRAIGENHNQGRLGVE  413

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+GFVFE++DF RPWEG+ +NLERYALQWESK+L+AVS AI++WLTS IA+ELMK+GA
Sbjct  414   ILISGFVFEDADFIRPWEGQNDNLERYALQWESKNLIAVSTAIQDWLTSRIAMELMKQGA  473

Query  906   MMTVL  892
             M+TVL
Sbjct  474   MLTVL  478



>gb|KCW53100.1| hypothetical protein EUGRSUZ_J02394 [Eucalyptus grandis]
Length=702

 Score =   246 bits (629),  Expect(2) = 8e-108, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 143/193 (74%), Gaps = 27/193 (14%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA++RSDKAG LLAEVL KGLQG+RPVTL+G+SLGARVIFKCLQ LA +   A
Sbjct  509  FIDSKWTIAINRSDKAGKLLAEVLGKGLQGNRPVTLIGYSLGARVIFKCLQFLAETEQTA  568

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI IRD NW+A RK+V+GRFIN YSTNDWMLG+ FRAS+ +QGLAGIQ 
Sbjct  569  ELVERVVLLGAPISIRDENWKAARKMVSGRFINAYSTNDWMLGLAFRASMFTQGLAGIQA  628

Query  475  VDVPGVEN---------------------------VDVTELIDGHSAYLWTSQEILELLQ  377
             D PG+EN                           VD+T+LI+GHS+YLW +Q+IL+ L+
Sbjct  629  TDHPGIENVRHINFSWTTHVRLRCIYHSPIWFLLQVDITDLIEGHSSYLWATQDILDRLE  688

Query  376  LDTYYPVFGRASR  338
            LDTYYP F   SR
Sbjct  689  LDTYYPTFRCPSR  701


 Score =   173 bits (439),  Expect(2) = 8e-108, Method: Compositional matrix adjust.
 Identities = 153/194 (79%), Positives = 178/194 (92%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A+S K  WAKW+RGGIIGAAALTGG LMAITGGLAAPAIAAG  ALAPTLGTL+PVIGAS
Sbjct  305   AQSPKKSWAKWKRGGIIGAAALTGGALMAITGGLAAPAIAAGLSALAPTLGTLIPVIGAS  364

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+G VDEFEFK+IG+N N+GRLAV
Sbjct  365   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGGVDEFEFKSIGENQNQGRLAV  424

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EIL++GFVF+E DF +PW+G+ +NLERYALQWESKHL+AVS AI++WLTS +A+ELMK+G
Sbjct  425   EILVSGFVFDEEDFVKPWQGQNDNLERYALQWESKHLIAVSTAIQDWLTSRVAMELMKQG  484

Query  909   AMMTVLSSFLTALA  868
             AM+TVLS+ LTALA
Sbjct  485   AMLTVLSTLLTALA  498



>ref|XP_006829156.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Amborella trichopoda]
 gb|ERM96572.1| hypothetical protein AMTR_s00001p00269860 [Amborella trichopoda]
Length=674

 Score =   264 bits (674),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 144/162 (89%), Gaps = 0/162 (0%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
            +FIDS+W+IAVDRSDKAG LLA+ L KGLQG+RPVTL+GFSLGAR IFKCLQ LA +G+ 
Sbjct  510  NFIDSKWSIAVDRSDKAGQLLADCLLKGLQGNRPVTLIGFSLGARAIFKCLQHLAKAGDR  569

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
             GLVERVVLLGAP+ I+D +WE  RK VAGRF+NVYSTNDW+LG+ FRASLL+QGLAGIQ
Sbjct  570  GGLVERVVLLGAPVSIKDEHWEDARKTVAGRFVNVYSTNDWILGVAFRASLLTQGLAGIQ  629

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PV   GVENVDVTEL++GHS+YLWT+Q+IL+ L+LDTYYP+F
Sbjct  630  PVTTSGVENVDVTELVEGHSSYLWTTQQILDRLELDTYYPIF  671


 Score =   155 bits (393),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 171/193 (89%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             E+ K +W+KW+RGGIIGAAALTGGTL+A+TGGLAAPAIAAGF ALAPTLG LVPVIGASG
Sbjct  308   EAEKGKWSKWKRGGIIGAAALTGGTLLAVTGGLAAPAIAAGFSALAPTLGALVPVIGASG  367

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAGSV GSVAVAASFGAAGA L+GSK+ARR+G +DEFEFK IG+NH  GRLAV 
Sbjct  368   FAAAASAAGSVAGSVAVAASFGAAGASLSGSKMARRIGGIDEFEFKPIGENHKNGRLAVG  427

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             I ++GFVFEE DF +PW G+ +NLERYALQWESK+L+ VS AI++WLTSS+ +ELMK+GA
Sbjct  428   IFVSGFVFEEEDFVKPWAGKESNLERYALQWESKNLITVSTAIQDWLTSSLTMELMKQGA  487

Query  906   MMTVLSSFLTALA  868
             M+TVL++ + ALA
Sbjct  488   MLTVLNTLVAALA  500



>ref|XP_003558988.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Brachypodium distachyon]
Length=634

 Score =   257 bits (657),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LAEVL KGLQG+RPVTLVGFSLGARVIFKCLQ LA S +N 
Sbjct  465  FIDSKWSVAIDRSDKAGKMLAEVLLKGLQGNRPVTLVGFSLGARVIFKCLQELALSSDNE  524

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WE  RK+VAGRF+NVYS +DW+LG+ FRASLL+QGLAGIQ 
Sbjct  525  GLVERVVLLGAPVSVKGERWEPARKMVAGRFVNVYSKDDWILGVTFRASLLTQGLAGIQA  584

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            VDVPGVENVDVTEL+DGHS+YL  +Q+ILE L+L+TYYPVF
Sbjct  585  VDVPGVENVDVTELVDGHSSYLSAAQQILEHLELNTYYPVF  625


 Score =   162 bits (409),  Expect(2) = 1e-107, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS+W KW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGTLVPVIGASGF
Sbjct  263   SPKSKWEKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTLVPVIGASGF  322

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+ATAAGSV GSVAVAASFGAAGAGLTG+K+ARR+G V EFEFK IG+NHN+GRLA+ I
Sbjct  323   AAMATAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGSVKEFEFKPIGENHNQGRLAIGI  382

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             LI+GF F+E D+ RPWEG  +NLERY LQWESKH++AVS AI++WLTS +ALELMK+GAM
Sbjct  383   LISGFAFDEEDYSRPWEGWKDNLERYILQWESKHIIAVSTAIQDWLTSRLALELMKQGAM  442

Query  903   MTVLSSFLTALA  868
              TVLS FL A A
Sbjct  443   RTVLSGFLAAFA  454



>ref|XP_011015560.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Populus euphratica]
Length=681

 Score =   258 bits (658),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA+DR+DKAG LLAEVL KGLQG+RPVTLVG+SLGAR+IFKCL+ LA + ++A
Sbjct  511  FIDSKWTIAIDRADKAGKLLAEVLLKGLQGNRPVTLVGYSLGARLIFKCLETLAETEHSA  570

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I+D  WEA RK+VAGRF+N YST DW LG+ FRASLL+QGLAGIQP
Sbjct  571  EVVERVVLLGAPISIKDQKWEAARKMVAGRFVNAYSTGDWTLGVAFRASLLTQGLAGIQP  630

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            VDVPG+ENVDVT+L++GHS+YLW +Q+ILE L+LD YY VF
Sbjct  631  VDVPGIENVDVTDLVEGHSSYLWATQQILEQLELDAYYHVF  671


 Score =   161 bits (407),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S KS+WAKW+RGGIIGAAA+TGGTL+AITGGLAAPAIAAGFGALAPTLGT++PVIGASG
Sbjct  308   KSPKSKWAKWKRGGIIGAAAITGGTLLAITGGLAAPAIAAGFGALAPTLGTIIPVIGASG  367

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAG+V GSVAVAASFGAAGAGL G+K+ARR G VDEFEFK IG NHN+GRLAV 
Sbjct  368   FAAAASAAGTVAGSVAVAASFGAAGAGLAGTKMARRTGSVDEFEFKAIGDNHNQGRLAVG  427

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             I+++G VF+E DF +PWEG+ +NLERYAL WESK+L+AVS AI++WLTS IA+E M++GA
Sbjct  428   IMVSGCVFDEEDFIKPWEGQNDNLERYALHWESKNLIAVSTAIQDWLTSRIAMEFMRQGA  487

Query  906   MMTVLSSFLTALA  868
             M+TVLS+ L ALA
Sbjct  488   MLTVLSTLLVALA  500



>ref|XP_004287838.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Fragaria vesca subsp. vesca]
Length=689

 Score =   258 bits (658),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IAVDRSDKAG LLA+VL KG  G+RPVTLVGFSLGAR IFKCLQ LA + ++A
Sbjct  521  FIDSKWSIAVDRSDKAGRLLADVLLKGSHGNRPVTLVGFSLGARTIFKCLQCLAETEHDA  580

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I+D NWEA RK+VAGRF+N YST DWMLGI FRASLLS+GLAGIQP
Sbjct  581  ELVERVVLLGAPISIKDENWEAARKMVAGRFVNAYSTKDWMLGIAFRASLLSRGLAGIQP  640

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +DV G+ENVDV+++ID HS YLW +Q+IL++L+L++YYPVF
Sbjct  641  IDVQGIENVDVSDVIDAHSTYLWATQQILDMLELESYYPVF  681


 Score =   160 bits (406),  Expect(2) = 2e-107, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS+WAKW+RGGI+GAAA+TGG L+ ITGGLAAPAIAAG GALAPTLG ++PVIGA+GF
Sbjct  319   SPKSKWAKWKRGGIVGAAAVTGGVLLTITGGLAAPAIAAGLGALAPTLGAVIPVIGATGF  378

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA ATAAGSV GSV VAASFGAAGAGLTG K+ARR G VDEFEFK IG+NHN+GRLAVEI
Sbjct  379   AAAATAAGSVAGSVVVAASFGAAGAGLTGFKMARRTGSVDEFEFKAIGENHNQGRLAVEI  438

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GFVF+  DF  PWEG+  NLERYA+ WESK+L+AVS AI++WLTSSIA+ LMK+GAM
Sbjct  439   LLSGFVFDVEDFVMPWEGQNGNLERYAVLWESKNLIAVSTAIQDWLTSSIAMGLMKQGAM  498

Query  903   MTVLSSFLTALA  868
             +TVLS  LTALA
Sbjct  499   LTVLSGLLTALA  510



>dbj|BAJ94309.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85894.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=657

 Score =   254 bits (649),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LAEVL KG QG+RPVTL+GFSLGARVIFKCLQ LA S +N 
Sbjct  489  FIDSKWSVAIDRSDKAGKMLAEVLMKGSQGNRPVTLIGFSLGARVIFKCLQELALSSDNE  548

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WE  RK+VAGRF+NVYS +DW+LG+ FRASLL+QGLAGIQ 
Sbjct  549  GLVERVVLLGAPVSVKGERWEPARKMVAGRFVNVYSKDDWILGVTFRASLLTQGLAGIQA  608

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            VDVPGVENVDVTEL+DGHS+YL  +Q ILE L+L+TYYPVF
Sbjct  609  VDVPGVENVDVTELVDGHSSYLSAAQLILEHLELNTYYPVF  649


 Score =   164 bits (414),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 152/192 (79%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS+WAKW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGTL+PVIGASGF
Sbjct  287   SPKSKWAKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTLMPVIGASGF  346

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+ATAAGSV GSVAVAASFGAAGAGLTG+K+ARR+G V EFEFK IG+NHN+GRLAV I
Sbjct  347   AAMATAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGSVKEFEFKPIGENHNQGRLAVGI  406

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GF F+E D+ RPWEG  +NLERY LQWESKH++AVS AI++WLTS +ALELMK+GAM
Sbjct  407   LVSGFAFDEEDYIRPWEGWKDNLERYILQWESKHIIAVSTAIQDWLTSRLALELMKQGAM  466

Query  903   MTVLSSFLTALA  868
              TVLS FL A A
Sbjct  467   RTVLSGFLAAFA  478



>ref|XP_011025906.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Populus euphratica]
Length=681

 Score =   256 bits (654),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA+DR+DKAG LLAEVL KGLQG+RPVTLVG+SLGAR+IFKCL+ LA + ++A
Sbjct  511  FIDSKWTIAIDRADKAGKLLAEVLLKGLQGNRPVTLVGYSLGARLIFKCLETLAETEHSA  570

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I+D  W+A RK+VAGRF+N YST DW LG+ FRASLL+QGLAGIQP
Sbjct  571  EVVERVVLLGAPISIKDQKWDAARKMVAGRFVNAYSTGDWTLGVAFRASLLTQGLAGIQP  630

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            VDVPG+ENVDVT+L++GHS+YLW +Q+ILE L+LD YY VF
Sbjct  631  VDVPGIENVDVTDLVEGHSSYLWATQQILEQLELDAYYHVF  671


 Score =   161 bits (407),  Expect(2) = 5e-107, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S KS+WAKW+RGGIIGAAA+TGGTL+AITGGLAAPAIAAGFGALAPTLGT++PVIGASG
Sbjct  308   KSPKSKWAKWKRGGIIGAAAITGGTLLAITGGLAAPAIAAGFGALAPTLGTIIPVIGASG  367

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAG+V GSVAVAASFGAAGAGL G+K+ARR G VDEFEFK IG NHN+GRLAV 
Sbjct  368   FAAAASAAGTVAGSVAVAASFGAAGAGLAGTKMARRTGSVDEFEFKAIGDNHNQGRLAVG  427

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             I+++G VF+E DF +PWEG+ +NLERYAL WESK+L+AVS AI++WLTS IA+E M++GA
Sbjct  428   IMVSGCVFDEEDFIKPWEGQNDNLERYALHWESKNLIAVSTAIQDWLTSRIAMEFMRQGA  487

Query  906   MMTVLSSFLTALA  868
             M+TVLS+ L ALA
Sbjct  488   MLTVLSTLLVALA  500



>ref|XP_009338652.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Pyrus x bretschneideri]
Length=713

 Score =   255 bits (652),  Expect(2) = 9e-107, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W IAVDRSDKAG LLAEVL KG+ G+RPVTLVGFSLGARVIFKCLQ LA + ++A
Sbjct  546  FIDSKWAIAVDRSDKAGKLLAEVLLKGIHGNRPVTLVGFSLGARVIFKCLQCLAETEHHA  605

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I D  WEA RK+VAGRF+N YSTNDWMLG+ FRASLLS+GLAGIQP
Sbjct  606  ELVERVVLLGAPISIADEKWEAARKMVAGRFVNAYSTNDWMLGVAFRASLLSRGLAGIQP  665

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPV  356
            ++V G+ENVDVT++ID HS+YLW++++ILEL++L+ YYPV
Sbjct  666  INVQGIENVDVTDIIDSHSSYLWSTKQILELVELEGYYPV  705


 Score =   161 bits (407),  Expect(2) = 9e-107, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S K +WAKW+RGGIIGAAA+TGG L+ ITGGLAAPAIAAG GALAPTLGT++PVIGASG
Sbjct  343   QSPKDKWAKWKRGGIIGAAAITGGALLTITGGLAAPAIAAGLGALAPTLGTIIPVIGASG  402

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA ATAAGSV GSV VAASFGAAGAGLTGSK+ARR G VD+FEFK IG+NHN+GRLAVE
Sbjct  403   FAAAATAAGSVAGSVVVAASFGAAGAGLTGSKMARRTGGVDQFEFKAIGENHNQGRLAVE  462

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             IL++GFVF+E DF +PWEG  +NLERYA+ WESK+L+AVS AI++WLTS+IA+ LMK+GA
Sbjct  463   ILVSGFVFDEEDFTKPWEGHDDNLERYAVLWESKNLIAVSTAIQDWLTSTIAMGLMKQGA  522

Query  906   MMTVLSSFLTALA  868
             MMTVL + +TA A
Sbjct  523   MMTVLGTLVTAFA  535



>ref|XP_006412018.1| hypothetical protein EUTSA_v10024597mg [Eutrema salsugineum]
 gb|ESQ53471.1| hypothetical protein EUTSA_v10024597mg [Eutrema salsugineum]
Length=676

 Score =   258 bits (658),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 142/165 (86%), Gaps = 4/165 (2%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN-  659
            FIDS+W+IA+DRSDKAG LLAEVLQKGLQG+RP+TLVGFSLGARVIFKCLQ LA      
Sbjct  508  FIDSKWSIAIDRSDKAGRLLAEVLQKGLQGNRPITLVGFSLGARVIFKCLQTLARQNKTV  567

Query  658  ---AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLA  488
               + LVERVVLLGAPI I + NW  VRK+VAGRFINVY+TNDW LG+ FRASLLSQGLA
Sbjct  568  FFLSELVERVVLLGAPISINNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLSQGLA  627

Query  487  GIQPVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            GIQP+ +PG+ENVDVT +++GHS+YLW +Q+ILE L++DTYYPVF
Sbjct  628  GIQPICIPGIENVDVTHMVEGHSSYLWKTQQILERLEIDTYYPVF  672


 Score =   158 bits (400),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A+S  + WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGAS
Sbjct  304   AQSPTNTWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGAS  363

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR GD+DEFEF  IG+NHN+GRLAV
Sbjct  364   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRTGDLDEFEFIAIGENHNQGRLAV  423

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             E+L+ GFVF+E DF +PWEG  +++ERY LQWESK+L+ VS AI++WLTS +A+ELMK+G
Sbjct  424   EVLVAGFVFKEEDFLKPWEGLTSSMERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQG  483

Query  909   AMMTVLSSFLTALA  868
             AM+TVLSS L ALA
Sbjct  484   AMLTVLSSLLMALA  497



>gb|KHN41681.1| Transmembrane and coiled-coil domain-containing protein 4 [Glycine 
soja]
Length=677

 Score =   253 bits (645),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 144/165 (87%), Gaps = 0/165 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA++RS+KAG LLAEVL +G QG+RPVTL+G+SLGARVIFKCLQ LA + N A
Sbjct  510  FIDSKWTIAINRSNKAGKLLAEVLLRGYQGNRPVTLIGYSLGARVIFKCLQYLAKTENGA  569

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVE+VVLLGAPI I+D N EA RK+VAGRF+N YS NDWMLG+ FRASLL++GLAGIQP
Sbjct  570  ELVEKVVLLGAPIPIKDENGEAARKMVAGRFVNAYSRNDWMLGVAFRASLLTKGLAGIQP  629

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRAS  341
            VD+PG++NV+VT+ I+GHS+YLW +Q+IL+ LQLDTYYPV+   S
Sbjct  630  VDIPGIQNVEVTDHIEGHSSYLWATQKILDQLQLDTYYPVYNSIS  674


 Score =   164 bits (414),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S +S+WAK +RGGIIGAAALTGGTL+AITGGLAAPAIAAG GALAPTLGTL+PVIGASG
Sbjct  307   QSKESKWAKLKRGGIIGAAALTGGTLLAITGGLAAPAIAAGLGALAPTLGTLIPVIGASG  366

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+G VDEFEFK IG+NHN+GRL VE
Sbjct  367   FAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRVGGVDEFEFKAIGENHNQGRLGVE  426

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             IL++GFVFE+ DF RPWEG+ +NLERYALQWESK+L+AVS AI++WLTS +A+ELMKRGA
Sbjct  427   ILVSGFVFEKEDFIRPWEGQNDNLERYALQWESKNLIAVSTAIQDWLTSRLAMELMKRGA  486

Query  906   MMTVLSS  886
             MMTVLSS
Sbjct  487   MMTVLSS  493



>emb|CDX69212.1| BnaC01g02410D [Brassica napus]
Length=634

 Score =   268 bits (684),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAEVLQKGLQG+RP+TLVGFSLGARVIFKCLQ LA +  NA
Sbjct  470  FIDSKWSIAIDRSDKAGKLLAEVLQKGLQGNRPITLVGFSLGARVIFKCLQTLAETEQNA  529

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVV+LGAPI I + NW  VRK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct  530  ELVERVVILGAPISINNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP  589

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + VPG+ENVDVT++++GHS+YLW +Q+ILE L++DTYYPVF
Sbjct  590  ICVPGIENVDVTDMVEGHSSYLWKTQQILERLEIDTYYPVF  630


 Score =   148 bits (374),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A SS S WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGA 
Sbjct  266   AASSSSTWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGAG  325

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+GD++EFEFK IG+NHN+GRLAV
Sbjct  326   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLEEFEFKAIGENHNQGRLAV  385

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             E+L+ G VFEE DF +PW+G  ++LERY LQWESK+L+ VS AI++WLTS +A+ELMK+G
Sbjct  386   EVLVAGVVFEEEDFVKPWQGLTSSLERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQG  445

Query  909   AMMTV  895
             AM TV
Sbjct  446   AMHTV  450



>ref|XP_009146060.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Brassica rapa]
Length=677

 Score =   268 bits (684),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAEVLQKGLQG+RP+TLVGFSLGARVIFKCLQ LA +  NA
Sbjct  513  FIDSKWSIAIDRSDKAGKLLAEVLQKGLQGNRPITLVGFSLGARVIFKCLQTLAETEQNA  572

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVV+LGAPI I + NW  VRK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct  573  ELVERVVILGAPISINNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP  632

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + +PG+ENVDVT++++GHS+YLW +Q+ILE L++DTYYPVF
Sbjct  633  ICIPGIENVDVTDMVEGHSSYLWKTQQILERLEIDTYYPVF  673


 Score =   148 bits (374),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A SS S WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGA 
Sbjct  309   AASSSSTWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGAG  368

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+GD++EFEFK IG+NHN+GRLAV
Sbjct  369   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLEEFEFKAIGENHNQGRLAV  428

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             E+L+ G VFEE DF +PW+G  ++LERY LQWESK+L+ VS AI++WLTS +A+ELMK+G
Sbjct  429   EVLVAGVVFEEDDFVKPWQGLTSSLERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQG  488

Query  909   AMMTV  895
             AM TV
Sbjct  489   AMHTV  493



>emb|CDX75561.1| BnaA01g01410D [Brassica napus]
Length=592

 Score =   267 bits (682),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAEVLQKGLQG+RP+TLVGFSLGARVIFKCLQ LA +  NA
Sbjct  428  FIDSKWSIAIDRSDKAGKLLAEVLQKGLQGNRPITLVGFSLGARVIFKCLQTLAETEQNA  487

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVV+LGAPI I + NW  VRK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct  488  ELVERVVILGAPISINNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP  547

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + +PG+ENVDVT++++GHS+YLW +Q+ILE L++DTYYPVF
Sbjct  548  ICIPGIENVDVTDMVEGHSSYLWKTQQILERLEIDTYYPVF  588


 Score =   149 bits (376),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 144/185 (78%), Positives = 167/185 (90%), Gaps = 0/185 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A SS S WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGA 
Sbjct  224   AASSSSTWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGAG  283

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+GD++EFEFK IG+NHN+GRLAV
Sbjct  284   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLEEFEFKAIGENHNQGRLAV  343

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             E+L+ G VFEE DF +PW+G  ++LERY LQWESK+L+ VS AI++WLTS +A+ELMK+G
Sbjct  344   EVLVAGVVFEEDDFVKPWQGLTSSLERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQG  403

Query  909   AMMTV  895
             AM TV
Sbjct  404   AMHTV  408



>ref|XP_008372754.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Malus domestica]
Length=713

 Score =   255 bits (651),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W IAVDRSDKAG LLAEVL KG+ G+RPVTLVGFSLGARVIFKCLQ LA + ++A
Sbjct  546  FIDSKWAIAVDRSDKAGKLLAEVLLKGVHGNRPVTLVGFSLGARVIFKCLQCLAETEHHA  605

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I D  WEA RK+VAGRF+N YSTNDWMLG+ FRASLLS+GLAGIQP
Sbjct  606  ELVERVVLLGAPISIADEKWEAARKMVAGRFVNAYSTNDWMLGVAFRASLLSRGLAGIQP  665

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPV  356
            ++V G+ENVDVT++ID HS+YLW++++ILEL++L+ YYPV
Sbjct  666  INVQGIENVDVTDIIDSHSSYLWSTKQILELVELEGYYPV  705


 Score =   160 bits (406),  Expect(2) = 1e-106, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S K +WAKW+RGGIIGAAA+TGG L+ ITGGLAAPAIAAG GALAPTLGT++PVIGASG
Sbjct  343   QSPKDKWAKWKRGGIIGAAAITGGALLTITGGLAAPAIAAGLGALAPTLGTIIPVIGASG  402

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA ATAAGSV GSV VAASFGAAGAGLTGSK+ARR G VD+FEFK IG+NHN+GRLAVE
Sbjct  403   FAAAATAAGSVAGSVVVAASFGAAGAGLTGSKMARRTGGVDQFEFKAIGENHNQGRLAVE  462

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             IL++GFVF+E DF +PWEG  +NLERYA+ WESK+L+AVS AI++WLTS++A+ LMK+GA
Sbjct  463   ILVSGFVFDEEDFMKPWEGHDDNLERYAVLWESKNLIAVSTAIQDWLTSTLAMGLMKQGA  522

Query  906   MMTVLSSFLTALA  868
             MMTVL + +TA A
Sbjct  523   MMTVLGTLVTAFA  535



>ref|XP_006297155.1| hypothetical protein CARUB_v10013157mg [Capsella rubella]
 gb|EOA30053.1| hypothetical protein CARUB_v10013157mg [Capsella rubella]
Length=661

 Score =   259 bits (663),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARVIFKCLQ LA +  NA
Sbjct  497  FIDSKWSIAIDRSDKAGKLLAEALRKGLQGNRPVTLVGFSLGARVIFKCLQTLAETEKNA  556

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I++ NW  +RK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct  557  EIVERVVLLGAPISIKNENWPDIRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP  616

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V +PG+E+VDVT++++GHS+YLW +Q+ILE L+LD  YPVF
Sbjct  617  VCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVF  657


 Score =   155 bits (393),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  + WAKW+RGGI+GAAALTGG LMAITGGLAAPAIAAGFG+LAPTLGT+VPVIGASGF
Sbjct  295   SPNTEWAKWKRGGIVGAAALTGGALMAITGGLAAPAIAAGFGSLAPTLGTIVPVIGASGF  354

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A AAG+V GSVAVAASFGAAGAGLTG+K+ARR GD++EFEFK IG+NHN+GRLAVEI
Sbjct  355   AAAAEAAGTVAGSVAVAASFGAAGAGLTGTKMARRTGDIEEFEFKAIGENHNQGRLAVEI  414

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ GFV +E DF +PWEG  +NLERY +QWESK+++AVS AI++WLTS +A+ELM++GAM
Sbjct  415   LVAGFVLKEEDFVKPWEGLTSNLERYTVQWESKNVIAVSTAIQDWLTSRVAMELMRQGAM  474

Query  903   MTVLSSFLTALA  868
              TVL+S L A+A
Sbjct  475   HTVLNSLLAAMA  486



>ref|XP_009378211.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Pyrus x bretschneideri]
Length=713

 Score =   254 bits (649),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 141/160 (88%), Gaps = 0/160 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W IAVDRSDKAG LLAEVL KG+ G+RPVTLVGFSLGAR IFKCLQ LA + ++A
Sbjct  546  FIDSKWAIAVDRSDKAGKLLAEVLLKGIHGNRPVTLVGFSLGARAIFKCLQCLAETEHHA  605

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I D  WEA RK+VAGRF+N YSTNDWMLG+ FRASLLS+GLAGIQP
Sbjct  606  ELVERVVLLGAPISIADEKWEAARKMVAGRFVNAYSTNDWMLGVAFRASLLSRGLAGIQP  665

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPV  356
            ++V G+ENVDVT++ID HS+YLW++++ILEL++L+ YYPV
Sbjct  666  INVQGIENVDVTDIIDSHSSYLWSTKQILELVELEGYYPV  705


 Score =   161 bits (407),  Expect(2) = 2e-106, Method: Compositional matrix adjust.
 Identities = 146/193 (76%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S K +WAKW+RGGIIGAAA+TGG L+ ITGGLAAPAIAAG GALAPTLGT++PVIGASG
Sbjct  343   QSPKDKWAKWKRGGIIGAAAITGGALLTITGGLAAPAIAAGLGALAPTLGTIIPVIGASG  402

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA ATAAGSV GSV VAASFGAAGAGLTGSK+ARR G VD+FEFK IG+NHN+GRLAVE
Sbjct  403   FAAAATAAGSVAGSVVVAASFGAAGAGLTGSKMARRTGGVDQFEFKAIGENHNQGRLAVE  462

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             IL++GFVF+E DF +PWEG  +NLERYA+ WESK+L+AVS AI++WLTS+IA+ LMK+GA
Sbjct  463   ILVSGFVFDEEDFTKPWEGHDDNLERYAVLWESKNLIAVSTAIQDWLTSTIAMGLMKQGA  522

Query  906   MMTVLSSFLTALA  868
             MMTVL + +TA A
Sbjct  523   MMTVLGTLVTAFA  535



>gb|KFK30255.1| hypothetical protein AALP_AA7G237500 [Arabis alpina]
Length=671

 Score =   267 bits (682),  Expect(2) = 4e-106, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAEVLQKGLQG+RP+TLVGFSLGARVIFKCLQ LA +  NA
Sbjct  507  FIDSKWSIAIDRSDKAGRLLAEVLQKGLQGNRPITLVGFSLGARVIFKCLQTLAETEQNA  566

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVV+LGAPI I+  NW  VRK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct  567  DLVERVVILGAPISIKSENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP  626

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + +PG+ENVDVT++++GH++YLW +Q+ILE L++DTYYPVF
Sbjct  627  ICIPGIENVDVTDMVEGHASYLWKTQQILERLEIDTYYPVF  667


 Score =   147 bits (372),  Expect(2) = 4e-106, Method: Compositional matrix adjust.
 Identities = 142/182 (78%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -1

Query  1440  SKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgfa  1261
             S S WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGT++PVIGASGFA
Sbjct  306   SPSTWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGASGFA  365

Query  1260  avataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEIL  1081
             A A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+GD+DEFEFK IG+NHN+GRLAVE+L
Sbjct  366   AAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLDEFEFKAIGENHNQGRLAVEVL  425

Query  1080  ITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAMM  901
             + G VFEE DF +PWEG  ++LERY LQWESK+L+ VS AI++WLTS++A++LMK+GAM 
Sbjct  426   VAGVVFEEEDFVKPWEGLTSSLERYTLQWESKNLILVSTAIQDWLTSTLAMQLMKQGAMH  485

Query  900   TV  895
             TV
Sbjct  486   TV  487



>ref|NP_179401.2| uncharacterized protein [Arabidopsis thaliana]
 gb|AEC06726.1| uncharacterized protein AT2G18100 [Arabidopsis thaliana]
Length=656

 Score =   259 bits (661),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ LA +  NA
Sbjct  492  FIDSRWSIAIDRSDKAGKLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQTLAETEKNA  551

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I++ NW  VRK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct  552  EIVERVVLLGAPISIKNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP  611

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V +PG+E+VDVT++++GHS+YLW +Q+ILE L+LD  YPVF
Sbjct  612  VCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVF  652


 Score =   154 bits (388),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  S WAKW+RGGI+GAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGT+VPVIGASGF
Sbjct  290   SPNSEWAKWKRGGIVGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTIVPVIGASGF  349

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A AAG+V GSVAVAASFGAAGAGLTG+K+ARR GD++EFEFK IG+NHN+GRLAVEI
Sbjct  350   AAAAEAAGTVAGSVAVAASFGAAGAGLTGTKMARRTGDIEEFEFKAIGENHNQGRLAVEI  409

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ GFV +E DF +PWEG  +NLERY +QWES++++AVS AI++WLTS +A+ELM++GAM
Sbjct  410   LVAGFVLKEEDFVKPWEGLTSNLERYTVQWESENIIAVSTAIQDWLTSRVAMELMRQGAM  469

