BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9796

Length=871
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFR66645.1|  MIP1.1a                                                 369   1e-122   Nicotiana benthamiana
ref|XP_007010484.1|  DNAJ                                               367   7e-122   Theobroma cacao [chocolate]
ref|XP_009588725.1|  PREDICTED: dnaJ protein homolog                    367   1e-121   Nicotiana tomentosiformis
gb|AGY48883.1|  MIP1.1b                                                 367   1e-121   Nicotiana benthamiana
ref|XP_011032891.1|  PREDICTED: dnaJ protein homolog                    367   1e-121   Populus euphratica
ref|XP_009760224.1|  PREDICTED: dnaJ protein homolog                    366   2e-121   Nicotiana sylvestris
dbj|BAC53943.1|  DnaJ homolog                                           362   4e-121   Nicotiana tabacum [American tobacco]
gb|AAG24642.1|AF308737_1  J1P                                           362   8e-120   Daucus carota [Queen Anne's lace]
ref|XP_002310999.1|  DnaJ family protein                                362   1e-119   Populus trichocarpa [western balsam poplar]
gb|KJB84159.1|  hypothetical protein B456_N007500                       362   1e-119   Gossypium raimondii
gb|KJB60379.1|  hypothetical protein B456_009G302500                    360   4e-119   Gossypium raimondii
dbj|BAA35121.1|  DnaJ homolog                                           360   6e-119   Salix gilgiana
gb|KDO48709.1|  hypothetical protein CISIN_1g015695mg                   358   7e-119   Citrus sinensis [Valencia orange]
ref|XP_006365673.1|  PREDICTED: dnaJ protein homolog isoform X2         359   8e-119   
ref|XP_010907714.1|  PREDICTED: dnaJ protein homolog                    359   8e-119   Elaeis guineensis
gb|KDO48714.1|  hypothetical protein CISIN_1g015695mg                   356   1e-118   Citrus sinensis [Valencia orange]
ref|XP_006365672.1|  PREDICTED: dnaJ protein homolog isoform X1         359   1e-118   
ref|XP_010319287.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    356   1e-118   Solanum lycopersicum
ref|XP_006345881.1|  PREDICTED: dnaJ protein homolog                    359   1e-118   Solanum tuberosum [potatoes]
gb|KDO48708.1|  hypothetical protein CISIN_1g015695mg                   357   2e-118   Citrus sinensis [Valencia orange]
ref|XP_009397426.1|  PREDICTED: dnaJ protein homolog                    358   2e-118   Musa acuminata subsp. malaccensis [pisang utan]
sp|P42824.1|DNJH2_ALLPO  RecName: Full=DnaJ protein homolog 2; Fl...    358   2e-118   Allium ampeloprasum
ref|XP_004306421.1|  PREDICTED: dnaJ protein homolog                    358   2e-118   Fragaria vesca subsp. vesca
gb|KDO48711.1|  hypothetical protein CISIN_1g015695mg                   358   2e-118   Citrus sinensis [Valencia orange]
gb|KDO48707.1|  hypothetical protein CISIN_1g015695mg                   357   3e-118   Citrus sinensis [Valencia orange]
ref|XP_006445792.1|  hypothetical protein CICLE_v10015385mg             358   3e-118   Citrus clementina
ref|XP_006485485.1|  PREDICTED: dnaJ protein homolog                    358   3e-118   Citrus sinensis [Valencia orange]
gb|AGY48885.1|  MIP1.3                                                  358   4e-118   Nicotiana benthamiana
ref|XP_009793842.1|  PREDICTED: dnaJ protein homolog isoform X2         357   4e-118   Nicotiana sylvestris
gb|KDO48710.1|  hypothetical protein CISIN_1g015695mg                   357   5e-118   Citrus sinensis [Valencia orange]
ref|XP_009793841.1|  PREDICTED: dnaJ protein homolog isoform X1         357   5e-118   Nicotiana sylvestris
ref|XP_011024143.1|  PREDICTED: dnaJ protein homolog                    357   6e-118   Populus euphratica
gb|AAN87055.1|  tuber-induction protein                                 353   8e-118   Solanum tuberosum [potatoes]
ref|XP_004236804.1|  PREDICTED: dnaJ protein homolog isoform X1         357   1e-117   Solanum lycopersicum
ref|XP_004249937.1|  PREDICTED: dnaJ protein homolog                    357   1e-117   
ref|XP_002316479.1|  DnaJ family protein                                357   1e-117   Populus trichocarpa [western balsam poplar]
ref|XP_009418972.1|  PREDICTED: dnaJ protein homolog isoform X2         356   2e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009418971.1|  PREDICTED: dnaJ protein homolog isoform X1         356   2e-117   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN82708.1|  hypothetical protein VITISV_000291                     355   2e-117   Vitis vinifera
ref|XP_010090486.1|  DnaJ-like protein                                  356   2e-117   Morus notabilis
ref|XP_010694477.1|  PREDICTED: dnaJ protein homolog                    356   2e-117   Beta vulgaris subsp. vulgaris [Swiss chard]
emb|CAA63965.1|  DnaJ protein                                           356   2e-117   Solanum tuberosum [potatoes]
ref|XP_009600920.1|  PREDICTED: dnaJ protein homolog                    356   2e-117   Nicotiana tomentosiformis
ref|XP_002263156.1|  PREDICTED: dnaJ protein homolog                    355   2e-117   Vitis vinifera
ref|XP_008787761.1|  PREDICTED: dnaJ protein homolog                    355   2e-117   Phoenix dactylifera
ref|XP_010263053.1|  PREDICTED: dnaJ protein homolog                    355   3e-117   Nelumbo nucifera [Indian lotus]
ref|XP_009623415.1|  PREDICTED: dnaJ protein homolog                    355   3e-117   Nicotiana tomentosiformis
ref|XP_002514419.1|  Chaperone protein dnaJ, putative                   355   4e-117   
gb|KCW50581.1|  hypothetical protein EUGRSUZ_J00292                     350   4e-117   Eucalyptus grandis [rose gum]
ref|XP_006378828.1|  hypothetical protein POPTR_0010s24930g             356   5e-117   Populus trichocarpa [western balsam poplar]
ref|XP_004239737.1|  PREDICTED: dnaJ protein homolog                    354   8e-117   Solanum lycopersicum
ref|XP_012090806.1|  PREDICTED: dnaJ protein homolog                    354   8e-117   Jatropha curcas
ref|XP_010907982.1|  PREDICTED: dnaJ protein homolog                    354   1e-116   Elaeis guineensis
gb|ABX57881.1|  DnaJ                                                    353   1e-116   Viola baoshanensis
ref|XP_007211787.1|  hypothetical protein PRUPE_ppa006330mg             353   2e-116   Prunus persica
ref|XP_009398344.1|  PREDICTED: dnaJ protein homolog 2-like             353   2e-116   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008375557.1|  PREDICTED: dnaJ protein homolog                    353   3e-116   Malus domestica [apple tree]
ref|XP_010263054.1|  PREDICTED: dnaJ protein homolog                    353   3e-116   Nelumbo nucifera [Indian lotus]
ref|XP_008231805.1|  PREDICTED: dnaJ protein homolog                    353   4e-116   Prunus mume [ume]
ref|XP_011084248.1|  PREDICTED: dnaJ protein homolog                    352   4e-116   Sesamum indicum [beniseed]
ref|XP_006367021.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    349   6e-116   Solanum tuberosum [potatoes]
gb|ABB16980.1|  DnaJ-like protein                                       352   8e-116   Solanum tuberosum [potatoes]
gb|KJB35426.1|  hypothetical protein B456_006G117100                    351   2e-115   Gossypium raimondii
gb|KHG17902.1|  Chaperone dnaJ 3 -like protein                          351   2e-115   Gossypium arboreum [tree cotton]
ref|XP_004982304.1|  PREDICTED: dnaJ protein homolog 2-like             351   2e-115   Setaria italica
ref|XP_006367020.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    350   5e-115   Solanum tuberosum [potatoes]
ref|XP_008345828.1|  PREDICTED: dnaJ protein homolog                    350   5e-115   Malus domestica [apple tree]
ref|XP_009766164.1|  PREDICTED: dnaJ protein homolog 2-like             349   7e-115   Nicotiana sylvestris
gb|ABI83623.1|  DnaJ-like protein                                       349   1e-114   Setaria italica
gb|KCW50580.1|  hypothetical protein EUGRSUZ_J00292                     347   2e-114   Eucalyptus grandis [rose gum]
ref|XP_002270362.1|  PREDICTED: dnaJ protein homolog isoform X1         348   2e-114   Vitis vinifera
ref|XP_010031320.1|  PREDICTED: dnaJ protein homolog                    348   3e-114   Eucalyptus grandis [rose gum]
ref|XP_010651845.1|  PREDICTED: dnaJ protein homolog isoform X2         347   4e-114   Vitis vinifera
ref|XP_009341572.1|  PREDICTED: dnaJ protein homolog                    347   6e-114   Pyrus x bretschneideri [bai li]
gb|AFW68139.1|  putative dnaJ chaperone family protein                  344   7e-114   Zea mays [maize]
gb|AGY48884.1|  MIP1.2                                                  347   9e-114   Nicotiana benthamiana
sp|Q04960.1|DNJH_CUCSA  RecName: Full=DnaJ protein homolog; AltNa...    346   1e-113   Cucumis sativus [cucumbers]
ref|XP_004981504.1|  PREDICTED: dnaJ protein homolog                    346   1e-113   Setaria italica
ref|NP_001238341.1|  seed maturation protein PM37                       346   1e-113   Glycine max [soybeans]
ref|NP_001168650.1|  putative dnaJ chaperone family protein             345   3e-113   Zea mays [maize]
ref|NP_001146715.1|  uncharacterized protein LOC100280317               345   4e-113   Zea mays [maize]
ref|XP_009406563.1|  PREDICTED: dnaJ protein homolog                    345   4e-113   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW68140.1|  putative dnaJ chaperone family protein isoform 1        345   4e-113   Zea mays [maize]
ref|NP_001149958.1|  dnaJ protein                                       342   5e-113   Zea mays [maize]
gb|KCW50936.1|  hypothetical protein EUGRSUZ_J00583                     342   6e-113   Eucalyptus grandis [rose gum]
ref|NP_001130317.1|  chaperone DNA J2                                   344   8e-113   Zea mays [maize]
gb|AGY48886.1|  MIP1.4a                                                 343   8e-113   Nicotiana benthamiana
ref|XP_008446732.1|  PREDICTED: dnaJ protein homolog                    343   1e-112   Cucumis melo [Oriental melon]
ref|XP_002466747.1|  hypothetical protein SORBIDRAFT_01g013390          344   1e-112   Sorghum bicolor [broomcorn]
ref|XP_009408521.1|  PREDICTED: dnaJ protein homolog isoform X2         343   1e-112   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABA46776.1|  DnaJ-like protein                                       345   1e-112   Solanum tuberosum [potatoes]
ref|XP_004139085.1|  PREDICTED: dnaJ protein homolog                    343   1e-112   Cucumis sativus [cucumbers]
gb|KDO48966.1|  hypothetical protein CISIN_1g014903mg                   340   2e-112   Citrus sinensis [Valencia orange]
ref|XP_009408520.1|  PREDICTED: dnaJ protein homolog isoform X1         343   2e-112   Musa acuminata subsp. malaccensis [pisang utan]
sp|Q03363.1|DNJH1_ALLPO  RecName: Full=DnaJ protein homolog 1; Sh...    342   2e-112   Allium ampeloprasum
ref|XP_008443634.1|  PREDICTED: dnaJ protein homolog                    343   2e-112   Cucumis melo [Oriental melon]
ref|XP_010089798.1|  DnaJ-like protein                                  343   3e-112   Morus notabilis
ref|XP_010031575.1|  PREDICTED: dnaJ protein homolog                    342   3e-112   Eucalyptus grandis [rose gum]
ref|XP_006826444.1|  PREDICTED: dnaJ protein homolog                    342   4e-112   Amborella trichopoda
gb|ABI18985.1|  molecular chaperone DjA2                                342   5e-112   Allium ampeloprasum
emb|CDO99946.1|  unnamed protein product                                342   5e-112   Coffea canephora [robusta coffee]
ref|NP_001267695.1|  dnaJ protein homolog                               342   6e-112   Cucumis sativus [cucumbers]
ref|XP_003596917.1|  DnaJ                                               336   8e-112   
gb|AAF64454.1|AF239932_1  DnaJ protein                                  341   1e-111   Euphorbia esula [wolf's milk]
gb|EMT10718.1|  DnaJ protein-like protein                               341   1e-111   Aegilops tauschii
ref|NP_001242510.1|  uncharacterized protein LOC100808604               341   1e-111   Glycine max [soybeans]
ref|XP_006424068.1|  hypothetical protein CICLE_v10028531mg             341   1e-111   Citrus clementina
ref|XP_006590333.1|  PREDICTED: uncharacterized protein LOC100808...    341   2e-111   Glycine max [soybeans]
gb|EMT20603.1|  DnaJ protein-like protein                               340   2e-111   Aegilops tauschii
gb|KJB09149.1|  hypothetical protein B456_001G126200                    340   3e-111   Gossypium raimondii
gb|AAX95135.1|  DnaJ protein, putative                                  340   3e-111   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001050779.1|  Os03g0648400                                       340   3e-111   
ref|NP_001234241.1|  DnaJ-like protein                                  340   3e-111   
gb|AAD12055.1|  DnaJ protein                                            340   4e-111   Hevea brasiliensis [Para rubber tree]
ref|XP_009789005.1|  PREDICTED: dnaJ protein homolog                    340   4e-111   Nicotiana sylvestris
ref|XP_004506241.1|  PREDICTED: dnaJ protein homolog ANJ1-like          339   8e-111   Cicer arietinum [garbanzo]
ref|XP_007132506.1|  hypothetical protein PHAVU_011G100000g             338   1e-110   Phaseolus vulgaris [French bean]
ref|XP_008385581.1|  PREDICTED: dnaJ protein homolog                    338   1e-110   Malus domestica [apple tree]
gb|AHA84223.1|  seed maturation protein PM37                            338   2e-110   Phaseolus vulgaris [French bean]
emb|CDP15561.1|  unnamed protein product                                338   2e-110   Coffea canephora [robusta coffee]
ref|XP_008359180.1|  PREDICTED: dnaJ protein homolog                    338   3e-110   Malus domestica [apple tree]
ref|XP_006650350.1|  PREDICTED: dnaJ protein homolog 2-like             338   3e-110   
ref|XP_011090296.1|  PREDICTED: dnaJ protein homolog                    337   3e-110   Sesamum indicum [beniseed]
ref|XP_003561819.1|  PREDICTED: dnaJ protein homolog                    337   4e-110   Brachypodium distachyon [annual false brome]
ref|XP_003596916.1|  DnaJ                                               337   4e-110   Medicago truncatula
gb|AFK37703.1|  unknown                                                 337   6e-110   Medicago truncatula
gb|ACJ84348.1|  unknown                                                 331   6e-110   Medicago truncatula
ref|XP_012066359.1|  PREDICTED: dnaJ protein homolog                    336   1e-109   Jatropha curcas
gb|KJB35429.1|  hypothetical protein B456_006G117100                    337   2e-109   Gossypium raimondii
ref|XP_007015641.1|  DNAJ isoform 2                                     335   2e-109   Theobroma cacao [chocolate]
ref|XP_009368443.1|  PREDICTED: dnaJ protein homolog                    335   2e-109   Pyrus x bretschneideri [bai li]
gb|AGY48887.1|  MIP1.4b                                                 335   2e-109   Nicotiana benthamiana
gb|AFK46626.1|  unknown                                                 329   3e-109   Medicago truncatula
gb|AFW67420.1|  putative dnaJ chaperone family protein                  335   3e-109   Zea mays [maize]
gb|AFW67421.1|  putative dnaJ chaperone family protein                  335   3e-109   Zea mays [maize]
gb|AFK38714.1|  unknown                                                 328   3e-109   Lotus japonicus
ref|XP_002313505.1|  seed maturation protein PM37                       335   4e-109   Populus trichocarpa [western balsam poplar]
gb|AFK48086.1|  unknown                                                 328   4e-109   Medicago truncatula
gb|ADK35105.1|  DnaJ-like protein 1                                     328   5e-109   Astragalus sinicus
ref|NP_001240264.1|  uncharacterized protein LOC100818805               334   9e-109   Glycine max [soybeans]
gb|EYU37228.1|  hypothetical protein MIMGU_mgv1a006942mg                334   9e-109   Erythranthe guttata [common monkey flower]
gb|EYU36023.1|  hypothetical protein MIMGU_mgv1a007093mg                334   1e-108   Erythranthe guttata [common monkey flower]
ref|XP_004291531.1|  PREDICTED: dnaJ protein homolog                    333   2e-108   Fragaria vesca subsp. vesca
ref|XP_009592511.1|  PREDICTED: dnaJ protein homolog                    333   2e-108   Nicotiana tomentosiformis
gb|AHA84264.1|  seed maturation protein PM37                            333   2e-108   Phaseolus vulgaris [French bean]
gb|KHN17991.1|  DnaJ protein like                                       333   2e-108   Glycine soja [wild soybean]
ref|XP_008230416.1|  PREDICTED: dnaJ protein homolog                    332   3e-108   Prunus mume [ume]
ref|XP_009336413.1|  PREDICTED: dnaJ protein homolog                    332   4e-108   Pyrus x bretschneideri [bai li]
ref|XP_008361658.1|  PREDICTED: dnaJ protein homolog                    332   4e-108   Malus domestica [apple tree]
ref|XP_002515865.1|  Chaperone protein dnaJ, putative                   332   6e-108   Ricinus communis
ref|XP_008670357.1|  PREDICTED: dnaJ protein homolog 2-like             326   8e-108   Zea mays [maize]
tpg|DAA40640.1|  TPA: putative dnaJ chaperone family protein            327   9e-108   Zea mays [maize]
ref|XP_003540271.1|  PREDICTED: dnaJ protein homolog                    331   1e-107   Glycine max [soybeans]
ref|XP_007205259.1|  hypothetical protein PRUPE_ppa006299mg             330   2e-107   Prunus persica
gb|AFW89867.1|  putative dnaJ chaperone family protein                  327   3e-107   Zea mays [maize]
ref|XP_008661261.1|  PREDICTED: dnaJ protein homolog 2-like             326   4e-107   Zea mays [maize]
ref|XP_003605981.1|  DnaJ                                               329   7e-107   
ref|XP_003605980.1|  DnaJ                                               329   8e-107   Medicago truncatula
ref|XP_006650701.1|  PREDICTED: dnaJ protein homolog 2-like             328   9e-107   Oryza brachyantha
gb|EYU36024.1|  hypothetical protein MIMGU_mgv1a007013mg                328   2e-106   Erythranthe guttata [common monkey flower]
ref|NP_001051497.1|  Os03g0787300                                       328   2e-106   
gb|EAY92107.1|  hypothetical protein OsI_13813                          328   2e-106   Oryza sativa Indica Group [Indian rice]
ref|XP_004291528.1|  PREDICTED: dnaJ protein homolog                    328   2e-106   Fragaria vesca subsp. vesca
ref|XP_006340319.1|  PREDICTED: dnaJ protein homolog ANJ1-like is...    325   3e-106   Solanum tuberosum [potatoes]
ref|XP_006340318.1|  PREDICTED: dnaJ protein homolog ANJ1-like is...    326   1e-105   Solanum tuberosum [potatoes]
gb|EYU37227.1|  hypothetical protein MIMGU_mgv1a006922mg                326   2e-105   Erythranthe guttata [common monkey flower]
ref|XP_007150008.1|  hypothetical protein PHAVU_005G118100g             325   3e-105   Phaseolus vulgaris [French bean]
ref|NP_001275059.1|  DnaJ-like protein                                  325   7e-105   Solanum tuberosum [potatoes]
gb|KHG16063.1|  DnaJ protein                                            319   1e-104   Gossypium arboreum [tree cotton]
ref|XP_007015640.1|  DNAJ isoform 1                                     323   1e-104   Theobroma cacao [chocolate]
ref|XP_010685460.1|  PREDICTED: dnaJ protein homolog ANJ1               323   2e-104   Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_008660777.1|  PREDICTED: dnaJ protein homolog 2-like             317   1e-103   Zea mays [maize]
gb|KHG01500.1|  Chaperone dnaJ 3 -like protein                          317   2e-103   Gossypium arboreum [tree cotton]
ref|XP_011008852.1|  PREDICTED: dnaJ protein homolog isoform X1         320   2e-103   Populus euphratica
ref|XP_011008853.1|  PREDICTED: dnaJ protein homolog isoform X2         320   2e-103   Populus euphratica
ref|XP_003558043.1|  PREDICTED: dnaJ protein homolog                    319   7e-103   Brachypodium distachyon [annual false brome]
ref|XP_004251216.1|  PREDICTED: dnaJ protein homolog                    318   8e-103   Solanum lycopersicum
ref|XP_010544327.1|  PREDICTED: dnaJ protein homolog                    318   2e-102   Tarenaya hassleriana [spider flower]
sp|P43644.1|DNJH_ATRNU  RecName: Full=DnaJ protein homolog ANJ1; ...    317   4e-102   Atriplex nummularia
gb|KDP22008.1|  hypothetical protein JCGZ_03128                         313   7e-102   Jatropha curcas
ref|XP_002874044.1|  hypothetical protein ARALYDRAFT_489058             316   7e-102   Arabidopsis lyrata subsp. lyrata
ref|XP_010521621.1|  PREDICTED: dnaJ protein homolog ANJ1-like          315   2e-101   Tarenaya hassleriana [spider flower]
emb|CAC12824.1|  putative DNAJ protein                                  314   4e-101   Nicotiana tabacum [American tobacco]
gb|EMS60670.1|  DnaJ protein-like protein                               314   9e-101   Triticum urartu
gb|AFW86285.1|  putative dnaJ chaperone family protein                  319   2e-100   Zea mays [maize]
gb|ABG78615.1|  J-domain protein                                        312   2e-100   Triticum aestivum [Canadian hard winter wheat]
ref|NP_568412.1|  chaperone protein dnaJ 2                              310   2e-99    Arabidopsis thaliana [mouse-ear cress]
gb|ACN39991.1|  unknown                                                 309   4e-99    Picea sitchensis
ref|XP_006400711.1|  hypothetical protein EUTSA_v10013655mg             309   5e-99    Eutrema salsugineum
dbj|BAJ91943.1|  predicted protein                                      308   7e-99    Hordeum vulgare subsp. vulgare [barley]
ref|XP_011088982.1|  PREDICTED: dnaJ protein homolog                    308   1e-98    Sesamum indicum [beniseed]
ref|XP_001782829.1|  predicted protein                                  307   2e-98    Physcomitrella patens
gb|AAB86799.1|  putative                                                307   3e-98    Arabidopsis thaliana [mouse-ear cress]
gb|ABK21047.1|  unknown                                                 299   3e-98    Picea sitchensis
ref|XP_008666814.1|  PREDICTED: dnaJ protein homolog 1-like             310   3e-98    Zea mays [maize]
ref|XP_001774283.1|  predicted protein                                  305   9e-98    Physcomitrella patens
ref|XP_002275918.1|  PREDICTED: dnaJ protein homolog 2                  305   1e-97    Vitis vinifera
ref|XP_010919645.1|  PREDICTED: dnaJ protein homolog                    305   2e-97    Elaeis guineensis
ref|XP_009120689.1|  PREDICTED: chaperone protein dnaJ 3-like           304   4e-97    Brassica rapa
emb|CDX92385.1|  BnaA10g14240D                                          304   4e-97    Brassica napus [oilseed rape]
ref|XP_009120690.1|  PREDICTED: chaperone protein dnaJ 3-like           304   5e-97    Brassica rapa
emb|CDX92386.1|  BnaA10g14250D                                          303   9e-97    Brassica napus [oilseed rape]
ref|XP_010420996.1|  PREDICTED: chaperone protein dnaJ 2 isoform X1     303   1e-96    Camelina sativa [gold-of-pleasure]
ref|XP_002969107.1|  hypothetical protein SELMODRAFT_267228             302   1e-96    Selaginella moellendorffii
ref|NP_189997.1|  chaperone protein dnaJ 3                              302   2e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010089281.1|  DnaJ-like protein                                  302   2e-96    Morus notabilis
ref|XP_002877319.1|  hypothetical protein ARALYDRAFT_905503             302   3e-96    Arabidopsis lyrata subsp. lyrata
ref|XP_006292339.1|  hypothetical protein CARUB_v10018551mg             301   3e-96    Capsella rubella
ref|XP_010454471.1|  PREDICTED: chaperone protein dnaJ 2                301   4e-96    Camelina sativa [gold-of-pleasure]
emb|CBI28261.3|  unnamed protein product                                300   4e-96    Vitis vinifera
ref|XP_006404506.1|  hypothetical protein EUTSA_v10010407mg             301   4e-96    Eutrema salsugineum
ref|XP_006287824.1|  hypothetical protein CARUB_v10001042mg             301   5e-96    Capsella rubella
ref|XP_010535721.1|  PREDICTED: chaperone protein dnaJ 3                301   5e-96    Tarenaya hassleriana [spider flower]
ref|XP_010427107.1|  PREDICTED: chaperone protein dnaJ 3 isoform X1     301   6e-96    Camelina sativa [gold-of-pleasure]
ref|XP_010514755.1|  PREDICTED: chaperone protein dnaJ 3-like           301   6e-96    Camelina sativa [gold-of-pleasure]
gb|AAK74013.1|  AT3g44110/F26G5_60                                      301   6e-96    Arabidopsis thaliana [mouse-ear cress]
gb|AAB49030.1|  DnaJ homolog                                            301   8e-96    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126521.1|  PREDICTED: chaperone protein dnaJ 3                300   1e-95    Brassica rapa
emb|CDY16617.1|  BnaC09g36560D                                          293   1e-95    Brassica napus [oilseed rape]
emb|CDY09117.1|  BnaA02g05430D                                          300   1e-95    Brassica napus [oilseed rape]
gb|KFK26344.1|  hypothetical protein AALP_AA8G235700                    300   1e-95    Arabis alpina [alpine rockcress]
ref|XP_010493266.1|  PREDICTED: chaperone protein dnaJ 2-like iso...    300   2e-95    Camelina sativa [gold-of-pleasure]
ref|XP_010520679.1|  PREDICTED: chaperone protein dnaJ 3-like           301   3e-95    Tarenaya hassleriana [spider flower]
gb|KHG16062.1|  Chaperone protein dnaJ 3                                295   5e-95    Gossypium arboreum [tree cotton]
ref|XP_001755408.1|  predicted protein                                  298   7e-95    Physcomitrella patens
ref|XP_001768102.1|  predicted protein                                  296   3e-94    Physcomitrella patens
gb|KHN36510.1|  DnaJ protein like                                       292   4e-94    Glycine soja [wild soybean]
ref|XP_010933633.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    296   5e-94    Elaeis guineensis
ref|XP_010933632.1|  PREDICTED: dnaJ protein homolog isoform X1         296   5e-94    Elaeis guineensis
ref|XP_008803820.1|  PREDICTED: dnaJ protein homolog 2-like             294   2e-93    
ref|XP_006445374.1|  hypothetical protein CICLE_v10020330mg             291   3e-93    Citrus clementina
ref|XP_009779099.1|  PREDICTED: dnaJ protein homolog                    293   9e-93    Nicotiana sylvestris
ref|XP_010248011.1|  PREDICTED: dnaJ protein homolog 2-like             292   1e-92    Nelumbo nucifera [Indian lotus]
ref|XP_006445376.1|  hypothetical protein CICLE_v10020330mg             292   2e-92    Citrus clementina
emb|CDY65546.1|  BnaCnng47600D                                          291   3e-92    Brassica napus [oilseed rape]
ref|XP_002963792.1|  hypothetical protein SELMODRAFT_230221             291   4e-92    Selaginella moellendorffii
ref|XP_009622737.1|  PREDICTED: dnaJ protein homolog 2-like             290   2e-91    Nicotiana tomentosiformis
ref|XP_009382439.1|  PREDICTED: dnaJ protein homolog                    290   2e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011621168.1|  PREDICTED: dnaJ protein homolog 2                  288   7e-91    Amborella trichopoda
ref|XP_002974881.1|  hypothetical protein SELMODRAFT_232411             287   1e-90    Selaginella moellendorffii
ref|XP_010258833.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    284   1e-90    Nelumbo nucifera [Indian lotus]
ref|XP_002983333.1|  hypothetical protein SELMODRAFT_118063             287   2e-90    Selaginella moellendorffii
emb|CBI16632.3|  unnamed protein product                                295   2e-90    Vitis vinifera
gb|ACJ83716.1|  unknown                                                 278   2e-90    Medicago truncatula
ref|XP_007052233.1|  DNAJ                                               286   4e-90    Theobroma cacao [chocolate]
ref|XP_010258832.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    285   9e-90    Nelumbo nucifera [Indian lotus]
ref|XP_008232370.1|  PREDICTED: dnaJ protein homolog 2-like             284   2e-89    Prunus mume [ume]
ref|XP_009131855.1|  PREDICTED: chaperone protein dnaJ 3-like           283   3e-89    Brassica rapa
ref|XP_003521084.1|  PREDICTED: dnaJ protein homolog 2-like             283   4e-89    Glycine max [soybeans]
ref|XP_007220469.1|  hypothetical protein PRUPE_ppa006364mg             283   4e-89    Prunus persica
ref|XP_002446897.1|  hypothetical protein SORBIDRAFT_06g024520          283   8e-89    Sorghum bicolor [broomcorn]
gb|KJB84164.1|  hypothetical protein B456_N007500                       283   8e-89    Gossypium raimondii
gb|ACU24346.1|  unknown                                                 281   2e-88    Glycine max [soybeans]
ref|XP_004976432.1|  PREDICTED: dnaJ protein homolog 2-like             281   3e-88    Setaria italica
gb|AGR45906.1|  DnaJ protein 2-like protein                             280   7e-88    Triticum aestivum [Canadian hard winter wheat]
tpg|DAA50892.1|  TPA: putative dnaJ chaperone family protein            293   1e-87    Zea mays [maize]
gb|ABY52936.1|  DnaJ family heat shock protein                          279   2e-87    Oryza sativa Japonica Group [Japonica rice]
emb|CDX70980.1|  BnaC03g10640D                                          278   4e-87    Brassica napus [oilseed rape]
ref|XP_003529049.1|  PREDICTED: dnaJ protein homolog 2-like             278   5e-87    Glycine max [soybeans]
ref|XP_004229763.1|  PREDICTED: dnaJ protein homolog 2-like             278   5e-87    Solanum lycopersicum
emb|CDP09461.1|  unnamed protein product                                276   1e-86    Coffea canephora [robusta coffee]
ref|NP_001136581.1|  putative dnaJ chaperone family protein             277   2e-86    Zea mays [maize]
ref|XP_004953339.1|  PREDICTED: dnaJ protein homolog 2-like             276   2e-86    Setaria italica
ref|XP_006347934.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    276   4e-86    
ref|XP_010692097.1|  PREDICTED: dnaJ protein homolog 2-like             275   6e-86    Beta vulgaris subsp. vulgaris [Swiss chard]
ref|XP_003570021.1|  PREDICTED: dnaJ protein homolog 2-like             275   8e-86    Brachypodium distachyon [annual false brome]
emb|CAH67501.1|  OSIGBa0134H18.3                                        274   2e-85    Oryza sativa Indica Group [Indian rice]
ref|NP_001053485.1|  Os04g0549600                                       274   2e-85    
ref|XP_008375745.1|  PREDICTED: dnaJ protein homolog 2-like             273   4e-85    Malus domestica [apple tree]
dbj|BAA76883.1|  DnaJ homolog protein                                   273   6e-85    Salix gilgiana
ref|XP_006345526.1|  PREDICTED: dnaJ protein homolog isoform X1         273   7e-85    Solanum tuberosum [potatoes]
ref|XP_009411580.1|  PREDICTED: dnaJ protein homolog                    273   8e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011457522.1|  PREDICTED: dnaJ protein homolog                    271   1e-84    Fragaria vesca subsp. vesca
ref|XP_006647627.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    270   1e-83    Oryza brachyantha
ref|XP_006647626.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    270   1e-83    Oryza brachyantha
ref|XP_007134513.1|  hypothetical protein PHAVU_010G053900g             269   1e-83    Phaseolus vulgaris [French bean]
dbj|BAD25681.1|  putative DnaJ-like protein MsJ1                        269   2e-83    Oryza sativa Japonica Group [Japonica rice]
gb|EEC73725.1|  hypothetical protein OsI_08334                          269   2e-83    Oryza sativa Indica Group [Indian rice]
ref|NP_001047626.1|  Os02g0656500                                       269   2e-83    
gb|EEE57509.1|  hypothetical protein OsJ_07792                          268   6e-83    
emb|CAD41609.2|  OSJNBb0034G17.1                                        275   9e-83    
gb|AGY48888.1|  MIP1L1                                                  267   1e-82    
ref|XP_004307004.1|  PREDICTED: dnaJ protein homolog 2-like             265   4e-82    
gb|KHF97331.1|  Chaperone dnaJ 3 -like protein                          265   9e-82    
gb|KJB41004.1|  hypothetical protein B456_007G087000                    262   1e-81    
ref|XP_009596179.1|  PREDICTED: dnaJ protein homolog                    263   2e-81    
tpg|DAA41085.1|  TPA: putative dnaJ chaperone family protein            264   6e-81    
gb|KJB41003.1|  hypothetical protein B456_007G087000                    261   2e-80    
ref|XP_010053981.1|  PREDICTED: dnaJ protein homolog                    258   3e-79    
ref|XP_011093285.1|  PREDICTED: chaperone protein dnaJ 3-like           257   7e-79    
ref|XP_004510114.1|  PREDICTED: dnaJ protein homolog 2-like             256   1e-78    
ref|XP_012083680.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    253   2e-77    
ref|XP_011017420.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    249   9e-77    
ref|XP_002454540.1|  hypothetical protein SORBIDRAFT_04g032970          251   1e-76    
ref|XP_006386554.1|  hypothetical protein POPTR_0002s14200g             251   1e-76    
ref|XP_002301248.1|  DnaJ family protein                                251   1e-76    
gb|EPS67712.1|  hypothetical protein M569_07062                         246   3e-76    
ref|XP_011017419.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    249   6e-76    
ref|XP_001774301.1|  predicted protein                                  249   8e-76    
ref|XP_002511620.1|  Chaperone protein dnaJ, putative                   248   9e-76    
tpg|DAA45534.1|  TPA: putative dnaJ chaperone family protein            241   3e-75    
gb|AFK35446.1|  unknown                                                 243   7e-75    
gb|AFK48766.1|  unknown                                                 244   6e-74    
ref|XP_003626730.1|  DnaJ protein-like protein                          244   7e-74    
gb|ACJ84518.1|  unknown                                                 243   1e-73    
gb|EPS61572.1|  hypothetical protein M569_13222                         235   2e-73    
emb|CAA04447.1|  DnaJ-like protein                                      241   1e-72    