Query  903   MTVLSSFLTAL  871
              TVL+S L A+
Sbjct  470   RTVLNSLLAAM  480



>gb|AET03833.2| transmembrane and coiled-coil protein [Medicago truncatula]
Length=316

 Score =   252 bits (644),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA++RS+KAG LLAEVL KGLQG+RPVTLVG+SLGARVIF CLQ LA + N A
Sbjct  131  FIDSKWTIAINRSNKAGKLLAEVLLKGLQGNRPVTLVGYSLGARVIFSCLQCLAKTENGA  190

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI IRD NWEA RK+VAGRF+N YS NDW+LG+ FRASLL++GLAGI+P
Sbjct  191  ELVERVVLLGAPISIRDENWEAARKMVAGRFVNAYSRNDWILGVAFRASLLTKGLAGIEP  250

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRAS  341
            VD+PG++NVDVT+ I+GHS+YLW +Q IL+ LQLDT +PV+   S
Sbjct  251  VDIPGIQNVDVTDHIEGHSSYLWATQHILDQLQLDTCFPVYSGVS  295


 Score =   160 bits (406),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR+G VDEF+FK IG+NHN+GRL VEILI+GFVFE+ DF RPWEG  +NLERY+LQW
Sbjct  19    KMARRVGGVDEFDFKPIGENHNQGRLGVEILISGFVFEKEDFIRPWEGLNDNLERYSLQW  78

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+AVS AI++WLTS +A++LMK+GAMMTVLS+ +TALA
Sbjct  79    ESKNLIAVSTAIQDWLTSRLAMQLMKQGAMMTVLSTLVTALA  120



>gb|KFK40188.1| hypothetical protein AALP_AA3G341700 [Arabis alpina]
Length=633

 Score =   257 bits (657),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ LA +  NA
Sbjct  469  FIDSRWSIAIDRSDKAGRLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQALAETEKNA  528

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAP+ I + NW  +RK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct  529  EIVERVVLLGAPVSITNENWREIRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP  588

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRA  344
            V +PG+E+VDVT++++GHS+YLW +Q+ILE L+LD  YPVF  A
Sbjct  589  VCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVFRNA  632


 Score =   155 bits (392),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S    WAKW+RGGI+GAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGT+VPVIGASGF
Sbjct  267   SPNDEWAKWKRGGIVGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTVVPVIGASGF  326

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A+AAG+V GSVAVAASFGAAGAGLTG+K+A+R GD+DEFEFK IG+NHN+GRLAVEI
Sbjct  327   AAAASAAGTVTGSVAVAASFGAAGAGLTGTKMAKRTGDIDEFEFKAIGENHNQGRLAVEI  386

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ GFV +E DF +PWEG  +NLERYA+QWE+++++AVS AI++WLTS +A+ELM++GAM
Sbjct  387   LVAGFVLKEEDFVKPWEGLTSNLERYAVQWETQNIIAVSTAIQDWLTSRVAMELMRQGAM  446

Query  903   MTVLSSFLTAL  871
              TVLSS L A+
Sbjct  447   RTVLSSLLAAM  457



>gb|KFK40189.1| hypothetical protein AALP_AA3G341700 [Arabis alpina]
Length=636

 Score =   257 bits (656),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 142/164 (87%), Gaps = 0/164 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ LA +  NA
Sbjct  472  FIDSRWSIAIDRSDKAGRLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQALAETEKNA  531

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAP+ I + NW  +RK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct  532  EIVERVVLLGAPVSITNENWREIRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP  591

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRA  344
            V +PG+E+VDVT++++GHS+YLW +Q+ILE L+LD  YPVF  A
Sbjct  592  VCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVFRNA  635


 Score =   155 bits (393),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S    WAKW+RGGI+GAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGT+VPVIGASGF
Sbjct  270   SPNDEWAKWKRGGIVGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTVVPVIGASGF  329

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A+AAG+V GSVAVAASFGAAGAGLTG+K+A+R GD+DEFEFK IG+NHN+GRLAVEI
Sbjct  330   AAAASAAGTVTGSVAVAASFGAAGAGLTGTKMAKRTGDIDEFEFKAIGENHNQGRLAVEI  389

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ GFV +E DF +PWEG  +NLERYA+QWE+++++AVS AI++WLTS +A+ELM++GAM
Sbjct  390   LVAGFVLKEEDFVKPWEGLTSNLERYAVQWETQNIIAVSTAIQDWLTSRVAMELMRQGAM  449

Query  903   MTVLSSFLTAL  871
              TVLSS L A+
Sbjct  450   RTVLSSLLAAM  460



>ref|XP_010933753.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Elaeis guineensis]
Length=622

 Score =   262 bits (669),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WT+A+DRSDKAG LLAEVL KGLQG+RPVTL+GFSLGARVIF+CL+ LA SG+N 
Sbjct  454  FIDSKWTMAIDRSDKAGKLLAEVLSKGLQGNRPVTLIGFSLGARVIFRCLRKLAESGDNE  513

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WE  RK+VAGRF+NVYSTNDW+LG+ FRASLL+QGLAGIQ 
Sbjct  514  GLVERVVLLGAPVSVKGEQWEIARKIVAGRFVNVYSTNDWILGVTFRASLLTQGLAGIQA  573

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            VDVPG+ENVDVT+ IDGHS+YL   Q+ILE L+LDTYYPVF
Sbjct  574  VDVPGIENVDVTDFIDGHSSYLSGVQQILEQLELDTYYPVF  614


 Score =   150 bits (380),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR G V+EFEFK IG NHN+GRLAV IL+TGF FE+ DF +PWEG  +NLERY LQW
Sbjct  342   KMARRTGSVEEFEFKPIGDNHNQGRLAVGILVTGFAFEKEDFIKPWEGLEDNLERYVLQW  401

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+++AVS AI++W+TSS+ + LMK+GAM+TVLS+ ++ALA
Sbjct  402   ESKYIIAVSTAIQDWITSSVTMGLMKQGAMLTVLSTLVSALA  443



>ref|XP_010467612.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=661

 Score =   257 bits (657),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ LA +  NA
Sbjct  497  FIDSKWSIAIDRSDKAGKLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQTLAETEKNA  556

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I++ NW  VRK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct  557  EIVERVVLLGAPISIKNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP  616

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V +PG+E+VDVT++++GHS+YLW  Q+ILE L+LD  YPVF
Sbjct  617  VCIPGIEDVDVTDMVEGHSSYLWKIQQILERLELDNSYPVF  657


 Score =   155 bits (391),  Expect(2) = 1e-105, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  S WAKW+RGGI+GAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGT++PVIGASGF
Sbjct  295   SPNSEWAKWKRGGIVGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGASGF  354

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A AAG+V GSVAVAASFGAAGAGLTG+K+ARR GD++EFEFK IG+NHN+GRLAVEI
Sbjct  355   AAAAEAAGTVAGSVAVAASFGAAGAGLTGTKMARRTGDIEEFEFKAIGENHNQGRLAVEI  414

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ GFV +E DF +PWEG  +NLERY +QWESK+++AVS AI++WLTS +A+ELM++GAM
Sbjct  415   LVAGFVLKEEDFVKPWEGLTSNLERYTVQWESKNIIAVSTAIQDWLTSRVAMELMRQGAM  474

Query  903   MTVLSSFLTAL  871
              TVL+S L A+
Sbjct  475   HTVLNSLLAAM  485



>ref|XP_003629357.1| Transmembrane and coiled-coil domain-containing protein [Medicago 
truncatula]
Length=359

 Score =   252 bits (643),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 143/165 (87%), Gaps = 0/165 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA++RS+KAG LLAEVL KGLQG+RPVTLVG+SLGARVIF CLQ LA + N A
Sbjct  131  FIDSKWTIAINRSNKAGKLLAEVLLKGLQGNRPVTLVGYSLGARVIFSCLQCLAKTENGA  190

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI IRD NWEA RK+VAGRF+N YS NDW+LG+ FRASLL++GLAGI+P
Sbjct  191  ELVERVVLLGAPISIRDENWEAARKMVAGRFVNAYSRNDWILGVAFRASLLTKGLAGIEP  250

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRAS  341
            VD+PG++NVDVT+ I+GHS+YLW +Q IL+ LQLDT +PV+   S
Sbjct  251  VDIPGIQNVDVTDHIEGHSSYLWATQHILDQLQLDTCFPVYSGVS  295


 Score =   160 bits (405),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR+G VDEF+FK IG+NHN+GRL VEILI+GFVFE+ DF RPWEG  +NLERY+LQW
Sbjct  19    KMARRVGGVDEFDFKPIGENHNQGRLGVEILISGFVFEKEDFIRPWEGLNDNLERYSLQW  78

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+AVS AI++WLTS +A++LMK+GAMMTVLS+ +TALA
Sbjct  79    ESKNLIAVSTAIQDWLTSRLAMQLMKQGAMMTVLSTLVTALA  120



>ref|XP_007046758.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
 ref|XP_007046759.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
 gb|EOX90915.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
 gb|EOX90916.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
1 [Theobroma cacao]
Length=670

 Score =   254 bits (648),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IAV+R+DKAG LLAEVL KG QG+RPVTL+G+SLGARVIFKCLQ L+ +  NA
Sbjct  504  FIDSTWSIAVNRTDKAGRLLAEVLLKGYQGNRPVTLIGYSLGARVIFKCLQALSETEQNA  563

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI I+  NWEA RK+VAGRFIN YSTNDWMLG+ FRASLL+QGLAGIQP
Sbjct  564  ELVERVVLLGAPISIKGENWEAARKMVAGRFINAYSTNDWMLGVAFRASLLTQGLAGIQP  623

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V + G+ENV+VT+LI+GHS+YLW +Q+IL+ L+LD YYPVF
Sbjct  624  VGLQGIENVNVTDLIEGHSSYLWATQQILDRLELDVYYPVF  664


 Score =   158 bits (400),  Expect(2) = 2e-105, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             ++SS+ +WAKW+R GIIGAAA+TGGTLMAITGGLAAPAIAAGF ALAPTLGT++PVIGAS
Sbjct  300   SQSSEGKWAKWKRRGIIGAAAITGGTLMAITGGLAAPAIAAGFSALAPTLGTIIPVIGAS  359

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+G VDEFEFK IG +HN+GRLAV
Sbjct  360   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGSVDEFEFKAIGDDHNQGRLAV  419

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EILI+GFVF++ DF RPWEG  +N+ER+ LQWESK+L+AVS AI++WLTS IA ELM++G
Sbjct  420   EILISGFVFDKEDFIRPWEGRIDNMERFVLQWESKNLIAVSTAIQDWLTSRIATELMRQG  479

Query  909   AMMTVLSS  886
             AMMTVLS+
Sbjct  480   AMMTVLST  487



>gb|EMS45711.1| hypothetical protein TRIUR3_14318 [Triticum urartu]
Length=946

 Score =   250 bits (639),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LAEVL KG QG+RPVTLVGFSLGARVIFKCLQ LA S +N 
Sbjct  777  FIDSKWSVAIDRSDKAGKMLAEVLMKGSQGNRPVTLVGFSLGARVIFKCLQELALSSDNE  836

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WE  RK+VA RF+NVYS +DW+LG+ FRASLL+QGLAGIQ 
Sbjct  837  GLVERVVLLGAPVSVKGEKWEPARKMVAARFVNVYSKDDWILGVTFRASLLTQGLAGIQA  896

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            VD+PGVENVDVTEL+DGHS+YL  +Q IL+ L+L+TYYPVF
Sbjct  897  VDIPGVENVDVTELVDGHSSYLSAAQLILKHLELNTYYPVF  937


 Score =   161 bits (408),  Expect(2) = 3e-105, Method: Compositional matrix adjust.
 Identities = 150/192 (78%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             + KS+WAKW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGT++PVIGASGF
Sbjct  575   TPKSKWAKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTIIPVIGASGF  634

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+ATAAGSV GSVAVAASFGAAGAGLTG+K+ARR+G V EFEFK IG+NHN+GRLAV I
Sbjct  635   AAMATAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGSVKEFEFKPIGENHNQGRLAVGI  694

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GF F+E D+ RPWEG  +NLERY LQWESKH++AVS AI++WLTS +ALELMK+GAM
Sbjct  695   LVSGFAFDEEDYIRPWEGWKDNLERYILQWESKHIIAVSTAIQDWLTSRLALELMKQGAM  754

Query  903   MTVLSSFLTALA  868
              TVLS FL A A
Sbjct  755   RTVLSGFLAAFA  766



>ref|XP_010413917.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Camelina sativa]
Length=661

 Score =   256 bits (654),  Expect(2) = 4e-105, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDK G LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ LA +  NA
Sbjct  497  FIDSKWSIAIDRSDKVGKLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQTLAETEKNA  556

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VER+VLLGAPI I++ NW  VRK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct  557  EIVERLVLLGAPISIKNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP  616

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V +PG+E+VDVT++++GHS+YLW +Q+ILE L+LD  YPVF
Sbjct  617  VCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVF  657


 Score =   155 bits (391),  Expect(2) = 4e-105, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  S WAKW+RGGI+GAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGT++PVIGASGF
Sbjct  295   SPNSEWAKWKRGGIVGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGASGF  354

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A AAG+V GSVAVAASFGAAGAGLTG+K+ARR GD++EFEFK IG+NHN+GRLAVEI
Sbjct  355   AAAAEAAGTVAGSVAVAASFGAAGAGLTGTKMARRTGDIEEFEFKAIGENHNQGRLAVEI  414

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ GFV +E DF +PWEG  +NLERY +QWESK+++AVS AI++WLTS +A+ELM++GAM
Sbjct  415   LVAGFVLKEEDFVKPWEGLTSNLERYTVQWESKNIIAVSTAIQDWLTSRVAMELMRQGAM  474

Query  903   MTVLSSFLTAL  871
              TVL+S L A+
Sbjct  475   HTVLNSLLAAM  485



>ref|XP_006409198.1| hypothetical protein EUTSA_v10022586mg [Eutrema salsugineum]
 gb|ESQ50651.1| hypothetical protein EUTSA_v10022586mg [Eutrema salsugineum]
Length=660

 Score =   257 bits (657),  Expect(2) = 4e-105, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ LA +  NA
Sbjct  496  FIDSKWSIAIDRSDKAGRLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQALAETEKNA  555

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I++ NW  VRK VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct  556  EIVERVVLLGAPISIKNENWRDVRKTVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP  615

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V +PG+E+VDV+++++GHS+YLW +Q+ILE L+LD  YPVF
Sbjct  616  VCIPGIEDVDVSDMVEGHSSYLWKTQQILERLELDNSYPVF  656


 Score =   153 bits (387),  Expect(2) = 4e-105, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  1302  LGTLVPVIgasgfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTI  1123
             LGTLVPVIGASGFAA A+AAG+V GSVAVAASFGAAGAGL G+K+ARR GD++EFEFK I
Sbjct  341   LGTLVPVIGASGFAAAASAAGTVTGSVAVAASFGAAGAGLAGTKMARRTGDIEEFEFKAI  400

Query  1122  GQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLT  943
             G++HN+GRLAVEIL+ GFV +E DF +PWEG  +NLERY +QWESK+++AVS AI++WLT
Sbjct  401   GEDHNQGRLAVEILVAGFVLKEEDFVKPWEGLTSNLERYTVQWESKNIIAVSTAIQDWLT  460

Query  942   SSIALELMKRGAMMTVLSSFLTALA  868
             S +A+ELM++GAM TVL+S L A+A
Sbjct  461   SRVAMELMRQGAMHTVLNSLLAAMA  485



>gb|AAO42809.1| At2g18100 [Arabidopsis thaliana]
 dbj|BAE99624.1| hypothetical protein [Arabidopsis thaliana]
Length=656

 Score =   255 bits (652),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            F +S W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ LA +  NA
Sbjct  492  FTNSRWSIAIDRSDKAGKLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQTLAETEKNA  551

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I++ NW  VRK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct  552  EIVERVVLLGAPISIKNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP  611

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V +PG+E+VDVT++++GHS+YLW +Q+ILE L+LD  YPVF
Sbjct  612  VCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVF  652


 Score =   154 bits (388),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 144/191 (75%), Positives = 171/191 (90%), Gaps = 0/191 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  S WAKW+RGGI+GAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGT+VPVIGASGF
Sbjct  290   SPNSEWAKWKRGGIVGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTIVPVIGASGF  349

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A AAG+V GSVAVAASFGAAGAGLTG+K+ARR GD++EFEFK IG+NHN+GRLAVEI
Sbjct  350   AAAAEAAGTVAGSVAVAASFGAAGAGLTGTKMARRTGDIEEFEFKAIGENHNQGRLAVEI  409

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ GFV +E DF +PWEG  +NLERY +QWES++++AVS AI++WLTS +A+ELM++GAM
Sbjct  410   LVAGFVLKEEDFVKPWEGLTSNLERYTVQWESENIIAVSTAIQDWLTSRVAMELMRQGAM  469

Query  903   MTVLSSFLTAL  871
              TVL+S L A+
Sbjct  470   RTVLNSLLAAM  480



>gb|KHN00498.1| Transmembrane and coiled-coil domain-containing protein 4 [Glycine 
soja]
Length=608

 Score =   248 bits (632),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 143/179 (80%), Gaps = 14/179 (8%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA++RS+KAG LLAEVL KGLQG+RPVTL+G+SLGARVIFKCLQ LA + N A
Sbjct  425  FIDSKWTIAINRSNKAGKLLAEVLLKGLQGNRPVTLIGYSLGARVIFKCLQYLAKTENGA  484

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRAS-----------  509
             LVE+VVLLGAPI I D NWEA RK+VAGRF+N YS  DWMLG+ FRA            
Sbjct  485  ELVEKVVLLGAPIPIMDENWEATRKMVAGRFVNAYSRTDWMLGVAFRARNTNIALEPYFK  544

Query  508  ---LLSQGLAGIQPVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRAS  341
               LL++GLAGIQPVD+PG++NVDVTE I+GHS+YLW +Q+IL+ LQLDTYYPV+   S
Sbjct  545  WKFLLTKGLAGIQPVDIPGIQNVDVTEHIEGHSSYLWATQKILDQLQLDTYYPVYNYIS  603


 Score =   160 bits (405),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 72/96 (75%), Positives = 88/96 (92%), Gaps = 0/96 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR+G VDEFEFK IG+NHN+GRL VEIL++GFVFE+ DF RPWEG+ +NLERYALQW
Sbjct  313   KMARRVGGVDEFEFKAIGENHNQGRLGVEILVSGFVFEKEDFIRPWEGQNDNLERYALQW  372

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSS  886
             ES++L+AVS AI++WLTS +A+ELMKRGAMMTVLSS
Sbjct  373   ESENLIAVSTAIQDWLTSKLAMELMKRGAMMTVLSS  408



>ref|NP_001132355.1| uncharacterized protein LOC100193799 [Zea mays]
 gb|ACF81166.1| unknown [Zea mays]
Length=650

 Score =   256 bits (655),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LAEVL KGLQG+RPVTLVGFSLGARVIFKCLQ LA S +N 
Sbjct  479  FIDSKWSVAIDRSDKAGKMLAEVLLKGLQGNRPVTLVGFSLGARVIFKCLQELALSSDNE  538

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WE  RK+VAGRF+NVYS +DW+LG+ FRASLL+QGLAGIQ 
Sbjct  539  GLVERVVLLGAPVSVKGERWEPARKMVAGRFVNVYSRDDWILGVTFRASLLTQGLAGIQA  598

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +DVPGVENVDVTEL+DGHS+YL  +Q+ILE L+L+TYYPVF
Sbjct  599  IDVPGVENVDVTELVDGHSSYLSAAQQILEHLELNTYYPVF  639


 Score =   151 bits (382),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S +S+W KW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGTLVP IGASGF
Sbjct  277   SPRSKWEKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTLVPFIGASGF  336

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+A AAGSV GSVAVAASFGAAGAGLTG+K+ARR+G V EFEFK IG NHN+GRLAV I
Sbjct  337   AAMAAAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGKVKEFEFKPIGDNHNQGRLAVGI  396

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GF F+E DF++PWEG  +NLE+Y LQWESKH++AVS AI++WLTS +A+ELMK+GAM
Sbjct  397   LVSGFAFDEEDFWKPWEGWKDNLEKYILQWESKHIIAVSTAIQDWLTSRLAMELMKQGAM  456

Query  903   MTVLSSFLTALA  868
              TVLS  L A A
Sbjct  457   RTVLSGLLAAFA  468



>ref|XP_007157950.1| hypothetical protein PHAVU_002G111800g [Phaseolus vulgaris]
 gb|ESW29944.1| hypothetical protein PHAVU_002G111800g [Phaseolus vulgaris]
Length=665

 Score =   256 bits (654),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 145/163 (89%), Gaps = 1/163 (1%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
             FIDS WTIA+DRSDKAG LLAEVL  GLQG+RPVTLVG+SLGARVIFKCL+ LA + N+
Sbjct  497  EFIDSTWTIAIDRSDKAGKLLAEVLLGGLQGNRPVTLVGYSLGARVIFKCLECLAETENS  556

Query  658  AG-LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGI  482
            A  LVE+VVLLGAPI I D NWEAVRK+VAGRF+NVYS+NDWMLG+ FRASLLSQGLAGI
Sbjct  557  AAELVEKVVLLGAPIAIMDENWEAVRKMVAGRFVNVYSSNDWMLGVAFRASLLSQGLAGI  616

Query  481  QPVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            QPV++PG++NVDVT+ ++GHS+YLW +Q++L+ L+LD YYP+F
Sbjct  617  QPVNIPGIQNVDVTDHVEGHSSYLWATQQVLDELELDAYYPLF  659


 Score =   152 bits (383),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S + +W KW+RGGIIGAAALTGGTLMAITGGLAAPAIAAG GALAPTLGTL+PVIGASGF
Sbjct  296   SKEGKWDKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGLGALAPTLGTLIPVIGASGF  355

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             +A A+AAG+V GSVAVAAS GAAGAGL+G+K+ARR+GDVDEFEFK IG+ HN+G L VEI
Sbjct  356   SAAASAAGTVAGSVAVAASLGAAGAGLSGTKMARRVGDVDEFEFKFIGETHNQGLLGVEI  415

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             +++GFVFE+ DF RPWEG  +N ERYALQWESK+L A+S AI++W+ S IA ELM++GAM
Sbjct  416   MVSGFVFEDDDFIRPWEGMNDNSERYALQWESKNLYALSSAIQDWVKSRIATELMRQGAM  475

Query  903   MTVLSSFLTALA  868
             MTVL   LTALA
Sbjct  476   MTVLHGLLTALA  487



>ref|XP_002465997.1| hypothetical protein SORBIDRAFT_01g049760 [Sorghum bicolor]
 gb|EER92995.1| hypothetical protein SORBIDRAFT_01g049760 [Sorghum bicolor]
Length=652

 Score =   254 bits (650),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LAEVL KGLQG+RPVTLVGFSLGARVIFKCLQ LA S  N 
Sbjct  484  FIDSKWSVAIDRSDKAGKMLAEVLLKGLQGNRPVTLVGFSLGARVIFKCLQELALSSGNE  543

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WE  RK+VAGRF+NVYS +DW+LG+ FRASLL+QGLAGIQ 
Sbjct  544  GLVERVVLLGAPVSVKGERWEPARKMVAGRFVNVYSRDDWILGVTFRASLLTQGLAGIQV  603

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +DVPGVENVDVTEL+DGHS+YL  +Q+ILE L+L+TYYPVF
Sbjct  604  IDVPGVENVDVTELVDGHSSYLSAAQQILEHLELNTYYPVF  644


 Score =   153 bits (387),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS+W KW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGTLVP IGASGF
Sbjct  282   SPKSKWEKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTLVPFIGASGF  341

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+A AAGSV GSVAVAASFGAAGAGLTG+K+ARR+G V EFEFK IG NHN+GRLAV I
Sbjct  342   AAMAAAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGKVKEFEFKPIGDNHNQGRLAVGI  401

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             LI+GF F+E DF++PWEG  +NLE+Y LQWESKH++AVS AI++WLTS +A+ELMK+GAM
Sbjct  402   LISGFAFDEEDFWKPWEGWKDNLEKYILQWESKHIIAVSTAIQDWLTSRLAMELMKQGAM  461

Query  903   MTVLSSFLTALA  868
              TVLS  L A A
Sbjct  462   RTVLSGLLAAFA  473



>ref|XP_004986015.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Setaria italica]
Length=681

 Score =   255 bits (652),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LAEVL KGLQG+RPVTL+GFSLGARVIFKCLQ LA S +N 
Sbjct  513  FIDSKWSVAIDRSDKAGKMLAEVLLKGLQGNRPVTLIGFSLGARVIFKCLQELALSSDNE  572

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WE  RK+VAGRF+NVYS +DW+LG+ FRASLLSQGLAGIQ 
Sbjct  573  GLVERVVLLGAPVSVKGERWEPARKMVAGRFVNVYSRDDWILGVTFRASLLSQGLAGIQA  632

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +DVPGVENVDVTEL+DGHS+YL  +++ILE L+L+TYYPVF
Sbjct  633  IDVPGVENVDVTELVDGHSSYLSAARQILEHLELNTYYPVF  673


 Score =   152 bits (384),  Expect(2) = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 168/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS+W KW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGTLVP IGASGF
Sbjct  311   SPKSKWEKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTLVPFIGASGF  370

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+A AAGSV GSVAVAASFGAAGAGLTGSK+ARR+G V EFEFK IG NHN+GRLAV I
Sbjct  371   AAMAAAAGSVAGSVAVAASFGAAGAGLTGSKMARRIGKVKEFEFKPIGDNHNQGRLAVGI  430

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GF F+E DF +PWEG  +NLE+Y LQWESKH++AVS AI++WLTS +A+ELMK+GAM
Sbjct  431   LVSGFAFDEEDFCKPWEGWKDNLEKYILQWESKHIIAVSTAIQDWLTSRLAMELMKQGAM  490

Query  903   MTVLSSFLTALA  868
              TVLS  L A A
Sbjct  491   RTVLSGLLAAFA  502



>emb|CDY53279.1| BnaC09g09640D [Brassica napus]
Length=634

 Score =   254 bits (649),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ L  +  NA
Sbjct  470  FIDSKWSIAIDRSDKAGRLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQALTETEKNA  529

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I + NW  VRK+VAGRFINVY+TNDW LG+ FRASLL+QGLAGIQP
Sbjct  530  EIVERVVLLGAPISINNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLAQGLAGIQP  589

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V +PG+E+VDVT++++GHS+YLW +Q+ILE L+LD  YPVF
Sbjct  590  VCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVF  630


 Score =   153 bits (387),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  1302  LGTLVPVIgasgfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTI  1123
             LGTLVPVIGASGFAA A+AAG+V GSVAVAASFGAAGAGL G+K+ARR G+++EFEFK I
Sbjct  315   LGTLVPVIGASGFAAAASAAGTVTGSVAVAASFGAAGAGLAGTKMARRTGEIEEFEFKAI  374

Query  1122  GQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLT  943
             G+NHN+GRLAVEIL+ GFVF+E DF +PWEG  +NLERY + WESK+++AVS AI++WLT
Sbjct  375   GENHNQGRLAVEILVAGFVFKEEDFVKPWEGLTSNLERYTVIWESKNIIAVSTAIQDWLT  434

Query  942   SSIALELMKRGAMMTVLSSFLTALA  868
             S +A+ELM++GAM TVLSS L A+A
Sbjct  435   SRVAMELMRQGAMYTVLSSLLAAMA  459



>ref|XP_002884114.1| hypothetical protein ARALYDRAFT_480715 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60373.1| hypothetical protein ARALYDRAFT_480715 [Arabidopsis lyrata subsp. 
lyrata]
Length=667

 Score =   253 bits (645),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ L  +  NA
Sbjct  503  FIDSKWSIAIDRSDKAGKLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQTLVETEKNA  562

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I++ NW  VRK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct  563  EIVERVVLLGAPISIKNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP  622

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V +PG+E+VDVT++++GHS+YLW +Q ILE L+L   YPVF
Sbjct  623  VCIPGIEDVDVTDMVEGHSSYLWKTQHILERLELVNSYPVF  663


 Score =   154 bits (390),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  S WAKW+RGGI+GAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGT+VPVIGASGF
Sbjct  301   SPTSEWAKWKRGGIVGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTMVPVIGASGF  360

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A AAG+V GSVAVAASFGAAGAGLTG+K+ARR GD++EFEFK IG+NHN+GRLAVEI
Sbjct  361   AAAAEAAGTVAGSVAVAASFGAAGAGLTGTKMARRTGDIEEFEFKAIGENHNQGRLAVEI  420

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ GFV +E DF +PWEG  +NLERY + WESK+++AVS AI++WLTS +A+ELM++GAM
Sbjct  421   LVAGFVLKEEDFVKPWEGLTSNLERYTVHWESKNIIAVSTAIQDWLTSRVAMELMRQGAM  480

Query  903   MTVLSSFLTALA  868
              TVL+S L A+A
Sbjct  481   HTVLNSLLAAMA  492



>gb|ABF93615.1| expressed protein [Oryza sativa Japonica Group]
Length=689

 Score =   245 bits (626),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 145/189 (77%), Gaps = 28/189 (15%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LAEVL KGLQG+RPVTL+GFSLGARVIFKCLQ LA S +N 
Sbjct  485  FIDSKWSVAIDRSDKAGKMLAEVLLKGLQGNRPVTLIGFSLGARVIFKCLQELALSSDNE  544

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WEA RK+VAGRF+NVYST+DW+LG+ FRASLL+QGLAGIQ 
Sbjct  545  GLVERVVLLGAPVSVKGERWEAARKMVAGRFVNVYSTDDWILGVTFRASLLTQGLAGIQA  604

Query  475  VDVPGVEN----------------------------VDVTELIDGHSAYLWTSQEILELL  380
            +DVPGVEN                            VDVTEL+DGHS+YL  +Q+ILE L
Sbjct  605  IDVPGVENVSIWGAILVFLRDFHLSFTRLCVQCNLQVDVTELVDGHSSYLSAAQQILEHL  664

Query  379  QLDTYYPVF  353
            +L+TYYPVF
Sbjct  665  ELNTYYPVF  673


 Score =   162 bits (409),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS+W KW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGTLVPVIGASGF
Sbjct  283   SPKSKWEKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTLVPVIGASGF  342

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+ATAAGSV GSVAVAASFGAAGAGLTGSK+ARR+G V EFEFK IG+NHN+GRLAV I
Sbjct  343   AAMATAAGSVAGSVAVAASFGAAGAGLTGSKMARRIGSVKEFEFKPIGENHNQGRLAVGI  402

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             LI+GF F+E DF RPWEG  +NLERY LQWESKH++AVS AI++WLTS +A+ELMK+GAM
Sbjct  403   LISGFAFDEDDFCRPWEGWQDNLERYILQWESKHIIAVSTAIQDWLTSRLAMELMKQGAM  462

Query  903   MTVLSSFLTALA  868
              TVLS  L A A
Sbjct  463   RTVLSGLLAAFA  474



>gb|KJB43387.1| hypothetical protein B456_007G197400 [Gossypium raimondii]
Length=563

 Score =   254 bits (648),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
            +FIDS+W+IAVDRSDKAG LLAEVL KG QG+RPVTL+G+SLGARVIF CLQ L+ +  N
Sbjct  395  NFIDSKWSIAVDRSDKAGRLLAEVLLKGYQGNRPVTLIGYSLGARVIFSCLQALSETERN  454

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            A LVERVVLLGAPI I+D NWEA RK+VAGRFIN YST DWMLG+ FRASLL+ GLAG+Q
Sbjct  455  AELVERVVLLGAPIAIKDENWEAARKMVAGRFINAYSTKDWMLGVAFRASLLTNGLAGLQ  514

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PVDV G+ENVDVT+ I+GHS+YLW++++ILE L+L+  YPVF
Sbjct  515  PVDVQGIENVDVTDTIEGHSSYLWSTRKILERLELEVCYPVF  556