emb|CAN64325.1|  hypothetical protein VITISV_005641                     239   3e-72    
tpg|DAA39063.1|  TPA: putative dnaJ chaperone family protein            231   8e-70    
ref|XP_008671675.1|  PREDICTED: dnaJ protein homolog                    218   1e-66    
ref|XP_006369376.1|  hypothetical protein POPTR_0001s22240g             216   1e-64    
ref|XP_012083681.1|  PREDICTED: dnaJ protein homolog 2-like isofo...    217   1e-63    
gb|AHH02353.1|  putative DnaJ-like protein                              207   1e-63    
ref|XP_003058583.1|  predicted protein                                  216   6e-63    
ref|XP_002507968.1|  predicted protein                                  215   1e-62    
ref|XP_001419206.1|  predicted protein                                  215   1e-62    
tpg|DAA39850.1|  TPA: putative dnaJ chaperone family protein            205   9e-62    
gb|AFW72108.1|  putative dnaJ chaperone family protein                  218   2e-61    
ref|XP_003080911.1|  DnaJ-like protein (ISS)                            211   4e-61    
gb|AFW76668.1|  putative dnaJ chaperone family protein                  216   3e-60    
tpg|DAA45343.1|  TPA: putative dnaJ chaperone family protein            218   5e-60    
gb|ADW66143.1|  DnaJ like-protein                                       192   1e-57    
ref|XP_010098885.1|  DnaJ-like protein                                  187   7e-56    
ref|NP_850653.1|  chaperone protein dnaJ 3                              191   3e-54    
ref|XP_002900006.1|  conserved hypothetical protein                     191   1e-53    
ref|XP_009525521.1|  hypothetical protein PHYSODRAFT_345922             191   2e-53    
gb|KDO27150.1|  hypothetical protein SPRG_07857                         190   2e-53    
ref|XP_008890293.1|  hypothetical protein PPTG_00631                    190   3e-53    
ref|XP_008874481.1|  hypothetical protein H310_10021                    190   4e-53    
gb|KDO27145.1|  hypothetical protein SPRG_07853                         189   7e-53    
ref|XP_008607516.1|  hypothetical protein SDRG_03657                    189   1e-52    
ref|XP_008612573.1|  DnaJ like subfamily A member 2                     189   1e-52    
ref|XP_004487721.1|  PREDICTED: dnaJ protein homolog                    185   4e-52    
gb|KDO19151.1|  hypothetical protein SPRG_15718                         182   4e-51    
ref|XP_007515206.1|  predicted protein                                  185   5e-51    
ref|XP_008607517.1|  hypothetical protein SDRG_03658                    184   6e-51    
ref|XP_005822285.1|  hypothetical protein GUITHDRAFT_97880              183   1e-50    
gb|KDO16638.1|  hypothetical protein SPRG_17375                         177   3e-49    
ref|XP_008874469.1|  hypothetical protein H310_10010                    178   1e-48    
dbj|BAG30793.1|  similar to DnaJ protein                                177   2e-48    
ref|XP_011663894.1|  PREDICTED: dnaJ homolog subfamily A member 2...    177   3e-48    
ref|XP_783184.2|  PREDICTED: dnaJ homolog subfamily A member 2 is...    177   3e-48    
ref|XP_011568922.1|  PREDICTED: dnaJ homolog subfamily A member 2...    177   3e-48    
emb|CCA21495.1|  conserved hypothetical protein                         177   4e-48    
dbj|BAM19149.1|  DnaJ-like-2 protein                                    176   5e-48    
ref|XP_009830477.1|  hypothetical protein H257_06808                    176   5e-48    
gb|ENN74728.1|  hypothetical protein YQE_08695                          173   6e-48    
ref|XP_002778410.1|  conserved hypothetical protein                     174   6e-48    
gb|ENN83357.1|  hypothetical protein YQE_00284                          173   6e-48    
ref|XP_005107829.1|  PREDICTED: dnaJ homolog subfamily A member 2...    176   8e-48    
gb|EHJ78745.1|  DnaJ-like protein 2                                     169   1e-47    
ref|XP_971446.1|  PREDICTED: dnaJ homolog subfamily A member 1          174   2e-47    
gb|KDO48715.1|  hypothetical protein CISIN_1g015695mg                   172   2e-47    
emb|CCI48832.1|  unnamed protein product                                179   3e-47    
emb|CCI48830.1|  unnamed protein product                                179   4e-47    
emb|CCI48831.1|  unnamed protein product                                179   4e-47    
emb|CCI48829.1|  unnamed protein product                                179   4e-47    
ref|XP_008885880.1|  DnaJ family chaperone, putative                    174   5e-47    
ref|NP_001157380.1|  DnaJ (Hsp40) homolog 1                             173   5e-47    
gb|ERL94599.1|  hypothetical protein D910_11876                         173   6e-47    
ref|XP_009830474.1|  hypothetical protein H257_06805                    173   6e-47    
ref|XP_011557028.1|  PREDICTED: dnaJ homolog subfamily A member 1       172   9e-47    
emb|CBJ30599.1|  Heat shock protein 40                                  173   9e-47    
gb|AAD09512.1|  ATFP9                                                   163   1e-46    
ref|XP_002364366.1|  DnaJ domain-containing protein                     174   1e-46    
gb|EHJ70691.1|  DnaJ-like protein 1                                     172   2e-46    
gb|EFX77852.1|  hypothetical protein DAPPUDRAFT_305330                  172   2e-46    
ref|XP_970724.1|  PREDICTED: dnaJ homolog subfamily A member 2          171   4e-46    
ref|XP_004067524.1|  PREDICTED: dnaJ homolog subfamily A member 2       171   4e-46    
ref|XP_008354864.1|  PREDICTED: dnaJ protein homolog                    169   4e-46    
ref|XP_005852710.1|  DnaJ subfamily A member 2-like protein             171   6e-46    
emb|CAD29846.1|  putative DnaJ protein                                  162   7e-46    
ref|XP_005707879.1|  molecular chaperone DnaJ                           171   9e-46    
gb|AHA86298.1|  DnaJ                                                    170   1e-45    
ref|XP_002768280.1|  chaperone protein DnaJ, putative                   170   1e-45    
gb|EWM24221.1|  HSP40/DnaJ heat shock protein                           171   1e-45    
emb|CDJ42592.1|  DnaJ domain-containing protein, putative               170   1e-45    
gb|KJB84165.1|  hypothetical protein B456_N007500                       168   1e-45    
ref|XP_011400324.1|  DnaJ protein-like protein 2                        166   2e-45    
gb|KFM76618.1|  DnaJ-like protein subfamily A member 1                  169   2e-45    
ref|XP_008296183.1|  PREDICTED: dnaJ homolog subfamily A member 2       169   3e-45    
ref|XP_004539855.1|  PREDICTED: dnaJ homolog subfamily A member 2...    169   3e-45    
ref|XP_008552261.1|  PREDICTED: dnaJ homolog subfamily A member 1       168   3e-45    
gb|AES67168.2|  DnaJ-class molecular chaperone                          167   3e-45    
ref|XP_009904990.1|  PREDICTED: dnaJ homolog subfamily A member 2       167   3e-45    
ref|XP_003699212.1|  PREDICTED: dnaJ homolog subfamily A member 1       168   4e-45    
ref|XP_667910.1|  DNAJ domain protein                                   169   4e-45    
ref|XP_003440442.1|  PREDICTED: dnaJ homolog subfamily A member 2...    168   4e-45    
ref|XP_004553333.1|  PREDICTED: dnaJ homolog subfamily A member 2...    168   5e-45    
ref|XP_627269.1|  DNAJ like chaperone                                   169   5e-45    
ref|NP_001004807.1|  DnaJ subfamily A member 2                          168   5e-45    
ref|XP_009058223.1|  hypothetical protein LOTGIDRAFT_122424             168   5e-45    
ref|XP_011474480.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    168   6e-45    
gb|EFX86347.1|  hypothetical protein DAPPUDRAFT_187536                  168   7e-45    
gb|KDR14838.1|  DnaJ-like protein subfamily A member 2                  168   8e-45    
gb|KFV72167.1|  DnaJ subfamily A member 2                               167   8e-45    
ref|XP_002604869.1|  hypothetical protein BRAFLDRAFT_217157             167   1e-44    
ref|NP_997830.1|  DnaJ subfamily A member 2-like                        167   1e-44    
gb|EFN71101.1|  DnaJ-like protein subfamily A member 1                  164   1e-44    
ref|NP_001040292.1|  DnaJ (Hsp40) homolog 2                             167   1e-44    
ref|XP_011150153.1|  PREDICTED: dnaJ homolog subfamily A member 1       166   2e-44    
ref|XP_011644113.1|  PREDICTED: dnaJ homolog subfamily A member 1       166   2e-44    
ref|XP_005802556.1|  PREDICTED: dnaJ homolog subfamily A member 2...    166   2e-44    
ref|XP_007887604.1|  PREDICTED: dnaJ homolog subfamily A member 2       166   2e-44    
gb|KJB35428.1|  hypothetical protein B456_006G117100                    164   3e-44    
ref|XP_010716282.1|  PREDICTED: dnaJ homolog subfamily A member 2       161   3e-44    
gb|EMC89242.1|  DnaJ like protein subfamily A member 2                  161   3e-44    
gb|ABF18277.1|  DNAJ chaperone                                          166   4e-44    
ref|XP_007543201.1|  PREDICTED: dnaJ homolog subfamily A member 2       166   4e-44    
ref|XP_011059083.1|  PREDICTED: dnaJ homolog subfamily A member 1       165   6e-44    
ref|XP_011690736.1|  PREDICTED: dnaJ homolog subfamily A member 4       165   6e-44    
ref|XP_003289478.1|  heat shock protein                                 165   7e-44    
ref|XP_008403090.1|  PREDICTED: dnaJ homolog subfamily A member 2       165   7e-44    
ref|XP_007015642.1|  DNAJ isoform 3                                     163   8e-44    
gb|ABA99886.2|  DnaJ protein, putative, expressed                       166   8e-44    
ref|XP_003967154.1|  PREDICTED: dnaJ homolog subfamily A member 2...    165   8e-44    
gb|EAY83926.1|  hypothetical protein OsI_39149                          166   1e-43    
ref|XP_001507642.1|  PREDICTED: dnaJ homolog subfamily A member 2       164   1e-43    
ref|XP_003885120.1|  DnaJ domain containing protein, related            165   1e-43    
ref|XP_005851097.1|  hypothetical protein CHLNCDRAFT_29444              165   1e-43    
ref|XP_011252179.1|  PREDICTED: dnaJ homolog subfamily A member 1       164   1e-43    
ref|XP_001844792.1|  DNAJ chaperone                                     164   2e-43    
emb|CDJ47480.1|  DnaJ domain-containing protein, putative               164   2e-43    
emb|CDQ55983.1|  unnamed protein product                                164   2e-43    
ref|XP_641304.1|  heat shock protein                                    164   2e-43    
ref|XP_007059709.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    162   2e-43    
gb|AAC72887.1|  heat shock protein Ddj1                                 164   2e-43    
ref|XP_007439805.1|  PREDICTED: dnaJ homolog subfamily A member 2       164   2e-43    
ref|XP_002142012.1|  DnaJ domain-containing protein                     164   2e-43    
ref|XP_011173657.1|  PREDICTED: dnaJ homolog subfamily A member 1       163   2e-43    
dbj|BAR40320.1|  DnaJ homolog subfamily A member 2                      164   3e-43    
ref|XP_007230450.1|  PREDICTED: dnaJ homolog subfamily A member 2       163   3e-43    
ref|XP_001363277.1|  PREDICTED: dnaJ homolog subfamily A member 2       163   4e-43    
ref|XP_010202745.1|  PREDICTED: dnaJ homolog subfamily A member 2       161   4e-43    
emb|CAG13048.1|  unnamed protein product                                164   4e-43    
ref|XP_009939420.1|  PREDICTED: dnaJ homolog subfamily A member 2       161   4e-43    
emb|CDQ59403.1|  unnamed protein product                                163   4e-43    
gb|KFU89463.1|  DnaJ subfamily A member 2                               162   4e-43    
ref|XP_009695370.1|  PREDICTED: dnaJ homolog subfamily A member 2       161   4e-43    
gb|ACN11426.1|  DnaJ homolog subfamily A member 2                       163   4e-43    
ref|XP_010013041.1|  PREDICTED: dnaJ homolog subfamily A member 2       161   4e-43    
ref|XP_005233897.1|  PREDICTED: dnaJ homolog subfamily A member 2       161   4e-43    
ref|XP_009461777.1|  PREDICTED: dnaJ homolog subfamily A member 2       161   4e-43    
ref|XP_005444666.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    161   5e-43    
ref|XP_009808292.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    161   5e-43    
gb|EEE53623.1|  hypothetical protein OsJ_36898                          164   5e-43    
emb|CDI76051.1|  DnaJ domain-containing protein, putative               163   5e-43    
gb|KFO91050.1|  DnaJ subfamily A member 2                               162   5e-43    
ref|XP_003222964.1|  PREDICTED: dnaJ homolog subfamily A member 2       163   5e-43    
emb|CEP12765.1|  hypothetical protein                                   162   6e-43    
ref|XP_010730226.1|  PREDICTED: dnaJ homolog subfamily A member 2       162   6e-43    
ref|XP_004889812.1|  PREDICTED: dnaJ homolog subfamily A member 2       162   6e-43    
ref|XP_004371689.1|  PREDICTED: dnaJ homolog subfamily A member 2       162   6e-43    
gb|KFP06656.1|  DnaJ subfamily A member 2                               162   6e-43    
ref|XP_003757275.1|  PREDICTED: dnaJ homolog subfamily A member 2       164   6e-43    
ref|NP_001171852.1|  dnaJ homolog subfamily A member 2-like             162   6e-43    
gb|KFQ09515.1|  DnaJ subfamily A member 2                               162   6e-43    
ref|XP_316024.4|  AGAP005981-PA                                         162   6e-43    
ref|XP_006641433.1|  PREDICTED: dnaJ homolog subfamily A member 2...    162   7e-43    
ref|XP_010136565.1|  PREDICTED: dnaJ homolog subfamily A member 2       162   7e-43    
gb|KFW75471.1|  DnaJ subfamily A member 2                               162   7e-43    
gb|KFV98944.1|  DnaJ subfamily A member 2                               162   7e-43    
ref|XP_005289904.1|  PREDICTED: dnaJ homolog subfamily A member 2       162   7e-43    
ref|XP_009555239.1|  PREDICTED: dnaJ homolog subfamily A member 2       160   8e-43    
gb|EMS59985.1|  Chaperone protein dnaJ 2                                160   8e-43    
ref|XP_011302182.1|  PREDICTED: dnaJ homolog subfamily A member 1       162   8e-43    
ref|XP_009485287.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    162   8e-43    
gb|KFO10768.1|  DnaJ subfamily A member 2                               161   8e-43    
gb|KFZ68007.1|  DnaJ subfamily A member 2                               162   8e-43    
ref|XP_010077475.1|  PREDICTED: dnaJ homolog subfamily A member 2       162   8e-43    
gb|KFQ95764.1|  DnaJ subfamily A member 2                               162   8e-43    
gb|KFW64542.1|  DnaJ subfamily A member 2                               162   8e-43    
gb|KFQ81485.1|  DnaJ subfamily A member 2                               162   8e-43    
gb|KFQ42556.1|  DnaJ subfamily A member 2                               162   9e-43    
ref|XP_003969457.1|  PREDICTED: dnaJ homolog subfamily A member 2       162   9e-43    
ref|XP_010182112.1|  PREDICTED: dnaJ homolog subfamily A member 2       162   9e-43    
gb|KFM05790.1|  DnaJ subfamily A member 2                               162   9e-43    
gb|KFQ73423.1|  DnaJ subfamily A member 2                               162   9e-43    
gb|KFV83098.1|  DnaJ subfamily A member 2                               161   9e-43    
ref|XP_009503179.1|  PREDICTED: dnaJ homolog subfamily A member 2       162   1e-42    
ref|XP_009917262.1|  PREDICTED: dnaJ homolog subfamily A member 2       162   1e-42    
ref|XP_009585864.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    162   1e-42    
ref|XP_009892401.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    162   1e-42    
ref|XP_010283751.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    162   1e-42    
gb|KFQ35044.1|  DnaJ subfamily A member 2                               161   1e-42    
ref|XP_010300497.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    162   1e-42    
ref|XP_011874589.1|  PREDICTED: dnaJ homolog subfamily A member 4...    162   1e-42    
gb|ELU11047.1|  hypothetical protein CAPTEDRAFT_164620                  162   1e-42    
ref|XP_010146106.1|  PREDICTED: LOW QUALITY PROTEIN: dnaJ homolog...    161   1e-42    
ref|XP_010123723.1|  PREDICTED: dnaJ homolog subfamily A member 2       162   1e-42    
gb|KGL74052.1|  DnaJ subfamily A member 2                               160   1e-42    
gb|KFR15862.1|  DnaJ subfamily A member 2                               161   1e-42    
gb|EOA97993.1|  DnaJ-like protein subfamily A member 2                  161   1e-42    
ref|XP_011874588.1|  PREDICTED: dnaJ homolog subfamily A member 4...    162   1e-42    
ref|XP_001635397.1|  predicted protein                                  162   1e-42    
ref|XP_008499565.1|  PREDICTED: dnaJ homolog subfamily A member 2       162   1e-42    
ref|NP_001005841.1|  dnaJ homolog subfamily A member 2                  162   1e-42    
ref|XP_005024213.1|  PREDICTED: dnaJ homolog subfamily A member 2       161   1e-42    
ref|XP_005707432.1|  molecular chaperone DnaJ                           162   1e-42    
ref|XP_010226166.1|  PREDICTED: dnaJ homolog subfamily A member 2       160   1e-42    



>gb|AFR66645.1| MIP1.1a [Nicotiana benthamiana]
Length=420

 Score =   369 bits (947),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 188/193 (97%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTI+GDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  229  VEKGMQNGQKITFPGEADEAPDTISGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF+VDFPET
Sbjct  289  GFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPET  348

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCK LEAVLPP+P T++TDMELDECEETTL+DVNIEEEMRRK QQQAQE Y+EDED
Sbjct  349  LSPEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDED  407

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  408  MHGGAQRVQCAQQ  420



>ref|XP_007010484.1| DNAJ [Theobroma cacao]
 gb|EOY19294.1| DNAJ [Theobroma cacao]
Length=417

 Score =   367 bits (943),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 185/193 (96%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  226  VEKGMQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++
Sbjct  286  GFQFILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQCKALEAVLPPR + ++TDMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDED
Sbjct  346  LIPDQCKALEAVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDED  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>ref|XP_009588725.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009588726.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=420

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 187/193 (97%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  229  VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPET
Sbjct  289  GFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPET  348

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ +QCK LEAVLPP+P T++TDMELDECEETTL+DVNIEEEMRRK QQQAQE Y+EDED
Sbjct  349  LSLEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDED  407

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  408  MHGGAQRVQCAQQ  420



>gb|AGY48883.1| MIP1.1b [Nicotiana benthamiana]
Length=418

 Score =   367 bits (942),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 175/193 (91%), Positives = 187/193 (97%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPET
Sbjct  287  GFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPET  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ +QCK LEAVLPP+P T++TDMELDECEETTL+DVNIEEEMRRK QQQAQE Y+EDED
Sbjct  347  LSLEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDED  405

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  406  MHGGAQRVQCAQQ  418



>ref|XP_011032891.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
 ref|XP_011032892.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
Length=420

 Score =   367 bits (941),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDT+TGDIVFVLQQK+H KFKRKGDD+FVEHTL+LTEALC
Sbjct  228  VEKGMQNGQRITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLSLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GF FVLTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF+VDFP++
Sbjct  288  GFHFVLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPDS  347

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQCKALEA LPPR + ++TDMELDECEETTL+DVNIEEEMRRKQQQQAQE Y+ED+D
Sbjct  348  LSADQCKALEAALPPRASVQLTDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDD  407

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  408  MHGGAQRVQCAQQ  420



>ref|XP_009760224.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
 ref|XP_009760225.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=420

 Score =   366 bits (940),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 174/193 (90%), Positives = 186/193 (96%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVF+LQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  229  VEKGMQNGQKITFPGEADEAPDTITGDIVFILQQKEHPKFKRKGDDLFVEHTLSLTEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPET
Sbjct  289  GFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPET  348

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ +QCK LEAVLPP+P T++TDMELDECEETTL+DVNIEEEMRRK QQQAQE Y EDED
Sbjct  349  LSLEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNIEEEMRRK-QQQAQEAYNEDED  407

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  408  MHGGAQRVQCAQQ  420



>dbj|BAC53943.1| DnaJ homolog [Nicotiana tabacum]
Length=339

 Score =   362 bits (930),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 173/193 (90%), Positives = 185/193 (96%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVF+LQQKEH KFKRK DD+FVEHTL+LTEALC
Sbjct  148  VEKGMQNGQKITFPGEADEAPDTITGDIVFILQQKEHPKFKRKEDDLFVEHTLSLTEALC  207

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPET
Sbjct  208  GFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPET  267

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ +QCK LEAVLPP+P T++TDMELDECEETTL+DVNIEEEMRRK QQQAQE Y EDED
Sbjct  268  LSLEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNIEEEMRRK-QQQAQEAYNEDED  326

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  327  MHGGAQRVQCAQQ  339



>gb|AAG24642.1|AF308737_1 J1P [Daucus carota]
 gb|AAG24643.1|AF308738_1 J2P [Daucus carota]
Length=418

 Score =   362 bits (929),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 185/193 (96%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEH+LTL+EALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHSLTLSEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKSQPGEV+KPDQFK INDEGMPMYQ+PFMRGKLYIHF+VDFPE+
Sbjct  287  GFQFTLTHLDGRQLLIKSQPGEVIKPDQFKGINDEGMPMYQRPFMRGKLYIHFSVDFPES  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTP+QCKALEAVLPPRP+ ++TDMELDECEETTL+DVNIEEEMRRK QQ AQE Y+EDED
Sbjct  347  LTPEQCKALEAVLPPRPSIQMTDMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDED  405

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  406  MHGGAQRVQCAQQ  418



>ref|XP_002310999.1| DnaJ family protein [Populus trichocarpa]
 gb|EEE88366.1| DnaJ family protein [Populus trichocarpa]
Length=420

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 185/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDT+TGDIVFVLQQK+H KFKRKGDD+FVEHTL+LTEALC
Sbjct  228  VEKGMQNGQRITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLSLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GF FVLTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF+VDFP++
Sbjct  288  GFHFVLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPDS  347

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQCKALEAVLPPR + ++TDMELDECEETTL+DVNIEEEMRRKQQQQAQE Y+ED++
Sbjct  348  LSTDQCKALEAVLPPRASVQLTDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDE  407

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  408  MPGGAQRVQCAQQ  420



>gb|KJB84159.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84160.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84161.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84162.1| hypothetical protein B456_N007500 [Gossypium raimondii]
 gb|KJB84166.1| hypothetical protein B456_N007500 [Gossypium raimondii]
Length=418

 Score =   362 bits (928),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDT+TGDIVFVLQQK+H KFKRKGDD+FVEHTL LTEALC
Sbjct  226  VEKGMQNGQRITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLALTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIK+QPGEVVKPDQFKAINDEGMP+YQ+PFMRGKL+IHFTVDFP++
Sbjct  286  GFQFILTHLDGRQLLIKTQPGEVVKPDQFKAINDEGMPIYQRPFMRGKLFIHFTVDFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTPDQCKALEAVLPP+ + ++TDMELDECEETT++DVNIEEEMRRKQ Q  QE YEEDED
Sbjct  346  LTPDQCKALEAVLPPKASVQLTDMELDECEETTMHDVNIEEEMRRKQAQAQQEAYEEDED  405

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  406  MHGGAQRVQCAQQ  418



>gb|KJB60379.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60380.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60381.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60382.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
 gb|KJB60383.1| hypothetical protein B456_009G302500 [Gossypium raimondii]
Length=418

 Score =   360 bits (924),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 182/193 (94%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQK+H KFKRK DD+FVEHTLTLTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKSDDLFVEHTLTLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIK+ PGEVVKPDQFKAINDEGM MYQ+PFMRGKLYIHFTVDFP++
Sbjct  286  GFQFILTHLDGRQLLIKTHPGEVVKPDQFKAINDEGMAMYQRPFMRGKLYIHFTVDFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+QCKALEAVLPPR + ++TDMELDECEETTLYDVNIEEEMRRKQ Q AQE YEED+D
Sbjct  346  LAPEQCKALEAVLPPRTSVQLTDMELDECEETTLYDVNIEEEMRRKQAQAAQEAYEEDDD  405

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  406  MHGGAQRVQCAQQ  418



>dbj|BAA35121.1| DnaJ homolog [Salix gilgiana]
Length=420

 Score =   360 bits (923),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 186/193 (96%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ++TFPGEADEAPDT+TGDIVFVLQQK+H KFKRKGDD+FVEHTL+LTEALC
Sbjct  228  VEKGMQNGQKVTFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLSLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF+V+FP++
Sbjct  288  GFQFVLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVEFPDS  347

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PD CKALEAVLPPR + ++TDMELDECEETTL+DVNI+EEMRRKQQQQAQE Y+ED++
Sbjct  348  LSPDMCKALEAVLPPRASVQLTDMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDE  407

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  408  MPGGAQRVQCAQQ  420



>gb|KDO48709.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=381

 Score =   358 bits (919),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  190  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  249

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFV+THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+
Sbjct  250  GFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES  309

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQCK LE VLPPR + ++TDMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+D
Sbjct  310  LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDD  368

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  369  MQGGAQRVQCAQQ  381



>ref|XP_006365673.1| PREDICTED: dnaJ protein homolog isoform X2 [Solanum tuberosum]
Length=412

 Score =   359 bits (922),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 185/193 (96%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ++TFPGEADEAP+TITGDIVFVLQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  221  VEKGMQNGQKVTFPGEADEAPETITGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALC  280

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGK+YIHFTVDFPE+
Sbjct  281  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKMYIHFTVDFPES  340

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTP+QCK LEAVLPPRP  +++DMELDECEETTL+DVNIE+EMRRK QQ AQE Y+ED+D
Sbjct  341  LTPEQCKNLEAVLPPRPKLQVSDMELDECEETTLHDVNIEDEMRRK-QQAAQEAYDEDDD  399

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  400  MPGGAQRVQCAQQ  412



>ref|XP_010907714.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=415

 Score =   359 bits (922),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 185/193 (96%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQK+H KFKRKGDD+F EHTL+LTEALC
Sbjct  224  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFFEHTLSLTEALC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++
Sbjct  284  GFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT +QCKALEAVLPP+P +++TDMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDED
Sbjct  344  LTLEQCKALEAVLPPKPVSQLTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDED  402

Query  330  MHGGAQRVQCAQQ  292
            +HGGAQRVQCAQQ
Sbjct  403  VHGGAQRVQCAQQ  415



>gb|KDO48714.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=335

 Score =   356 bits (914),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  144  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  203

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFV+THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+
Sbjct  204  GFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES  263

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQCK LE VLPPR + ++TDMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+D
Sbjct  264  LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDD  322

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  323  MQGGAQRVQCAQQ  335



>ref|XP_006365672.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum tuberosum]
Length=419

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 185/193 (96%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ++TFPGEADEAP+TITGDIVFVLQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  228  VEKGMQNGQKVTFPGEADEAPETITGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGK+YIHFTVDFPE+
Sbjct  288  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKMYIHFTVDFPES  347

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTP+QCK LEAVLPPRP  +++DMELDECEETTL+DVNIE+EMRRK QQ AQE Y+ED+D
Sbjct  348  LTPEQCKNLEAVLPPRPKLQVSDMELDECEETTLHDVNIEDEMRRK-QQAAQEAYDEDDD  406