 Score =   153 bits (386),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             ++SS S WAKW+R GIIGAAA+ GGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGAS
Sbjct  192   SQSSGSTWAKWKRRGIIGAAAVAGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGAS  251

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR G++DEFEF  IG  HN+GRLAV
Sbjct  252   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRTGNIDEFEFIAIGDYHNQGRLAV  311

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EILI+GFVF + D+ RPWEG+ +N+ER+AL WES++L+AVS AI++WLTSSIALELM++G
Sbjct  312   EILISGFVFSKEDYVRPWEGQIDNMERFALLWESRNLIAVSTAIQDWLTSSIALELMRQG  371

Query  909   AMMTVLS  889
             AMMTVLS
Sbjct  372   AMMTVLS  378



>gb|KJB43386.1| hypothetical protein B456_007G197400 [Gossypium raimondii]
Length=671

 Score =   253 bits (645),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
            +FIDS+W+IAVDRSDKAG LLAEVL KG QG+RPVTL+G+SLGARVIF CLQ L+ +  N
Sbjct  503  NFIDSKWSIAVDRSDKAGRLLAEVLLKGYQGNRPVTLIGYSLGARVIFSCLQALSETERN  562

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            A LVERVVLLGAPI I+D NWEA RK+VAGRFIN YST DWMLG+ FRASLL+ GLAG+Q
Sbjct  563  AELVERVVLLGAPIAIKDENWEAARKMVAGRFINAYSTKDWMLGVAFRASLLTNGLAGLQ  622

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PVDV G+ENVDVT+ I+GHS+YLW++++ILE L+L+  YPVF
Sbjct  623  PVDVQGIENVDVTDTIEGHSSYLWSTRKILERLELEVCYPVF  664


 Score =   152 bits (385),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/187 (78%), Positives = 170/187 (91%), Gaps = 0/187 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             ++SS S WAKW+R GIIGAAA+ GGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGAS
Sbjct  300   SQSSGSTWAKWKRRGIIGAAAVAGGTLMAITGGLAAPAIAAGFGALAPTLGTLVPVIGAS  359

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR G++DEFEF  IG  HN+GRLAV
Sbjct  360   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRTGNIDEFEFIAIGDYHNQGRLAV  419

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EILI+GFVF + D+ RPWEG+ +N+ER+AL WES++L+AVS AI++WLTSSIALELM++G
Sbjct  420   EILISGFVFSKEDYVRPWEGQIDNMERFALLWESRNLIAVSTAIQDWLTSSIALELMRQG  479

Query  909   AMMTVLS  889
             AMMTVLS
Sbjct  480   AMMTVLS  486



>gb|AFW89819.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=954

 Score =   253 bits (647),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LAEVL KGLQG+RPVTLVGFSLGARVIFKCLQ LA S +N 
Sbjct  786  FIDSKWSVAIDRSDKAGKMLAEVLLKGLQGNRPVTLVGFSLGARVIFKCLQELALSSDNE  845

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WE  RK+VAGRF+NVYS +DW+LG+ FRASLL+QGLAGIQ 
Sbjct  846  GLVERVVLLGAPVSVKGERWEPARKMVAGRFVNVYSRDDWILGVTFRASLLTQGLAGIQA  905

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +DVPGVENVDVT L+DGHS+YL  +Q+ILE L+L+TYYPVF
Sbjct  906  IDVPGVENVDVTGLVDGHSSYLSAAQQILEHLELNTYYPVF  946


 Score =   152 bits (384),  Expect(2) = 2e-103, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S +S+W KW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGTLVP IGASGF
Sbjct  584   SPRSKWEKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTLVPFIGASGF  643

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+A AAGSV GSVAVAASFGAAGAGLTG+K+ARR+G V EFEFK IG NHN+GRLAV I
Sbjct  644   AAMAAAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGKVKEFEFKPIGDNHNQGRLAVGI  703

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GF F+E DF++PWEG  +NLE+Y LQWESKH++AVS AI++WLTS +A+ELMK+GAM
Sbjct  704   LVSGFAFDEEDFWKPWEGWKDNLEKYILQWESKHIIAVSTAIQDWLTSRLAMELMKQGAM  763

Query  903   MTVLSSFLTALA  868
              TVLS  L A A
Sbjct  764   RTVLSGLLAAFA  775



>ref|XP_008658122.1| PREDICTED: uncharacterized protein LOC100193799 isoform X1 [Zea 
mays]
Length=647

 Score =   253 bits (646),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LAEVL KGLQG+RPVTLVGFSLGARVIFKCLQ LA S +N 
Sbjct  479  FIDSKWSVAIDRSDKAGKMLAEVLLKGLQGNRPVTLVGFSLGARVIFKCLQELALSSDNE  538

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WE  RK+VAGRF+NVYS +DW+LG+ FRASLL+QGLAGIQ 
Sbjct  539  GLVERVVLLGAPVSVKGERWEPARKMVAGRFVNVYSRDDWILGVTFRASLLTQGLAGIQA  598

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +DVPGVENVDVT L+DGHS+YL  +Q+ILE L+L+TYYPVF
Sbjct  599  IDVPGVENVDVTGLVDGHSSYLSAAQQILEHLELNTYYPVF  639


 Score =   151 bits (382),  Expect(2) = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S +S+W KW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGTLVP IGASGF
Sbjct  277   SPRSKWEKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTLVPFIGASGF  336

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+A AAGSV GSVAVAASFGAAGAGLTG+K+ARR+G V EFEFK IG NHN+GRLAV I
Sbjct  337   AAMAAAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGKVKEFEFKPIGDNHNQGRLAVGI  396

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GF F+E DF++PWEG  +NLE+Y LQWESKH++AVS AI++WLTS +A+ELMK+GAM
Sbjct  397   LVSGFAFDEEDFWKPWEGWKDNLEKYILQWESKHIIAVSTAIQDWLTSRLAMELMKQGAM  456

Query  903   MTVLSSFLTALA  868
              TVLS  L A A
Sbjct  457   RTVLSGLLAAFA  468



>gb|AAD20116.1| unknown protein [Arabidopsis thaliana]
Length=655

 Score =   259 bits (661),  Expect(2) = 9e-103, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ LA +  NA
Sbjct  491  FIDSRWSIAIDRSDKAGKLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQTLAETEKNA  550

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I++ NW  VRK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQP
Sbjct  551  EIVERVVLLGAPISIKNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQP  610

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V +PG+E+VDVT++++GHS+YLW +Q+ILE L+LD  YPVF
Sbjct  611  VCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVF  651


 Score =   144 bits (363),  Expect(2) = 9e-103, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  S WAKW+RGGI+GAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGT+VPVIGASGF
Sbjct  290   SPNSEWAKWKRGGIVGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTIVPVIGASGF  349

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A AAG+V GSVAVAASFGAAGAGLTG+K+ARR GD++EFEFK IG+NHN+G + VEI
Sbjct  350   AAAAEAAGTVAGSVAVAASFGAAGAGLTGTKMARRTGDIEEFEFKAIGENHNQG-VTVEI  408

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ GFV +E DF +PWEG  +NLERY +QWES++++AVS AI++WLTS +A+ELM++GAM
Sbjct  409   LVAGFVLKEEDFVKPWEGLTSNLERYTVQWESENIIAVSTAIQDWLTSRVAMELMRQGAM  468

Query  903   MTVLSSFLTAL  871
              TVL+S L A+
Sbjct  469   RTVLNSLLAAM  479



>ref|XP_007226229.1| hypothetical protein PRUPE_ppa016746mg [Prunus persica]
 gb|EMJ27428.1| hypothetical protein PRUPE_ppa016746mg [Prunus persica]
Length=671

 Score =   258 bits (660),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 142/162 (88%), Gaps = 1/162 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNN  659
             IDS+W +AVDRSDKAG +LAEVL KGLQG+RPVTL+GFSLGARV+FKCLQ LA + G+N
Sbjct  496  LIDSKWAVAVDRSDKAGKMLAEVLLKGLQGNRPVTLIGFSLGARVVFKCLQCLAETEGDN  555

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AGLVERVVLLGAPI I + NW   RK+VAGRF+N YS +DW LGI FRASLLSQGL GIQ
Sbjct  556  AGLVERVVLLGAPISIEEENWTDARKMVAGRFVNAYSISDWTLGIAFRASLLSQGLGGIQ  615

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PVDVPG+ENVDVT+L++GHS+YLW +++ILE L+LD+YYPVF
Sbjct  616  PVDVPGIENVDVTQLVEGHSSYLWKTKQILEQLELDSYYPVF  657


 Score =   144 bits (364),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 86/102 (84%), Gaps = 1/102 (1%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR G ++EFEF+TIG N+++GRLAV IL++G VFE+ DF RPWEG+  NLERYAL W
Sbjct  385   KMARRTGSIEEFEFRTIG-NYDQGRLAVGILVSGLVFEDEDFIRPWEGQNENLERYALWW  443

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+A+S AI++WLTS IALELMK GAMMTVL++ L A A
Sbjct  444   ESKNLIALSTAIQDWLTSRIALELMKEGAMMTVLNTLLAAFA  485



>emb|CDY30329.1| BnaA09g09480D [Brassica napus]
Length=1407

 Score =   254 bits (649),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835   FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             FIDS+W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ L  +  NA
Sbjct  1243  FIDSKWSIAIDRSDKAGRLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQALTETEKNA  1302

Query  655   GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
              +VERVVLLGAPI I + NW  VRK+VAGRFINVY+TNDW LG+ FRASLL+QGLAGIQP
Sbjct  1303  EIVERVVLLGAPISINNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLAQGLAGIQP  1362

Query  475   VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
             V +PG+E+VDVT++++GHS+YLW +Q+ILE L+LD  YPVF
Sbjct  1363  VCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVF  1403


 Score =   148 bits (374),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  1302  LGTLVPVIgasgfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTI  1123
             LGTLVPVIGASGFAA A+AAG+V GSVAVAASFGAAGAGL G+K+ARR G+++EFEFK I
Sbjct  1088  LGTLVPVIGASGFAAAASAAGTVTGSVAVAASFGAAGAGLAGAKMARRTGEIEEFEFKAI  1147

Query  1122  GQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLT  943
             G+NHN+GRLAVEIL+ GFVF+E DF +PWEG  +NLERY + WESK+++AVS AI++WLT
Sbjct  1148  GENHNQGRLAVEILVAGFVFKEEDFVKPWEGLTSNLERYTVIWESKNIIAVSTAIQDWLT  1207

Query  942   SSIALELMKRGAMMTVLSSFLTALA  868
             S +A+ELM++GAM TVLSS L A+A
Sbjct  1208  SRVAMELMRQGAMYTVLSSLLAAMA  1232



>gb|ACN33345.1| unknown [Zea mays]
Length=647

 Score =   251 bits (641),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LAEVL KGLQG+RPVTLVGFSLGARVIFKCLQ LA S +N 
Sbjct  479  FIDSKWSVAIDRSDKAGKMLAEVLLKGLQGNRPVTLVGFSLGARVIFKCLQELALSSDNE  538

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WE  RK+VAGRF+NVYS +DW+LG+ FRASLL+QGLAGIQ 
Sbjct  539  GLVERVVLLGAPVSVKGERWEPARKMVAGRFVNVYSRDDWILGVTFRASLLTQGLAGIQA  598

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            +DVPGVENVDV  L+DGHS+YL  +Q+ILE L+L+TYYPVF
Sbjct  599  IDVPGVENVDVAGLVDGHSSYLSAAQQILEHLELNTYYPVF  639


 Score =   151 bits (382),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S +S+W KW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGTLVP IGASGF
Sbjct  277   SPRSKWEKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTLVPFIGASGF  336

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+A AAGSV GSVAVAASFGAAGAGLTG+K+ARR+G V EFEFK IG NHN+GRLAV I
Sbjct  337   AAMAAAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGKVKEFEFKPIGDNHNQGRLAVGI  396

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GF F+E DF++PWEG  +NLE+Y LQWESKH++AVS AI++WLTS +A+ELMK+GAM
Sbjct  397   LVSGFAFDEEDFWKPWEGWKDNLEKYILQWESKHIIAVSTAIQDWLTSRLAMELMKQGAM  456

Query  903   MTVLSSFLTALA  868
              TVLS  L A A
Sbjct  457   RTVLSGLLAAFA  468



>gb|KCW67917.1| hypothetical protein EUGRSUZ_F01619 [Eucalyptus grandis]
Length=669

 Score =   252 bits (643),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILA-ASGNN  659
             IDS+W +A+DRSDKAG LL+EVL KGLQG+RPVTL+GFSLGARVIFKCLQ LA AS +N
Sbjct  492  IIDSKWAVAIDRSDKAGELLSEVLLKGLQGNRPVTLIGFSLGARVIFKCLQFLAEASEDN  551

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            A  VERVVLLGAPI I+D NWE  RK+VAGRF+N YST DW LGI FRASL SQGLAGIQ
Sbjct  552  AKFVERVVLLGAPISIKDENWETARKMVAGRFVNAYSTKDWTLGIAFRASLFSQGLAGIQ  611

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRASR  338
            PV VPG+ENVDVTELIDGHS+YLW +++IL+  +LD+  PVF  +++
Sbjct  612  PVKVPGMENVDVTELIDGHSSYLWMAKQILKQQELDSPSPVFKTSTK  658


 Score =   150 bits (380),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR+G ++EFEFK IG+NHN+G+LAVEIL++G  FE  DF RPWEG  +N+ERYALQW
Sbjct  380   KMARRIGGIEEFEFKAIGENHNQGQLAVEILVSGLAFESEDFVRPWEGYDSNVERYALQW  439

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+A+S AI++WLTS +A+EL+K GAMMTVLS+ + ALA
Sbjct  440   ESKNLIALSTAIQDWLTSRLAMELVKEGAMMTVLSTLVAALA  481



>ref|XP_010061018.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Eucalyptus grandis]
Length=668

 Score =   252 bits (643),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 141/167 (84%), Gaps = 1/167 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILA-ASGNN  659
             IDS+W +A+DRSDKAG LL+EVL KGLQG+RPVTL+GFSLGARVIFKCLQ LA AS +N
Sbjct  491  IIDSKWAVAIDRSDKAGELLSEVLLKGLQGNRPVTLIGFSLGARVIFKCLQFLAEASEDN  550

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            A  VERVVLLGAPI I+D NWE  RK+VAGRF+N YST DW LGI FRASL SQGLAGIQ
Sbjct  551  AKFVERVVLLGAPISIKDENWETARKMVAGRFVNAYSTKDWTLGIAFRASLFSQGLAGIQ  610

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRASR  338
            PV VPG+ENVDVTELIDGHS+YLW +++IL+  +LD+  PVF  +++
Sbjct  611  PVKVPGMENVDVTELIDGHSSYLWMAKQILKQQELDSPSPVFKTSTK  657


 Score =   150 bits (380),  Expect(2) = 1e-102, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 88/102 (86%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR+G ++EFEFK IG+NHN+G+LAVEIL++G  FE  DF RPWEG  +N+ERYALQW
Sbjct  379   KMARRIGGIEEFEFKAIGENHNQGQLAVEILVSGLAFESEDFVRPWEGYDSNVERYALQW  438

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+A+S AI++WLTS +A+EL+K GAMMTVLS+ + ALA
Sbjct  439   ESKNLIALSTAIQDWLTSRLAMELVKEGAMMTVLSTLVAALA  480



>ref|XP_009112467.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Brassica rapa]
Length=656

 Score =   254 bits (648),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ L  +  NA
Sbjct  492  FIDSKWSIAIDRSDKAGRLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQALTETEKNA  551

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I + NW  VRK+VAGRFINVY+TNDW LG+ FRASLL+QGLAGIQP
Sbjct  552  EIVERVVLLGAPISINNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLAQGLAGIQP  611

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V +PG+E+VDVT++++GHS+YLW +Q+ILE L+LD  YPVF
Sbjct  612  VCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVF  652


 Score =   148 bits (374),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  1302  LGTLVPVIgasgfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTI  1123
             LGTLVPVIGASGFAA A+AAG+V GSVAVAASFGAAGAGL G+K+ARR G+++EFEFK I
Sbjct  337   LGTLVPVIGASGFAAAASAAGTVTGSVAVAASFGAAGAGLAGAKMARRTGEIEEFEFKAI  396

Query  1122  GQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLT  943
             G+NHN+GRLAVEIL+ GFVF+E DF +PWEG  +NLERY + WESK+++AVS AI++WLT
Sbjct  397   GENHNQGRLAVEILVAGFVFKEEDFVKPWEGLTSNLERYTVIWESKNIIAVSTAIQDWLT  456

Query  942   SSIALELMKRGAMMTVLSSFLTALA  868
             S +A+ELM++GAM TVLSS L A+A
Sbjct  457   SRVAMELMRQGAMYTVLSSLLAAMA  481



>ref|XP_008221322.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Prunus mume]
Length=707

 Score =   258 bits (658),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 142/162 (88%), Gaps = 1/162 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNN  659
             IDS+W +AVDRSDKAG +LAEVL KGLQG+RPVTL+GFSLGARV+FKCLQ LA + G+N
Sbjct  532  LIDSKWAVAVDRSDKAGKMLAEVLLKGLQGNRPVTLIGFSLGARVVFKCLQCLAETEGDN  591

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AGLVERVVLLGAPI I + NW   RK+VAGRF+N YS +DW LGI FRASLLSQGL GIQ
Sbjct  592  AGLVERVVLLGAPISIEEENWTDARKMVAGRFVNAYSISDWTLGIAFRASLLSQGLGGIQ  651

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PVDVPG+ENVDVT+L++GHS+YLW +++ILE L+LD+YYPVF
Sbjct  652  PVDVPGIENVDVTQLVEGHSSYLWKTKQILEQLELDSYYPVF  693


 Score =   144 bits (363),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 86/102 (84%), Gaps = 1/102 (1%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR G ++EFEF+TIG N+++GRLAV IL++G VFE+ DF RPWEG+  NLERYAL W
Sbjct  421   KMARRTGSIEEFEFRTIG-NYDQGRLAVGILVSGLVFEDEDFIRPWEGQNENLERYALWW  479

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+A+S AI++WLTS IALELMK GAMMTVL++ L A A
Sbjct  480   ESKNLIALSTAIQDWLTSRIALELMKEGAMMTVLNTLLAAFA  521



>ref|XP_009112468.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X2 [Brassica rapa]
Length=587

 Score =   254 bits (648),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARV+FKCLQ L  +  NA
Sbjct  423  FIDSKWSIAIDRSDKAGRLLAEALRKGLQGNRPVTLVGFSLGARVVFKCLQALTETEKNA  482

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I + NW  VRK+VAGRFINVY+TNDW LG+ FRASLL+QGLAGIQP
Sbjct  483  EIVERVVLLGAPISINNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLAQGLAGIQP  542

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V +PG+E+VDVT++++GHS+YLW +Q+ILE L+LD  YPVF
Sbjct  543  VCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVF  583


 Score =   148 bits (373),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = -1

Query  1302  LGTLVPVIgasgfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTI  1123
             LGTLVPVIGASGFAA A+AAG+V GSVAVAASFGAAGAGL G+K+ARR G+++EFEFK I
Sbjct  268   LGTLVPVIGASGFAAAASAAGTVTGSVAVAASFGAAGAGLAGAKMARRTGEIEEFEFKAI  327

Query  1122  GQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLT  943
             G+NHN+GRLAVEIL+ GFVF+E DF +PWEG  +NLERY + WESK+++AVS AI++WLT
Sbjct  328   GENHNQGRLAVEILVAGFVFKEEDFVKPWEGLTSNLERYTVIWESKNIIAVSTAIQDWLT  387

Query  942   SSIALELMKRGAMMTVLSSFLTALA  868
             S +A+ELM++GAM TVLSS L A+A
Sbjct  388   SRVAMELMRQGAMYTVLSSLLAAMA  412



>ref|XP_010263882.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane and coiled-coil 
domain-containing protein 4-like [Nelumbo nucifera]
Length=675

 Score =   251 bits (640),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 141/162 (87%), Gaps = 1/162 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIAVDRSDKAG LLAEVL KGLQG+RPVTL+GFSLGARV+FKCL+ LA      
Sbjct  503  FIDSKWTIAVDRSDKAGKLLAEVLAKGLQGNRPVTLIGFSLGARVVFKCLKYLARMEIEG  562

Query  655  G-LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            G +VERVVLLGAP+ I+D  WE  R++VAGRF+N YST+DWMLGI FRASLL+QGLAGIQ
Sbjct  563  GSVVERVVLLGAPVPIQDEYWETARRMVAGRFVNAYSTSDWMLGIAFRASLLTQGLAGIQ  622

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PV+VPG+ENVDVTELI+GHS+YL  SQ+ILE L+LD Y+PVF
Sbjct  623  PVEVPGIENVDVTELIEGHSSYLRMSQQILERLELDAYFPVF  664


 Score =   151 bits (381),  Expect(2) = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A+S    W KW+RGGIIGAAA+TGGTL+AITGGLAAPAIAAGFGALAPTLG+LVPVIGAS
Sbjct  299   AKSQDKSWVKWKRGGIIGAAAITGGTLLAITGGLAAPAIAAGFGALAPTLGSLVPVIGAS  358

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA ATAAGSV GSVAVAAS GAAGAGLTG K ARR+G VDEFEFK IG+NHN+G L+V
Sbjct  359   GFAAAATAAGSVAGSVAVAASLGAAGAGLTGYKTARRIGSVDEFEFKAIGKNHNQGCLSV  418

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
              I ++G VFEE DF RPWEG   NLERY L+WESK+L+ +S AI++WL S IA+ELMK+G
Sbjct  419   GIFVSGLVFEEKDFIRPWEGREFNLERYVLRWESKNLILLSTAIQDWLASRIAMELMKQG  478

Query  909   AMMTVLSSFLTALA  868
             AMMTVLSS LTALA
Sbjct  479   AMMTVLSSLLTALA  492



>ref|XP_010489507.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Camelina sativa]
Length=660

 Score =   243 bits (621),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 139/161 (86%), Gaps = 1/161 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+ +IA+DRSDKAG LLAE L+KGLQG+RP  LVGFSLGARV+FKCLQ LA +  NA
Sbjct  497  FIDSKRSIAIDRSDKAGKLLAEALRKGLQGNRPA-LVGFSLGARVVFKCLQTLAETEKNA  555

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I++ NW  VRK+VAGRFINVY+TNDW LG+ FRASLLSQGLAGIQ 
Sbjct  556  EIVERVVLLGAPISIKNENWRDVRKMVAGRFINVYATNDWTLGVAFRASLLSQGLAGIQR  615

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V +PG+E+VDVT++++GHS+YLW +Q+ILE L+LD  YPVF
Sbjct  616  VCIPGIEDVDVTDMVEGHSSYLWKTQQILERLELDNSYPVF  656


 Score =   155 bits (391),  Expect(2) = 2e-101, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  S WAKW+RGGI+GAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGT++PVIGASGF
Sbjct  295   SPNSEWAKWKRGGIVGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGASGF  354

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A AAG+V GSVAVAASFGAAGAGLT +K+ARR GD++EFEFK IG+NHN+GRLAVEI
Sbjct  355   AAAAEAAGTVAGSVAVAASFGAAGAGLTETKMARRTGDIEEFEFKAIGENHNQGRLAVEI  414

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ GFV +E DF +PWEG  +NLERY +QWESK+++AVS AI++WLTS +A+ELM++GAM
Sbjct  415   LVAGFVLKEEDFVKPWEGLTSNLERYTVQWESKNIIAVSTAIQDWLTSRVAMELMRQGAM  474

Query  903   MTVLSSFLTAL  871
              TVL+S L A+
Sbjct  475   HTVLNSLLVAM  485



>gb|KHG22516.1| Transmembrane and coiled-coil domain-containing 4 [Gossypium 
arboreum]
Length=619

 Score =   253 bits (646),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
            +FIDS+W+IAVDRSDKAG LLAEVL KG QG+RPVTL+G+SLGARVIF CLQ L+ +  N
Sbjct  451  NFIDSKWSIAVDRSDKAGRLLAEVLLKGYQGNRPVTLIGYSLGARVIFSCLQALSETERN  510

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            A LVERVVLLGAPI I+D NWEA RK+VAGRFIN YST DWMLG+ FRASLL+ GLAG+Q
Sbjct  511  AELVERVVLLGAPIAIKDENWEAARKMVAGRFINAYSTKDWMLGVAFRASLLTNGLAGLQ  570

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PVDV G+ENVDVT+ I+GHS+YLW++++ILE L+L+  YPVF
Sbjct  571  PVDVQGIENVDVTDTIEGHSSYLWSTRKILERLELEVCYPVF  612


 Score =   144 bits (363),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR G++DEFEF  IG  HN+GRLAVEILI+GFVF + D+ RPWEG+ +N+ER+ L W
Sbjct  340   KMARRTGNIDEFEFIAIGDYHNQGRLAVEILISGFVFSKEDYVRPWEGQIDNMERFVLLW  399

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLS  889
             ES++L+AVS AI++WLTSSIALELM++GAMMTVLS
Sbjct  400   ESRNLIAVSTAIQDWLTSSIALELMRQGAMMTVLS  434



>ref|XP_007017690.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
2 [Theobroma cacao]
 gb|EOY14915.1| Transmembrane and coiled-coil domain-containing protein 4 isoform 
2 [Theobroma cacao]
Length=668

 Score =   253 bits (647),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GN  662
            + ID+ W +AVDRSDKAG LLAEVL KGLQG+RPVTL GF+LGARVIFKCLQ LA + G+
Sbjct  491  NLIDNVWAVAVDRSDKAGKLLAEVLLKGLQGNRPVTLFGFALGARVIFKCLQCLAETEGD  550

Query  661  NAGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGI  482
            NAGLVERVVLLGAPI I D NWE  RK+VAGRF+NVYSTNDW LGI+FRAS+LS+GLAGI
Sbjct  551  NAGLVERVVLLGAPISIHDENWEDARKMVAGRFVNVYSTNDWTLGIIFRASILSKGLAGI  610

Query  481  QPVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            QPVD+ G+ENVD TE I+GHS+YLW +++IL  L LD YYP+F
Sbjct  611  QPVDLHGIENVDATEFIEGHSSYLWMAKKILRQLDLDNYYPIF  653


 Score =   142 bits (359),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+A+R GD+DEFEFK IG+NH++GRLAV IL++G VFEE DF RPWE   +NLERY L+W
Sbjct  380   KMAKRTGDLDEFEFKQIGKNHDQGRLAVGILVSGIVFEEEDFLRPWEDHNDNLERYVLKW  439

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ES+ L+A++ +++ WLTS IAL++M+ GAM+TVLS+ + ALA
Sbjct  440   ESEKLIALNISVQKWLTSRIALDVMQAGAMLTVLSTLVAALA  481



>ref|XP_009335556.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Pyrus x bretschneideri]
Length=712

 Score =   256 bits (653),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNN  659
             IDS+W +AVDRSDKAG +LAEVL  GLQG RPVTL+GFSLGARVIFKCLQ LA + G+N
Sbjct  533  LIDSKWAVAVDRSDKAGKMLAEVLLNGLQGGRPVTLIGFSLGARVIFKCLQCLAETEGDN  592

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AGLVERVVLLGAP+ + + NW   RK+VAGRF+N YS NDW LGI FRASLLSQGL GIQ
Sbjct  593  AGLVERVVLLGAPVSVEEENWSDARKMVAGRFVNAYSINDWTLGIAFRASLLSQGLGGIQ  652

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PVDVPG+ENVDVT++++GHS+YLW +++ILE L+LD+YYPVF
Sbjct  653  PVDVPGIENVDVTQIVEGHSSYLWKTKQILEQLELDSYYPVF  694


 Score =   139 bits (349),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 84/102 (82%), Gaps = 1/102 (1%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR G+++EFEF+T+G N+ KGRLAV IL++G VFE+ DF RPWE    NLERYAL W
Sbjct  422   KMARRTGNIEEFEFRTVG-NYEKGRLAVGILVSGLVFEDEDFIRPWEAHNENLERYALWW  480

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+A+S AI++WLTS IAL+LMK GAM+TVL++ L A A
Sbjct  481   ESKNLIALSTAIQDWLTSRIALQLMKEGAMLTVLNTLLAAFA  522



>ref|XP_004982627.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Setaria italica]
Length=619

 Score =   248 bits (632),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
             FIDS+WT+A+DRSDKA  +LA+VL KGLQG RPVTLVGFSLGARV+FKCLQ LA  GNN
Sbjct  450  EFIDSKWTMAIDRSDKAAKMLADVLLKGLQGSRPVTLVGFSLGARVVFKCLQELAHMGNN  509

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
             G+VER VL+GAP+ ++   WE  RK+VAGRF+NVYSTNDW+LGI FRASLL+QGLAGIQ
Sbjct  510  EGIVERAVLIGAPVSVKGEMWEPARKMVAGRFVNVYSTNDWILGITFRASLLTQGLAGIQ  569

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
             VDVPGVENVDVTEL+ GHS+YL   Q+IL+ L+L++YYPVF
Sbjct  570  AVDVPGVENVDVTELVFGHSSYLSLVQQILDHLELNSYYPVF  611


 Score =   146 bits (368),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 140/192 (73%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  SRW  W+RGGIIGAAALTGGTLMAI+GGLAAPAIAAGF AL PTL TLVPVIGASGF
Sbjct  249   SPSSRWENWKRGGIIGAAALTGGTLMAISGGLAAPAIAAGFTALVPTLHTLVPVIGASGF  308

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+ATAAG   GSVAVAASFGAAGAGLTG+K+A+R+G+V EFEFKTIG+NHN+GRLAV I
Sbjct  309   AAIATAAGHTAGSVAVAASFGAAGAGLTGTKMAKRIGNVKEFEFKTIGENHNQGRLAVGI  368

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
              ++GF F E D+ +PWEG   NLERY LQWESKH++AVS AI++WL S +ALEL++ GAM
Sbjct  369   FVSGFAFTEEDYSKPWEGWKTNLERYVLQWESKHVIAVSTAIQDWLASRVALELIREGAM  428

Query  903   MTVLSSFLTALA  868
              TVLS  ++A A
Sbjct  429   QTVLSGIISAFA  440



>emb|CAN59788.1| hypothetical protein VITISV_012480 [Vitis vinifera]
Length=670

 Score =   224 bits (571),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 125/161 (78%), Gaps = 18/161 (11%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA+DRSDKAG LLAEVLQKGLQG+RPVTL+G+SLGARVIFKCLQ LA +  NA
Sbjct  519  FIDSKWTIALDRSDKAGKLLAEVLQKGLQGNRPVTLIGYSLGARVIFKCLQYLAETEQNA  578

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             LVERVVLLGAPI  RD NWE  RK+VAGRF+N +STNDW LG+ FRA            
Sbjct  579  ELVERVVLLGAPISFRDENWEVARKMVAGRFVNAFSTNDWTLGVAFRAKY----------  628

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
                    VDVTELI+GHS+YLW +++IL+ L+LDTYYPVF
Sbjct  629  --------VDVTELIEGHSSYLWVTEDILDRLELDTYYPVF  661


 Score =   168 bits (426),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 76/102 (75%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR G VDEFEFK IG+NHN+GRLAVEIL++GFVF+E DF  PWEG+ NNLERYALQW
Sbjct  407   KMARRTGSVDEFEFKAIGENHNQGRLAVEILVSGFVFQEEDFISPWEGQNNNLERYALQW  466

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+AVS AI++WLTSSIAL +MK+GAM+TVLS+ +TALA
Sbjct  467   ESKNLIAVSTAIQDWLTSSIALSMMKQGAMLTVLSTLMTALA  508



>ref|XP_004291817.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Fragaria vesca subsp. vesca]
Length=721

 Score =   257 bits (657),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILA-ASGNN  659
             IDS+W IA DRSDKAG +LAEVL KGLQG+RPVTL+GFSLG RV+FKCL+ LA A GNN
Sbjct  537  LIDSKWAIAADRSDKAGKMLAEVLLKGLQGNRPVTLIGFSLGGRVVFKCLECLAEAEGNN  596

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AGLVERVVLLGAP+ I D NWE  RK+VAGRF+N +STNDW LG+ FRASLLSQGLAGIQ
Sbjct  597  AGLVERVVLLGAPVSIEDENWEDARKMVAGRFVNAFSTNDWTLGVAFRASLLSQGLAGIQ  656

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGR  347
             V+VPG+ENVDVT+ ++GHS+YLW +++ILELL+L++Y+PVF +
Sbjct  657  AVNVPGIENVDVTQFVEGHSSYLWKTKQILELLELESYHPVFRK  700


 Score =   135 bits (339),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 84/102 (82%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR+G+++EFEFK +   +N+GRL V I+++G VFE+ DF RPWEG  ++LERYAL W
Sbjct  425   KMARRIGNIEEFEFKAVEGTYNQGRLGVGIVVSGLVFEDEDFVRPWEGYNDHLERYALWW  484

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+A+S AI++WLTS IALELMK GAM+TVL++ + A A
Sbjct  485   ESKNLVALSTAIQDWLTSRIALELMKEGAMLTVLNTLVAAFA  526



>ref|XP_006661949.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Oryza brachyantha]
Length=623

 Score =   243 bits (620),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG +LAEVL KGLQG RPVTL+GFSLGARV+FKCLQ LA  GNN 
Sbjct  455  FIDSKWSIAIDRSDKAGKILAEVLLKGLQGSRPVTLIGFSLGARVVFKCLQELALLGNNE  514

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VER VL+GAP+  +   WE  RK+VAGRF+NVYSTNDW+LGI FRASLL+QGLAGIQ 
Sbjct  515  GIVERAVLIGAPVSDKGELWEPARKMVAGRFVNVYSTNDWILGITFRASLLTQGLAGIQA  574

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V VPGVENVDVTEL+ GHS+YL   ++IL+ L+L+TYYPVF
Sbjct  575  VHVPGVENVDVTELVVGHSSYLTLVKQILDQLELNTYYPVF  615


 Score =   146 bits (369),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 161/193 (83%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             ES  SRW  W+RGGIIGAAALTGGTLMAI+GGLAAPAIAAGF ALAPTL TLVP+IGASG
Sbjct  252   ESPNSRWENWKRGGIIGAAALTGGTLMAISGGLAAPAIAAGFTALAPTLHTLVPLIGASG  311

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA+ATAAG   GSVAVAASFGAAGAGLTG+K+A+R+G V EFEFK IG+NHN+GRLAV 
Sbjct  312   FAAIATAAGHTAGSVAVAASFGAAGAGLTGTKMAKRIGSVKEFEFKAIGENHNQGRLAVA  371

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             IL+TGF F E D+ +PWEG   NLERY LQWESKH++ VS AIR+WL S  A+ELM+ GA
Sbjct  372   ILVTGFAFTEEDYIKPWEGWKTNLERYILQWESKHIIGVSTAIRDWLASRFAMELMREGA  431

Query  906   MMTVLSSFLTALA  868
             M TVL   ++A A
Sbjct  432   MQTVLCGIVSAFA  444



>ref|XP_009420791.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Musa acuminata subsp. malaccensis]
Length=642

 Score =   235 bits (600),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 110/153 (72%), Positives = 133/153 (87%), Gaps = 0/153 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRS+KAG LLAE L KGLQG+RPVTL+GFSLGARVIFKCL+ L+ SGNN 
Sbjct  489  FIDSKWSIAIDRSNKAGKLLAEALLKGLQGNRPVTLIGFSLGARVIFKCLEELSKSGNNE  548

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERV LLGAPI +   NWE  RK+VAGRF+NV+STNDW+LGI FRAS+L+ GLAGIQ 
Sbjct  549  GLVERVFLLGAPISVSGENWEGARKIVAGRFVNVFSTNDWILGITFRASMLTHGLAGIQN  608

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQ  377
            V+VPG+ENVDVT++I GHS+YL  +QEIL+ L+
Sbjct  609  VNVPGIENVDVTDIISGHSSYLCAAQEILQQLE  641


 Score =   153 bits (386),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 171/194 (88%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
              ES++SRW++W+RGGIIGAAALTGGT++AI+GGLAAPAIAAGF ALAPTLGTLVPVIGAS
Sbjct  285   GESAESRWSRWKRGGIIGAAALTGGTVLAISGGLAAPAIAAGFSALAPTLGTLVPVIGAS  344

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA AT AGS  GSVAVAASFGAAGAGL GSK+ARR+GD++EF+F  IG+NHN+G LAV
Sbjct  345   GFAAAATVAGSAAGSVAVAASFGAAGAGLAGSKMARRVGDIEEFDFIPIGENHNQGCLAV  404

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
              I ++GFVFEE DF RPW+   NNLERY L+WESK+L+A+S AI++W+TS +  ELMKRG
Sbjct  405   GIYVSGFVFEEEDFVRPWDAIVNNLERYVLRWESKNLIALSNAIQDWITSKVTKELMKRG  464

Query  909   AMMTVLSSFLTALA  868
             AMMTVLS+ +TA++
Sbjct  465   AMMTVLSTLVTAVS  478



>ref|XP_010934560.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Elaeis guineensis]
Length=703

 Score =   234 bits (597),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W IA+DRSDKAG LLA+ L KGLQG+RPVTLVGFSLGARVIFKCL+ LA S NN 
Sbjct  550  FIDSKWLIAIDRSDKAGKLLADALLKGLQGNRPVTLVGFSLGARVIFKCLEHLAKSVNNE  609

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVE+VVLLGAPI ++   WE+VRK+VAGRF+N++STNDW+LGI FRASL++QGLAGIQ 
Sbjct  610  GLVEKVVLLGAPISLKGEEWESVRKMVAGRFVNIFSTNDWILGITFRASLMTQGLAGIQA  669

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILE  386
            ++VPG+ENVDVT++IDGHS+YLW +  IL+
Sbjct  670  INVPGIENVDVTDIIDGHSSYLWAASGILQ  699


 Score =   151 bits (381),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
              ES+ S W+ W+R GIIGAAALTGGTL+AI+GGLAAPAIA+GF ALAPTLGTLVP IGAS
Sbjct  346   CESTDSSWSGWKRSGIIGAAALTGGTLLAISGGLAAPAIASGFSALAPTLGTLVPAIGAS  405

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA  +AAGS  GS+AVAASFG AGAGL+GSK+ARR+ D++EFEF  +G+N N+GRLAV
Sbjct  406   GFAAAVSAAGSAAGSMAVAASFGVAGAGLSGSKMARRIADIEEFEFIPMGENRNQGRLAV  465

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             +I ++GFVFEE DF RPWE   +NLER+ALQWESKHL+AVS AI+NWLT+ I  EL+K+G
Sbjct  466   DIFVSGFVFEEEDFRRPWEEIEDNLERFALQWESKHLIAVSTAIQNWLTAKITTELVKQG  525

Query  909   AMMTVLSSFLTALA  868
             AMMTVLS+ ++ALA
Sbjct  526   AMMTVLSTLVSALA  539



>ref|XP_010934563.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Elaeis guineensis]
Length=629

 Score =   234 bits (598),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W IA+DRSDKAG LLA+ L KGLQG+RPVTLVGFSLGARVIFKCL+ LA S NN 
Sbjct  476  FIDSKWLIAIDRSDKAGKLLADALLKGLQGNRPVTLVGFSLGARVIFKCLEHLAKSVNNE  535

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVE+VVLLGAPI ++   WE+VRK+VAGRF+N++STNDW+LGI FRASL++QGLAGIQ 
Sbjct  536  GLVEKVVLLGAPISLKGEEWESVRKMVAGRFVNIFSTNDWILGITFRASLMTQGLAGIQA  595

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILE  386
            ++VPG+ENVDVT++IDGHS+YLW +  IL+
Sbjct  596  INVPGIENVDVTDIIDGHSSYLWAASGILQ  625


 Score =   150 bits (380),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
              ES+ S W+ W+R GIIGAAALTGGTL+AI+GGLAAPAIA+GF ALAPTLGTLVP IGAS
Sbjct  272   CESTDSSWSGWKRSGIIGAAALTGGTLLAISGGLAAPAIASGFSALAPTLGTLVPAIGAS  331

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA  +AAGS  GS+AVAASFG AGAGL+GSK+ARR+ D++EFEF  +G+N N+GRLAV
Sbjct  332   GFAAAVSAAGSAAGSMAVAASFGVAGAGLSGSKMARRIADIEEFEFIPMGENRNQGRLAV  391

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             +I ++GFVFEE DF RPWE   +NLER+ALQWESKHL+AVS AI+NWLT+ I  EL+K+G
Sbjct  392   DIFVSGFVFEEEDFRRPWEEIEDNLERFALQWESKHLIAVSTAIQNWLTAKITTELVKQG  451

Query  909   AMMTVLSSFLTALA  868
             AMMTVLS+ ++ALA
Sbjct  452   AMMTVLSTLVSALA  465



>ref|XP_010934564.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X4 [Elaeis guineensis]
Length=568

 Score =   233 bits (595),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W IA+DRSDKAG LLA+ L KGLQG+RPVTLVGFSLGARVIFKCL+ LA S NN 
Sbjct  415  FIDSKWLIAIDRSDKAGKLLADALLKGLQGNRPVTLVGFSLGARVIFKCLEHLAKSVNNE  474

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVE+VVLLGAPI ++   WE+VRK+VAGRF+N++STNDW+LGI FRASL++QGLAGIQ 
Sbjct  475  GLVEKVVLLGAPISLKGEEWESVRKMVAGRFVNIFSTNDWILGITFRASLMTQGLAGIQA  534

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILE  386
            ++VPG+ENVDVT++IDGHS+YLW +  IL+
Sbjct  535  INVPGIENVDVTDIIDGHSSYLWAASGILQ  564


 Score =   151 bits (382),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 167/194 (86%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
              ES+ S W+ W+R GIIGAAALTGGTL+AI+GGLAAPAIA+GF ALAPTLGTLVP IGAS
Sbjct  211   CESTDSSWSGWKRSGIIGAAALTGGTLLAISGGLAAPAIASGFSALAPTLGTLVPAIGAS  270

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA  +AAGS  GS+AVAASFG AGAGL+GSK+ARR+ D++EFEF  +G+N N+GRLAV
Sbjct  271   GFAAAVSAAGSAAGSMAVAASFGVAGAGLSGSKMARRIADIEEFEFIPMGENRNQGRLAV  330

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             +I ++GFVFEE DF RPWE   +NLER+ALQWESKHL+AVS AI+NWLT+ I  EL+K+G
Sbjct  331   DIFVSGFVFEEEDFRRPWEEIEDNLERFALQWESKHLIAVSTAIQNWLTAKITTELVKQG  390

Query  909   AMMTVLSSFLTALA  868
             AMMTVLS+ ++ALA
Sbjct  391   AMMTVLSTLVSALA  404



>ref|NP_001130514.1| putative DUF726-domain family protein [Zea mays]
 gb|ACF78760.1| unknown [Zea mays]
 tpg|DAA49326.1| TPA: putative DUF726-domain family protein [Zea mays]
Length=624

 Score =   243 bits (620),  Expect(2) = 5e-97, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LA+VL KGLQG RPVTLVGFSLGARV+FKCLQ LA  GNN 
Sbjct  456  FIDSKWSVAIDRSDKAGKMLADVLLKGLQGSRPVTLVGFSLGARVVFKCLQELAQLGNNV  515

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VER VL+GAP+ ++   WE  RK+VAGRF+NVYSTNDW+LG+ FRASL +QGLAGIQ 
Sbjct  516  GIVERAVLIGAPVSVQGEMWEPARKMVAGRFVNVYSTNDWILGVTFRASLFTQGLAGIQD  575

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V VPGVENVDVTEL+ GHS+YL   Q+IL+ L+L+TYYPVF
Sbjct  576  VHVPGVENVDVTELVVGHSSYLSLLQKILDHLELNTYYPVF  616


 Score =   141 bits (355),  Expect(2) = 5e-97, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  SRW  W+RGGIIGAAALTGGTLMAI+GGLAAPAIAAGF AL PTL TLVP+IGASGF
Sbjct  254   SPNSRWENWKRGGIIGAAALTGGTLMAISGGLAAPAIAAGFTALVPTLHTLVPLIGASGF  313

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+ATAAG   GSVAVAASFGAAGAGLTG+K+A R+G+V EFEFKTIGQNH++GRLAV I
Sbjct  314   AAIATAAGHTAGSVAVAASFGAAGAGLTGTKMATRIGNVKEFEFKTIGQNHSQGRLAVGI  373

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
              ++GF F E D+ +PWEG   NLERY LQWESKH++ VS AI++WL S +A+ELM+ GAM
Sbjct  374   FVSGFAFSEDDYSKPWEGWKTNLERYVLQWESKHVIGVSTAIQDWLASRVAIELMREGAM  433

Query  903   MTVLSSFLTALA  868
              TVL+  ++A A
Sbjct  434   QTVLNGIISAFA  445



>ref|NP_001176237.1| Os10g0512100 [Oryza sativa Japonica Group]
 gb|AAP54584.2| hypothetical protein LOC_Os10g36830 [Oryza sativa Japonica Group]
 gb|EAZ16662.1| hypothetical protein OsJ_32136 [Oryza sativa Japonica Group]
 dbj|BAH94965.1| Os10g0512100 [Oryza sativa Japonica Group]
Length=636

 Score =   239 bits (611),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DR+DK G +LAEVL +GLQG RPVTL+GFSLGARV+FKCL+ LA  GNN 
Sbjct  463  FIDSKWSIAIDRADKTGKMLAEVLLRGLQGSRPVTLIGFSLGARVVFKCLEELALLGNNE  522

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVER V++GAP+  ++  WE+ RK+VAGRF+NVYSTNDW+LGI FRASLLSQGLAGIQ 
Sbjct  523  GLVERAVMIGAPVSDKEELWESTRKMVAGRFVNVYSTNDWILGITFRASLLSQGLAGIQA  582

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V+VPGVENVD +ELI GHS+YL    +IL+ L+L+TYYPVF
Sbjct  583  VNVPGVENVDASELIVGHSSYLTLVNQILDQLELNTYYPVF  623


 Score =   143 bits (360),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+A+R+G V EFEF TIG+NHN+GRLAV IL+TGF F E D+ +PWEG   NLERY LQW
Sbjct  351   KMAKRIGCVREFEFNTIGENHNQGRLAVAILVTGFAFTEEDYMKPWEGWKTNLERYILQW  410

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESKH++ VS AIR+WL S  A+ELM+ GAM TVLS  ++A A
Sbjct  411   ESKHIIGVSTAIRDWLASRFAIELMREGAMQTVLSGIVSAFA  452



>gb|EAY79183.1| hypothetical protein OsI_34294 [Oryza sativa Indica Group]
Length=639

 Score =   239 bits (611),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DR+DK G +LAEVL +GLQG RPVTL+GFSLGARV+FKCL+ LA  GNN 
Sbjct  463  FIDSKWSIAIDRADKTGKMLAEVLLRGLQGSRPVTLIGFSLGARVVFKCLEELALLGNNE  522

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVER V++GAP+  ++  WE+ RK+VAGRF+NVYSTNDW+LGI FRASLLSQGLAGIQ 
Sbjct  523  GLVERAVMIGAPVSDKEELWESTRKMVAGRFVNVYSTNDWILGITFRASLLSQGLAGIQA  582

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V+VPGVENVD +ELI GHS+YL    +IL+ L+L+TYYPVF
Sbjct  583  VNVPGVENVDASELIVGHSSYLTLVNQILDQLELNTYYPVF  623


 Score =   143 bits (360),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+A+R+G V EFEF TIG+NHN+GRLAV IL+TGF F E D+ +PWEG   NLERY LQW
Sbjct  351   KMAKRIGCVREFEFNTIGENHNQGRLAVAILVTGFAFTEEDYMKPWEGWKTNLERYILQW  410

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESKH++ VS AIR+WL S  A+ELM+ GAM TVLS  ++A A
Sbjct  411   ESKHIIGVSTAIRDWLASRFAIELMREGAMQTVLSGIVSAFA  452



>ref|XP_010934561.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Elaeis guineensis]
Length=652

 Score =   234 bits (597),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W IA+DRSDKAG LLA+ L KGLQG+RPVTLVGFSLGARVIFKCL+ LA S NN 
Sbjct  499  FIDSKWLIAIDRSDKAGKLLADALLKGLQGNRPVTLVGFSLGARVIFKCLEHLAKSVNNE  558

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVE+VVLLGAPI ++   WE+VRK+VAGRF+N++STNDW+LGI FRASL++QGLAGIQ 
Sbjct  559  GLVEKVVLLGAPISLKGEEWESVRKMVAGRFVNIFSTNDWILGITFRASLMTQGLAGIQA  618

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILE  386
            ++VPG+ENVDVT++IDGHS+YLW +  IL+
Sbjct  619  INVPGIENVDVTDIIDGHSSYLWAASGILQ  648


 Score =   147 bits (372),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 87/102 (85%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR+ D++EFEF  +G+N N+GRLAV+I ++GFVFEE DF RPWE   +NLER+ALQW
Sbjct  387   KMARRIADIEEFEFIPMGENRNQGRLAVDIFVSGFVFEEEDFRRPWEEIEDNLERFALQW  446

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESKHL+AVS AI+NWLT+ I  EL+K+GAMMTVLS+ ++ALA
Sbjct  447   ESKHLIAVSTAIQNWLTAKITTELVKQGAMMTVLSTLVSALA  488



>ref|XP_004500958.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Cicer arietinum]
Length=662

 Score =   260 bits (665),  Expect(2) = 6e-96, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 143/162 (88%), Gaps = 1/162 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNN  659
             IDS+W +AVDRS+KAG +LAEVL KGLQG+RPVTLVGFSLGARVIFKCLQ LA S G+N
Sbjct  486  LIDSKWAVAVDRSEKAGKVLAEVLLKGLQGNRPVTLVGFSLGARVIFKCLQCLAESKGDN  545

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AGLVERVVLLGAPI I+D NWE  RK+VAGRF+NVYSTNDW LGI FRASLLSQGLAGIQ
Sbjct  546  AGLVERVVLLGAPISIKDENWEVARKMVAGRFVNVYSTNDWTLGITFRASLLSQGLAGIQ  605

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PVD+PGVENVDVT +I+GHS+YLW + +ILE L+LD Y+ V+
Sbjct  606  PVDLPGVENVDVTHIIEGHSSYLWMAPKILEQLELDQYFAVY  647


 Score =   120 bits (301),  Expect(2) = 6e-96, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+A R+G ++EFE   +G  H +G LAV I I+G  FEE DF +PWEG  +N+ERY L++
Sbjct  375   KMATRIGSLEEFELLEVGGTH-QGHLAVRISISGLAFEEKDFIKPWEGHNDNMERYVLKY  433

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+A+S AI++WLTS I +ELMK GAM+TVL++ + ALA
Sbjct  434   ESKNLIALSTAIQDWLTSKIMVELMKGGAMLTVLNTLVAALA  475



>ref|XP_003574182.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Brachypodium distachyon]
Length=632

 Score =   242 bits (618),  Expect(2) = 7e-96, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDK G +LAEVL KGLQG RPVTL+GFSLGARV+FKCLQ LA SGNN 
Sbjct  464  FIDSKWSIAIDRSDKVGKMLAEVLLKGLQGSRPVTLIGFSLGARVVFKCLQELALSGNNE  523

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VER VL+GAP+ ++D  W   RK+VAGR +NVYSTNDW+LG+ FRASLL+QGLAGIQ 
Sbjct  524  GIVERAVLIGAPVSVKDELWGPARKMVAGRLVNVYSTNDWILGVTFRASLLTQGLAGIQA  583

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            + VPGVENVDV+EL+ GHS+YL   Q+IL+ L+L+TYYPVF
Sbjct  584  IPVPGVENVDVSELVVGHSSYLGLLQQILDQLELNTYYPVF  624


 Score =   138 bits (347),  Expect(2) = 7e-96, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S +SRW  W+RGGIIGAAALTGGTLMAI+GGLAAPAIAAGF ALAPTL  LVP+IGASGF
Sbjct  262   SPRSRWQNWKRGGIIGAAALTGGTLMAISGGLAAPAIAAGFSALAPTLHALVPIIGASGF  321

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+ATAAG   GSVAVAASFGAAGAGLTGSK+A+R+G+V EFEFKT+G+NHN+GRLAV I
Sbjct  322   AAMATAAGHTAGSVAVAASFGAAGAGLTGSKMAKRIGNVREFEFKTMGENHNQGRLAVCI  381

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             +++GF F E DF +PWEG   NLERY LQWE+ H++A+S AI+++L S +A+ELM+ GAM
Sbjct  382   MVSGFGFNEDDFLKPWEGWKTNLERYILQWETNHIVALSTAIQDFLASRVAMELMREGAM  441

Query  903   MTVLSSFLTALA  868
              TVLS  ++A A
Sbjct  442   QTVLSGIISAFA  453



>ref|XP_002510477.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52664.1| conserved hypothetical protein [Ricinus communis]
Length=624

 Score =   247 bits (631),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNNA  656
            IDS+W IA+DRSDKAG LLAEVL KGLQG+RPVTL+GFSLGARVIFKCLQ LA + G+N 
Sbjct  449  IDSKWAIAIDRSDKAGKLLAEVLLKGLQGNRPVTLIGFSLGARVIFKCLQCLAETQGDNG  508

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VERVVLLGAPI I +  WE VRK+V+GR IN YSTNDW LGI FRA+LLSQGLAGIQP
Sbjct  509  GIVERVVLLGAPISINNEKWEDVRKMVSGRLINAYSTNDWTLGIAFRANLLSQGLAGIQP  568

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRA  344
            VD+PG+ENVDVTE I+ H++Y+  ++EIL+ L+L++YYP F  A
Sbjct  569  VDIPGIENVDVTEYIESHASYVCKTKEILDQLELESYYPDFKNA  612


 Score =   132 bits (333),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 60/95 (63%), Positives = 76/95 (80%), Gaps = 0/95 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR+G +DEFEF  IG+N N+GRLAV ILI+G VF++ DF  PWEG+  NLERYAL+W
Sbjct  336   KMARRVGSLDEFEFNQIGENRNEGRLAVAILISGLVFKDEDFVVPWEGQITNLERYALRW  395

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLS  889
             ES +L A+S AIR+WL S IA++LM  GAM+T LS
Sbjct  396   ESNNLSALSTAIRDWLASRIAMQLMTEGAMLTALS  430



>ref|XP_003603726.1| Transmembrane and coiled-coil domain-containing protein [Medicago 
truncatula]
 gb|AES73977.1| transmembrane and coiled-coil protein [Medicago truncatula]
Length=663

 Score =   258 bits (659),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 141/162 (87%), Gaps = 1/162 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNN  659
             IDS+W +AVDRS+KAG +LAEVL KGLQG+RP TLVGFSLGARVIFKCLQ LA S G+N
Sbjct  487  LIDSKWAVAVDRSEKAGKVLAEVLLKGLQGNRPATLVGFSLGARVIFKCLQCLADSKGDN  546

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AGLVERVVLLGAPI I+D NWE  RK+VAGRF+N YSTNDW LGI FRASLLSQGLAGIQ
Sbjct  547  AGLVERVVLLGAPISIKDENWEVARKMVAGRFVNAYSTNDWTLGITFRASLLSQGLAGIQ  606

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PVD+PG+ENVDVT +I+GHS+YLW + +ILE L+LD Y+ V+
Sbjct  607  PVDIPGIENVDVTRVIEGHSSYLWMTPKILEQLELDNYFAVY  648


 Score =   120 bits (302),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 157/191 (82%), Gaps = 1/191 (1%)
 Frame = -1

Query  1440  SKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgfa  1261
             S++ W KW+RGGI+GAAA+TGGT+MAITGGLAAPAIA G GALAPTLG+++PVIGA GFA
Sbjct  287   SETSWDKWKRGGIVGAAAVTGGTVMAITGGLAAPAIAQGLGALAPTLGSIIPVIGAGGFA  346

Query  1260  avataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEIL  1081
             A ATA GSV GSVAVAASFGAAGAGLTGSK+A R+G ++EFE   +G  H +G LAV I 
Sbjct  347   AAATATGSVAGSVAVAASFGAAGAGLTGSKMATRIGSLEEFELIEVGGTH-RGHLAVRIS  405

Query  1080  ITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAMM  901
             I+G  FEE DF +PWEG  +N+ERY L++ESK L+A+S AI++WLTS I  ELMK GAMM
Sbjct  406   ISGLAFEEEDFIKPWEGHNDNMERYVLKYESKILIALSTAIQDWLTSKIMSELMKGGAMM  465

Query  900   TVLSSFLTALA  868
             TVLS+ + ALA
Sbjct  466   TVLSTLVAALA  476



>gb|KHN36057.1| Transmembrane and coiled-coil domain-containing protein 4 [Glycine 
soja]
Length=628

 Score =   265 bits (678),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 145/164 (88%), Gaps = 0/164 (0%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
             FIDS WTIA+DRSDKAG LLAEVL  GLQG+RPVTLVG+SLGARVIFKCL+ LA + N+
Sbjct  460  EFIDSTWTIAIDRSDKAGKLLAEVLLGGLQGNRPVTLVGYSLGARVIFKCLEFLAETENS  519

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            A LVERVVLLGAPI I+D NWEA RK+VAGRF+N YS NDWMLG+ FRASLLSQGLAGIQ
Sbjct  520  AELVERVVLLGAPIAIKDENWEAARKMVAGRFVNAYSRNDWMLGVAFRASLLSQGLAGIQ  579

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGR  347
            PVD+PG++NVDVT+ I+GHS+YLW +Q++L+ L+LDTYYPV+ +
Sbjct  580  PVDIPGIQNVDVTDHIEGHSSYLWATQQVLDELELDTYYPVYNK  623


 Score =   112 bits (279),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 69/95 (73%), Gaps = 7/95 (7%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR+GDV+EFEFK +G+NHN+GRL VEI+I+GFVFE+ DF RPWEG  +NLER  L  
Sbjct  354   KMARRVGDVEEFEFKAVGENHNQGRLGVEIMISGFVFEDDDFIRPWEGLDDNLERIGL--  411

Query  993   ESKHLMAVSYAIRNW-LTSSIALELMKRGAMMTVL  892
                 L  + +  R   L   IA ELMK+GAMMTVL
Sbjct  412   ----LQVIGFDSRMLVLLYGIATELMKQGAMMTVL  442



>gb|EMT23841.1| hypothetical protein F775_21532 [Aegilops tauschii]
Length=610

 Score =   235 bits (600),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 137/172 (80%), Gaps = 7/172 (4%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W++A+DRSDK GI+LAEVL  GLQG RPVTL+GFSLGARV+FKCLQ LA SGNN 
Sbjct  430  FIDSTWSVAIDRSDKVGIMLAEVLLNGLQGSRPVTLIGFSLGARVVFKCLQELALSGNNE  489

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VER VL+GAPI + D  W   RK+VAGR +NVYST DW+LG+ FRASLL+QGLAGIQ 
Sbjct  490  GIVERAVLIGAPISVNDELWGPARKMVAGRLVNVYSTKDWILGVTFRASLLTQGLAGIQA  549

Query  475  VDVPGVEN-------VDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRAS  341
            V VPGVEN       VDV+EL+ GHS+YL   Q+ILE L+L+TYYPVF  ++
Sbjct  550  VQVPGVENVAARLTQVDVSELVVGHSSYLGLMQQILEQLELNTYYPVFSPST  601


 Score =   139 bits (350),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+A+R+G+V EFEFK +GQNHN+GRLAV I+++GF F E DF +PWEG   NLERY LQW
Sbjct  318   KMAKRIGNVKEFEFKALGQNHNQGRLAVCIMVSGFAFNEDDFLKPWEGWKTNLERYILQW  377

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             E+KH++A+S AI+++L S  A+ELM+ GAM TVLS  ++A A
Sbjct  378   ETKHIIALSTAIQDFLASRFAMELMREGAMQTVLSGIISAFA  419



>gb|KHN09111.1| Transmembrane and coiled-coil domain-containing protein 4 [Glycine 
soja]
Length=630

 Score =   247 bits (630),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNN  659
             IDS+W IAVDRSDKAG +LAEVL  GLQG+RPVTLVGFSLGARVIFKCLQ L+ S G+N
Sbjct  457  IIDSKWAIAVDRSDKAGKVLAEVLLHGLQGNRPVTLVGFSLGARVIFKCLQCLSESKGDN  516

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AG+VERVV LGAPI I + NWEA RK+VAGRF+N YS+NDW LGI FRASLLS GLAGIQ
Sbjct  517  AGIVERVVFLGAPISIGEENWEAARKMVAGRFVNAYSSNDWTLGITFRASLLSHGLAGIQ  576

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PVDVPGVENVDVT+LI+GHS+YL  +Q+ILE L+LD    VF
Sbjct  577  PVDVPGVENVDVTQLIEGHSSYLRMTQKILEQLELDNCCAVF  618


 Score =   125 bits (315),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+A R+G ++EFE K +G   N+G LAV I I+G  F+E DF  PWEG  +N+ERY LQ+
Sbjct  346   KMATRIGSLEEFELKGVG-GINEGHLAVRISISGLAFKEKDFIEPWEGLNDNMERYVLQY  404

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+A+S AI++WLTS IA++LMK GAM+TVLSS LTALA
Sbjct  405   ESKNLIALSTAIQDWLTSLIAIQLMKDGAMLTVLSSLLTALA  446



>ref|XP_010933752.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Elaeis guineensis]
Length=633

 Score =   212 bits (540),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WT+A+DRSDKAG LLAEVL KGLQG+RPVTL+GFSLGARVIF+CL+ LA SG+N 
Sbjct  505  FIDSKWTMAIDRSDKAGKLLAEVLSKGLQGNRPVTLIGFSLGARVIFRCLRKLAESGDNE  564

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVERVVLLGAP+ ++   WE  RK+VAGRF+NVYSTNDW+LG+ FRASLL+QGLAGIQ 
Sbjct  565  GLVERVVLLGAPVSVKGEQWEIARKIVAGRFVNVYSTNDWILGVTFRASLLTQGLAGIQA  624

Query  475  VDVPGVEN  452
            VDVPG+EN
Sbjct  625  VDVPGIEN  632


 Score =   160 bits (405),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             ++S KS+WA+W+RGGIIGAAALTGG L+AITGGLAAPAIAAGF ALAPTLGTLVPVIGAS
Sbjct  301   SQSEKSKWARWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFSALAPTLGTLVPVIGAS  360

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA+A+AAGSV GSVAVAASFGAAGAGL+GSK+ARR G V+EFEFK IG NHN+GRLAV
Sbjct  361   GFAAIASAAGSVAGSVAVAASFGAAGAGLSGSKMARRTGSVEEFEFKPIGDNHNQGRLAV  420

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
              IL+TGF FE+ DF +PWEG  +NLERY LQWESK+++AVS AI++W+TSS+ + LMK+G
Sbjct  421   GILVTGFAFEKEDFIKPWEGLEDNLERYVLQWESKYIIAVSTAIQDWITSSVTMGLMKQG  480

Query  909   AMMTVLSSFLTALA  868
             AM+TVLS+ ++ALA
Sbjct  481   AMLTVLSTLVSALA  494



>ref|XP_003527670.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Glycine max]
Length=630

 Score =   246 bits (628),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 138/162 (85%), Gaps = 1/162 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNN  659
             IDS+W IAVDRSD+AG +LAEVL  GLQG+RPVTLVGFSLGARVIFKCLQ L+ S G+N
Sbjct  457  IIDSKWAIAVDRSDRAGKVLAEVLLHGLQGNRPVTLVGFSLGARVIFKCLQCLSESKGDN  516