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  407  MPGGAQRVQCAQQ  419



>ref|XP_010319287.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Solanum lycopersicum]
Length=337

 Score =   356 bits (914),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 184/194 (95%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            V+KGMQNGQ+ITFPGEADE PDT+TGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  144  VDKGMQNGQKITFPGEADEEPDTVTGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALC  203

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQL+IKSQPGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTVDFP T
Sbjct  204  GFQFVLTHLDNRQLIIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVDFPNT  263

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDE  334
            LTP+ CK LEAVLP RP T+ +DMELDECEETTL+DVNI+EEMRRKQQQQAQE Y E+D+
Sbjct  264  LTPELCKNLEAVLPARPKTQASDMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDD  323

Query  333  DMHGGAQRVQCAQQ  292
            DMHGGAQRVQCAQQ
Sbjct  324  DMHGGAQRVQCAQQ  337



>ref|XP_006345881.1| PREDICTED: dnaJ protein homolog [Solanum tuberosum]
 gb|ABB16989.1| DnaJ-like protein [Solanum tuberosum]
Length=419

 Score =   359 bits (921),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/194 (88%), Positives = 187/194 (96%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQL+IK QPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP+T
Sbjct  287  GFQFILTHLDNRQLIIKPQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDT  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDE  334
            L+P+QCK LEAVLPP+P T++TDMELDECEETTL+DVNIEEEMRRK QQQAQE Y E+DE
Sbjct  347  LSPEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDDE  405

Query  333  DMHGGAQRVQCAQQ  292
            DMHGGAQRVQCAQQ
Sbjct  406  DMHGGAQRVQCAQQ  419



>gb|KDO48708.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=383

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  192  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  251

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFV+THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+
Sbjct  252  GFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES  311

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQCK LE VLPPR + ++TDMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+D
Sbjct  312  LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDD  370

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  371  MQGGAQRVQCAQQ  383



>ref|XP_009397426.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=416

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 186/193 (96%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+T+TGDIVFVLQQK+H KFKRKGDD+F EH L+LTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPETVTGDIVFVLQQKDHPKFKRKGDDLFYEHALSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GF+FVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++
Sbjct  285  GFRFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDS  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            +TP+QCKALE+VLPP+PA+++TDMELDECEETTL+DVNIEEEMRRK Q QAQE YEED+D
Sbjct  345  MTPEQCKALESVLPPKPASQMTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDDD  403

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  404  MHGGAQRVQCAQQ  416



>sp|P42824.1|DNJH2_ALLPO RecName: Full=DnaJ protein homolog 2; Flags: Precursor [Allium 
ampeloprasum]
 emb|CAA54720.1| LDJ2 [Allium ampeloprasum]
Length=418

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 184/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+F EH+L+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFYEHSLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEV+KPDQFK INDEGMPMYQ+PFMRGKLYIHF+VDFP++
Sbjct  286  GFQFVLTHLDNRQLLIKSNPGEVIKPDQFKGINDEGMPMYQRPFMRGKLYIHFSVDFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTPDQCKALE+VLP R A+++TDME+DECEETT++DVNIEEEMRRKQ QQAQE Y+ED++
Sbjct  346  LTPDQCKALESVLPSRNASRLTDMEIDECEETTMHDVNIEEEMRRKQHQQAQEAYDEDDE  405

Query  330  MHGGAQRVQCAQQ  292
             HGGAQRVQCAQQ
Sbjct  406  GHGGAQRVQCAQQ  418



>ref|XP_004306421.1| PREDICTED: dnaJ protein homolog [Fragaria vesca subsp. vesca]
Length=410

 Score =   358 bits (919),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+F EHTL+L EALC
Sbjct  218  VEKGMQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFYEHTLSLMEALC  277

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD+RQLLIKS PGEVVKPDQFKAINDEGMPMYQ+ FM+GKLYIHFTV+FP++
Sbjct  278  GFQFVLTHLDSRQLLIKSHPGEVVKPDQFKAINDEGMPMYQRAFMKGKLYIHFTVEFPDS  337

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+QCK LEAVLPPR +T++TDMELDECEETTL+DVNIEEEMRRKQ QQ+QE Y+EDED
Sbjct  338  LNPEQCKTLEAVLPPRSSTQLTDMELDECEETTLHDVNIEEEMRRKQGQQSQEAYDEDED  397

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  398  MHGGAQRVQCAQQ  410



>gb|KDO48711.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
 gb|KDO48712.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
 gb|KDO48713.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=402

 Score =   358 bits (918),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  211  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  270

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFV+THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+
Sbjct  271  GFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES  330

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQCK LE VLPPR + ++TDMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+D
Sbjct  331  LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDD  389

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  390  MQGGAQRVQCAQQ  402



>gb|KDO48707.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=382

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  191  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  250

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFV+THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+
Sbjct  251  GFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES  310

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQCK LE VLPPR + ++TDMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+D
Sbjct  311  LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDD  369

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  370  MQGGAQRVQCAQQ  382



>ref|XP_006445792.1| hypothetical protein CICLE_v10015385mg [Citrus clementina]
 gb|ESR59032.1| hypothetical protein CICLE_v10015385mg [Citrus clementina]
Length=416

 Score =   358 bits (918),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHLKFKRKGDDLFVEHTLSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFV+THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+
Sbjct  285  GFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQCK LE VLPPR + ++TDMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+D
Sbjct  345  LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDD  403

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  404  MQGGAQRVQCAQQ  416



>ref|XP_006485485.1| PREDICTED: dnaJ protein homolog [Citrus sinensis]
Length=416

 Score =   358 bits (918),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFV+THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+
Sbjct  285  GFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQCK LE VLPPR + ++TDMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+D
Sbjct  345  LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDD  403

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  404  MQGGAQRVQCAQQ  416



>gb|AGY48885.1| MIP1.3 [Nicotiana benthamiana]
Length=418

 Score =   358 bits (918),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 185/193 (96%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+TITGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPETITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+
Sbjct  287  GFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTP+QCK LEAVLPP+P  ++++MELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+D
Sbjct  347  LTPEQCKNLEAVLPPKPKMEVSEMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDD  405

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  406  MPGGAQRVQCAQQ  418



>ref|XP_009793842.1| PREDICTED: dnaJ protein homolog isoform X2 [Nicotiana sylvestris]
Length=412

 Score =   357 bits (917),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 185/193 (96%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+TITGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  221  VEKGMQNGQKITFPGEADEAPETITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALC  280

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+
Sbjct  281  GFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES  340

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTP+QCK LEAVLPP+P  ++++MELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+D
Sbjct  341  LTPEQCKNLEAVLPPKPKMEVSEMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDD  399

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  400  MPGGAQRVQCAQQ  412



>gb|KDO48710.1| hypothetical protein CISIN_1g015695mg [Citrus sinensis]
Length=401

 Score =   357 bits (916),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  210  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  269

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFV+THLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+
Sbjct  270  GFQFVITHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES  329

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQCK LE VLPPR + ++TDMELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+D
Sbjct  330  LSPDQCKMLETVLPPRTSVQLTDMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDD  388

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  389  MQGGAQRVQCAQQ  401



>ref|XP_009793841.1| PREDICTED: dnaJ protein homolog isoform X1 [Nicotiana sylvestris]
Length=418

 Score =   357 bits (917),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 185/193 (96%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+TITGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPETITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+
Sbjct  287  GFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTP+QCK LEAVLPP+P  ++++MELDECEETTL+DVNIEEEMRRK QQ AQE Y+ED+D
Sbjct  347  LTPEQCKNLEAVLPPKPKMEVSEMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDDD  405

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  406  MPGGAQRVQCAQQ  418



>ref|XP_011024143.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
 ref|XP_011024144.1| PREDICTED: dnaJ protein homolog [Populus euphratica]
Length=422

 Score =   357 bits (917),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 183/194 (94%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN QRITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+L EALC
Sbjct  229  VEKGMQNAQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLAEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++
Sbjct  289  GFQFILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDS  348

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQCKALE +LPPR + ++TDMELDECEETTL+DVNIEEEMRRKQQQQAQE Y+ED+D
Sbjct  349  LSLDQCKALETMLPPRTSAELTDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDD  408

Query  330  MH-GGAQRVQCAQQ  292
            MH GG QRVQCAQQ
Sbjct  409  MHSGGGQRVQCAQQ  422



>gb|AAN87055.1| tuber-induction protein [Solanum tuberosum]
Length=315

 Score =   353 bits (906),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPG+ DEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  123  VEKGMQNGQKITFPGDMDEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  182

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQL+IK Q GEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP+T
Sbjct  183  GFQFILTHLDNRQLIIKPQAGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDT  242

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDE  334
            L+P+QCK LEAVLPP+P T++TDMELDECEETTL+DVNIEEEMRRK QQQAQE Y E+DE
Sbjct  243  LSPEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDDE  301

Query  333  DMHGGAQRVQCAQQ  292
            DMHGGAQRVQCAQQ
Sbjct  302  DMHGGAQRVQCAQQ  315



>ref|XP_004236804.1| PREDICTED: dnaJ protein homolog isoform X1 [Solanum lycopersicum]
Length=418

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/194 (87%), Positives = 184/194 (95%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            V+KGMQNGQ+ITFPGEADE PDT+TGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  225  VDKGMQNGQKITFPGEADEEPDTVTGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQL+IKSQPGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTVDFP T
Sbjct  285  GFQFVLTHLDNRQLIIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVDFPNT  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDE  334
            LTP+ CK LEAVLP RP T+ +DMELDECEETTL+DVNI+EEMRRKQQQQAQE Y E+D+
Sbjct  345  LTPELCKNLEAVLPARPKTQASDMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDD  404

Query  333  DMHGGAQRVQCAQQ  292
            DMHGGAQRVQCAQQ
Sbjct  405  DMHGGAQRVQCAQQ  418



>ref|XP_004249937.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=419

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 184/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ++TFPGEADEAPDTITGDIVFVLQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  228  VEKGMQNGQKVTFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGK+YIHFTVDFPE+
Sbjct  288  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKMYIHFTVDFPES  347

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT +QCK LEAVLPP+P  +++DMELDECEETTL+DVNIE+EMRRK QQ AQE Y+ED+D
Sbjct  348  LTAEQCKNLEAVLPPKPKLQVSDMELDECEETTLHDVNIEDEMRRK-QQAAQEAYDEDDD  406

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  407  MPGGAQRVQCAQQ  419



>ref|XP_002316479.1| DnaJ family protein [Populus trichocarpa]
 gb|ABK95315.1| unknown [Populus trichocarpa]
 gb|EEF02650.1| DnaJ family protein [Populus trichocarpa]
Length=422

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 183/194 (94%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN QRITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+L EALC
Sbjct  229  VEKGMQNAQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLAEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++
Sbjct  289  GFQFILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDS  348

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQCKALE VLPPR + ++TDMELDECEETTL+DVNIEEEMRRKQQQQAQE Y+ED++
Sbjct  349  LSLDQCKALETVLPPRTSAELTDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDE  408

Query  330  MH-GGAQRVQCAQQ  292
            MH GG QRVQCAQQ
Sbjct  409  MHGGGGQRVQCAQQ  422



>ref|XP_009418972.1| PREDICTED: dnaJ protein homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 184/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQ K+H+KFKRKGDD+F EHTL+L+EALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQLKDHSKFKRKGDDLFFEHTLSLSEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQ+VLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+
Sbjct  285  GFQYVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT DQCKALE VLPPR AT++TDMELDECEETTL+DVNIEEEMRRK Q QAQE YEED+D
Sbjct  345  LTLDQCKALETVLPPRLATQMTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDDD  403

Query  330  MHGGAQRVQCAQQ  292
            +HGGAQRVQCAQQ
Sbjct  404  VHGGAQRVQCAQQ  416



>ref|XP_009418971.1| PREDICTED: dnaJ protein homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 169/193 (88%), Positives = 184/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQ K+H+KFKRKGDD+F EHTL+L+EALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQLKDHSKFKRKGDDLFFEHTLSLSEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQ+VLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+
Sbjct  286  GFQYVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT DQCKALE VLPPR AT++TDMELDECEETTL+DVNIEEEMRRK Q QAQE YEED+D
Sbjct  346  LTLDQCKALETVLPPRLATQMTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDDD  404

Query  330  MHGGAQRVQCAQQ  292
            +HGGAQRVQCAQQ
Sbjct  405  VHGGAQRVQCAQQ  417



>emb|CAN82708.1| hypothetical protein VITISV_000291 [Vitis vinifera]
Length=407

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 182/193 (94%), Gaps = 2/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  217  VEKGMQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  276

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKS PGEVVKPDQFKAINDEGMP+YQKPFM+GKLYIHF VDFP++
Sbjct  277  GFQFILTHLDGRQLLIKSHPGEVVKPDQFKAINDEGMPIYQKPFMKGKLYIHFAVDFPDS  336

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L  DQCKALEAVLPPR +T++TDME+DECEETTL+DVNIEEEMRRK  Q AQE YEEDED
Sbjct  337  LNTDQCKALEAVLPPRTSTQLTDMEIDECEETTLHDVNIEEEMRRK--QAAQEAYEEDED  394

Query  330  MHGGAQRVQCAQQ  292
            +HGGAQRVQCAQQ
Sbjct  395  IHGGAQRVQCAQQ  407



>ref|XP_010090486.1| DnaJ-like protein [Morus notabilis]
 gb|EXB39585.1| DnaJ-like protein [Morus notabilis]
Length=417

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDDIF EHTL+LTEALC
Sbjct  226  VEKGMQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDIFYEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALE VLPPR   ++TDME+DECEETTL+DVNIEEEMRRK Q QAQE Y+ED+D
Sbjct  346  LSPEQCKALETVLPPRSGQQLTDMEIDECEETTLHDVNIEEEMRRK-QAQAQEAYDEDDD  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>ref|XP_010694477.1| PREDICTED: dnaJ protein homolog [Beta vulgaris subsp. vulgaris]
Length=419

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVF+LQQKEH+K+KRKGDD+F EHTL+LTEALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPDTVTGDIVFILQQKEHSKYKRKGDDLFYEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKSQPGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  287  GFQFVLTHLDNRQLLIKSQPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L  DQCK+LEAVLPPR A ++TDMELDECEETTL+DVNIEEEMRRK+ +  QE Y+EDED
Sbjct  347  LAVDQCKSLEAVLPPRSAAQLTDMELDECEETTLHDVNIEEEMRRKEARAQQEAYDEDED  406

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  407  MHGGAQRVQCAQQ  419



>emb|CAA63965.1| DnaJ protein [Solanum tuberosum]
Length=419

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQL+IK Q GEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP+T
Sbjct  287  GFQFILTHLDNRQLIIKPQAGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDT  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDE  334
            L+P+QCK LEAVLPP+P T++TDMELDECEETTL+DVNIEEEMRRK QQQAQE Y E+DE
Sbjct  347  LSPEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDDE  405

Query  333  DMHGGAQRVQCAQQ  292
            DMHGGAQRVQCAQQ
Sbjct  406  DMHGGAQRVQCAQQ  419



>ref|XP_009600920.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009600921.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=417

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 185/193 (96%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+TITGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPETITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFPE+
Sbjct  286  GFQFILTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPES  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTP+QCK LEAVLPP+P  ++++MELDECEETTL+DVNIEEEMRRK QQ AQE Y++D+D
Sbjct  346  LTPEQCKNLEAVLPPKPKMEVSEMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDDDDD  404

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  405  MPGGAQRVQCAQQ  417



>ref|XP_002263156.1| PREDICTED: dnaJ protein homolog [Vitis vinifera]
 ref|XP_010658892.1| PREDICTED: dnaJ protein homolog [Vitis vinifera]
 emb|CBI24994.3| unnamed protein product [Vitis vinifera]
Length=416