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AG+VERVV LGAPI I + NWEA RK+VAGRF+N YS+NDW LGI FRASLLS GLAGIQ
Sbjct  517  AGIVERVVFLGAPISIGEENWEAARKMVAGRFVNAYSSNDWTLGITFRASLLSHGLAGIQ  576

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PVDVPGVENVDVT+LI+GHS+YL  +Q+ILE L+LD    VF
Sbjct  577  PVDVPGVENVDVTQLIEGHSSYLRMTQKILEQLELDNCCAVF  618


 Score =   125 bits (315),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 1/102 (1%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+A R+G ++EFE K +G   N+G LAV I I+G  F+E DF  PWEG  +N+ERY LQ+
Sbjct  346   KMATRIGSLEEFELKGVG-GINEGHLAVRISISGLAFKEKDFIEPWEGLNDNMERYVLQY  404

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+A+S AI++WLTS IA++LMK GAM+TVLSS LTALA
Sbjct  405   ESKNLIALSTAIQDWLTSLIAIQLMKDGAMLTVLSSLLTALA  446



>ref|XP_002976085.1| hypothetical protein SELMODRAFT_104378 [Selaginella moellendorffii]
 gb|EFJ22990.1| hypothetical protein SELMODRAFT_104378 [Selaginella moellendorffii]
Length=607

 Score =   225 bits (573),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS WTIAVDRSDKAG +LA  L  GL G RPVTL+GFSLGARVIF CL+ LA  GN  
Sbjct  447  FIDSRWTIAVDRSDKAGEILANCLLSGLHGSRPVTLLGFSLGARVIFSCLEHLAKKGN-G  505

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VERVVLLGAP+ +    W   RK+VAGRF+N YS+NDW+LG+++RAS+LSQGLAGIQP
Sbjct  506  GIVERVVLLGAPLSLDRKRWMNARKIVAGRFVNCYSSNDWILGVIYRASILSQGLAGIQP  565

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V +PG+ENV+VT LI GHS+YL    EILE + LD Y+PVF
Sbjct  566  VALPGIENVNVTHLITGHSSYLSKIPEILETIHLDNYFPVF  606


 Score =   146 bits (369),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 138/194 (71%), Positives = 165/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             AE+ KS+W+KW+RG +IGAAA+TGGTL+AITGGLAAPAIAAG  ALAP  GT+VP+IGAS
Sbjct  243   AEAEKSKWSKWKRGSLIGAAAVTGGTLLAITGGLAAPAIAAGLAALAPAAGTVVPIIGAS  302

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A A G+  GSVA+AASFGAAGAGLTGSK+ARR+GDVDEF F+ IG NHN+GRLAV
Sbjct  303   GFAAAAAATGTAAGSVAIAASFGAAGAGLTGSKMARRIGDVDEFGFEAIGDNHNQGRLAV  362

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
              I+I+G +FEE DF RPW     +LERY+L+WE+K LMAVS AI++WLT+++A ELMKRG
Sbjct  363   AIVISGIIFEEDDFTRPWIFPDADLERYSLRWETKILMAVSSAIQDWLTTAVAKELMKRG  422

Query  909   AMMTVLSSFLTALA  868
             AMMTVLS  L ALA
Sbjct  423   AMMTVLSGLLAALA  436



>ref|XP_002968294.1| hypothetical protein SELMODRAFT_170005 [Selaginella moellendorffii]
 gb|EFJ30548.1| hypothetical protein SELMODRAFT_170005 [Selaginella moellendorffii]
Length=607

 Score =   224 bits (572),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS WTIAVDRSDKAG +LA  L  GL G RPVTL+GFSLGARVIF CL+ LA  GN  
Sbjct  447  FIDSRWTIAVDRSDKAGEILANCLLSGLHGSRPVTLLGFSLGARVIFSCLEHLAKKGN-G  505

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VERVVLLGAP+ +    W   RK+VAGRF+N YS+NDW+LG+++RAS+LSQGLAGIQP
Sbjct  506  GIVERVVLLGAPLSLDRKRWMNARKIVAGRFVNCYSSNDWILGVIYRASILSQGLAGIQP  565

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V +PG+ENV+VT LI GHS+YL    EILE + LD Y+PVF
Sbjct  566  VALPGIENVNVTHLITGHSSYLSKIPEILETIHLDNYFPVF  606


 Score =   144 bits (364),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/194 (71%), Positives = 164/194 (85%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             AE+ KS+W+KW+RG +IGAAA+TGGTL+AITGGLAAPAIAAG  ALAP  GT+VP+IGAS
Sbjct  243   AEAEKSKWSKWKRGSLIGAAAVTGGTLLAITGGLAAPAIAAGLAALAPAAGTVVPIIGAS  302

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A A G+  GSVA+AASFGAAGAGLTGSK+ARR+GDVDEF F+ IG NHN+GRLAV
Sbjct  303   GFAAAAAATGTAAGSVAIAASFGAAGAGLTGSKMARRIGDVDEFGFEAIGDNHNQGRLAV  362

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
              I+I+G +FEE DF RPW     +LERY+L+WE+  LMAVS AI++WLT+++A ELMKRG
Sbjct  363   AIVISGIIFEEDDFTRPWIFPDADLERYSLRWETNVLMAVSSAIQDWLTTAVAKELMKRG  422

Query  909   AMMTVLSSFLTALA  868
             AMMTVLS  L ALA
Sbjct  423   AMMTVLSGLLAALA  436



>ref|XP_007136056.1| hypothetical protein PHAVU_009G014300g [Phaseolus vulgaris]
 ref|XP_007136057.1| hypothetical protein PHAVU_009G014300g [Phaseolus vulgaris]
 gb|ESW08050.1| hypothetical protein PHAVU_009G014300g [Phaseolus vulgaris]
 gb|ESW08051.1| hypothetical protein PHAVU_009G014300g [Phaseolus vulgaris]
Length=623

 Score =   237 bits (604),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 134/166 (81%), Gaps = 1/166 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNNA  656
            IDS+W IAVDRSDKAG +L+EVL  GLQG+RPVTLVGFSLGARVIFKCLQ LA S G+NA
Sbjct  456  IDSKWAIAVDRSDKAGKVLSEVLLTGLQGNRPVTLVGFSLGARVIFKCLQCLADSKGDNA  515

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VERVVLLGAPI I D NW   RK+VAGRF+N YS+NDW LGI FRASL SQGLAGIQ 
Sbjct  516  GIVERVVLLGAPISIADENWATARKIVAGRFVNAYSSNDWTLGITFRASLFSQGLAGIQS  575

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRASR  338
            VD+ G+ENVDVT LI+GHS+Y+  +Q+IL+ LQLD    +     R
Sbjct  576  VDIHGIENVDVTHLIEGHSSYIRMTQKILDQLQLDNCCSISASEKR  621


 Score =   125 bits (315),  Expect(2) = 2e-90, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+A R+G+++EFE K++G   N+G LA+ I I+G  F E DF  PWEG  +N+ERY LQ+
Sbjct  344   KMATRIGNLEEFELKSVG-GANQGHLAIRISISGHAFAEKDFVEPWEGLNDNMERYVLQY  402

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+A+S A+R+WLTS IA+ LMK GAMMT+L S +TALA
Sbjct  403   ESKNLIALSTAVRDWLTSQIAIRLMKDGAMMTILGSLVTALA  444



>gb|KJB29621.1| hypothetical protein B456_005G110800 [Gossypium raimondii]
Length=671

 Score =   239 bits (611),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNN  659
             IDS W IAVDRSDKAG LLAE+L  GLQGHRPVTLVGFSLGARVI KCLQ LA + G+N
Sbjct  489  LIDSAWAIAVDRSDKAGKLLAELLISGLQGHRPVTLVGFSLGARVILKCLQCLAETQGDN  548

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AGLVERVVLLGAPI I+D  WE  RK+VAGRF+NVY TNDW LGI+FRAS+LS GLAGIQ
Sbjct  549  AGLVERVVLLGAPIPIKDEKWEDARKMVAGRFVNVYHTNDWTLGIIFRASVLSTGLAGIQ  608

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PV + G+ENVD TE ++GHS+YLW ++EIL  L +D Y  +F
Sbjct  609  PVQLRGIENVDATEYVEGHSSYLWMTKEILRQLDVDNYNAIF  650


 Score =   118 bits (295),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -1

Query  1161  RMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKH  982
             R+ D+DEFEF   G  HN+GRLAV ILI+G  FEE DF RPWE   +NLERY L+WESK+
Sbjct  381   RIEDLDEFEFIQTGLYHNQGRLAVGILISGIAFEEEDFLRPWENYNDNLERYVLKWESKN  440

Query  981   LMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFL  880
             L+A++  I  W+TS +A  L++ GAM+TVLS+ L
Sbjct  441   LIALNAGIMEWITSKVASNLLQGGAMLTVLSTLL  474



>gb|KJB29620.1| hypothetical protein B456_005G110800 [Gossypium raimondii]
Length=666

 Score =   239 bits (611),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNN  659
             IDS W IAVDRSDKAG LLAE+L  GLQGHRPVTLVGFSLGARVI KCLQ LA + G+N
Sbjct  484  LIDSAWAIAVDRSDKAGKLLAELLISGLQGHRPVTLVGFSLGARVILKCLQCLAETQGDN  543

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AGLVERVVLLGAPI I+D  WE  RK+VAGRF+NVY TNDW LGI+FRAS+LS GLAGIQ
Sbjct  544  AGLVERVVLLGAPIPIKDEKWEDARKMVAGRFVNVYHTNDWTLGIIFRASVLSTGLAGIQ  603

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PV + G+ENVD TE ++GHS+YLW ++EIL  L +D Y  +F
Sbjct  604  PVQLRGIENVDATEYVEGHSSYLWMTKEILRQLDVDNYNAIF  645


 Score =   118 bits (295),  Expect(2) = 4e-89, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -1

Query  1161  RMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKH  982
             R+ D+DEFEF   G  HN+GRLAV ILI+G  FEE DF RPWE   +NLERY L+WESK+
Sbjct  376   RIEDLDEFEFIQTGLYHNQGRLAVGILISGIAFEEEDFLRPWENYNDNLERYVLKWESKN  435

Query  981   LMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFL  880
             L+A++  I  W+TS +A  L++ GAM+TVLS+ L
Sbjct  436   LIALNAGIMEWITSKVASNLLQGGAMLTVLSTLL  469



>gb|KJB29619.1| hypothetical protein B456_005G110800 [Gossypium raimondii]
Length=615

 Score =   240 bits (612),  Expect(2) = 5e-89, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNN  659
             IDS W IAVDRSDKAG LLAE+L  GLQGHRPVTLVGFSLGARVI KCLQ LA + G+N
Sbjct  433  LIDSAWAIAVDRSDKAGKLLAELLISGLQGHRPVTLVGFSLGARVILKCLQCLAETQGDN  492

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AGLVERVVLLGAPI I+D  WE  RK+VAGRF+NVY TNDW LGI+FRAS+LS GLAGIQ
Sbjct  493  AGLVERVVLLGAPIPIKDEKWEDARKMVAGRFVNVYHTNDWTLGIIFRASVLSTGLAGIQ  552

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PV + G+ENVD TE ++GHS+YLW ++EIL  L +D Y  +F
Sbjct  553  PVQLRGIENVDATEYVEGHSSYLWMTKEILRQLDVDNYNAIF  594


 Score =   117 bits (294),  Expect(2) = 5e-89, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -1

Query  1161  RMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKH  982
             R+ D+DEFEF   G  HN+GRLAV ILI+G  FEE DF RPWE   +NLERY L+WESK+
Sbjct  325   RIEDLDEFEFIQTGLYHNQGRLAVGILISGIAFEEEDFLRPWENYNDNLERYVLKWESKN  384

Query  981   LMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFL  880
             L+A++  I  W+TS +A  L++ GAM+TVLS+ L
Sbjct  385   LIALNAGIMEWITSKVASNLLQGGAMLTVLSTLL  418



>gb|KDO71092.1| hypothetical protein CISIN_1g006082mg [Citrus sinensis]
Length=609

 Score =   177 bits (450),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 84/108 (78%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             IDS+WTIAVDRSDKAG LLAEVL +GLQG+RPVTL+G+SLGARVIFKCL+ LA +  NA
Sbjct  498  LIDSKWTIAVDRSDKAGKLLAEVLMQGLQGYRPVTLIGYSLGARVIFKCLENLAENECNA  557

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRA  512
            G+VERVVLLGAPI I+D NWEAVRK+VAGRFIN Y+TNDW L I FRA
Sbjct  558  GIVERVVLLGAPISIKDQNWEAVRKMVAGRFINCYATNDWTLAIAFRA  605


 Score =   167 bits (424),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 177/194 (91%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A SS+S+WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAGF ALAPTLGTL+PVIGAS
Sbjct  294   ATSSESKWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGFSALAPTLGTLIPVIGAS  353

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+G VDEFEFK IG+N N+GRLAV
Sbjct  354   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRIGSVDEFEFKAIGENQNQGRLAV  413

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EILI+G VF++ DF RPWEG+ +N+ERY LQWESK+L+AVS AI++WLTS IA+ELMK+G
Sbjct  414   EILISGVVFDQEDFVRPWEGQNDNMERYVLQWESKNLIAVSTAIQDWLTSRIAMELMKQG  473

Query  909   AMMTVLSSFLTALA  868
             AMMTVL + L ALA
Sbjct  474   AMMTVLKTLLAALA  487



>ref|XP_008668853.1| PREDICTED: putative DUF726-domain family protein isoform X1 [Zea 
mays]
Length=621

 Score =   202 bits (513),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 122/161 (76%), Gaps = 3/161 (2%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LA+VL KGLQG RPVTLVGFSLGARV+FKCLQ LA  GNN 
Sbjct  456  FIDSKWSVAIDRSDKAGKMLADVLLKGLQGSRPVTLVGFSLGARVVFKCLQELAQLGNNV  515

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VER VL+GAP+ ++   WE  RK+VAGRF+NVYSTNDW+LG+ FRA            
Sbjct  516  GIVERAVLIGAPVSVQGEMWEPARKMVAGRFVNVYSTNDWILGVTFRARFGRHPGRACPW  575

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
               P    VDVTEL+ GHS+YL   Q+IL+ L+L+TYYPVF
Sbjct  576  SREP---QVDVTELVVGHSSYLSLLQKILDHLELNTYYPVF  613


 Score =   141 bits (355),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  SRW  W+RGGIIGAAALTGGTLMAI+GGLAAPAIAAGF AL PTL TLVP+IGASGF
Sbjct  254   SPNSRWENWKRGGIIGAAALTGGTLMAISGGLAAPAIAAGFTALVPTLHTLVPLIGASGF  313

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+ATAAG   GSVAVAASFGAAGAGLTG+K+A R+G+V EFEFKTIGQNH++GRLAV I
Sbjct  314   AAIATAAGHTAGSVAVAASFGAAGAGLTGTKMATRIGNVKEFEFKTIGQNHSQGRLAVGI  373

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
              ++GF F E D+ +PWEG   NLERY LQWESKH++ VS AI++WL S +A+ELM+ GAM
Sbjct  374   FVSGFAFSEDDYSKPWEGWKTNLERYVLQWESKHVIGVSTAIQDWLASRVAIELMREGAM  433

Query  903   MTVLSSFLTALA  868
              TVL+  ++A A
Sbjct  434   QTVLNGIISAFA  445



>ref|XP_008668907.1| PREDICTED: putative DUF726-domain family protein isoform X2 [Zea 
mays]
Length=605

 Score =   199 bits (506),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LA+VL KGLQG RPVTLVGFSLGARV+FKCLQ LA  GNN 
Sbjct  456  FIDSKWSVAIDRSDKAGKMLADVLLKGLQGSRPVTLVGFSLGARVVFKCLQELAQLGNNV  515

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VER VL+GAP+ ++   WE  RK+VAGRF+NVYSTNDW+LG+ FRASL +QGLAGIQ 
Sbjct  516  GIVERAVLIGAPVSVQGEMWEPARKMVAGRFVNVYSTNDWILGVTFRASLFTQGLAGIQD  575

Query  475  VDVPGVEN  452
            V VPGVEN
Sbjct  576  VHVPGVEN  583


 Score =   141 bits (356),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  SRW  W+RGGIIGAAALTGGTLMAI+GGLAAPAIAAGF AL PTL TLVP+IGASGF
Sbjct  254   SPNSRWENWKRGGIIGAAALTGGTLMAISGGLAAPAIAAGFTALVPTLHTLVPLIGASGF  313

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+ATAAG   GSVAVAASFGAAGAGLTG+K+A R+G+V EFEFKTIGQNH++GRLAV I
Sbjct  314   AAIATAAGHTAGSVAVAASFGAAGAGLTGTKMATRIGNVKEFEFKTIGQNHSQGRLAVGI  373

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
              ++GF F E D+ +PWEG   NLERY LQWESKH++ VS AI++WL S +A+ELM+ GAM
Sbjct  374   FVSGFAFSEDDYSKPWEGWKTNLERYVLQWESKHVIGVSTAIQDWLASRVAIELMREGAM  433

Query  903   MTVLSSFLTALA  868
              TVL+  ++A A
Sbjct  434   QTVLNGIISAFA  445



>gb|KEH20390.1| transmembrane and coiled-coil protein [Medicago truncatula]
Length=262

 Score =   174 bits (442),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA++RS+KAG LLAEVL KGLQG+RPVTLVG+SLGARVIF CLQ LA + N A
Sbjct  131  FIDSKWTIAINRSNKAGKLLAEVLLKGLQGNRPVTLVGYSLGARVIFSCLQCLAKTENGA  190

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRAS  509
             LVERVVLLGAPI IRD NWEA RK+VAGRF+N YS NDW+LG+ FRAS
Sbjct  191  ELVERVVLLGAPISIRDENWEAARKMVAGRFVNAYSRNDWILGVAFRAS  239


 Score =   160 bits (406),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR+G VDEF+FK IG+NHN+GRL VEILI+GFVFE+ DF RPWEG  +NLERY+LQW
Sbjct  19    KMARRVGGVDEFDFKPIGENHNQGRLGVEILISGFVFEKEDFIRPWEGLNDNLERYSLQW  78

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+AVS AI++WLTS +A++LMK+GAMMTVLS+ +TALA
Sbjct  79    ESKNLIAVSTAIQDWLTSRLAMQLMKQGAMMTVLSTLVTALA  120



>gb|KHN01737.1| Transmembrane and coiled-coil domain-containing protein 4 [Glycine 
soja]
Length=276

 Score =   222 bits (566),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 134/166 (81%), Gaps = 7/166 (4%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FI+S+WTIA++RS+KAG LLAEVL +G QG+RP TL+G+SLGARVIFKCLQ LA + N A
Sbjct  114  FINSKWTIAINRSNKAGKLLAEVLLRGYQGNRPETLIGYSLGARVIFKCLQYLAKTENGA  173

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRAS-LLSQGLAGIQ  479
             LVE+VVLLGAPI I+D N EA RK+VAGRF+N YS NDWMLG+ FRAS LL++GLAGIQ
Sbjct  174  ELVEKVVLLGAPIPIKDENGEAARKMVAGRFVNAYSRNDWMLGVAFRASRLLTKGLAGIQ  233

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVFGRAS  341
            PVD+PG++NV        HS+  W +Q+IL+ LQLDTYYPV+   S
Sbjct  234  PVDIPGIQNVRC------HSSNPWATQKILDQLQLDTYYPVYNNIS  273


 Score =   112 bits (281),  Expect(2) = 3e-82, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 67/82 (82%), Gaps = 1/82 (1%)
 Frame = -1

Query  1128  TIGQNHN-KGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRN  952
             T+G N    G + VEIL + FVFE+ DF RPWEG+  NLERYALQWESK+L+AVS AI++
Sbjct  16    TLGSNSLLSGGVGVEILASRFVFEKEDFIRPWEGQNYNLERYALQWESKNLIAVSTAIQD  75

Query  951   WLTSSIALELMKRGAMMTVLSS  886
             WLTS +A+ELMKRGAMMTVLSS
Sbjct  76    WLTSRLAMELMKRGAMMTVLSS  97



>ref|XP_004512101.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Cicer arietinum]
Length=609

 Score =   171 bits (434),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 95/111 (86%), Gaps = 0/111 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W+IA+DRSDKAG LLAEVL  GLQG+RPVTL+G+SLGARVIFKCL++LA + N+A
Sbjct  497  FIDSTWSIAIDRSDKAGKLLAEVLLGGLQGNRPVTLIGYSLGARVIFKCLEVLAETENHA  556

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLL  503
             LVERVVLLGAPI I++ NW+A RK+VAGRFIN YS  DWMLG+ FRA  +
Sbjct  557  ELVERVVLLGAPIAIKNENWKAARKMVAGRFINAYSRTDWMLGVAFRARYM  607


 Score =   162 bits (410),  Expect(2) = 7e-82, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S +S WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAG GALAPTLGTL+PVIGASG
Sbjct  294   QSKESSWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGLGALAPTLGTLIPVIGASG  353

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAG+VVGSVAVAASFGAAGAGLTGSK+ARR+G VDEFEF+ IG+NHN+GRL VE
Sbjct  354   FAAAASAAGTVVGSVAVAASFGAAGAGLTGSKMARRVGSVDEFEFRAIGENHNQGRLGVE  413

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+GFVFE++DF RPWEG+ +NLERYALQWESK+L+AVS AI++WLTS IA+ELMK+GA
Sbjct  414   ILISGFVFEDADFIRPWEGQNDNLERYALQWESKNLIAVSTAIQDWLTSRIAMELMKQGA  473

Query  906   MMTVL  892
             M+TVL
Sbjct  474   MLTVL  478



>ref|XP_006380790.1| hypothetical protein POPTR_0007s13750g [Populus trichocarpa]
 gb|ERP58587.1| hypothetical protein POPTR_0007s13750g [Populus trichocarpa]
Length=621

 Score =   174 bits (441),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 95/110 (86%), Gaps = 0/110 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+WTIA+DRSDKAG LLAEVL KGLQG+RPVTLVG+SLGARVIFKCL+ LA + ++A
Sbjct  511  FIDSKWTIAIDRSDKAGKLLAEVLLKGLQGNRPVTLVGYSLGARVIFKCLETLAETEHSA  570

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASL  506
             +VERVVLLGAPI I+D  WEA RK+VAGRF+N YST DW LG+ FRAS 
Sbjct  571  EVVERVVLLGAPISIKDQKWEAARKMVAGRFVNAYSTGDWTLGVAFRASF  620


 Score =   159 bits (401),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S KS+WAKW+RGGIIGAAA+TGGTL+AITGGLAAPAIAAGFGALAPTLGT++PVIGASG
Sbjct  308   KSPKSKWAKWKRGGIIGAAAITGGTLLAITGGLAAPAIAAGFGALAPTLGTIIPVIGASG  367

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAG+V GSVAVAASFGAAGAGL G+K+ARR G VDEFEFK +G NHN+GRLAV 
Sbjct  368   FAAAASAAGTVAGSVAVAASFGAAGAGLAGTKMARRTGSVDEFEFKAVGDNHNQGRLAVG  427

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             I+++G VF+E DF +PWEG+ +NLERYAL WE K+L+AVS AI++WLTS IA+E M++GA
Sbjct  428   IMVSGCVFDEEDFIKPWEGQNDNLERYALHWEPKNLIAVSTAIQDWLTSRIAMEFMRQGA  487

Query  906   MMTVLSSFLTALA  868
             M+TVLS+ L ALA
Sbjct  488   MLTVLSTLLVALA  500



>ref|XP_002464384.1| hypothetical protein SORBIDRAFT_01g017280 [Sorghum bicolor]
 gb|EER91382.1| hypothetical protein SORBIDRAFT_01g017280 [Sorghum bicolor]
Length=578

 Score =   189 bits (480),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 118/161 (73%), Gaps = 22/161 (14%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LAEVL  GLQG R              F CLQ+        
Sbjct  435  FIDSKWSVAIDRSDKAGKMLAEVLLNGLQGSR--------------FFCLQL--------  472

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            G+VER VL+GAP+ ++   WE  RK+VAGRF+NVYSTNDW+LGI FRASL +QGLAGIQ 
Sbjct  473  GIVERAVLIGAPVSVQGEMWEPARKMVAGRFVNVYSTNDWILGITFRASLFTQGLAGIQD  532

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            V VPGVENVDVTEL+ GHS+YL   ++IL+ L+L+TYYPVF
Sbjct  533  VHVPGVENVDVTELVVGHSSYLSLLEKILDHLELNTYYPVF  573


 Score =   143 bits (361),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 81/102 (79%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+A R+G+V EFEFKTIGQNHN+GRLAV I I+GF F E D+ +PWEG   NLERY LQW
Sbjct  323   KMATRIGNVKEFEFKTIGQNHNQGRLAVGIFISGFAFSEDDYSKPWEGWKTNLERYILQW  382

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESKH++ VS AI++WL S +A+ELM+ GAM TVLS  ++A A
Sbjct  383   ESKHVIGVSTAIQDWLASRLAIELMREGAMQTVLSGIISAFA  424



>ref|XP_006297154.1| hypothetical protein CARUB_v10013157mg [Capsella rubella]
 gb|EOA30052.1| hypothetical protein CARUB_v10013157mg [Capsella rubella]
Length=626

 Score =   177 bits (448),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 95/108 (88%), Gaps = 0/108 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAE L+KGLQG+RPVTLVGFSLGARVIFKCLQ LA +  NA
Sbjct  497  FIDSKWSIAIDRSDKAGKLLAEALRKGLQGNRPVTLVGFSLGARVIFKCLQTLAETEKNA  556

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRA  512
             +VERVVLLGAPI I++ NW  +RK+VAGRFINVY+TNDW LG+ FRA
Sbjct  557  EIVERVVLLGAPISIKNENWPDIRKMVAGRFINVYATNDWTLGVAFRA  604


 Score =   155 bits (393),  Expect(2) = 1e-81, Method: Compositional matrix adjust.
 Identities = 143/192 (74%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  + WAKW+RGGI+GAAALTGG LMAITGGLAAPAIAAGFG+LAPTLGT+VPVIGASGF
Sbjct  295   SPNTEWAKWKRGGIVGAAALTGGALMAITGGLAAPAIAAGFGSLAPTLGTIVPVIGASGF  354

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A AAG+V GSVAVAASFGAAGAGLTG+K+ARR GD++EFEFK IG+NHN+GRLAVEI
Sbjct  355   AAAAEAAGTVAGSVAVAASFGAAGAGLTGTKMARRTGDIEEFEFKAIGENHNQGRLAVEI  414

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ GFV +E DF +PWEG  +NLERY +QWESK+++AVS AI++WLTS +A+ELM++GAM
Sbjct  415   LVAGFVLKEEDFVKPWEGLTSNLERYTVQWESKNVIAVSTAIQDWLTSRVAMELMRQGAM  474

Query  903   MTVLSSFLTALA  868
              TVL+S L A+A
Sbjct  475   HTVLNSLLAAMA  486



>gb|KJB29622.1| hypothetical protein B456_005G110800 [Gossypium raimondii]
Length=579

 Score =   240 bits (612),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNN  659
             IDS W IAVDRSDKAG LLAE+L  GLQGHRPVTLVGFSLGARVI KCLQ LA + G+N
Sbjct  397  LIDSAWAIAVDRSDKAGKLLAELLISGLQGHRPVTLVGFSLGARVILKCLQCLAETQGDN  456

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AGLVERVVLLGAPI I+D  WE  RK+VAGRF+NVY TNDW LGI+FRAS+LS GLAGIQ
Sbjct  457  AGLVERVVLLGAPIPIKDEKWEDARKMVAGRFVNVYHTNDWTLGIIFRASVLSTGLAGIQ  516

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PV + G+ENVD TE ++GHS+YLW ++EIL  L +D Y  +F
Sbjct  517  PVQLRGIENVDATEYVEGHSSYLWMTKEILRQLDVDNYNAIF  558


 Score = 89.4 bits (220),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -1

Query  1095  AVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMK  916
              V ILI+G  FEE DF RPWE   +NLERY L+WESK+L+A++  I  W+TS +A  L++
Sbjct  311   GVGILISGIAFEEEDFLRPWENYNDNLERYVLKWESKNLIALNAGIMEWITSKVASNLLQ  370

Query  915   RGAMMTVLSSFL  880
              GAM+TVLS+ L
Sbjct  371   GGAMLTVLSTLL  382



>ref|NP_195344.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAA18127.1| putative protein [Arabidopsis thaliana]
 emb|CAB80292.1| putative protein [Arabidopsis thaliana]
 gb|AEE86634.1| uncharacterized protein AT4G36210 [Arabidopsis thaliana]
Length=516

 Score =   167 bits (424),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 109/163 (67%), Gaps = 38/163 (23%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W+IA+DRSDKAG LLAEVLQKGLQG+R                C           
Sbjct  386  FIDSKWSIAIDRSDKAGRLLAEVLQKGLQGNR-----------YRFHDCCN---------  425

Query  655  GLVERVVLLGAPIRIRDVNWEAVRK--VVAGRFINVYSTNDWMLGIVFRASLLSQGLAGI  482
                            +VN  ++ K  +VAGRFINVY+TNDW LGI FRASL+SQGLAGI
Sbjct  426  ----------------EVNIISIFKSYMVAGRFINVYATNDWTLGIAFRASLISQGLAGI  469

Query  481  QPVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            QP+ +PG+ENVDVT++++GHS+YLW +Q+ILE L++DTYYPVF
Sbjct  470  QPICIPGIENVDVTDMVEGHSSYLWKTQQILERLEIDTYYPVF  512


 Score =   157 bits (397),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             +  + WAKW+RGGIIGAAA+TGGTLMAITGGLAAPAIAAGFGALAPTLGT++PVIGA GF
Sbjct  184   TPTTSWAKWKRGGIIGAAAITGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGAGGF  243

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+GD+DEFEFK IG+NHN+GRLAVE+
Sbjct  244   AAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRIGDLDEFEFKAIGENHNQGRLAVEV  303

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ G VFEE DF +PWEG  +NLERY LQWESK+L+ VS AI++WLTS +A+ELMK+GAM
Sbjct  304   LVAGVVFEEEDFVKPWEGLTSNLERYTLQWESKNLILVSTAIQDWLTSRLAMELMKQGAM  363

Query  903   MTVLSSFLTALA  868
              TVL+S L ALA
Sbjct  364   HTVLASLLMALA  375



>ref|XP_010489506.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Camelina sativa]
Length=661

 Score =   166 bits (419),  Expect(3) = 2e-78, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 95/115 (83%), Gaps = 1/115 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+ +IA+DRSDKAG LLAE L+KGLQG+RP  LVGFSLGARV+FKCLQ LA +  NA
Sbjct  497  FIDSKRSIAIDRSDKAGKLLAEALRKGLQGNRPA-LVGFSLGARVVFKCLQTLAETEKNA  555

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGL  491
             +VERVVLLGAPI I++ NW  VRK+VAGRFINVY+TNDW LG+ FRAS    GL
Sbjct  556  EIVERVVLLGAPISIKNENWRDVRKMVAGRFINVYATNDWTLGVAFRASWNPTGL  610


 Score =   155 bits (391),  Expect(3) = 2e-78, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  S WAKW+RGGI+GAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGT++PVIGASGF
Sbjct  295   SPNSEWAKWKRGGIVGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGASGF  354

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A AAG+V GSVAVAASFGAAGAGLT +K+ARR GD++EFEFK IG+NHN+GRLAVEI
Sbjct  355   AAAAEAAGTVAGSVAVAASFGAAGAGLTETKMARRTGDIEEFEFKAIGENHNQGRLAVEI  414

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ GFV +E DF +PWEG  +NLERY +QWESK+++AVS AI++WLTS +A+ELM++GAM
Sbjct  415   LVAGFVLKEEDFVKPWEGLTSNLERYTVQWESKNIIAVSTAIQDWLTSRVAMELMRQGAM  474

Query  903   MTVLSSFLTAL  871
              TVL+S L A+
Sbjct  475   HTVLNSLLVAM  485


 Score = 22.7 bits (47),  Expect(3) = 2e-78, Method: Compositional matrix adjust.
 Identities = 11/20 (55%), Positives = 12/20 (60%), Gaps = 0/20 (0%)
 Frame = -2

Query  497  RASWDSTG*CSWSREC*CNR  438
            RASW+ TG     R C CNR
Sbjct  602  RASWNPTGLYPRDRGCGCNR  621



>ref|XP_008387987.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Malus domestica]
Length=190

 Score =   253 bits (647),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNN  659
             IDS+W +AVDRSDKAG +LAEVL  GLQG RPVTLVGFSLGARVIFKCLQ LA + G+N
Sbjct  11   LIDSKWAVAVDRSDKAGKMLAEVLLNGLQGGRPVTLVGFSLGARVIFKCLQSLAETEGDN  70

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
            AGLVERVVLLGAP+ + + NW   RK+VAGRF+N YS NDW LGI FRASLLSQGL GIQ
Sbjct  71   AGLVERVVLLGAPVSVEEENWSDARKMVAGRFVNAYSINDWTLGIAFRASLLSQGLGGIQ  130

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            PVDVPG+ENVDVT++++GHS+YLW +++ILE L+LD+YYPVF
Sbjct  131  PVDVPGIENVDVTQIVEGHSSYLWKTKQILEQLELDSYYPVF  172



>ref|XP_010489505.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Camelina sativa]
Length=663

 Score =   165 bits (417),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 98/122 (80%), Gaps = 2/122 (2%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+ +IA+DRSDKAG LLAE L+KGLQG+RP  LVGFSLGARV+FKCLQ LA +  NA
Sbjct  497  FIDSKRSIAIDRSDKAGKLLAEALRKGLQGNRPA-LVGFSLGARVVFKCLQTLAETEKNA  555

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             +VERVVLLGAPI I++ NW  VRK+VAGRFINVY+TNDW LG+ FRA  +S    G+ P
Sbjct  556  EIVERVVLLGAPISIKNENWRDVRKMVAGRFINVYATNDWTLGVAFRAR-ISWNPTGLYP  614

Query  475  VD  470
             D
Sbjct  615  RD  616


 Score =   155 bits (391),  Expect(2) = 8e-78, Method: Compositional matrix adjust.
 Identities = 143/191 (75%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S  S WAKW+RGGI+GAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGT++PVIGASGF
Sbjct  295   SPNSEWAKWKRGGIVGAAALTGGTLMAITGGLAAPAIAAGFGALAPTLGTIIPVIGASGF  354

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA A AAG+V GSVAVAASFGAAGAGLT +K+ARR GD++EFEFK IG+NHN+GRLAVEI
Sbjct  355   AAAAEAAGTVAGSVAVAASFGAAGAGLTETKMARRTGDIEEFEFKAIGENHNQGRLAVEI  414

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L+ GFV +E DF +PWEG  +NLERY +QWESK+++AVS AI++WLTS +A+ELM++GAM
Sbjct  415   LVAGFVLKEEDFVKPWEGLTSNLERYTVQWESKNIIAVSTAIQDWLTSRVAMELMRQGAM  474

Query  903   MTVLSSFLTAL  871
              TVL+S L A+
Sbjct  475   HTVLNSLLVAM  485



>gb|EMT20138.1| hypothetical protein F775_14016 [Aegilops tauschii]
Length=623

 Score =   163 bits (412),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS+WAKW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGT++PVIGASGF
Sbjct  284   SPKSKWAKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTIMPVIGASGF  343

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+ATAAGSV GSVAVAASFGAAGAGLTG+K+ARR+G V EFEFK IG+NHN+GRLAV I
Sbjct  344   AAMATAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGSVKEFEFKPIGENHNQGRLAVGI  403

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GF F+E D+ RPWEG  +NLERY LQWESKH++AVS AI++WLTS +ALELMK+GAM
Sbjct  404   LVSGFAFDEEDYIRPWEGWKDNLERYILQWESKHIIAVSTAIQDWLTSRLALELMKQGAM  463

Query  903   MTVLSSFLTALA  868
              TVLS FL A A
Sbjct  464   RTVLSGFLAAFA  475


 Score =   156 bits (395),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 107/161 (66%), Gaps = 32/161 (20%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS+W++A+DRSDKAG +LA+VL KG QG+  +           IFK L       N A
Sbjct  486  FIDSKWSVAIDRSDKAGKMLADVLMKGSQGNSCM---------HAIFKDL-------NLA  529

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
             L     L                ++VAGRF+NVYS +DW+LG+ FRASLL+QGLAGIQ 
Sbjct  530  TLFAWTWL----------------QMVAGRFVNVYSKDDWILGVTFRASLLTQGLAGIQA  573

Query  475  VDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPVF  353
            VDVPGVENVDVTEL+DGHS+YL  +Q ILE L+L+TYYPVF
Sbjct  574  VDVPGVENVDVTELVDGHSSYLSAAQLILEHLELNTYYPVF  614



>gb|KDP46691.1| hypothetical protein JCGZ_06479 [Jatropha curcas]
Length=609

 Score =   156 bits (394),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 89/102 (87%), Gaps = 0/102 (0%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             K+ARR G VDEFEFK IG+NHN+GRLAV I+++GFVF+E DF RPWEG+ + LERY LQW
Sbjct  343   KMARRTGSVDEFEFKAIGENHNQGRLAVGIMVSGFVFDEGDFVRPWEGQNDILERYVLQW  402

Query  993   ESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             ESK+L+AVS AI++ LTSSIAL LMK+GAMMTVLS+ +TALA
Sbjct  403   ESKNLIAVSTAIQDLLTSSIALGLMKQGAMMTVLSTLVTALA  444


 Score =   149 bits (375),  Expect(2) = 3e-73, Method: Compositional matrix adjust.
 Identities = 81/147 (55%), Positives = 90/147 (61%), Gaps = 39/147 (27%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FIDS W IA+DRSDKAG LLA+VL KGLQG+RPVTLVG+SLGARVIFKCL+ LA +   A
Sbjct  455  FIDSTWPIAIDRSDKAGKLLADVLLKGLQGNRPVTLVGYSLGARVIFKCLETLAETEYGA  514

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKV----------------------------------  578
             LVERVVLLGAPI I++  WEA RKV                                  
Sbjct  515  ELVERVVLLGAPISIKNEKWEAARKVIGVPSLEASFAISSRIFFLLHTFINPLQRPQSVY  574

Query  577  -----VAGRFINVYSTNDWMLGIVFRA  512
                 VAGRFIN YS NDW LG+ FRA
Sbjct  575  AVFQMVAGRFINAYSRNDWTLGVAFRA  601



>ref|XP_006601464.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like [Glycine max]
Length=258

 Score =   192 bits (487),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 112/129 (87%), Gaps = 1/129 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
            FI+S+WTIA++RS+KAG LLAEVL +G QG+RP TL+G+SLGARVIFKCLQ LA + N A
Sbjct  118  FINSKWTIAINRSNKAGKLLAEVLLRGYQGNRPETLIGYSLGARVIFKCLQYLAKTENGA  177

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRAS-LLSQGLAGIQ  479
             LVE+VVLLGAPI I+D N EA RK+VAGRF+N YS NDWMLG+ FRAS LL++GLAGIQ
Sbjct  178  ELVEKVVLLGAPIPIKDENGEAARKMVAGRFVNAYSRNDWMLGVAFRASRLLTKGLAGIQ  237

Query  478  PVDVPGVEN  452
            PVD+PG++N
Sbjct  238  PVDIPGIQN  246


 Score =   110 bits (274),  Expect(2) = 2e-72, Method: Compositional matrix adjust.
 Identities = 52/71 (73%), Positives = 62/71 (87%), Gaps = 0/71 (0%)
 Frame = -1

Query  1098  LAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELM  919
             + VEIL + FVFE+ DF RPWEG+  NLERYALQWESK+L+AVS AI++WLTS +A+ELM
Sbjct  31    VGVEILASRFVFEKEDFIRPWEGQNYNLERYALQWESKNLIAVSTAIQDWLTSRLAMELM  90

Query  918   KRGAMMTVLSS  886
             KRGAMMTVLSS
Sbjct  91    KRGAMMTVLSS  101



>gb|KEH36226.1| transmembrane and coiled-coil protein [Medicago truncatula]
Length=598

 Score =   176 bits (446),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 85/109 (78%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNN  659
             IDS+W +AVDRS+KAG +LAEVL KGLQG+RP TLVGFSLGARVIFKCLQ LA S G+N
Sbjct  487  LIDSKWAVAVDRSEKAGKVLAEVLLKGLQGNRPATLVGFSLGARVIFKCLQCLADSKGDN  546

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRA  512
            AGLVERVVLLGAPI I+D NWE  RK+VAGRF+N YSTNDW LGI FRA
Sbjct  547  AGLVERVVLLGAPISIKDENWEVARKMVAGRFVNAYSTNDWTLGITFRA  595


 Score =   120 bits (302),  Expect(2) = 7e-71, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 157/191 (82%), Gaps = 1/191 (1%)
 Frame = -1

Query  1440  SKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgfa  1261
             S++ W KW+RGGI+GAAA+TGGT+MAITGGLAAPAIA G GALAPTLG+++PVIGA GFA
Sbjct  287   SETSWDKWKRGGIVGAAAVTGGTVMAITGGLAAPAIAQGLGALAPTLGSIIPVIGAGGFA  346

Query  1260  avataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEIL  1081
             A ATA GSV GSVAVAASFGAAGAGLTGSK+A R+G ++EFE   +G  H +G LAV I 
Sbjct  347   AAATATGSVAGSVAVAASFGAAGAGLTGSKMATRIGSLEEFELIEVGGTH-RGHLAVRIS  405

Query  1080  ITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAMM  901
             I+G  FEE DF +PWEG  +N+ERY L++ESK L+A+S AI++WLTS I  ELMK GAMM
Sbjct  406   ISGLAFEEEDFIKPWEGHNDNMERYVLKYESKILIALSTAIQDWLTSKIMSELMKGGAMM  465

Query  900   TVLSSFLTALA  868
             TVLS+ + ALA
Sbjct  466   TVLSTLVAALA  476



>ref|XP_003612112.1| Transmembrane and coiled-coil domain-containing protein [Medicago 
truncatula]
Length=717

 Score =   240 bits (613),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = -3

Query  805  DRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAGLVERVVLLG  626
            + SDKAG LLAEVL  GLQG+RPVTL+G+SLGARVIFKCL+ LA + N+A LVERVVLLG
Sbjct  560  NTSDKAGKLLAEVLLGGLQGNRPVTLIGYSLGARVIFKCLECLAETENHAELVERVVLLG  619

Query  625  APIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPVDVPGVENVD  446
            API I+DVNWEA RK+VAGRFIN YS  DWMLG+ FRASLLSQGLAGIQP+D+PG++NVD
Sbjct  620  APIAIKDVNWEAARKMVAGRFINAYSRTDWMLGVAFRASLLSQGLAGIQPIDIPGIQNVD  679

Query  445  VTELIDGHSAYLWTSQEILELLQLDTYYPVFG  350
            VT+ I+GHS+YLW +Q+IL+ L+L+TYYPV+ 
Sbjct  680  VTDRIEGHSSYLWATQQILDELELETYYPVYN  711


 Score =   167 bits (423),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             A+S++S WAKW+RGGIIGAAALTGG LMAITGGLAAPAIAAG GALAPTLGTL+PVIGA 
Sbjct  301   AQSNESGWAKWKRGGIIGAAALTGGALMAITGGLAAPAIAAGLGALAPTLGTLIPVIGAG  360

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA A+AAG+V GSVAVAASFGAAGAGLTG+K+ARR+G VDEFEF+ IG NHN+GRLAV
Sbjct  361   GFAAAASAAGTVAGSVAVAASFGAAGAGLTGTKMARRVGSVDEFEFRAIGDNHNQGRLAV  420

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
             EIL++GFVFEE DF RPWEG+ +NLERYALQWESK+L+AVS AI++WLTS IA+ELMK+G
Sbjct  421   EILVSGFVFEEDDFVRPWEGQNDNLERYALQWESKNLIAVSTAIQDWLTSRIAMELMKQG  480

Query  909   AMMTVLS  889
             AMMTVLS
Sbjct  481   AMMTVLS  487



>gb|KHN41922.1| Transmembrane and coiled-coil domain-containing protein 4 [Glycine 
soja]
Length=231

 Score =   137 bits (344),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 79/93 (85%), Gaps = 0/93 (0%)
 Frame = -1

Query  1170  VARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWE  991
             +ARR+GDVDEFE K +G+NHN+GRL + I+++GFVFE+ DF RPWE   +NLERYALQWE
Sbjct  1     MARRVGDVDEFELKAVGKNHNQGRLGIMIMVSGFVFEDDDFIRPWEVLDDNLERYALQWE  60

Query  990   SKHLMAVSYAIRNWLTSSIALELMKRGAMMTVL  892
             SK+L ++S AI++WL+S IA ELMK+GA MTVL
Sbjct  61    SKNLFSLSTAIQDWLSSRIATELMKQGATMTVL  93


 Score =   134 bits (338),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 79/105 (75%), Gaps = 10/105 (10%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
             FIDS WTIA+DRSDKAG LLAEVL  GLQG+RPVTLVG           ++ LA + N+
Sbjct  111  EFIDSTWTIAIDRSDKAGKLLAEVLLGGLQGNRPVTLVG----------SIEFLAETENS  160

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGI  524
            A LVERVVLLG PI I+D NWEA RK+VAGRF+N YS NDWMLG+
Sbjct  161  AELVERVVLLGLPIAIKDENWEAARKMVAGRFVNAYSRNDWMLGV  205


 Score = 21.6 bits (44),  Expect(3) = 2e-63, Method: Compositional matrix adjust.
 Identities = 11/25 (44%), Positives = 13/25 (52%), Gaps = 0/25 (0%)
 Frame = -2

Query  524  CLSC*SPESRASWDSTG*CSWSREC  450
            C  C S  SR SW+ T  C W  +C
Sbjct  207  CFPCQSTFSRISWNPTRRCFWDPKC  231



>gb|AFW89820.1| putative DUF26 domain receptor-like protein kinase [Zea mays]
Length=853

 Score =   152 bits (384),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S +S+W KW+RGGIIGAAALTGG L+AITGGLAAPAIAAGFGALAPTLGTLVP IGASGF
Sbjct  584   SPRSKWEKWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFGALAPTLGTLVPFIGASGF  643

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+A AAGSV GSVAVAASFGAAGAGLTG+K+ARR+G V EFEFK IG NHN+GRLAV I
Sbjct  644   AAMAAAAGSVAGSVAVAASFGAAGAGLTGTKMARRIGKVKEFEFKPIGDNHNQGRLAVGI  703

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GF F+E DF++PWEG  +NLE+Y LQWESKH++AVS AI++WLTS +A+ELMK+GAM
Sbjct  704   LVSGFAFDEEDFWKPWEGWKDNLEKYILQWESKHIIAVSTAIQDWLTSRLAMELMKQGAM  763

Query  903   MTVLSSFLTALA  868
              TVLS  L A A
Sbjct  764   RTVLSGLLAAFA  775


 Score = 99.8 bits (247),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 54/59 (92%), Gaps = 0/59 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
            FIDS+W++A+DRSDKAG +LAEVL KGLQG+RPVTLVGFSLGARVIFKCLQ LA S +N
Sbjct  786  FIDSKWSVAIDRSDKAGKMLAEVLLKGLQGNRPVTLVGFSLGARVIFKCLQELALSSDN  844



>gb|KHG10124.1| Transmembrane and coiled-coil domain-containing 4 [Gossypium 
arboreum]
 gb|KHG17468.1| Transmembrane and coiled-coil domain-containing 4 [Gossypium 
arboreum]
Length=648

 Score =   130 bits (326),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 75/109 (69%), Gaps = 21/109 (19%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAAS-GNN  659
             IDS W IAVDR                    PVTL+GFSLGARVI KCLQ LA + G+N
Sbjct  484  LIDSAWAIAVDR--------------------PVTLIGFSLGARVILKCLQCLAETQGDN  523

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRA  512
            AGLVERV+LLGAPI I+D  WE  RK+VAGRF+NVY TNDW LGI+FRA
Sbjct  524  AGLVERVILLGAPIPIKDEKWEDARKMVAGRFVNVYHTNDWTLGIIFRA  572


 Score =   118 bits (295),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = -1

Query  1161  RMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKH  982
             R+ D+DEFEF   G  HN+GRLAV ILI+G  FEE DF RPWE   +NLERY L+WESK+
Sbjct  376   RIEDLDEFEFIQTGLYHNQGRLAVGILISGIAFEEEDFLRPWENYNDNLERYVLKWESKN  435

Query  981   LMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFL  880
             L+A++  I  W+TS +A  L++ GAM+TVLS+ L
Sbjct  436   LIALNAGITEWITSKVASNLLQGGAMLTVLSTLL  469



>ref|XP_006435098.1| hypothetical protein CICLE_v10003998mg [Citrus clementina]
 gb|ESR48338.1| hypothetical protein CICLE_v10003998mg [Citrus clementina]
Length=209

 Score =   117 bits (292),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             IDS+  +AV RSDKA  LLAEVL KGLQG+RPVTLVGF LGA VIFKCL+ LA +G+NA
Sbjct  120  LIDSKRAVAVVRSDKASELLAEVLTKGLQGNRPVTLVGFPLGAPVIFKCLKCLAETGDNA  179

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVA  572
            G VE VVLLG PI I+D  WE  RK  A
Sbjct  180  GFVEMVVLLGRPISIKDEKWEDARKAFA  207


 Score =   111 bits (277),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 77/109 (71%), Gaps = 8/109 (7%)
 Frame = -1

Query  1170  VARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWE  991
             +ARR+  ++EFEF+ I QNH +G LAV I+I+G VFE+  F +PWEG  + LERYAL WE
Sbjct  1     MARRIKSINEFEFQDIVQNHKQGHLAVGIMISGLVFEQEHFVQPWEGYKDYLERYALWWE  60

Query  990   SKHLMAVSYAIRNWLTSSIAL--------ELMKRGAMMTVLSSFLTALA  868
             S  L+A+S AI +WLTSS  +        +L+ +GAM+TVLS+ ++A A
Sbjct  61    SDKLIALSTAIEDWLTSSTLMNLVLVKLVKLISKGAMVTVLSTLVSAFA  109



>ref|XP_010933754.1| PREDICTED: uncharacterized membrane protein YFL034W-like isoform 
X4 [Elaeis guineensis]
Length=541

 Score =   160 bits (404),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 175/194 (90%), Gaps = 0/194 (0%)
 Frame = -1

Query  1449  AESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgas  1270
             ++S KS+WA+W+RGGIIGAAALTGG L+AITGGLAAPAIAAGF ALAPTLGTLVPVIGAS
Sbjct  301   SQSEKSKWARWKRGGIIGAAALTGGALLAITGGLAAPAIAAGFSALAPTLGTLVPVIGAS  360

Query  1269  gfaavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAV  1090
             GFAA+A+AAGSV GSVAVAASFGAAGAGL+GSK+ARR G V+EFEFK IG NHN+GRLAV
Sbjct  361   GFAAIASAAGSVAGSVAVAASFGAAGAGLSGSKMARRTGSVEEFEFKPIGDNHNQGRLAV  420

Query  1089  EILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRG  910
              IL+TGF FE+ DF +PWEG  +NLERY LQWESK+++AVS AI++W+TSS+ + LMK+G
Sbjct  421   GILVTGFAFEKEDFIKPWEGLEDNLERYVLQWESKYIIAVSTAIQDWITSSVTMGLMKQG  480

Query  909   AMMTVLSSFLTALA  868
             AM+TVLS+ ++ALA
Sbjct  481   AMLTVLSTLVSALA  494


 Score = 59.3 bits (142),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLV  725
            FIDS+WT+A+DRSDKAG LLAEVL KGLQG+R  + +
Sbjct  505  FIDSKWTMAIDRSDKAGKLLAEVLSKGLQGNRSASYI  541



>ref|XP_006573571.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Glycine max]
Length=536

 Score =   156 bits (395),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 146/185 (79%), Positives = 170/185 (92%), Gaps = 0/185 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S + +WAKW+RGGIIGAAALTGGTLMA+TGGLAAPAIAAG GALAPTLGTL+PVIGASG
Sbjct  297   QSKEDKWAKWKRGGIIGAAALTGGTLMAVTGGLAAPAIAAGLGALAPTLGTLIPVIGASG  356

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAG+V GSVAVAASFGAAGAGLTGSK+ARR+GDV+EFEFK +G+NHN+GRL VE
Sbjct  357   FAAAASAAGTVAGSVAVAASFGAAGAGLTGSKMARRVGDVEEFEFKAVGENHNQGRLGVE  416

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             I+I+GFVFE+ DF RPWEG  +NLERYAL+WESK+L A+S AI++WLTS IA ELMK+GA
Sbjct  417   IMISGFVFEDDDFIRPWEGLDDNLERYALKWESKNLFALSTAIQDWLTSRIATELMKQGA  476

Query  906   MMTVL  892
             MMTVL
Sbjct  477   MMTVL  481


 Score = 55.1 bits (131),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVT  731
             FIDS WTIA+DRSDKAG LLAEVL  GLQG+R +T
Sbjct  499  EFIDSTWTIAIDRSDKAGKLLAEVLLGGLQGNRLLT  534



>gb|KEF52411.1| hypothetical protein A1O9_11652 [Exophiala aquamarina CBS 119918]
Length=673

 Score =   155 bits (391),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 2/142 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             +D+ W++A  RSDKAG +LA+ L   +QG RPVTL+G+SLGAR+I+ CL  LA      
Sbjct  477  LVDNPWSVAASRSDKAGKVLAQALISRVQGERPVTLLGYSLGARLIYSCLDELA-DRRAY  535

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVE VVL GA      V W  +R VV+GR INVYSTND++LGI++R S L  G+AG+Q 
Sbjct  536  GLVESVVLAGAAAPSDSVTWRKLRAVVSGRLINVYSTNDYLLGILYRTSSLQYGIAGLQT  595

Query  475  V-DVPGVENVDVTELIDGHSAY  413
            + DVPG+ENVD + ++DGH+ Y
Sbjct  596  IEDVPGIENVDASSIVDGHTQY  617


 Score = 46.6 bits (109),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 24/80 (30%), Positives = 45/80 (56%), Gaps = 9/80 (11%)
 Frame = -1

Query  1152  DVDEFEFKTIGQNH---------NKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYAL  1000
             +VD+F F  + + H         +   L V I I+G++ +ES+  +PW+   N++E +AL
Sbjct  363   EVDDFAFIPLHKTHGFHIKDAEGDSRHLRVAIGISGYLNDESEVVKPWQVIGNSVEGFAL  422

Query  999   QWESKHLMAVSYAIRNWLTS  940
             +WE K L+ +  A+  ++ S
Sbjct  423   RWEVKSLVKLGSALTTYIRS  442



>ref|XP_004512102.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X3 [Cicer arietinum]
Length=515

 Score =   162 bits (411),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 151/185 (82%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  1446  ESSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasg  1267
             +S +S WAKW+RGGIIGAAALTGGTLMAITGGLAAPAIAAG GALAPTLGTL+PVIGASG
Sbjct  294   QSKESSWAKWKRGGIIGAAALTGGTLMAITGGLAAPAIAAGLGALAPTLGTLIPVIGASG  353

Query  1266  faavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVE  1087
             FAA A+AAG+VVGSVAVAASFGAAGAGLTGSK+ARR+G VDEFEF+ IG+NHN+GRL VE
Sbjct  354   FAAAASAAGTVVGSVAVAASFGAAGAGLTGSKMARRVGSVDEFEFRAIGENHNQGRLGVE  413

Query  1086  ILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGA  907
             ILI+GFVFE++DF RPWEG+ +NLERYALQWESK+L+AVS AI++WLTS IA+ELMK+GA
Sbjct  414   ILISGFVFEDADFIRPWEGQNDNLERYALQWESKNLIAVSTAIQDWLTSRIAMELMKQGA  473

Query  906   MMTVL  892
             M+TVL
Sbjct  474   MLTVL  478



>gb|EKV12492.1| hypothetical protein PDIG_44160 [Penicillium digitatum PHI26]
 gb|EKV16489.1| hypothetical protein PDIP_35390 [Penicillium digitatum Pd1]
Length=731

 Score =   145 bits (366),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 109/159 (69%), Gaps = 2/159 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            +D+ +++A  R+DKAG +LA+ L    QG RPVTL+G+SLG+R+IF CLQ L    +  G
Sbjct  479  VDNPFSVAKARADKAGEVLADALINKAQGERPVTLMGYSLGSRLIFSCLQSLEKR-DAYG  537

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            LVE V+++G+P      +W+ +R VV+GR +NV+S ND +L  ++R S L  G+AG+QPV
Sbjct  538  LVESVIMMGSPTPSDTQDWQKIRSVVSGRVVNVFSENDSVLAFLYRTSSLQLGVAGLQPV  597

Query  472  D-VPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYP  359
            + VPGVEN+DV+E+I GH  Y +   +IL L+ L    P
Sbjct  598  EGVPGVENLDVSEMISGHLRYQFLLGKILALIGLQDLDP  636


 Score = 48.5 bits (114),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 53/97 (55%), Gaps = 7/97 (7%)
 Frame = -1

Query  1146  DEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVS  967
             D  E K+  Q+H   RL V I +TG+V EES+F  PW     + E + L+WE + LM + 
Sbjct  378   DSSEKKSAEQDH---RLRVTIGVTGWVKEESNFVIPWRVIGADSEVFGLRWEMEPLMNLG  434

Query  966   YAIRNWLTS---SIA-LELMKRGAMMTVLSSFLTALA  868
              AI   +TS   S+A  E++ R    T++S+ +  L 
Sbjct  435   NAISALVTSAAWSVAGREVLARTIFHTIMSAVMLPLG  471



>gb|KIV92973.1| hypothetical protein PV10_04223 [Exophiala mesophila]
Length=664

 Score =   150 bits (380),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 107/156 (69%), Gaps = 2/156 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             +D+ +++A  RS+KAG++LA  L + +QG RPVTLVG+SLG+R+I+ CL  LA      
Sbjct  465  MVDNPFSVARSRSEKAGVVLAHALIEKVQGERPVTLVGYSLGSRLIYSCLNELAER-RAF  523

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVE VVL G+      + W  +R VV GR INVYSTND++LGI++R S L  G+AG+Q 
Sbjct  524  GLVESVVLAGSATPSDSLAWRKMRSVVTGRLINVYSTNDYLLGILYRTSSLQYGIAGLQA  583

Query  475  V-DVPGVENVDVTELIDGHSAYLWTSQEILELLQLD  371
            V DVPGV+NVDV+  +DGH+ Y +    IL+   L+
Sbjct  584  VRDVPGVQNVDVSSFVDGHTQYRFLMGRILQTAGLE  619


 Score = 42.0 bits (97),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 21/75 (28%), Positives = 41/75 (55%), Gaps = 4/75 (5%)
 Frame = -1

Query  1152  DVDEFEF----KTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESK  985
             +V++F F       G   N   L V I ++G++ +E++   PW    +++E +AL+WE  
Sbjct  356   EVEDFAFIPLQDKTGDKQNSRHLRVAIGVSGYLTDEAEVTSPWTPIGDSIEGFALRWELD  415

Query  984   HLMAVSYAIRNWLTS  940
              L+A+  A+  ++ S
Sbjct  416   TLLALGSALTAYIRS  430



>ref|XP_010085832.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Pterocles gutturalis]
Length=607

 Score =   136 bits (343),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  363  IDNPWGVCLHRSAEVGKHLAHILLSRRQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  422

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E V+LLGAP+     +W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  423  IIEDVILLGAPVEGEAKHWKAITKVVSGRIINGYCRGDWLLGFVYRTSSVQINVAGLQPV  482

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  483  DLDDRRMVNMDLSSVVNGHRDYMKQMDTILKAVGVKT  519


 Score = 54.7 bits (130),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (9%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGR---QLHITIAITGWLCTGKYGSFTAPWRNMLRSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+  +  + +A E +K     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDFFFVNMMAQEALK----FTVLSGIVTAL  350



>gb|KFV05358.1| Transmembrane and coiled-coil domain-containing protein 4, partial 
[Pterocles gutturalis]
Length=503

 Score =   136 bits (342),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  346  IDNPWGVCLHRSAEVGKHLAHILLSRRQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  405

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E V+LLGAP+     +W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  406  IIEDVILLGAPVEGEAKHWKAITKVVSGRIINGYCRGDWLLGFVYRTSSVQINVAGLQPV  465

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  466  DLDDRRMVNMDLSSVVNGHRDYMKQMDTILKAVGVKT  502


 Score = 55.1 bits (131),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 9/103 (9%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  238   KMKKRVGAIEEFEFLPLTEGR---QLHITIAITGWLCTGKYGSFTAPWRNMLRSSEQYCL  294

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+  +  + +A E +K     TVLS  +TAL
Sbjct  295   AWESKYLMELGNALDFFFVNMMAQEALK----FTVLSGIVTAL  333



>ref|XP_008796876.1| PREDICTED: uncharacterized membrane protein YFL034W-like isoform 
X2 [Phoenix dactylifera]
Length=557

 Score =   159 bits (402),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 145/192 (76%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  1443  SSKSRWAKWRRggiigaaaltggtlmaitgglaapaiaagfgalapTLGTLVPVIgasgf  1264
             S KS+WA+W+RGGIIGAAALTGG L+A+TGGLAAPAIAAGF ALAPTLGTLVPVIGASGF
Sbjct  320   SEKSKWARWKRGGIIGAAALTGGALLAVTGGLAAPAIAAGFSALAPTLGTLVPVIGASGF  379

Query  1263  aavataagsvvgsvavaasfgaagagltgSKVARRMGDVDEFEFKTIGQNHNKGRLAVEI  1084
             AA+A+AAGSV GSVAVAASFGAAGAGL+GSK+ARR+G V+EFEFK IG NHN+GRLAV I
Sbjct  380   AAIASAAGSVAGSVAVAASFGAAGAGLSGSKMARRIGSVEEFEFKPIGDNHNQGRLAVGI  439

Query  1083  LITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSSIALELMKRGAM  904
             L++GF FE+ DF +PWEG  +NLERY LQWESK+++AVS AI++W+TS +  ELMK+GAM
Sbjct  440   LVSGFAFEKEDFIKPWEGLEDNLERYVLQWESKYIIAVSTAIQDWITSRVTTELMKQGAM  499

Query  903   MTVLSSFLTALA  868
             MTVLS+ ++ALA
Sbjct  500   MTVLSTLVSALA  511



>gb|KJJ22224.1| hypothetical protein U727_00432610121 [Penicillium solitum]
Length=731

 Score =   144 bits (362),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            +D+ +++A  R+DKAG +LA+ L    QG RPVTL+G+SLG+R+IF CLQ L    N  G
Sbjct  479  VDNPFSVAKARADKAGEVLADALINKAQGERPVTLMGYSLGSRLIFSCLQSLEKR-NAYG  537

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            LVE V+++G+P      +W+ +R VV+GR +NV+S ND +L  ++R S L  G+AG+QPV
Sbjct  538  LVESVIMMGSPTPSDIEDWQKIRSVVSGRVVNVFSENDSVLAFLYRTSSLQLGVAGLQPV  597

Query  472  D-VPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYP  359
            + VPGVEN++V+E+I GH  Y +    IL L+ L    P
Sbjct  598  EGVPGVENLNVSEMISGHLRYQFLLGRILTLIGLQDLDP  636


 Score = 47.0 bits (110),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = -1

Query  1131  KTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRN  952
             K+  Q+H   RL V I +TG+V EES+F  PW     + E + L+WE + LM +  AI  
Sbjct  383   KSAEQDH---RLRVTIGVTGWVKEESNFVVPWRVIGADSEVFGLRWEMEPLMNLGNAISA  439