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 182/193 (94%), Gaps = 2/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKS PGEVVKPDQFKAINDEGMP+YQKPFM+GKLYIHF VDFP++
Sbjct  286  GFQFILTHLDGRQLLIKSHPGEVVKPDQFKAINDEGMPIYQKPFMKGKLYIHFAVDFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L  DQCKALEAVLPPR +T++TDME+DECEETTL+DVNIEEEMRRK  Q AQE YEEDED
Sbjct  346  LNTDQCKALEAVLPPRTSTQLTDMEIDECEETTLHDVNIEEEMRRK--QAAQEAYEEDED  403

Query  330  MHGGAQRVQCAQQ  292
            +HGGAQRVQCAQQ
Sbjct  404  IHGGAQRVQCAQQ  416



>ref|XP_008787761.1| PREDICTED: dnaJ protein homolog [Phoenix dactylifera]
Length=415

 Score =   355 bits (912),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQK+H KFKRKGDD+F E TL+LTEALC
Sbjct  224  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFYESTLSLTEALC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGE+VKPDQFKAINDEGMP+YQ+PFMRGKLYIHFTVDFP++
Sbjct  284  GFQFVLTHLDNRQLLIKSNPGEIVKPDQFKAINDEGMPIYQRPFMRGKLYIHFTVDFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+QCKALEAVLPPRP +++TDMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDE+
Sbjct  344  LAPEQCKALEAVLPPRPVSQMTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEE  402

Query  330  MHGGAQRVQCAQQ  292
             HGGAQRVQCAQQ
Sbjct  403  AHGGAQRVQCAQQ  415



>ref|XP_010263053.1| PREDICTED: dnaJ protein homolog [Nelumbo nucifera]
Length=417

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 172/193 (89%), Positives = 182/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            V+KGMQNGQRITF GEADEAPDTITGDIVFVLQQKEH KFKRKGDDIF EHTL+LTEALC
Sbjct  226  VDKGMQNGQRITFQGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDIFYEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT +QCKALEAVLPPR + ++TDMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDED
Sbjct  346  LTMEQCKALEAVLPPRTSQQLTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDED  404

Query  330  MHGGAQRVQCAQQ  292
             HGGAQRVQCAQQ
Sbjct  405  AHGGAQRVQCAQQ  417



>ref|XP_009623415.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
 ref|XP_009623416.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=420

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 172/196 (88%), Positives = 185/196 (94%), Gaps = 3/196 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+TITGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPETITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD+RQLLIKSQPGEVVKPDQFK INDEGMPMYQ+PFMRGKLYIHFTVDFPET
Sbjct  285  GFQFVLTHLDSRQLLIKSQPGEVVKPDQFKGINDEGMPMYQRPFMRGKLYIHFTVDFPET  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEE---  340
            L P+ CK LEAVLPPRP T+ +DMELDECEETTL+DVN+EEEMRRK+QQQAQE YEE   
Sbjct  345  LAPELCKNLEAVLPPRPKTQASDMELDECEETTLHDVNMEEEMRRKRQQQAQEAYEEDDD  404

Query  339  DEDMHGGAQRVQCAQQ  292
            D+DMHGGAQRVQCAQQ
Sbjct  405  DDDMHGGAQRVQCAQQ  420



>ref|XP_002514419.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|ABH06547.1| molecular chaperone [Ricinus communis]
 gb|EEF47915.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=418

 Score =   355 bits (911),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 168/193 (87%), Positives = 182/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVFVLQQKEH KFKRKGDD+ VEHTL+LTEALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLVVEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF+VDFP++
Sbjct  287  GFQFILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPDS  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQCKALE VLP R + +++DMELDECEETTL+DVN EEEMRRK QQQAQE Y+EDED
Sbjct  347  LPPDQCKALETVLPSRTSVQLSDMELDECEETTLHDVNFEEEMRRK-QQQAQEAYDEDED  405

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  406  MHGGAQRVQCAQQ  418



>gb|KCW50581.1| hypothetical protein EUGRSUZ_J00292 [Eucalyptus grandis]
Length=296

 Score =   350 bits (899),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+I FPGEADEAPDT+TGDIVFVLQQKEH K+KRKGDD+F EHTL+LTE+LC
Sbjct  105  VEKGMQNGQKIKFPGEADEAPDTVTGDIVFVLQQKEHPKYKRKGDDLFYEHTLSLTESLC  164

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF L+HLD RQLLIKSQPGEV+KPDQFKAINDEGMP+Y +PFM+GKLYIHFTV+FP+T
Sbjct  165  GFQFALSHLDGRQLLIKSQPGEVIKPDQFKAINDEGMPIYPRPFMKGKLYIHFTVEFPDT  224

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALE +LPPR + ++TDMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDED
Sbjct  225  LSPEQCKALETILPPRSSAQLTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDED  283

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  284  MHGGAQRVQCAQQ  296



>ref|XP_006378828.1| hypothetical protein POPTR_0010s24930g [Populus trichocarpa]
 gb|ERP56625.1| hypothetical protein POPTR_0010s24930g [Populus trichocarpa]
Length=459

 Score =   356 bits (914),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 183/194 (94%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN QRITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+L EALC
Sbjct  266  VEKGMQNAQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLAEALC  325

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++
Sbjct  326  GFQFILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDS  385

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQCKALE VLPPR + ++TDMELDECEETTL+DVNIEEEMRRKQQQQAQE Y+ED++
Sbjct  386  LSLDQCKALETVLPPRTSAELTDMELDECEETTLHDVNIEEEMRRKQQQQAQEAYDEDDE  445

Query  330  MH-GGAQRVQCAQQ  292
            MH GG QRVQCAQQ
Sbjct  446  MHGGGGQRVQCAQQ  459



>ref|XP_004239737.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=419

 Score =   354 bits (909),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 170/194 (88%), Positives = 186/194 (96%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQL+IKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP+T
Sbjct  287  GFQFILTHLDTRQLIIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDT  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDE  334
            L+ +QCK LEAVLPP+P T++TDMELDECEETTL+DVNIEEEMRRK QQQAQE Y E+DE
Sbjct  347  LSLEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDEDDE  405

Query  333  DMHGGAQRVQCAQQ  292
            DMHGGAQRVQCAQQ
Sbjct  406  DMHGGAQRVQCAQQ  419



>ref|XP_012090806.1| PREDICTED: dnaJ protein homolog [Jatropha curcas]
Length=417

 Score =   354 bits (909),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEH KFKRKGDD+ V+HTL+LTEALC
Sbjct  226  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLIVDHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++
Sbjct  286  GFQFILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQCKALEAVLP R + +++DMELDECEETTL+DVN EEEMRRK QQ A E Y+EDED
Sbjct  346  LPPDQCKALEAVLPSRSSVQLSDMELDECEETTLHDVNFEEEMRRK-QQHAAEAYDEDED  404

Query  330  MHGGAQRVQCAQQ  292
            MHGG+QRVQCAQQ
Sbjct  405  MHGGSQRVQCAQQ  417



>ref|XP_010907982.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=417

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQK+H KFKRKGDD+F EHTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKDHPKFKRKGDDLFFEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGM +YQ+PFMRGKLYIHF VDFP++
Sbjct  286  GFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMTLYQRPFMRGKLYIHFAVDFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTPDQCKA+EAVLPP+P +++TDME+DECEETTL+DVNIEEEMRRK Q QAQE YEEDE+
Sbjct  346  LTPDQCKAIEAVLPPKPVSQLTDMEIDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEE  404

Query  330  MHGGAQRVQCAQQ  292
             HGGAQRVQCAQQ
Sbjct  405  AHGGAQRVQCAQQ  417



>gb|ABX57881.1| DnaJ [Viola baoshanensis]
Length=417

 Score =   353 bits (907),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 184/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIV VLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDIVSVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF L HLDNRQLLIKSQPGEVVKPDQFKAINDEGMP+YQ+PFMRGKLYIHFTV+FP++
Sbjct  286  GFQFALAHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPIYQRPFMRGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTPDQ +A+EAVLP RP+ ++TDME+DECEETTL+DVNIE+EMRRK QQQAQE Y+EDED
Sbjct  346  LTPDQSRAIEAVLPARPSPQLTDMEVDECEETTLHDVNIEDEMRRK-QQQAQEAYDEDED  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>ref|XP_007211787.1| hypothetical protein PRUPE_ppa006330mg [Prunus persica]
 gb|EMJ12986.1| hypothetical protein PRUPE_ppa006330mg [Prunus persica]
Length=417

 Score =   353 bits (907),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 167/193 (87%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEH KFKRKGDD+F EHTL+L EALC
Sbjct  226  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLVEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GF FVLTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFHFVLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+QCK LEAVLPPR + ++TDMELDECEETTL+DVNIEEEMRRK Q QAQE Y+ED+D
Sbjct  346  LNPEQCKGLEAVLPPRSSAQLTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYDEDDD  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>ref|XP_009398344.1| PREDICTED: dnaJ protein homolog 2-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   353 bits (906),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 185/194 (95%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+I+FPGEADEAPDT TGDIVFVLQQK+H K+KRKGDDIF EHTL+LTEALC
Sbjct  226  VEKGMQNGQKISFPGEADEAPDTATGDIVFVLQQKDHPKYKRKGDDIFYEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIK  PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++
Sbjct  286  GFQFVLTHLDNRQLLIKLNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEE-DE  334
            LTPDQCKALEAVLPP+PA+++TDMELDECEETT++DVN+EEEMRRK Q QAQE YEE D+
Sbjct  346  LTPDQCKALEAVLPPKPASQMTDMELDECEETTVHDVNMEEEMRRK-QAQAQEAYEEDDD  404

Query  333  DMHGGAQRVQCAQQ  292
            D+HGGAQRVQCAQQ
Sbjct  405  DVHGGAQRVQCAQQ  418



>ref|XP_008375557.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=417

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+F EHTL+L E+LC
Sbjct  226  VEKGMQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLMESLC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFILTHLDGRQLLIKSHPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+QCKALEAVLPPR + ++TDMELDECEETTL+DVNIEEEMRRK Q  AQE Y+EDED
Sbjct  346  LNPEQCKALEAVLPPRTSAQLTDMELDECEETTLHDVNIEEEMRRK-QAHAQEAYDEDED  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>ref|XP_010263054.1| PREDICTED: dnaJ protein homolog [Nelumbo nucifera]
Length=416

 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 170/193 (88%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            V+KGMQNGQRITF GEADEAPDTITGDIVFVLQQKEH KFKRKGDD+F EHTL+LTEALC
Sbjct  225  VDKGMQNGQRITFQGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFYEHTLSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP++
Sbjct  285  GFQFVLTHLDNRQLLIKSSPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDS  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT +QCKALEAVLPPR + ++TDMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDED
Sbjct  345  LTMEQCKALEAVLPPRTSQQLTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDED  403

Query  330  MHGGAQRVQCAQQ  292
            +HGGAQRVQCAQQ
Sbjct  404  VHGGAQRVQCAQQ  416



>ref|XP_008231805.1| PREDICTED: dnaJ protein homolog [Prunus mume]
Length=417

 Score =   353 bits (905),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEH KFKRKGDD+F EHTL+L E+LC
Sbjct  226  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLVESLC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GF FVLTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFHFVLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+QCK LEAVLPPR + ++TDMELDECEETTL+DVNIEEEMRRK Q QAQE Y+ED+D
Sbjct  346  LNPEQCKGLEAVLPPRSSAQLTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYDEDDD  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>ref|XP_011084248.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
 ref|XP_011084249.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=418

 Score =   352 bits (904),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 166/193 (86%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADEAPDT+TGDIVFVLQQKE+ KFKRKGDD+FVEHTLTLTEALC
Sbjct  227  VEKGMQHGQKITFPGEADEAPDTVTGDIVFVLQQKEYPKFKRKGDDLFVEHTLTLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQLLIKS+PGEV+KPDQFKAINDEGMPMYQ+ FM+GKLYI FTVDFPE+
Sbjct  287  GFQFILTHLDNRQLLIKSEPGEVIKPDQFKAINDEGMPMYQRSFMKGKLYIQFTVDFPES  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KALE VLPPRP T++TDMELDECEETTL+DVN+EEEMRRK QQ AQE YEED+D
Sbjct  347  LSPDQSKALEGVLPPRPTTRLTDMELDECEETTLHDVNMEEEMRRK-QQHAQEAYEEDDD  405

Query  330  MHGGAQRVQCAQQ  292
            MHGG QRVQCAQQ
Sbjct  406  MHGGPQRVQCAQQ  418



>ref|XP_006367021.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Solanum tuberosum]
Length=338

 Score =   349 bits (896),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 183/195 (94%), Gaps = 2/195 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            V+KGMQNGQ+ITFPGEADE PDT+TGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  144  VDKGMQNGQKITFPGEADEEPDTVTGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALC  203

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQL+IKSQPGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTVDFP  
Sbjct  204  GFQFVLTHLDNRQLIIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVDFPNI  263

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDE  334
            LTP+ CK LEAVLP RP T+ +DMELDECEETTL+DVNI+EEMRRKQQQQAQE Y E+D+
Sbjct  264  LTPELCKNLEAVLPARPKTQASDMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDD  323

Query  333  DMH-GGAQRVQCAQQ  292
            DMH GGAQRVQCAQQ
Sbjct  324  DMHGGGAQRVQCAQQ  338



>gb|ABB16980.1| DnaJ-like protein [Solanum tuberosum]
Length=419

 Score =   352 bits (902),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 168/194 (87%), Positives = 184/194 (95%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEH L+LTE LC
Sbjct  227  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHXLSLTEXLC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQL+IK QPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP+T
Sbjct  287  GFQFILTHLDNRQLIIKPQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDT  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDE  334
            L+P+QCK LEAVLPP+P T++TDMELDECEETTL+DV IEEEMRRK QQQAQE Y E+DE
Sbjct  347  LSPEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVXIEEEMRRK-QQQAQEAYDEDDE  405

Query  333  DMHGGAQRVQCAQQ  292
            DMHGGAQRVQCAQQ
Sbjct  406  DMHGGAQRVQCAQQ  419



>gb|KJB35426.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=417

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+T+TGDIVFVLQQK+H KFKRKG+D+F+EHTL+LTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPETVTGDIVFVLQQKDHPKFKRKGEDLFLEHTLSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFV+THLD RQLLIKS PGEVVKPD  KAINDEGMP+YQ+PFM+GKLYI FTV+FP++
Sbjct  285  GFQFVITHLDGRQLLIKSNPGEVVKPDSCKAINDEGMPLYQRPFMKGKLYIQFTVEFPDS  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KALEA+LPP+P ++++DMELDECEETTLYDVNIEEEMRRKQQQ AQE YEEDED
Sbjct  345  LSPDQVKALEAILPPKPTSQLSDMELDECEETTLYDVNIEEEMRRKQQQAAQEAYEEDED  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>gb|KHG17902.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=417

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 183/193 (95%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+T+TGDIVFVLQQK+H KFKRKG+D+F+EHTL+LTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPETVTGDIVFVLQQKDHPKFKRKGEDLFLEHTLSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFV+THLD RQLLIKS PGEVVKPD  KAINDEGMP+YQ+PFM+GKLYI FTV+FP++
Sbjct  285  GFQFVITHLDGRQLLIKSNPGEVVKPDSCKAINDEGMPLYQRPFMKGKLYIQFTVEFPDS  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KALEA+LPP+P ++++DMELDECEETTLYDVNIEEEMRRKQQQ AQE YEEDED
Sbjct  345  LSPDQVKALEAILPPKPTSQLSDMELDECEETTLYDVNIEEEMRRKQQQAAQEAYEEDED  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>ref|XP_004982304.1| PREDICTED: dnaJ protein homolog 2-like [Setaria italica]
Length=419