Query  951   WLTS---SIA-LELMKRGAMMTVLSSFLTALA  868
              +TS   S+A  E++ R    T++S+ +  L 
Sbjct  440   LVTSAAWSVAGREVLARTVFSTIMSAVMLPLG  471



>gb|KGO72173.1| Protein of unknown function DUF726 [Penicillium italicum]
Length=731

 Score =   144 bits (362),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 108/160 (68%), Gaps = 2/160 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             +D+ +++A  R+DKAG +LA+ L    QG RPVTL+G+SLG+R+IF CLQ L    N  
Sbjct  478  IVDNPFSVAKARADKAGEVLADALINKAQGERPVTLMGYSLGSRLIFSCLQSLERR-NAY  536

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVE V+++G+P      +W+ +R VV+GR +NV+S ND +L  ++R S L  G+AG+QP
Sbjct  537  GLVESVIMMGSPTPSDTEDWQKIRSVVSGRVVNVFSENDSVLAFLYRTSSLQLGVAGLQP  596

Query  475  VD-VPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYP  359
            V+ VPGVEN++V+E+I GH  Y +    IL+ + L    P
Sbjct  597  VEGVPGVENLNVSEMISGHLRYQFLLGRILKFVGLQDLDP  636


 Score = 46.6 bits (109),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = -1

Query  1131  KTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRN  952
             K+  Q+H   RL V I +TG+V EES+F  PW     + E + L+WE + LM +  AI  
Sbjct  383   KSAEQDH---RLRVTIGVTGWVKEESNFVIPWRVIGADSEVFGLRWEMEPLMNLGNAISA  439

Query  951   WLTS---SIA-LELMKRGAMMTVLSSFLTALA  868
              +TS   S+A  E++ R    T++S+ +  L 
Sbjct  440   LVTSAAWSVAGREVLARTVFHTIMSAVMLPLG  471



>gb|KGO46963.1| Protein of unknown function DUF726 [Penicillium expansum]
 gb|KGO58961.1| Protein of unknown function DUF726 [Penicillium expansum]
 gb|KGO73134.1| Protein of unknown function DUF726 [Penicillium expansum]
Length=731

 Score =   143 bits (360),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 107/160 (67%), Gaps = 2/160 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             +D+ +++A  R+DKAG +LA+ L    QG RPVTL+G+SLG+R+IF CLQ L    N  
Sbjct  478  IVDNPFSVAKARADKAGEVLADALINKAQGERPVTLMGYSLGSRLIFSCLQSLERR-NAY  536

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVE V+++G+P      +W  +R VV+GR +NV+S ND +L  ++R S L  G+AG+QP
Sbjct  537  GLVESVIMMGSPTPSDTEDWRRIRSVVSGRVVNVFSENDSVLAFLYRTSSLQLGVAGLQP  596

Query  475  VD-VPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYP  359
            V+ VPGVEN++V+E+I GH  Y +    IL L+ L    P
Sbjct  597  VEGVPGVENLNVSEMISGHLRYQFLLGRILTLVGLQDLDP  636


 Score = 47.4 bits (111),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 51/92 (55%), Gaps = 7/92 (8%)
 Frame = -1

Query  1131  KTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRN  952
             K+  Q+H   RL V I +TG+V EES+F  PW     + E + L+WE + LM +  AI  
Sbjct  383   KSAEQDH---RLRVTIGVTGWVMEESNFVIPWRVIGADSEVFGLRWEMEPLMNLGNAISA  439

Query  951   WLTS---SIA-LELMKRGAMMTVLSSFLTALA  868
              +TS   S+A  E++ R    T++S+ +  L 
Sbjct  440   LVTSAAWSVAGREVLARTIFHTIMSAVMLPLG  471



>gb|EPS33767.1| hypothetical protein PDE_08729 [Penicillium oxalicum 114-2]
Length=613

 Score =   140 bits (352),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/162 (45%), Positives = 106/162 (65%), Gaps = 2/162 (1%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
            + +D+ +++A  R++KAG  LA+ L   +QG RPVTL+G+SLG+RVI+ C+Q L    + 
Sbjct  376  NLVDNPFSLAKTRAEKAGEALADALINKVQGERPVTLIGYSLGSRVIYSCMQSLCRR-SA  434

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
             GLVE V+L+G+        W  +R VV+GR +NVYS ND +L  ++R S L  G+AG+Q
Sbjct  435  YGLVESVILMGSATPADVEAWRRIRSVVSGRVVNVYSQNDSVLAFLYRTSSLQAGVAGLQ  494

Query  478  PVD-VPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPV  356
            P++  PGVENVDVTE I GH  Y +   +IL+ + L    PV
Sbjct  495  PIEGAPGVENVDVTEKISGHLKYQFALGQILDTIGLQDLDPV  536


 Score = 50.1 bits (118),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -1

Query  1119  QNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTS  940
             Q+H   RL V I +TG+    SDF  PW    +N E +AL+WE++ +M++ +AI N +TS
Sbjct  286   QDH---RLRVTIGVTGWAKNRSDFVVPWRVLGDNSEVFALRWETEAMMSLGHAINNLVTS  342

Query  939   SI  934
             ++
Sbjct  343   AV  344



>ref|XP_009927110.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane and coiled-coil 
domain-containing protein 4 [Haliaeetus albicilla]
Length=619

 Score =   136 bits (342),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  362  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  421

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG+V+R S +   +AG+QPV
Sbjct  422  IIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLGVVYRTSSVQINVAGLQPV  481

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  482  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  518


 Score = 53.9 bits (128),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  251   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLQSSEQYCL  307

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  308   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  349



>ref|XP_009487437.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Pelecanus crispus]
Length=610

 Score =   134 bits (338),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+G+ IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKAITKVVSGKIINGYCRGDWLLGFVYRTSSVQLSVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 55.5 bits (132),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 57/104 (55%), Gaps = 6/104 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
              WESK+LM +  A+ + L   + + + +     TVLS  +TALA
Sbjct  312   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTALA  354



>ref|XP_009323520.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Pygoscelis adeliae]
Length=621

 Score =   136 bits (342),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+AV KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKAVTKVVSGRIINGYCRGDWLLGFVYRTSSVQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.5 bits (127),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>ref|XP_011583445.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Aquila chrysaetos canadensis]
 ref|XP_011583446.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Aquila chrysaetos canadensis]
Length=610

 Score =   136 bits (342),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLGFVYRTSSVQLNVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.9 bits (128),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>ref|XP_009986511.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Tauraco erythrolophus]
Length=610

 Score =   135 bits (341),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLGFVYRTSSVQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSIVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.5 bits (127),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGR---QLHITIAITGWLCTGKYGSFTAPWSSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNGFVNI-MAQEALKFTVLSGIVTAL  353



>ref|XP_010575570.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Haliaeetus leucocephalus]
Length=610

 Score =   135 bits (341),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLGFVYRTSSVQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.5 bits (127),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>ref|XP_002557597.1| Pc12g07620 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP80389.1| Pc12g07620 [Penicillium rubens Wisconsin 54-1255]
Length=913

 Score =   144 bits (363),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/159 (47%), Positives = 108/159 (68%), Gaps = 2/159 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            +D+ +++A  R+DKAG +LA+ L    QG RPVTL+G+SLG+R+IF CLQ L    N  G
Sbjct  662  VDNPFSVAKARADKAGEVLADALINKAQGERPVTLMGYSLGSRLIFSCLQSLERR-NAYG  720

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            LVE V+L+G+P      +W+ +R VV+GR +NV+S ND +L  ++R S L  G+AG+QPV
Sbjct  721  LVESVILMGSPTPSDTEDWQKIRSVVSGRVVNVFSENDSVLAFLYRTSSLQLGVAGLQPV  780

Query  472  D-VPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYP  359
            + VPGVEN++V+++I GH  Y +   +IL L  L    P
Sbjct  781  EGVPGVENLNVSDMISGHLRYQYLLGKILTLTGLQDLDP  819


 Score = 45.1 bits (105),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (56%), Gaps = 7/88 (8%)
 Frame = -1

Query  1119  QNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTS  940
             Q+H   RL V I +TG+V EES+F  PW     + E + L+WE + LM +  AI   +TS
Sbjct  570   QDH---RLRVTIGVTGWVKEESNFVVPWRVIGADSEVFGLRWEMEPLMNLGNAISALVTS  626

Query  939   ---SIA-LELMKRGAMMTVLSSFLTALA  868
                S+A  E++ R    T++S+ +  L 
Sbjct  627   AAWSVAGREVLARTVFSTLMSAVMLPLG  654



>ref|XP_004347299.1| hypothetical protein CAOG_04552 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE93810.1| hypothetical protein, variant [Capsaspora owczarzaki ATCC 30864]
Length=830

 Score =   141 bits (355),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 102/157 (65%), Gaps = 1/157 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN-  659
             ID+ W +A +R+++ GI LA  LQ  LQG RPV+L+GFSLGAR I KCL+ LA+     
Sbjct  596  LIDNPWAVATNRAEECGIALANALQARLQGCRPVSLIGFSLGARAILKCLEELASRKVPI  655

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
             GL+E V L GA +    + W+  + VVAGRF+N YS  DW+L  ++RA+     +AGI 
Sbjct  656  HGLIEDVYLFGAAVPGDPLQWQLAKSVVAGRFVNGYSRGDWLLTFLYRAASAQLSIAGIA  715

Query  478  PVDVPGVENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            PV+V G+ENVD+++LI  H+ Y     ++L  + L+T
Sbjct  716  PVEVEGIENVDLSDLIVSHTKYPEQMHKVLARVGLNT  752


 Score = 48.1 bits (113),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 51/103 (50%), Gaps = 4/103 (4%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITG-FVFEESDFFRPWEGEYNNLERYALQ  997
             K+  R+G + EF F  I      GR+ V I +TG    EE+ +  PW    +  E+Y ++
Sbjct  486   KMKTRIGGLKEFAFAPISTG---GRMHVVITVTGWLATEEATYQAPWASLDDVGEQYTVE  542

Query  996   WESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
             WE + L+ +  A+ N +   +     ++  + T L+  L ALA
Sbjct  543   WEHQKLVDLGKALSNLIKDQVVGYAAQQILLHTALAGMLVALA  585



>ref|XP_007779876.1| hypothetical protein W97_03792 [Coniosporium apollinis CBS 100218]
 gb|EON64559.1| hypothetical protein W97_03792 [Coniosporium apollinis CBS 100218]
Length=689

 Score =   149 bits (375),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 107/151 (71%), Gaps = 2/151 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             +D+ ++IA  RS+KAG +LA+ L    QG RPVTL+G+SLGARVI+ CLQ LA      
Sbjct  459  IVDNPFSIAKTRSEKAGEVLADALINKAQGERPVTLIGYSLGARVIYTCLQTLAER-KAF  517

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVE VVL+GAP      +W  +R VV+GR +NVYSTND++L  ++R+S +  G+AG+Q 
Sbjct  518  GLVESVVLVGAPTPSTAADWRKLRSVVSGRVVNVYSTNDYVLAFLYRSSSIQLGVAGLQA  577

Query  475  VD-VPGVENVDVTELIDGHSAYLWTSQEILE  386
            ++ V GVENVDV++L+ GH+ Y + +  IL+
Sbjct  578  IEGVKGVENVDVSDLVSGHTKYRYITGSILK  608


 Score = 40.0 bits (92),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 40/78 (51%), Gaps = 7/78 (9%)
 Frame = -1

Query  1152  DVDEFEFKTIGQNHNKG-------RLAVEILITGFVFEESDFFRPWEGEYNNLERYALQW  994
             +VD+F F  +   H          RL V I I+G++ +  D  +PW     + E +AL+W
Sbjct  348   EVDDFGFIPVRDWHKPRKIEKEYRRLRVAIGISGWITDPQDVVKPWRVISQSTEGFALRW  407

Query  993   ESKHLMAVSYAIRNWLTS  940
             E + LM +  AI+  ++S
Sbjct  408   ELEALMNLGNAIKTMVSS  425



>ref|XP_009287859.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Aptenodytes forsteri]
Length=621

 Score =   135 bits (341),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLGFVYRTSSVQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.1 bits (126),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWTSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>emb|CCX32722.1| Similar to Uncharacterized membrane protein C6F6.13c; acc. no. 
Q9US10 [Pyronema omphalodes CBS 100304]
Length=614

 Score =   135 bits (340),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 97/142 (68%), Gaps = 1/142 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            +D+ ++IA  RSDKAG++LA+ +    QG RPVTLVG+SLGARVIF  L  LA  G   G
Sbjct  369  VDNPFSIAKLRSDKAGLVLADAILNKAQGSRPVTLVGYSLGARVIFSALLSLAERGGY-G  427

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            LVE VVLLGAP    + +W+ +R VVAGR +NVYS  D++L  ++R S +  G+AG++ +
Sbjct  428  LVENVVLLGAPTPADEESWKKIRSVVAGRVVNVYSDQDYILAFLYRTSSIQLGVAGLKEI  487

Query  472  DVPGVENVDVTELIDGHSAYLW  407
             + G+ENV+  E + GH  Y +
Sbjct  488  AIDGIENVNAGETVKGHLRYRY  509


 Score = 53.5 bits (127),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 53/98 (54%), Gaps = 7/98 (7%)
 Frame = -1

Query  1170  VARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWE  991
             +AR   +V++F F  +    +  RL V + ITG++ EE D  +PW      LE YAL+WE
Sbjct  261   MARYAAEVEDFAFLPV---RDDSRLRVAVGITGWLVEEEDVLQPWRSLGGGLEPYALRWE  317

Query  990   SKHLMAVSYAIRNWLTSS----IALELMKRGAMMTVLS  889
                L+ +  +++  L S+     A+E++KR    T+ S
Sbjct  318   MDALLDLGTSLQEVLKSAAMSLFAMEVVKRTVFATLYS  355



>ref|XP_009888268.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Charadrius vociferus]
Length=602

 Score =   135 bits (339),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A    + G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKGSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLGFVYRTSSVQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.9 bits (128),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGR---QLHITIAITGWLCTGKYGSFTAPWSSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>ref|XP_005444038.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Falco cherrug]
Length=610

 Score =   135 bits (340),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLGFVYRTSSVQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.1 bits (126),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEE--SDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++       F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGRYGSFTAPWSSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+   L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDTLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>ref|XP_005229681.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Falco peregrinus]
Length=610

 Score =   135 bits (340),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLGFVYRTSSVQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.1 bits (126),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEE--SDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++       F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGRYGSFTAPWSSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+   L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDTLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>ref|XP_008925547.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Manacus vitellinus]
Length=610

 Score =   134 bits (338),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 105/163 (64%), Gaps = 4/163 (2%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA ++    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHIMLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E V+LLGAP+     +W+A+ KVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct  426  IIEDVILLGAPVEGEAKHWKALTKVVSGRIINGYCRGDWLLSFVYRTSSVQLNVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT--YYPV  356
            D+    + N+D++ +++GH  Y+     IL+ + + T  Y PV
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKTKEYQPV  528


 Score = 53.5 bits (127),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCAGKYGSFTAPWSSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>ref|XP_009994063.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Chaetura pelagica]
Length=610

 Score =   134 bits (337),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 103/157 (66%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPV+L+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVSLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+     +W+A+RKVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKHWKAIRKVVSGRIINGYCRGDWLLRFVYRTSSVQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDMILKAVGIKT  522


 Score = 53.9 bits (128),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 58/103 (56%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW    ++ E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGR---QLHITIAITGWLCTGKYGSFTAPWSSMLHSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WE+K+LM +  A+ + L   +++ + +     TVLS  +TAL
Sbjct  312   AWETKYLMELGNALDSLLNGFVSM-MAQEALKFTVLSGIVTAL  353



>ref|XP_010280036.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Phaethon lepturus]
Length=610

 Score =   134 bits (337),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W A+ KVV+GR +N Y   DW+LG V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWRAITKVVSGRIVNGYCRGDWLLGFVYRTSSVQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.5 bits (127),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWTSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>ref|XP_009644771.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Egretta garzetta]
Length=610

 Score =   132 bits (333),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAREKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLRFVYRTSSIQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 54.7 bits (130),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLRSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L S + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNSFVNM-MAQEALKFTVLSGIVTAL  353



>gb|EMC84630.1| Transmembrane and coiled-coil domain-containing protein 4, partial 
[Columba livia]
Length=516

 Score =   134 bits (337),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  359  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  418

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E V+LLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  419  IIEDVILLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLGFVYRTSSVQLNVAGLQPV  478

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL  + + T
Sbjct  479  DLDDRRMVNMDLSAVVNGHLDYMKQMDTILRAVGVKT  515


 Score = 53.1 bits (126),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  248   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCAGKYGSFTAPWSSMLRSSEQYCL  304

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  305   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  346



>ref|XP_010410793.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Corvus cornix cornix]
 ref|XP_010410794.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Corvus cornix cornix]
Length=610

 Score =   133 bits (335),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGQRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+     +W+A+ +VV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKHWKALTRVVSGRIINGYCRGDWLLSFVYRTSSVQLNIAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.9 bits (128),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW    ++ E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLHSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>ref|XP_009897800.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Picoides pubescens]
Length=580

 Score =   130 bits (327),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 97/150 (65%), Gaps = 2/150 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA+VL    QG RPVTL+GFSLGARVI+ CLQ +A      G
Sbjct  353  IDNPWGVCLHRSAQVGKHLAQVLLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKGCEG  412

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+     +W+A+ +VV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct  413  IIEDVVLLGAPVEGDAKHWKAISRVVSGRIINGYCRGDWLLSFVYRTSSVQIKVAGLQPV  472

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEIL  389
            D+    + N+D++ +++GH  Y+     IL
Sbjct  473  DLEDRRMVNMDLSAVVNGHLDYMKQMDTIL  502


 Score = 57.0 bits (136),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  242   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCAGKYGSFTAPWSNLLQSSEQYCL  298

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM + +A+   L   I L + +    +TVLS  +TAL
Sbjct  299   AWESKYLMELGHALDTLLNGFINL-MAEEALKLTVLSGIVTAL  340



>ref|XP_009502643.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane and coiled-coil 
domain-containing protein 4 [Phalacrocorax carbo]
Length=620

 Score =   129 bits (325),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L +  QG RPVTL+GFSLGARVI+ CL+ +A   ++ G
Sbjct  363  IDNPWGVCLHRSAEVGKHLAYILLRRQQGRRPVTLIGFSLGARVIYFCLKEMAQEKDSQG  422

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+L  V+R S     +AG+QPV
Sbjct  423  IIEDVVLLGAPVEGEAKYWKAIAKVVSGRIINGYCRGDWLLRFVYRTSSAQINVAGLQPV  482

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  483  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  519


 Score = 57.4 bits (137),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 9/103 (9%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLRSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L + +A E +K     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLXNMMAQEALK----FTVLSGIVTAL  350



>ref|XP_005508013.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Columba livia]
Length=585

 Score =   134 bits (336),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  359  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  418

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E V+LLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  419  IIEDVILLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLGFVYRTSSVQLNVAGLQPV  478

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL  + + T
Sbjct  479  DLDDRRMVNMDLSAVVNGHLDYMKQMDTILRAVGVKT  515


 Score = 53.1 bits (126),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  248   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCAGKYGSFTAPWSSMLRSSEQYCL  304

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  305   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  346



>ref|XP_006696222.1| hypothetical protein CTHT_0059030 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
 gb|EGS19277.1| hypothetical protein CTHT_0059030 [Chaetomium thermophilum var. 
thermophilum DSM 1495]
Length=764

 Score =   134 bits (336),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 99/142 (70%), Gaps = 2/142 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             +D+ ++IA  RS+KAG +LA+ L   +QG RPVTL+G+SLGARVI+ CLQ LAA G   
Sbjct  411  LVDNPFSIAKARSEKAGRVLADALINRVQGERPVTLIGYSLGARVIYTCLQELAARG-AF  469

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVE VV++GA +      WE +R VV+G+  N YS ND++L  ++RA+ +  G+AG+Q 
Sbjct  470  GLVEDVVMIGAAVPSDKNEWETMRSVVSGKMYNAYSENDFLLAFLYRATAIQLGVAGLQA  529

Query  475  VD-VPGVENVDVTELIDGHSAY  413
            ++ V GVENV+V   ++GH  Y
Sbjct  530  IEGVEGVENVNVGSEVEGHVGY  551


 Score = 53.5 bits (127),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 57/104 (55%), Gaps = 8/104 (8%)
 Frame = -1

Query  1170  VARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWE  991
             V R   +V++F+F  + Q+ N+ RL V I I G++   +D  +PW       E +ALQ++
Sbjct  300   VDRYAREVEDFKFLPLRQDQNERRLRVTICINGWLDAPADVSKPWRILSPTTEAFALQYD  359

Query  990   SKHLMAVSYAIRNWLTS----SIALELMKRGAMMTVLSSFLTAL  871
                L+ +  +IR  +TS    ++  E++K     TVLS+  +AL
Sbjct  360   LSALLGLGTSIRQLVTSAAFRTVGAEILKH----TVLSTLSSAL  399



>gb|EDP54788.1| DUF726 domain protein [Aspergillus fumigatus A1163]
Length=683

 Score =   143 bits (360),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 107/156 (69%), Gaps = 2/156 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            +D+ +++A  R+DKAG +LA+ L   +QG RPVTL+G+SLG+RVIF CLQ LA      G
Sbjct  460  VDNPFSVAKARADKAGEVLADALISKVQGERPVTLIGYSLGSRVIFACLQSLAKR-RAFG  518

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            LVE  +L+GAP       W  +R VV+GR +NVYS ND +L +++R S L  G+AG+QPV
Sbjct  519  LVESAILMGAPTPSNSEQWCRIRSVVSGRLVNVYSENDSVLALLYRTSSLQLGVAGLQPV  578

Query  472  D-VPGVENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            + V GVEN+DV++LI GH  Y +    IL ++ L++
Sbjct  579  EGVSGVENLDVSDLISGHLRYQFLVGRILSVVGLES  614


 Score = 43.9 bits (102),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 12/106 (11%)
 Frame = -1

Query  1152  DVDEFEFKTIGQN-----------HNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERY  1006
             +VD+F F  I  +           H   RL V I +TG++ EE +F  PW       E +
Sbjct  344   EVDDFAFLPIRGSRHRSEDEREAAHQDHRLRVTIGVTGWLTEEDNFVIPWRVIGAESEVF  403

Query  1005  ALQWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
              L+WE++ LM +  A+ + L +S A    ++    T LS  LTA+A
Sbjct  404   GLRWETEPLMNLGNAL-DLLVTSAAWTAGEQVLKKTFLSQLLTAVA  448



>ref|XP_755617.1| DUF726 domain protein [Aspergillus fumigatus Af293]
 gb|EAL93579.1| DUF726 domain protein [Aspergillus fumigatus Af293]
Length=683

 Score =   143 bits (360),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 75/156 (48%), Positives = 107/156 (69%), Gaps = 2/156 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            +D+ +++A  R+DKAG +LA+ L   +QG RPVTL+G+SLG+RVIF CLQ LA      G
Sbjct  460  VDNPFSVAKARADKAGEVLADALISKVQGERPVTLIGYSLGSRVIFACLQSLAKR-RAFG  518

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            LVE  +L+GAP       W  +R VV+GR +NVYS ND +L +++R S L  G+AG+QPV
Sbjct  519  LVESAILMGAPTPSNSEQWCRIRSVVSGRLVNVYSENDSVLALLYRTSSLQLGVAGLQPV  578

Query  472  D-VPGVENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            + V GVEN+DV++LI GH  Y +    IL ++ L++
Sbjct  579  EGVSGVENLDVSDLISGHLRYQFLVGRILSVVGLES  614


 Score = 43.9 bits (102),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 12/106 (11%)
 Frame = -1

Query  1152  DVDEFEFKTIGQN-----------HNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERY  1006
             +VD+F F  I  +           H   RL V I +TG++ EE +F  PW       E +
Sbjct  344   EVDDFAFLPIRGSRHRSEDEREAAHQDHRLRVTIGVTGWLTEEDNFVIPWRVIGAESEVF  403

Query  1005  ALQWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
              L+WE++ LM +  A+ + L +S A    ++    T LS  LTA+A
Sbjct  404   GLRWETEPLMNLGNAL-DLLVTSAAWTAGEQVLKKTFLSQLLTAVA  448



>ref|XP_009707318.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Cariama cristata]
Length=610

 Score =   133 bits (334),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+     +W+A+ KVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKHWKAIAKVVSGRIINGYCRGDWLLRFVYRTSSVQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.5 bits (127),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLKSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>emb|CDM35337.1| Protein of unknown function DUF726 [Penicillium roqueforti FM164]
Length=720

 Score =   141 bits (356),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 108/160 (68%), Gaps = 2/160 (1%)
 Frame = -3

Query  835  FIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNA  656
             +D+ +++A  R+DKAG +LA+ L    QG RPVTL+G+SLG+R+IF CL+ L    +  
Sbjct  467  IVDNPFSVAKARADKAGEVLADALINRAQGERPVTLMGYSLGSRLIFSCLKSLERR-DAY  525

Query  655  GLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQP  476
            GLVE V+L+G+P      +W+ +R VV+GR +NV+S ND +L  ++R S    G+AG+QP
Sbjct  526  GLVESVILMGSPTPSNAEDWQKIRSVVSGRVVNVFSENDSVLAFLYRTSSFQLGVAGLQP  585

Query  475  VD-VPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYP  359
            V+ VPGVEN++V+ELI+GH  Y +    IL L+ L    P
Sbjct  586  VEGVPGVENLNVSELINGHLRYQFLLGRILTLIGLQDLDP  625


 Score = 45.1 bits (105),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 52/94 (55%), Gaps = 7/94 (7%)
 Frame = -1

Query  1137  EFKTIGQNHNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAI  958
             E ++  Q+H   RL V I +TG+V EES+F  PW     + E + L+WE + LM +  AI
Sbjct  370   EKESAKQDH---RLRVTIGVTGWVKEESNFVIPWRVIGADSEVFGLRWEMEPLMNLGNAI  426

Query  957   RNWLTS---SIA-LELMKRGAMMTVLSSFLTALA  868
                +TS   S+A  E++ R    T++S+ +  L 
Sbjct  427   SALVTSAAWSVAGREVLARTFFHTIMSAVMLPLG  460



>gb|KFP61470.1| Transmembrane and coiled-coil domain-containing protein 4, partial 
[Cariama cristata]
Length=506

 Score =   133 bits (334),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  349  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  408

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+     +W+A+ KVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct  409  IIEDVVLLGAPVEGEAKHWKAIAKVVSGRIINGYCRGDWLLRFVYRTSSVQINVAGLQPV  468

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  469  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  505


 Score = 53.5 bits (127),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 58/104 (56%), Gaps = 8/104 (8%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  238   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLKSSEQYCL  294

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAM-MTVLSSFLTAL  871
              WESK+LM +  A+ + L   +   +M + A+  TVLS  +TAL
Sbjct  295   AWESKYLMELGNALDSLLNGFV--NMMAQEALKFTVLSGIVTAL  336



>ref|XP_009940062.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane and coiled-coil 
domain-containing protein 4 [Opisthocomus hoazin]
Length=617

 Score =   133 bits (334),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A    + G
Sbjct  360  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKGSQG  419

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S     +AG+QPV
Sbjct  420  IIEDVVLLGAPVEGETKYWKAITKVVSGRIINGYCRGDWLLGFVYRTSSAQINVAGLQPV  479

Query  472  DVPGVE--NVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+      N+D++ +++GH  Y+     IL  + + T
Sbjct  480  DLDDRRMVNMDLSSVVNGHLDYMKQMDMILTAVGIKT  516


 Score = 53.1 bits (126),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  249   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLRSREQYCL  305

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  306   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  347



>ref|XP_417632.4| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X6 [Gallus gallus]
 ref|XP_004947542.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X9 [Gallus gallus]
Length=642

 Score =   133 bits (334),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 101/159 (64%), Gaps = 2/159 (1%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
            + ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++
Sbjct  364  NVIDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDS  423

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
             G++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+Q
Sbjct  424  QGIIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLGFVYRTSSVQLNVAGLQ  483

Query  478  PV--DVPGVENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            P+  D   + N+D++ ++ GH  Y+     IL+ + + T
Sbjct  484  PIKLDDRRMVNMDLSSVVSGHLDYMKQMDTILKAVGIKT  522


 Score = 53.5 bits (127),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 58/106 (55%), Gaps = 12/106 (11%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW    ++ E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGR---QLHITIAITGWLCAGKYGSFTAPWSSMLHSSEQYCL  311

Query  999   QWESKHLMAVSYAIR---NWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+    N   + +A E +K     TVLS  +TAL
Sbjct  312   AWESKYLMELGSALDTLVNGFVNMMAQEALK----FTVLSGIVTAL  353



>ref|XP_005015051.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X2 [Anas platyrhynchos]
Length=604

 Score =   134 bits (337),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKALTKVVSGRIINGYCRGDWLLGFVYRTSSVQLNVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ ++ GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVKGHLDYMKQMDTILKAVGIKT  522


 Score = 52.0 bits (123),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCAGKYGSFTAPWSSLLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +   + ++L +     + +    +TVLS  +TAL
Sbjct  312   AWESKYLMELGNTL-DYLLNGFVNMMAQEALKLTVLSGIVTAL  353



>ref|XP_009808720.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Gavia stellata]
Length=610

 Score =   134 bits (337),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAKEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLGFVYRTSSVQINVAGLQPV  485

Query  472  DVPGVE--NVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+      N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSFVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 52.0 bits (123),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +   + + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNTLDSLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>ref|XP_004947540.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X7 [Gallus gallus]
Length=695

 Score =   133 bits (334),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  419  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  478

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QP+
Sbjct  479  IIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLGFVYRTSSVQLNVAGLQPI  538

Query  472  --DVPGVENVDVTELIDGHSAYLWTSQEILELLQLDT  368
              D   + N+D++ ++ GH  Y+     IL+ + + T
Sbjct  539  KLDDRRMVNMDLSSVVSGHLDYMKQMDTILKAVGIKT  575


 Score = 53.1 bits (126),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 58/106 (55%), Gaps = 12/106 (11%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW    ++ E+Y L
Sbjct  308   KMKKRVGAIEEFEFLPLTEGR---QLHITIAITGWLCAGKYGSFTAPWSSMLHSSEQYCL  364

Query  999   QWESKHLMAVSYAIR---NWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+    N   + +A E +K     TVLS  +TAL
Sbjct  365   AWESKYLMELGSALDTLVNGFVNMMAQEALK----FTVLSGIVTAL  406



>ref|XP_006004344.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Latimeria chalumnae]
Length=539

 Score =   128 bits (322),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA++L +  QG+RPV+L+GFSLGARVI+ CLQ LA      G
Sbjct  267  IDNPWGVCLSRSAEVGKHLADLLLRRQQGNRPVSLIGFSLGARVIYFCLQELAREKGCEG  326

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            +++ VVLLGAP+      W+ + KVVAG+ IN Y   DW+L  V+R S +   +AG+QP+
Sbjct  327  IIQDVVLLGAPVEGAVKYWKPLTKVVAGKIINGYCRGDWLLKFVYRTSSVKIDIAGLQPI  386

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + NVD+T +++GH  Y+     IL+ + + T
Sbjct  387  DLDDRRMTNVDLTPIVNGHLDYMKKIDTILDAVGVRT  423


 Score = 57.8 bits (138),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 60/104 (58%), Gaps = 6/104 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     ++ + I ITG++   +   F  PW    ++ E+Y L
Sbjct  156   KMKKRVGAIEEFEFLPLTEGK---QMHITIAITGWLSTGKYGSFIVPWSNLAHSSEQYCL  212

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
              WESK+LMA+   +  ++ + I  ++ +    +TVLS  LTALA
Sbjct  213   AWESKYLMALGNGLE-YMLNGILSQVTQEALKLTVLSGILTALA  255