 Score =   351 bits (900),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 183/194 (94%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADEAPDT TGDIVFVLQQK+H+KFKRKGDD+F EHTL+LTEALC
Sbjct  226  VEKGMQHGQKITFPGEADEAPDTTTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDE  334
            L P+QCKALEAVLPP+P +K+TDME+DECEETT++DV NIEEEMRRKQ   AQE YEED+
Sbjct  346  LAPEQCKALEAVLPPKPTSKLTDMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDD  405

Query  333  DMHGGAQRVQCAQQ  292
            DM GGAQRVQCAQQ
Sbjct  406  DMPGGAQRVQCAQQ  419



>ref|XP_006367020.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Solanum tuberosum]
Length=419

 Score =   350 bits (898),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 183/195 (94%), Gaps = 2/195 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            V+KGMQNGQ+ITFPGEADE PDT+TGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  225  VDKGMQNGQKITFPGEADEEPDTVTGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQL+IKSQPGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTVDFP  
Sbjct  285  GFQFVLTHLDNRQLIIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVDFPNI  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDE  334
            LTP+ CK LEAVLP RP T+ +DMELDECEETTL+DVNI+EEMRRKQQQQAQE Y E+D+
Sbjct  345  LTPELCKNLEAVLPARPKTQASDMELDECEETTLHDVNIDEEMRRKQQQQAQEAYDEDDD  404

Query  333  DMH-GGAQRVQCAQQ  292
            DMH GGAQRVQCAQQ
Sbjct  405  DMHGGGAQRVQCAQQ  419



>ref|XP_008345828.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=417

 Score =   350 bits (897),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVFVLQQKEH KFKRKGDD+F EHTL+L E+LC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLVESLC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+QCKALEAVLPP+ + ++TDMELDECEETTL+DVNIEEEMRRK Q  A E Y++DED
Sbjct  346  LNPEQCKALEAVLPPKTSAQLTDMELDECEETTLHDVNIEEEMRRK-QAHAHEAYDDDED  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>ref|XP_009766164.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana sylvestris]
 ref|XP_009766166.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana sylvestris]
Length=419

 Score =   349 bits (896),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 168/195 (86%), Positives = 184/195 (94%), Gaps = 2/195 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+TITGDIVF+LQQKEH KFKRKGDD+F EHTLTLTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPETITGDIVFILQQKEHPKFKRKGDDLFAEHTLTLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD+RQLLIKSQPGEVVKPDQFK INDEGMPMYQ+PFMRGKLYIHFTVDFP+T
Sbjct  285  GFQFVLTHLDSRQLLIKSQPGEVVKPDQFKGINDEGMPMYQRPFMRGKLYIHFTVDFPDT  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY--EED  337
            L P+ CK LEAVLPPRP T+ +DMELDECEETTL+DVN+EEEMRRK+QQQAQE Y  ++D
Sbjct  345  LAPELCKNLEAVLPPRPKTQASDMELDECEETTLHDVNMEEEMRRKRQQQAQEAYEEDDD  404

Query  336  EDMHGGAQRVQCAQQ  292
            +DMHGGAQRVQCAQQ
Sbjct  405  DDMHGGAQRVQCAQQ  419



>gb|ABI83623.1| DnaJ-like protein [Setaria italica]
Length=419

 Score =   349 bits (895),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 163/194 (84%), Positives = 182/194 (94%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADEAPDT TGD VFVLQQK+H+KFKRKGDD+F EHTL+LTEALC
Sbjct  226  VEKGMQHGQKITFPGEADEAPDTTTGDTVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDE  334
            L P+QCKALEAVLPP+P +K+TDME+DECEETT++DV NIEEEMRRKQ   AQE YEED+
Sbjct  346  LAPEQCKALEAVLPPKPTSKLTDMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDD  405

Query  333  DMHGGAQRVQCAQQ  292
            DM GGAQRVQCAQQ
Sbjct  406  DMPGGAQRVQCAQQ  419



>gb|KCW50580.1| hypothetical protein EUGRSUZ_J00292 [Eucalyptus grandis]
Length=373

 Score =   347 bits (890),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+I FPGEADEAPDT+TGDIVFVLQQKEH K+KRKGDD+F EHTL+LTE+LC
Sbjct  182  VEKGMQNGQKIKFPGEADEAPDTVTGDIVFVLQQKEHPKYKRKGDDLFYEHTLSLTESLC  241

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF L+HLD RQLLIKSQPGEV+KPDQFKAINDEGMP+Y +PFM+GKLYIHFTV+FP+T
Sbjct  242  GFQFALSHLDGRQLLIKSQPGEVIKPDQFKAINDEGMPIYPRPFMKGKLYIHFTVEFPDT  301

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALE +LPPR + ++TDMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDED
Sbjct  302  LSPEQCKALETILPPRSSAQLTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDED  360

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  361  MHGGAQRVQCAQQ  373



>ref|XP_002270362.1| PREDICTED: dnaJ protein homolog isoform X1 [Vitis vinifera]
 emb|CAN64692.1| hypothetical protein VITISV_030671 [Vitis vinifera]
Length=417

 Score =   348 bits (892),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ++TFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKVTFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKS PGEVVKPDQFKAINDEGMP+YQ+PFMRGKLYI F V+FP+T
Sbjct  286  GFQFILTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPIYQRPFMRGKLYIQFNVEFPDT  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALEAVLP R  T++TDMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDE+
Sbjct  346  LSPEQCKALEAVLPARATTQLTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEE  404

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  405  MPGGAQRVQCAQQ  417



>ref|XP_010031320.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 ref|XP_010031321.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW50579.1| hypothetical protein EUGRSUZ_J00292 [Eucalyptus grandis]
Length=417

 Score =   348 bits (892),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+I FPGEADEAPDT+TGDIVFVLQQKEH K+KRKGDD+F EHTL+LTE+LC
Sbjct  226  VEKGMQNGQKIKFPGEADEAPDTVTGDIVFVLQQKEHPKYKRKGDDLFYEHTLSLTESLC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF L+HLD RQLLIKSQPGEV+KPDQFKAINDEGMP+Y +PFM+GKLYIHFTV+FP+T
Sbjct  286  GFQFALSHLDGRQLLIKSQPGEVIKPDQFKAINDEGMPIYPRPFMKGKLYIHFTVEFPDT  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALE +LPPR + ++TDMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDED
Sbjct  346  LSPEQCKALETILPPRSSAQLTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDED  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>ref|XP_010651845.1| PREDICTED: dnaJ protein homolog isoform X2 [Vitis vinifera]
Length=417

 Score =   347 bits (891),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ++TFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKVTFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKS PGEVVKPDQFKAINDEGMP+YQ+PFMRGKLYI F V+FP+T
Sbjct  286  GFQFILTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPIYQRPFMRGKLYIQFNVEFPDT  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALEAVLP R  T++TDMELDECEETTL+DVNIEEEMRRK Q QAQE YEEDE+
Sbjct  346  LSPEQCKALEAVLPARATTQLTDMELDECEETTLHDVNIEEEMRRK-QAQAQEAYEEDEE  404

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  405  MPGGAQRVQCAQQ  417



>ref|XP_009341572.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=417

 Score =   347 bits (890),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 180/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVFVLQQKEH KFKRKGDD+F EHTL+L E+LC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFFEHTLSLVESLC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+ FM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRSFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+QCKALEAVLPP+ + ++TDMELDECEETTL+DVNIEEEMRRK Q  A E Y++DED
Sbjct  346  LNPEQCKALEAVLPPKTSAQLTDMELDECEETTLHDVNIEEEMRRK-QAHAHEAYDDDED  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>gb|AFW68139.1| putative dnaJ chaperone family protein [Zea mays]
Length=338

 Score =   344 bits (882),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 184/194 (95%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITFPGEADEAPDT+TGDIVFVLQQK+H+KFKRKG+D+F EHTL+LTEALC
Sbjct  145  VEKGMQHSQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALC  204

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  205  GFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDS  264

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDE  334
            L P+QCKALE+VLPP+P++K+TDME+DECEETT++DV NIEEEMRRKQ   AQE YEED+
Sbjct  265  LAPEQCKALESVLPPKPSSKLTDMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDD  324

Query  333  DMHGGAQRVQCAQQ  292
            +M GGAQRVQCAQQ
Sbjct  325  EMPGGAQRVQCAQQ  338



>gb|AGY48884.1| MIP1.2 [Nicotiana benthamiana]
Length=419

 Score =   347 bits (889),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 184/195 (94%), Gaps = 2/195 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+TITGDIVF+LQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPETITGDIVFILQQKEHPKFKRKGDDLFVEHTLTLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD+RQLLIKSQPGEVVKPDQFK INDEGMPMYQ+PFMRGKLYIHFTVDFP+T
Sbjct  285  GFQFVLTHLDSRQLLIKSQPGEVVKPDQFKGINDEGMPMYQRPFMRGKLYIHFTVDFPDT  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY--EED  337
              P+ CK LEAVLPPRP T+ ++MELDECEETTL+DVN+EEEMRRK+QQQAQE Y  +++
Sbjct  345  FAPEMCKNLEAVLPPRPKTQASNMELDECEETTLHDVNMEEEMRRKRQQQAQEAYEEDDE  404

Query  336  EDMHGGAQRVQCAQQ  292
            +DMHGGAQRV+CAQQ
Sbjct  405  DDMHGGAQRVECAQQ  419



>sp|Q04960.1|DNJH_CUCSA RecName: Full=DnaJ protein homolog; AltName: Full=DNAJ-1; Flags: 
Precursor [Cucumis sativus]
 emb|CAA47925.1| cs DnaJ-1 [Cucumis sativus]
 gb|KGN52169.1| hypothetical protein Csa_5G613470 [Cucumis sativus]
Length=413

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 180/193 (93%), Gaps = 3/193 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN Q+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+L E+LC
Sbjct  224  VEKGMQNAQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLVESLC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++
Sbjct  284  GFQFILTHLDGRQLLIKSLPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+QCKALE VLPPR + +++DMELDECEETTL+DVNIEEEMRRK   QAQE Y+EDED
Sbjct  344  LNPEQCKALEGVLPPRTSVQLSDMELDECEETTLHDVNIEEEMRRK---QAQEAYDEDED  400

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  401  MHGGAQRVQCAQQ  413



>ref|XP_004981504.1| PREDICTED: dnaJ protein homolog [Setaria italica]
Length=418

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 180/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTE+LC
Sbjct  227  VEKGMQNGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTESLC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++
Sbjct  287  GFQFVLTHLDNRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDS  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+QCKALEAVLPP+P ++ TDMELDECEET  YDVNIEEE+RR+QQQ  QE Y+EDED
Sbjct  347  LNPEQCKALEAVLPPKPTSQYTDMELDECEETMPYDVNIEEELRRRQQQH-QEAYDEDED  405

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  406  MPGGAQRVQCAQQ  418



>ref|NP_001238341.1| seed maturation protein PM37 [Glycine max]
 gb|AAD51625.1|AF169022_1 seed maturation protein PM37 [Glycine max]
 gb|KHN21201.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   346 bits (888),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 183/193 (95%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVFVLQQKEH KFKRK +D+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKAEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQ KALEAVLPP+P++++TDMELDECEETTL+DVN+EEE RRK QQQAQE Y+ED+D
Sbjct  346  LNPDQVKALEAVLPPKPSSQLTDMELDECEETTLHDVNMEEETRRK-QQQAQEAYDEDDD  404

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  405  MPGGAQRVQCAQQ  417



>ref|NP_001168650.1| putative dnaJ chaperone family protein [Zea mays]
 gb|ACN29044.1| unknown [Zea mays]
 tpg|DAA51803.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=418

 Score =   345 bits (886),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 180/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTE+LC
Sbjct  227  VEKGMQNGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTESLC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFV+THLDNRQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++
Sbjct  287  GFQFVVTHLDNRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDS  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALEAVLPP+P ++ TDMELDECEET  YDVNIE EMRR+QQQ  QE Y+EDED
Sbjct  347  LSPEQCKALEAVLPPKPVSQYTDMELDECEETMPYDVNIEAEMRRRQQQH-QEAYDEDED  405

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  406  MPGGAQRVQCAQQ  418



>ref|NP_001146715.1| uncharacterized protein LOC100280317 [Zea mays]
 gb|ACL54611.1| unknown [Zea mays]
Length=419

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 184/194 (95%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITFPGEADEAPDT+TGDIVFVLQQK+H+KFKRKG+D+F EHTL+LTEALC
Sbjct  226  VEKGMQHSQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDE  334
            L P+QCKALE+VLPP+P++K+TDME+DECEETT++DV NIEEEMRRKQ   AQE YEED+
Sbjct  346  LAPEQCKALESVLPPKPSSKLTDMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDD  405

Query  333  DMHGGAQRVQCAQQ  292
            +M GGAQRVQCAQQ
Sbjct  406  EMPGGAQRVQCAQQ  419



>ref|XP_009406563.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=414

 Score =   345 bits (884),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 165/193 (85%), Positives = 182/193 (94%), Gaps = 2/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVF+LQQK+H KFKRKGDDIF EHTL+LTEALC
Sbjct  224  VEKGMQNGQKITFPGEADEAPDTVTGDIVFILQQKDHPKFKRKGDDIFYEHTLSLTEALC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAI+DEGMPMYQ+PFMRGKLYIHFTVDFP++
Sbjct  284  GFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAIDDEGMPMYQRPFMRGKLYIHFTVDFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTPDQCKALEAVLPPR A ++T+MELDECEET L +VNIEEEMRRK Q Q+QE Y+ED+D
Sbjct  344  LTPDQCKALEAVLPPRQALQMTEMELDECEETILNNVNIEEEMRRK-QAQSQEAYDEDDD  402

Query  330  MHGGAQRVQCAQQ  292
            +HGGA RVQCAQQ
Sbjct  403  VHGGA-RVQCAQQ  414



>gb|AFW68140.1| putative dnaJ chaperone family protein isoform 1 [Zea mays]
 gb|AFW68141.1| putative dnaJ chaperone family protein isoform 2 [Zea mays]
Length=419

 Score =   345 bits (884),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 184/194 (95%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITFPGEADEAPDT+TGDIVFVLQQK+H+KFKRKG+D+F EHTL+LTEALC
Sbjct  226  VEKGMQHSQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDE  334
            L P+QCKALE+VLPP+P++K+TDME+DECEETT++DV NIEEEMRRKQ   AQE YEED+
Sbjct  346  LAPEQCKALESVLPPKPSSKLTDMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDD  405

Query  333  DMHGGAQRVQCAQQ  292
            +M GGAQRVQCAQQ
Sbjct  406  EMPGGAQRVQCAQQ  419



>ref|NP_001149958.1| dnaJ protein [Zea mays]
 gb|ACG37341.1| dnaJ protein [Zea mays]
Length=336

 Score =   342 bits (876),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 179/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTE+LC
Sbjct  145  VEKGMQNGQKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTESLC  204

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++
Sbjct  205  GFQFVLTHLDNRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDS  264

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALEAVLPP+P ++ TDMELDECEET  YDVNIEEEMRR+QQQ  QE Y+ED+D
Sbjct  265  LSPEQCKALEAVLPPKPVSQYTDMELDECEETMSYDVNIEEEMRRRQQQH-QEAYDEDDD  323

Query  330  MHGGAQRVQCAQQ  292
            + GG QRVQCAQQ
Sbjct  324  VPGGGQRVQCAQQ  336



>gb|KCW50936.1| hypothetical protein EUGRSUZ_J00583 [Eucalyptus grandis]
Length=335

 Score =   342 bits (876),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 182/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVF+LQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  144  VEKGMQNGQKITFPGEADEAPDTVTGDIVFILQQKEHPKFKRKGDDLFVEHTLSLTEALC  203