>ref|XP_005015050.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Anas platyrhynchos]
Length=632

 Score =   134 bits (337),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  394  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  453

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  454  IIEDVVLLGAPVEGEAKYWKALTKVVSGRIINGYCRGDWLLGFVYRTSSVQLNVAGLQPV  513

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ ++ GH  Y+     IL+ + + T
Sbjct  514  DLDDRRMVNMDLSSVVKGHLDYMKQMDTILKAVGIKT  550


 Score = 52.0 bits (123),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  283   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCAGKYGSFTAPWSSLLQSSEQYCL  339

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +   + ++L +     + +    +TVLS  +TAL
Sbjct  340   AWESKYLMELGNTL-DYLLNGFVNMMAQEALKLTVLSGIVTAL  381



>ref|XP_005015052.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X3 [Anas platyrhynchos]
Length=520

 Score =   134 bits (336),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  282  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  341

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S +   +AG+QPV
Sbjct  342  IIEDVVLLGAPVEGEAKYWKALTKVVSGRIINGYCRGDWLLGFVYRTSSVQLNVAGLQPV  401

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ ++ GH  Y+     IL+ + + T
Sbjct  402  DLDDRRMVNMDLSSVVKGHLDYMKQMDTILKAVGIKT  438


 Score = 52.0 bits (123),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 57/106 (54%), Gaps = 12/106 (11%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  171   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCAGKYGSFTAPWSSLLQSSEQYCL  227

Query  999   QWESKHLMAVSYAIR---NWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +   +    N   + +A E +K    +TVLS  +TAL
Sbjct  228   AWESKYLMELGNTLDYLLNGFVNMMAQEALK----LTVLSGIVTAL  269



>ref|XP_009461663.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Nipponia nippon]
Length=610

 Score =   132 bits (332),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCIHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR +N Y   DW+L  V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKAITKVVSGRIVNGYCRGDWLLRFVYRTSSVQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSIVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.9 bits (128),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>ref|XP_009076642.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Acanthisitta chloris]
Length=603

 Score =   133 bits (334),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKALTKVVSGRIINGYCRGDWLLSFVYRTSSVQLNVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 52.8 bits (125),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWRTMLQSKEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>emb|CCX32946.1| Similar to Uncharacterized membrane protein C6F6.13c; acc. no. 
Q9US10 [Pyronema omphalodes CBS 100304]
Length=645

 Score =   140 bits (352),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 107/156 (69%), Gaps = 2/156 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            +D+ ++IA  RS+KAG++LA+ +    QG RPVTLVG+SLGARV++ CL  LA  G   G
Sbjct  430  VDNPFSIAKQRSEKAGLILADAIINKTQGERPVTLVGYSLGARVVYFCLLELAQRGAY-G  488

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            LVE VVL+GA +     +W+ +R VVAGR +NVYS  D++L  ++R S +  G+AG+Q +
Sbjct  489  LVENVVLMGAAVPANKESWKTIRSVVAGRVVNVYSEQDYVLAFLYRTSSIQLGVAGLQEI  548

Query  472  DVPGVENVDVTELIDGHSAYLWTSQEIL-ELLQLDT  368
             V GVENV+V + ++GH  Y +    IL ++L+ DT
Sbjct  549  KVRGVENVNVEDTVEGHLRYRYAVGRILGDVLKGDT  584


 Score = 45.8 bits (107),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 53/104 (51%), Gaps = 10/104 (10%)
 Frame = -1

Query  1164  RRMGDVDEFEFKTIGQ-NHNKGRLAVEILITG-FVFEESDFFRPWEGEYNNLERYALQWE  991
             R   +V +FEF  I +     GRL V I +TG  V  E +   PW+   + +E YAL+WE
Sbjct  319   RYAKEVSDFEFLPIRELGAEDGRLRVAIGVTGWLVNGEEEVVEPWKTLGDGVEGYALRWE  378

Query  990   SKHLMAVSYAIRNWLTSS----IALELMKRGAMMTVLSSFLTAL  871
                L  +  A+   LTS     +  E++KR    TVL++  +AL
Sbjct  379   VAALTDLGRAMEKILTSYAMGWVKKEIIKR----TVLAALYSAL  418



>ref|XP_010152926.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Eurypyga helias]
Length=610

 Score =   132 bits (331),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLRFVYRTSSVQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGVKT  522


 Score = 53.9 bits (128),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 57/104 (55%), Gaps = 6/104 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
              WES++LM +  A+ + L   + + + +     TVLS  +TALA
Sbjct  312   AWESRYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTALA  354



>gb|KFP70804.1| Transmembrane and coiled-coil domain-containing protein 4, partial 
[Acanthisitta chloris]
Length=506

 Score =   132 bits (333),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  349  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  408

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct  409  IIEDVVLLGAPVEGEAKYWKALTKVVSGRIINGYCRGDWLLSFVYRTSSVQLNVAGLQPV  468

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  469  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  505


 Score = 52.8 bits (125),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  238   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWRTMLQSKEQYCL  294

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  295   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  336



>ref|XP_010171576.1| PREDICTED: LOW QUALITY PROTEIN: transmembrane and coiled-coil 
domain-containing protein 4 [Caprimulgus carolinensis]
Length=602

 Score =   131 bits (330),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  364  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  423

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+A+ KVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct  424  IIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLRFVYRTSSVQINVAGLQPV  483

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  484  DLHDRRMVNMDLSSVVNGHLDYMKQMDMILKAVGIKT  520


 Score = 53.9 bits (128),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  253   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLQSSEQYCL  309

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  310   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  351



>ref|XP_007579866.1| putative duf726 domain-containing protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD52662.1| putative duf726 domain-containing protein [Neofusicoccum parvum 
UCRNP2]
Length=892

 Score =   147 bits (371),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/152 (51%), Positives = 103/152 (68%), Gaps = 2/152 (1%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
              +D+ ++IA  RSDKAG +LA+ L    QG RPVTL+G+SLGARVI+ CL  LA     
Sbjct  487  RIVDNPFSIARARSDKAGQVLADALVNKAQGERPVTLIGYSLGARVIYSCLLQLAER-RA  545

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
             GLVE VVL+GAP       W  +R VVAGR +NVYS+ND +LG ++R S +  G+AG+Q
Sbjct  546  FGLVENVVLMGAPTPSDAAAWRKMRTVVAGRVVNVYSSNDHILGFLYRTSSVQLGVAGLQ  605

Query  478  PVD-VPGVENVDVTELIDGHSAYLWTSQEILE  386
             V  V GVENVDV+ ++DGH+ Y W +  IL+
Sbjct  606  EVQGVQGVENVDVSAMVDGHTRYRWLTGTILK  637


 Score = 38.1 bits (87),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 41/81 (51%), Gaps = 8/81 (10%)
 Frame = -1

Query  1101  RLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSS----I  934
             RL + I I+G++ + +D F PW      LE +AL+WE   L+ +  ++   L S+     
Sbjct  401   RLRIAIAISGWLSDSTDVFTPWFVLGPQLETFALRWEVDALLKLGTSLSAVLKSAAWGYA  460

Query  933   ALELMKRGAMMTVLSSFLTAL  871
               E++KR    TVL S    L
Sbjct  461   KYEIVKR----TVLGSLAAGL  477



>ref|XP_003212354.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Meleagris gallopavo]
Length=641

 Score =   132 bits (331),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 101/159 (64%), Gaps = 2/159 (1%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
            + ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++
Sbjct  364  NVIDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDS  423

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
             G++E VVLLGAP+      W+A+ +VV+GR IN Y   DW+LG V+R S +   +AG+Q
Sbjct  424  QGIIEDVVLLGAPVEGEAKYWKAITRVVSGRIINGYCRGDWLLGFVYRTSSVQLNVAGLQ  483

Query  478  PV--DVPGVENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            PV  D   + N+D++ ++ GH  Y+     IL+ + + T
Sbjct  484  PVKLDDRRMVNMDLSSVVSGHLDYMKQMDTILKAVGIKT  522


 Score = 53.5 bits (127),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 58/106 (55%), Gaps = 12/106 (11%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW    ++ E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGR---QLHITIAITGWLCAGKYGSFTAPWSSMLHSSEQYCL  311

Query  999   QWESKHLMAVSYAIR---NWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+    N   + +A E +K     TVLS  +TAL
Sbjct  312   AWESKYLMELGSALDTLVNGFVNMMAQEALK----FTVLSGIVTAL  353



>ref|XP_010187070.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4, partial [Mesitornis unicolor]
Length=438

 Score =   131 bits (330),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 101/159 (64%), Gaps = 2/159 (1%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
            + ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++
Sbjct  192  NVIDNPWGVCLHRSAEVGKHLARILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAEEKDS  251

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
             G++E VVLLGAP+      W+A+ KVV+G+ IN Y   DW+L  V+R S +   +AG+Q
Sbjct  252  QGIIEDVVLLGAPVEGEAKYWKAITKVVSGKIINGYCRGDWLLRFVYRTSSVQINVAGLQ  311

Query  478  PVDVPGVE--NVDVTELIDGHSAYLWTSQEILELLQLDT  368
            PVD+      N+D++ +++GH  Y+     IL+ + + T
Sbjct  312  PVDLDDRRMINMDLSSVVNGHLDYMKQMDTILKAVGIKT  350


 Score = 53.9 bits (128),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  83    KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCAGKYGSFTAPWSSMLQSREQYCL  139

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  140   AWESKYLMELGSALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  181



>gb|KEY75495.1| hypothetical protein BA78_1654 [Aspergillus fumigatus var. RP-2014]
Length=683

 Score =   141 bits (356),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 106/156 (68%), Gaps = 2/156 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            +D+ +++A  R+DKAG +LA+ L   +QG RPVTL+G+SLG+RVIF CLQ LA      G
Sbjct  460  VDNPFSVAKARADKAGEVLADALISKVQGERPVTLIGYSLGSRVIFACLQSLAKR-RAFG  518

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            LVE  +L+GAP       W  +R VV+GR +NVYS ND +L +++R S L  G+AG+QPV
Sbjct  519  LVESAILMGAPTPSNSEQWCRIRSVVSGRLVNVYSENDSVLALLYRTSSLQLGVAGLQPV  578

Query  472  D-VPGVENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            + V G EN+DV++LI GH  Y +    IL ++ L++
Sbjct  579  EGVSGAENLDVSDLISGHLRYQFLVGRILSVVGLES  614


 Score = 43.9 bits (102),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 12/106 (11%)
 Frame = -1

Query  1152  DVDEFEFKTIGQN-----------HNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERY  1006
             +VD+F F  I  +           H   RL V I +TG++ EE +F  PW       E +
Sbjct  344   EVDDFAFLPIRGSRHRSEDEREAAHQDHRLRVTIGVTGWLTEEDNFVIPWRVIGAESEVF  403

Query  1005  ALQWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTALA  868
              L+WE++ LM +  A+ + L +S A    ++    T LS  LTA+A
Sbjct  404   GLRWETEPLMNLGNAL-DLLVTSAAWTAGEQVLKKTFLSQLLTAVA  448



>ref|XP_010303750.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Balearica regulorum gibbericeps]
Length=605

 Score =   133 bits (334),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  365  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  424

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            L+E VVLLGAP+      W+A+ KVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct  425  LIEDVVLLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLRFVYRTSSVQINVAGLQPV  484

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  485  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  521


 Score = 52.4 bits (124),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  254   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCAGKYGSFTAPWSSLLQSSEQYCL  310

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +   + + L   + + + +     TVLS  +TAL
Sbjct  311   AWESKYLMELGTVLDSLLNGFVNM-MAQEALKFTVLSGIMTAL  352



>ref|XP_005528440.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Pseudopodoces humilis]
Length=623

 Score =   131 bits (330),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A    + G
Sbjct  361  IDNPWGVCLHRSAEVGKHLARILLSRQQGQRPVTLIGFSLGARVIYFCLQEMAQEKGSQG  420

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+     +W+A+ +VV+GR IN +   DW+L  V+R S +   +AG+QPV
Sbjct  421  IIEDVVLLGAPVEGEAKHWKALTRVVSGRIINGFCRGDWLLSFVYRTSSVQLNVAGLQPV  480

Query  472  DVPGVE--NVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+      NVD++ +++GH  Y+     IL+ + + T
Sbjct  481  DLDDRRMVNVDLSSVVNGHLDYMKQMDTILKAVGIKT  517


 Score = 53.5 bits (127),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW    ++ E+Y L
Sbjct  250   KMKKRVGAIEEFEFLPLTEGR---QLHITIAITGWLCTGKYGSFTAPWGSMLHSSEQYCL  306

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  307   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  348



>ref|XP_008714926.1| hypothetical protein HMPREF1541_02349 [Cyphellophora europaea 
CBS 101466]
 gb|ETN43190.1| hypothetical protein HMPREF1541_02349 [Cyphellophora europaea 
CBS 101466]
Length=1151

 Score =   144 bits (363),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/155 (46%), Positives = 105/155 (68%), Gaps = 2/155 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            +D+ +++A  R+DKAG +LA+ L    QG RPVTLVG+SLGARVI+ CL+ LA      G
Sbjct  468  LDNPFSVAKSRADKAGEVLADALINRAQGERPVTLVGYSLGARVIYTCLKTLAER-KAFG  526

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            L+E  +++GAP      +W  +R  V+GR INVYS ND++LG ++R S L  G+AG++P+
Sbjct  527  LIEHAIMIGAPAPSDMTHWRVLRTAVSGRLINVYSENDYLLGFMYRTSALQYGVAGLEPI  586

Query  472  -DVPGVENVDVTELIDGHSAYLWTSQEILELLQLD  371
              + GVENV+V+E +DGH+ Y +    IL+ L  D
Sbjct  587  RGLAGVENVNVSEDVDGHTRYRFLVGAILKKLGFD  621


 Score = 40.4 bits (93),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 29/113 (26%), Positives = 58/113 (51%), Gaps = 23/113 (20%)
 Frame = -1

Query  1152  DVDEFEF------KTIGQNHNKG---------RLAVEILITGFVFEESDFFRPWEGEYNN  1018
             +V++FEF      +   ++H+KG         +L + I I+G++ E+ +  +PW      
Sbjct  348   EVEDFEFLQVHSDQKTSEDHDKGAQEASEHDHKLRLTICISGWLTEKQEVTKPWRVLGTG  407

Query  1017  LERYALQWESKHLMAVSYAIRNWLTSS----IALELMKRGAMMTVLSSFLTAL  871
              E +AL+WE + L+ + +A+   + S+       EL+KR    T+ +  ++AL
Sbjct  408   SEVFALKWELEALLNLGHAMDGMVQSAAWGYAQKELIKR----TIFAELMSAL  456



>gb|KKA18762.1| DUF726 domain protein [Rasamsonia emersonii CBS 393.64]
Length=972

 Score =   142 bits (358),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 106/160 (66%), Gaps = 2/160 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            +D+ +++A  R+DKAG +LA+ L    QG RPVTL+G+SLG+RV+F CLQ LA      G
Sbjct  687  VDNPFSVAKARADKAGEVLADALINKAQGERPVTLIGYSLGSRVVFSCLQSLAKR-RAYG  745

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            LVE  +L+G+P      +W  +R VV+GR +NV+S ND +L +++RAS    G+AG+Q +
Sbjct  746  LVETAILMGSPTPSNSKHWRMMRSVVSGRLVNVFSENDAVLALLYRASSAQLGVAGLQRI  805

Query  472  -DVPGVENVDVTELIDGHSAYLWTSQEILELLQLDTYYPV  356
             DVPGVENVD +EL+ GH  Y +   +IL  +  +   PV
Sbjct  806  EDVPGVENVDASELVSGHLRYQYLIGKILTNIGFEEIDPV  845


 Score = 42.4 bits (98),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 52/106 (49%), Gaps = 15/106 (14%)
 Frame = -1

Query  1152  DVDEFEF-KTIGQN----------HNKGRLAVEILITGFVFEESDFFRPWEGEYNNLERY  1006
             +V++F F  T GQN              RL V I ITG+  EE D   PW     + E +
Sbjct  569   EVEDFAFIPTRGQNKSFKDEKEAAQQDHRLRVTIGITGWATEEEDMVVPWRVIGPDSEVF  628

Query  1005  ALQWESKHLMAVSYAIRNWLTS---SIA-LELMKRGAMMTVLSSFL  880
             AL+WE + L+ +   IR  +TS   S+A  E++ R     ++S+ +
Sbjct  629   ALRWELESLLNLGNGIRALVTSAAWSVAGREILSRTIFAQIMSAVM  674



>emb|CCA73020.1| hypothetical protein PIIN_06975 [Piriformospora indica DSM 11827]
Length=592

 Score =   144 bits (363),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 105/151 (70%), Gaps = 2/151 (1%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
              +D+ + +A +RS+K G++LA+ +    QG RP++L+GFSLGARVI+ CL  LA     
Sbjct  427  RIVDNPFNVAKNRSEKTGLILADAIIHRAQGKRPISLIGFSLGARVIYSCLLSLAER-KA  485

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
             GLVE VVL+GAP+      W  +R VV+GR +N Y++ DW+LG ++R S +  G+AG+Q
Sbjct  486  FGLVETVVLMGAPVPSATETWALMRAVVSGRLVNAYASEDWVLGFLYRTSAIQLGVAGLQ  545

Query  478  PVD-VPGVENVDVTELIDGHSAYLWTSQEIL  389
            P++ V GVEN DV ++IDGH +Y +++Q I+
Sbjct  546  PIEGVEGVENFDVGDVIDGHLSYAYSTQAIV  576


 Score = 40.8 bits (94),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 53/104 (51%), Gaps = 13/104 (13%)
 Frame = -1

Query  1164  RRMGDVDEFEFKTIGQNHNK--GRLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWE  991
             R   +V++F F  +   H K   +L V + I+G++ ++     PW    ++   YAL+WE
Sbjct  321   RYADEVEDFAFLPL---HPKLESKLRVTVCISGWLTQDDQVKSPWMTFNDSANVYALRWE  377

Query  990   SKHLM----AVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              K L+    A+   +R +    I  E++KR    TVL+S  +AL
Sbjct  378   MKALLELGSAIETLVRQYAIGYIKSEIIKR----TVLASLWSAL  417



>ref|XP_005145526.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Melopsittacus undulatus]
Length=594

 Score =   131 bits (329),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 99/157 (63%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   +  G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDFQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+      W+ + KVV+GR IN Y   DW+LG V+R S     +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGDPKYWKPIAKVVSGRIINGYCRGDWLLGFVYRTSSAQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLEDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.5 bits (127),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 56/104 (54%), Gaps = 8/104 (8%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEE--SDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++       F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCPGKYGSFTAPWSSMLQSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAM-MTVLSSFLTAL  871
              WESK+LM +  A+   L   +   +M + A+  TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDTLLNGFV--NMMAQEALKFTVLSGIVTAL  353



>ref|XP_006031545.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Alligator sinensis]
Length=658

 Score =   131 bits (330),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 99/159 (62%), Gaps = 2/159 (1%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
            + ID+ W + + RS + G  LA +L    QG RPVTLVGFSLGARVI+ CLQ +A   ++
Sbjct  368  NVIDNPWGVCLHRSAEVGKHLAHILLSRQQGMRPVTLVGFSLGARVIYFCLQEMAQEKDS  427

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
             G+VE VVLLGAP+      W+A  KVV+GR IN Y   DW+L  V+R S     +AG+Q
Sbjct  428  EGIVEDVVLLGAPVEGEAKYWKACAKVVSGRIINGYCRGDWLLSFVYRTSSAKLNVAGLQ  487

Query  478  PVDVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            PV++    + NVD++ ++ GH  Y+     IL+ + + T
Sbjct  488  PVNLDDRRMVNVDLSSIVSGHLDYMKQMDTILKAVGIKT  526


 Score = 53.5 bits (127),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 58/106 (55%), Gaps = 12/106 (11%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  259   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLQSSEQYCL  315

Query  999   QWESKHLMAVSYAIR---NWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+    N L + +A E +K     T+LS  +TAL
Sbjct  316   AWESKYLMELGNALDSLLNGLVNIMAQEALK----YTILSGIVTAL  357



>ref|XP_008945640.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4, partial [Merops nubicus]
Length=517

 Score =   133 bits (334),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA VL  G QG RPVTL+GFSLGARVI+ CLQ +A   +  G
Sbjct  359  IDNPWGVCLHRSAEVGKQLAHVLLSGQQGKRPVTLIGFSLGARVIYFCLQEMAQEKDAQG  418

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E V+LLGAP+      W+A+ KVV+GR IN Y   DW+LG V+R S     +AG+QP+
Sbjct  419  IIEDVILLGAPVEGEAKYWKAITKVVSGRIINGYCRADWLLGFVYRTSSAQIHVAGLQPI  478

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL  + + T
Sbjct  479  DLDDRRMVNMDLSFVVNGHLDYMKQMDTILRAVGVRT  515


 Score = 51.6 bits (122),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 58/104 (56%), Gaps = 8/104 (8%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  248   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSLLRSSEQYCL  304

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAM-MTVLSSFLTAL  871
              WES++LM +  A+ + L   +   +M + A+  TVLS  +TAL
Sbjct  305   AWESRYLMELGNALDSLLNGFV--NMMAQEALKFTVLSGIVTAL  346



>ref|XP_005495905.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Zonotrichia albicollis]
Length=606

 Score =   130 bits (328),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  361  IDNPWGVCLHRSAEVGKHLAHILLSRQQGQRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  420

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+     +W A+ +VV+GR IN +   DW+L  V+R S +   +AG+QPV
Sbjct  421  IIEDVVLLGAPVEGEAKHWRALTRVVSGRIINGFCRGDWLLSFVYRTSSVQLSVAGLQPV  480

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  481  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  517


 Score = 53.9 bits (128),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 58/106 (55%), Gaps = 12/106 (11%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW    ++ E+Y L
Sbjct  250   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLHSSEQYCL  306

Query  999   QWESKHLMAVSYAIR---NWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+    N   + +A E +K     TVLS  +TAL
Sbjct  307   AWESKYLMELGNALDSLLNGFVNMVAQEALK----FTVLSGIVTAL  348



>ref|XP_002190164.2| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Taeniopygia guttata]
Length=614

 Score =   130 bits (328),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/159 (42%), Positives = 102/159 (64%), Gaps = 2/159 (1%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
            + ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++
Sbjct  377  NVIDNPWGVCLHRSAEVGKHLAHILLSRQQGQRPVTLIGFSLGARVIYFCLQEMAQEKDS  436

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
             G++E VVLLGAP+     +W A+ +VV+GR IN +   DW+L  V+R S +   +AG+Q
Sbjct  437  QGIIEDVVLLGAPVEGEAKHWRALTRVVSGRIINGFCRGDWLLSFVYRTSSVKLNVAGLQ  496

Query  478  PVDVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            PVD+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  497  PVDLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  535


 Score = 53.9 bits (128),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW    ++ E+Y L
Sbjct  268   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLHSSEQYCL  324

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  325   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  366



>ref|XP_005428211.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Geospiza fortis]
Length=610

 Score =   130 bits (328),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 101/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRQQGQRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+     +W A+ +VV+GR IN +   DW+L  V+R S +   +AG+QPV
Sbjct  426  IIEDVVLLGAPVEGEAKHWRALTRVVSGRIINGFCRGDWLLSFVYRTSSVQLNVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.9 bits (128),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW    ++ E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLHSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  353



>ref|XP_006115110.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X1 [Pelodiscus sinensis]
Length=465

 Score =   130 bits (326),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA++L    QG RPVTL+GFSLGARVI+ CL+ +A   +  G
Sbjct  175  IDNPWGVCLSRSAEVGKHLAQILLSRRQGKRPVTLIGFSLGARVIYFCLKEMAQEKDCEG  234

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+     NW+   KVV+GR IN Y   DW+L  V+R S     +AG+QPV
Sbjct  235  IIEDVVLLGAPVEGEAKNWKPFSKVVSGRIINGYCRGDWLLSFVYRTSSAQLNVAGLQPV  294

Query  472  --DVPGVENVDVTELIDGHSAYLWTSQEILELLQLDT  368
              D   + NVD++ +++GH  Y+     IL+ + + T
Sbjct  295  SLDDRRMVNVDLSSVVNGHLDYMKQMDTILKAVGIKT  331


 Score = 54.3 bits (129),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 58/106 (55%), Gaps = 12/106 (11%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  64    KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWNSMLQSREQYCL  120

Query  999   QWESKHLMAVSYAIR---NWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+    N L + +A E +K     TVLS  +TAL
Sbjct  121   AWESKYLMELGNALDSLLNGLVNIMAQEALK----YTVLSGIVTAL  162



>ref|XP_663872.1| hypothetical protein AN6268.2 [Aspergillus nidulans FGSC A4]
 gb|EAA58652.1| hypothetical protein AN6268.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF69817.1| TPA: DUF726 domain protein (AFU_orthologue; AFUA_2G12860) [Aspergillus 
nidulans FGSC A4]
Length=873

 Score =   140 bits (354),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 106/154 (69%), Gaps = 2/154 (1%)
 Frame = -3

Query  829  DSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAGL  650
            D+ +++A  R+DKAG +LA+ L   +QG RPVTL+G+SLG+RVIF CLQ L+   +  GL
Sbjct  634  DNPFSVAKSRADKAGEVLADALISKVQGERPVTLIGYSLGSRVIFSCLQTLSKR-HAYGL  692

Query  649  VERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPVD  470
            +E  + +GAP      +W  +R+VV+GR +NVYS ND +L  ++R S L  G+AG+Q ++
Sbjct  693  IESAIFMGAPTPSDTPDWRRMRRVVSGRLVNVYSGNDSVLAFLYRTSSLQLGVAGLQAIE  752

Query  469  -VPGVENVDVTELIDGHSAYLWTSQEILELLQLD  371
             VPGVEN+DV+++I+GH  Y +    IL  + L+
Sbjct  753  NVPGVENLDVSDIINGHLRYQYLLGRILRTVGLE  786


 Score = 43.5 bits (101),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = -1

Query  1101  RLAVEILITGFVFEESDFFRPWEGEYNNLERYALQWESKHLMAVSYAIRNWLTSS  937
             RL V I ITG++ EE +F  PW     + E + L+WE+K L+ + +AI   +TS+
Sbjct  545   RLRVTIGITGWLTEEDNFVVPWRVIGKDSEVFGLRWETKPLLDLGHAIDRLVTSA  599



>ref|XP_006115111.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4-like isoform X2 [Pelodiscus sinensis]
Length=417

 Score =   130 bits (327),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 98/157 (62%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA++L    QG RPVTL+GFSLGARVI+ CL+ +A   +  G
Sbjct  127  IDNPWGVCLSRSAEVGKHLAQILLSRRQGKRPVTLIGFSLGARVIYFCLKEMAQEKDCEG  186

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+     NW+   KVV+GR IN Y   DW+L  V+R S     +AG+QPV
Sbjct  187  IIEDVVLLGAPVEGEAKNWKPFSKVVSGRIINGYCRGDWLLSFVYRTSSAQLNVAGLQPV  246

Query  472  --DVPGVENVDVTELIDGHSAYLWTSQEILELLQLDT  368
              D   + NVD++ +++GH  Y+     IL+ + + T
Sbjct  247  SLDDRRMVNVDLSSVVNGHLDYMKQMDTILKAVGIKT  283


 Score = 53.9 bits (128),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 58/106 (55%), Gaps = 12/106 (11%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  16    KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWNSMLQSREQYCL  72

Query  999   QWESKHLMAVSYAIR---NWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+    N L + +A E +K     TVLS  +TAL
Sbjct  73    AWESKYLMELGNALDSLLNGLVNIMAQEALK----YTVLSGIVTAL  114



>ref|XP_005057822.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 isoform X1 [Ficedula albicollis]
Length=609

 Score =   130 bits (327),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 102/157 (65%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  365  IDNPWGVCLHRSAEVGKHLAHILLSRQQGQRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  424

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E VVLLGAP+     +W+A+ +VV+GR IN +   DW+L  V+R S +   +AG+QPV
Sbjct  425  IIEDVVLLGAPVEGEAKHWKALTRVVSGRIINGFCRGDWLLSFVYRTSSVQLNVAGLQPV  484

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  485  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIRT  521


 Score = 53.5 bits (127),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW    ++ E+Y L
Sbjct  254   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTVPWSSMLHSSEQYCL  310

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  311   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  352



>ref|XP_004377237.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Trichechus manatus latirostris]
Length=637

 Score =   135 bits (340),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = -3

Query  838  HFIDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNN  659
            + ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   + 
Sbjct  365  NVIDNPWGVCLHRSAEVGKHLAHILLSRQQGRRPVTLIGFSLGARVIYFCLQEMAQEKDC  424

Query  658  AGLVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQ  479
             G++E VVLLGAP+     +WEA RKVV+GR IN Y   DW+L  V+R S +   +AG+Q
Sbjct  425  QGIIEDVVLLGAPVEGEAKHWEAFRKVVSGRIINGYCRGDWLLRFVYRTSSVQLRVAGLQ  484

Query  478  PV--DVPGVENVDVTELIDGHSAY  413
            PV  D   VENVD++ ++ GH  Y
Sbjct  485  PVQLDDRRVENVDLSSVVSGHLDY  508


 Score = 48.9 bits (115),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVFEES--DFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EF F  + +     +L + I ITG++       F  PW     + E+Y L
Sbjct  256   KMKKRVGAIEEFTFLPLTEGR---QLHITITITGWLASGKYRTFIAPWAALARSREQYCL  312

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WE+K+LM +  A+   L S +A  + +     TVLS  + AL
Sbjct  313   AWEAKYLMELGNALETIL-SGLATMVAQEALKYTVLSGIVAAL  354



>ref|XP_010121688.1| PREDICTED: transmembrane and coiled-coil domain-containing protein 
4 [Chlamydotis macqueenii]
Length=606

 Score =   130 bits (328),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 100/157 (64%), Gaps = 2/157 (1%)
 Frame = -3

Query  832  IDSEWTIAVDRSDKAGILLAEVLQKGLQGHRPVTLVGFSLGARVIFKCLQILAASGNNAG  653
            ID+ W + + RS + G  LA +L    QG RPVTL+GFSLGARVI+ CLQ +A   ++ G
Sbjct  366  IDNPWGVCLHRSAEVGKHLAHILLSRRQGKRPVTLIGFSLGARVIYFCLQEMAQEKDSQG  425

Query  652  LVERVVLLGAPIRIRDVNWEAVRKVVAGRFINVYSTNDWMLGIVFRASLLSQGLAGIQPV  473
            ++E V LLGAP+      W+A+ KVV+GR IN Y   DW+L  V+R S +   +AG+QPV
Sbjct  426  IIEDVALLGAPVEGEAKYWKAITKVVSGRIINGYCRGDWLLRFVYRTSSVQINVAGLQPV  485

Query  472  DVPG--VENVDVTELIDGHSAYLWTSQEILELLQLDT  368
            D+    + N+D++ +++GH  Y+     IL+ + + T
Sbjct  486  DLDDRRMVNMDLSSVVNGHLDYMKQMDTILKAVGIKT  522


 Score = 53.1 bits (126),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = -1

Query  1173  KVARRMGDVDEFEFKTIGQNHNKGRLAVEILITGFVF--EESDFFRPWEGEYNNLERYAL  1000
             K+ +R+G ++EFEF  + +     +L + I ITG++   +   F  PW     + E+Y L
Sbjct  255   KMKKRVGAIEEFEFLPLTEGK---QLHITIAITGWLCTGKYGSFTAPWSSMLRSSEQYCL  311

Query  999   QWESKHLMAVSYAIRNWLTSSIALELMKRGAMMTVLSSFLTAL  871
              WESK+LM +  A+ + L   + + + +     TVLS  +TAL
Sbjct  312   AWESKYLMELGNALDSLLNGFVNM-MAQEALKFTVLSGIVTAL  353



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4388773014703