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFPE+
Sbjct  204  GFQFVLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPES  263

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+Q +AL++VLP +PA+++T+MELDECEETTL+DVNIEEEMRRKQQ QA E Y+ED+D
Sbjct  264  LSPEQVEALQSVLPQKPASQLTEMELDECEETTLHDVNIEEEMRRKQQAQA-EAYDEDDD  322

Query  330  MHGGAQRVQCAQQ  292
            M  GAQRVQCAQQ
Sbjct  323  MPSGAQRVQCAQQ  335



>ref|NP_001130317.1| chaperone DNA J2 [Zea mays]
 gb|AAC08009.1| DnaJ-related protein ZMDJ1 [Zea mays]
 gb|ACF78499.1| unknown [Zea mays]
 gb|ACG32917.1| dnaJ protein [Zea mays]
 gb|ACL53813.1| unknown [Zea mays]
 gb|ACN34490.1| unknown [Zea mays]
 gb|ACR38444.1| unknown [Zea mays]
 tpg|DAA50285.1| TPA: chaperone DNA J2 [Zea mays]
Length=419

 Score =   344 bits (883),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 183/194 (94%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITFPGEADEAPDT+TGDIVFVLQQK+H+KFKRKG+D+F EHTL+LTEALC
Sbjct  226  VEKGMQHNQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDNRQLLIKSDPGEVVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDE  334
            L P+QCKALE VLPPRP++K+TDME+DECEETT++DV NIEEEMRRKQ   AQE YEED+
Sbjct  346  LAPEQCKALETVLPPRPSSKLTDMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDD  405

Query  333  DMHGGAQRVQCAQQ  292
            +M GGAQRVQCAQQ
Sbjct  406  EMPGGAQRVQCAQQ  419



>gb|AGY48886.1| MIP1.4a [Nicotiana benthamiana]
Length=403

 Score =   343 bits (881),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 181/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQK+H +FKRKGDD+FV+HTL+LTEALC
Sbjct  212  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKDHPRFKRKGDDLFVDHTLSLTEALC  271

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF++THLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF V+FPE+
Sbjct  272  GFQFIITHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFVVEFPES  331

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+Q KALEAVLPPRP ++ TDMELDECEET+L+DVNIEEEMRRKQ  Q QE Y+ED++
Sbjct  332  LSPEQAKALEAVLPPRPQSQYTDMELDECEETSLHDVNIEEEMRRKQAAQ-QEAYDEDDE  390

Query  330  MHGGAQRVQCAQQ  292
            +HGG QRVQCAQQ
Sbjct  391  LHGGGQRVQCAQQ  403



>ref|XP_008446732.1| PREDICTED: dnaJ protein homolog [Cucumis melo]
Length=413

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 179/193 (93%), Gaps = 3/193 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN Q+ITFPGEADEAPDT+TGDIVFVLQQKEH +FKRKGDD+FVEHTL+L E+LC
Sbjct  224  VEKGMQNAQKITFPGEADEAPDTVTGDIVFVLQQKEHPRFKRKGDDLFVEHTLSLVESLC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++
Sbjct  284  GFQFILTHLDGRQLLIKSLPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+QCKALE VLPPR + +++DMELDECEETTL+DVNIEEEMRRK   Q QE Y+EDED
Sbjct  344  LNPEQCKALEGVLPPRTSVQLSDMELDECEETTLHDVNIEEEMRRK---QVQEAYDEDED  400

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  401  MHGGAQRVQCAQQ  413



>ref|XP_002466747.1| hypothetical protein SORBIDRAFT_01g013390 [Sorghum bicolor]
 gb|EER93745.1| hypothetical protein SORBIDRAFT_01g013390 [Sorghum bicolor]
Length=419

 Score =   344 bits (882),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 183/194 (94%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITFPGEADEAPDT+TGDIVFVLQQK+H+KFKRKG+D+F EHTL+LTEALC
Sbjct  226  VEKGMQHNQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGEDLFYEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPIYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDE  334
            L P+QCKALEAVLPPR ++K+TDME+DECEETT++DV NIEEEMRRKQ   AQE YEED+
Sbjct  346  LAPEQCKALEAVLPPRSSSKLTDMEIDECEETTMHDVNNIEEEMRRKQAHAAQEAYEEDD  405

Query  333  DMHGGAQRVQCAQQ  292
            +M GGAQRVQCAQQ
Sbjct  406  EMPGGAQRVQCAQQ  419



>ref|XP_009408521.1| PREDICTED: dnaJ protein homolog isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=416

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 180/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN Q+ITFPGEADEAP+T+TGDIVFVLQQK+H KFKRKGDD++ EHTL+LTEALC
Sbjct  225  VEKGMQNEQKITFPGEADEAPETVTGDIVFVLQQKDHPKFKRKGDDLYYEHTLSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
             FQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP+ 
Sbjct  285  SFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDL  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT DQCKALEA LPP+PA+++TDMELDECEETTLYDVNIEEEMRRK Q QAQE YEE++D
Sbjct  345  LTLDQCKALEAALPPKPASQMTDMELDECEETTLYDVNIEEEMRRK-QAQAQEAYEEEDD  403

Query  330  MHGGAQRVQCAQQ  292
            + G AQR+QCAQQ
Sbjct  404  VSGRAQRLQCAQQ  416



>gb|ABA46776.1| DnaJ-like protein [Solanum tuberosum]
Length=443

 Score =   345 bits (884),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 164/188 (87%), Positives = 181/188 (96%), Gaps = 2/188 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQL+IK QPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP+T
Sbjct  287  GFQFILTHLDNRQLIIKPQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFPDT  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDE  334
            L+P+QCK LEAVLPP+P T++TDMELDECEETTL+DV+IEEEMRRK QQQAQE Y E+DE
Sbjct  347  LSPEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVHIEEEMRRK-QQQAQEAYDEDDE  405

Query  333  DMHGGAQR  310
            DMHGGAQR
Sbjct  406  DMHGGAQR  413



>ref|XP_004139085.1| PREDICTED: dnaJ protein homolog [Cucumis sativus]
 gb|KGN66611.1| DnaJ [Cucumis sativus]
Length=413

 Score =   343 bits (880),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 182/193 (94%), Gaps = 3/193 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  224  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIK+ PGEVVKPD FKAINDEGMP+YQ+PFM+GKLYIHF+VDFP++
Sbjct  284  GFQFALTHLDGRQLLIKTNPGEVVKPDSFKAINDEGMPVYQRPFMKGKLYIHFSVDFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+Q KALEAVLP +P++++TDMELDECEET+++DVNIEEEMRRKQQ +A   YEEDED
Sbjct  344  LSPEQIKALEAVLPSKPSSQLTDMELDECEETSMHDVNIEEEMRRKQQAEA---YEEDED  400

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  401  MHGGAQRVQCAQQ  413



>gb|KDO48966.1| hypothetical protein CISIN_1g014903mg [Citrus sinensis]
Length=335

 Score =   340 bits (873),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 178/193 (92%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKG+D+F EHTL+LTEALC
Sbjct  144  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFYEHTLSLTEALC  203

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS PGEVVKPD +KAIN+EGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  204  GFQFALTHLDGRQLLIKSNPGEVVKPDSYKAINEEGMPLYQRPFMKGKLYIHFTVEFPDS  263

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTPDQ KALEA+LP RP + +TDMELDECEETTL+DVNIEEEMRRK Q  AQE YEEDED
Sbjct  264  LTPDQVKALEAILPSRPLSGMTDMELDECEETTLHDVNIEEEMRRK-QAHAQEAYEEDED  322

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  323  MPGGAQRVQCAQQ  335



>ref|XP_009408520.1| PREDICTED: dnaJ protein homolog isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 180/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN Q+ITFPGEADEAP+T+TGDIVFVLQQK+H KFKRKGDD++ EHTL+LTEALC
Sbjct  226  VEKGMQNEQKITFPGEADEAPETVTGDIVFVLQQKDHPKFKRKGDDLYYEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
             FQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP+ 
Sbjct  286  SFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDL  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT DQCKALEA LPP+PA+++TDMELDECEETTLYDVNIEEEMRRK Q QAQE YEE++D
Sbjct  346  LTLDQCKALEAALPPKPASQMTDMELDECEETTLYDVNIEEEMRRK-QAQAQEAYEEEDD  404

Query  330  MHGGAQRVQCAQQ  292
            + G AQR+QCAQQ
Sbjct  405  VSGRAQRLQCAQQ  417



>sp|Q03363.1|DNJH1_ALLPO RecName: Full=DnaJ protein homolog 1; Short=DNAJ-1; Flags: Precursor, 
partial [Allium ampeloprasum]
 emb|CAA49211.1| DNA J protein [Allium ampeloprasum]
 prf||1914140A DnaJ protein
Length=397

 Score =   342 bits (878),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDT+TGDIVFVLQQKEH KF+RKGDD+F +HTL+LTEALC
Sbjct  205  VEKGMQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFQRKGDDLFYKHTLSLTEALC  264

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYI F VDFP++
Sbjct  265  GFQFVLTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIQFLVDFPDS  324

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTPDQCK +E+VLP   ++++TDME+DECEETT++DVNIEEEMRRKQ Q AQE Y+ED++
Sbjct  325  LTPDQCKVIESVLPRSASSQLTDMEIDECEETTMHDVNIEEEMRRKQHQHAQEAYDEDDE  384

Query  330  MHGGAQRVQCAQQ  292
             HGG QRVQCAQQ
Sbjct  385  GHGGGQRVQCAQQ  397



>ref|XP_008443634.1| PREDICTED: dnaJ protein homolog [Cucumis melo]
Length=413

 Score =   343 bits (879),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 182/193 (94%), Gaps = 3/193 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  224  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIK+ PGEVVKPD FKAINDEGMP+YQ+PFM+GKLYIHF+VDFP++
Sbjct  284  GFQFVLTHLDGRQLLIKTNPGEVVKPDSFKAINDEGMPVYQRPFMKGKLYIHFSVDFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+Q KALE VLP +P++++TDMELDECEET+++DVNIEEEMRRKQQ +A   YEEDED
Sbjct  344  LSPEQIKALETVLPSKPSSQLTDMELDECEETSMHDVNIEEEMRRKQQAEA---YEEDED  400

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  401  MHGGAQRVQCAQQ  413



>ref|XP_010089798.1| DnaJ-like protein [Morus notabilis]
 gb|EXB38414.1| DnaJ-like protein [Morus notabilis]
Length=440

 Score =   343 bits (881),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPG +DEAPDTITGDIVFVLQQKEH KFKRKGDD+FVEH L+LTEALC
Sbjct  248  VEKGMQNGQRITFPGASDEAPDTITGDIVFVLQQKEHPKFKRKGDDLFVEHNLSLTEALC  307

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP+ 
Sbjct  308  GFQFVLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDY  367

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+  KALE VLPP+P + ++DMELDECEETT ++VNIEEEMRRKQQQ   E YEEDED
Sbjct  368  LSPEHVKALEVVLPPKPLSPLSDMELDECEETTPHNVNIEEEMRRKQQQAQAEAYEEDED  427

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  428  MQGGAQRVQCAQQ  440



>ref|XP_010031575.1| PREDICTED: dnaJ protein homolog [Eucalyptus grandis]
 gb|KCW50935.1| hypothetical protein EUGRSUZ_J00583 [Eucalyptus grandis]
Length=416

 Score =   342 bits (878),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 182/193 (94%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVF+LQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPDTVTGDIVFILQQKEHPKFKRKGDDLFVEHTLSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFPE+
Sbjct  285  GFQFVLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPES  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+Q +AL++VLP +PA+++T+MELDECEETTL+DVNIEEEMRRKQQ QA E Y+ED+D
Sbjct  345  LSPEQVEALQSVLPQKPASQLTEMELDECEETTLHDVNIEEEMRRKQQAQA-EAYDEDDD  403

Query  330  MHGGAQRVQCAQQ  292
            M  GAQRVQCAQQ
Sbjct  404  MPSGAQRVQCAQQ  416



>ref|XP_006826444.1| PREDICTED: dnaJ protein homolog [Amborella trichopoda]
 gb|ERM93681.1| hypothetical protein AMTR_s00004p00172570 [Amborella trichopoda]
Length=419

 Score =   342 bits (878),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 164/194 (85%), Positives = 180/194 (93%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPD ITGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDCITGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMY +PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYGRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KALEAVL PR ++++TDMELDECEETTL+DVNIEEEMRRKQ   AQEVY+ED+D
Sbjct  346  LSPDQSKALEAVLLPRSSSQLTDMELDECEETTLHDVNIEEEMRRKQSHPAQEVYDEDDD  405

Query  330  M-HGGAQRVQCAQQ  292
                GAQRVQCAQQ
Sbjct  406  GPASGAQRVQCAQQ  419



>gb|ABI18985.1| molecular chaperone DjA2 [Allium ampeloprasum]
Length=418

 Score =   342 bits (878),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 178/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDT+TGDIVFVLQQKEH KF+RKGDD+F +HTL+LTEALC
Sbjct  226  VEKGMQNGQRITFPGEADEAPDTVTGDIVFVLQQKEHPKFQRKGDDLFYKHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYI F VDFP++
Sbjct  286  GFQFVLTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIQFLVDFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTPDQCK +E+VLP   ++++TDME+DECEETT++DVNIEEEMRRKQ Q AQE Y+ED++
Sbjct  346  LTPDQCKVIESVLPRSASSQLTDMEIDECEETTMHDVNIEEEMRRKQHQHAQEAYDEDDE  405

Query  330  MHGGAQRVQCAQQ  292
             HGG QRVQCAQQ
Sbjct  406  GHGGGQRVQCAQQ  418



>emb|CDO99946.1| unnamed protein product [Coffea canephora]
Length=416

 Score =   342 bits (877),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 179/193 (93%), Gaps = 2/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRK DD+F EHTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKHDDLFYEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKSQPGEV+KPDQFKAINDEGM +YQ+PFMRGKLYIHF V+FP+ 
Sbjct  286  GFQFILTHLDGRQLLIKSQPGEVLKPDQFKAINDEGMVVYQRPFMRGKLYIHFNVEFPDY  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+QCK+LEAVLPP+   +ITDMELDECEETTL+DVNIE+EMRRK  QQAQE YEEDED
Sbjct  346  LDPEQCKSLEAVLPPKTTKQITDMELDECEETTLHDVNIEDEMRRK--QQAQEAYEEDED  403

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  404  MHGGAQRVQCAQQ  416



>ref|NP_001267695.1| dnaJ protein homolog [Cucumis sativus]
 gb|ADF30255.1| heat shock protein [Cucumis sativus]
Length=413

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 178/193 (92%), Gaps = 3/193 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN Q+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+L E+LC
Sbjct  224  VEKGMQNAQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLVESLC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHF V+FP++
Sbjct  284  GFQFILTHLDGRQLLIKSLPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFCVEFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+QCKALE VLPPR + +++DMELDECEETTL+DVNIEEEMRRK   QAQE  +EDED
Sbjct  344  LNPEQCKALEGVLPPRTSVQLSDMELDECEETTLHDVNIEEEMRRK---QAQEANDEDED  400

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  401  MHGGAQRVQCAQQ  413



>ref|XP_003596917.1| DnaJ [Medicago truncatula]
Length=256

 Score =   336 bits (861),  Expect = 8e-112, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 179/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  65   VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  124

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FPE+
Sbjct  125  GFQFALTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPES  184

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT DQ KALE +LP RP +++TDMELDECEETTL+DVNIEEE RR+QQ Q QE Y+ED++
Sbjct  185  LTLDQVKALETILPARPVSQLTDMELDECEETTLHDVNIEEETRRRQQAQ-QEAYDEDDE  243

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  244  MPGGAQRVQCAQQ  256



>gb|AAF64454.1|AF239932_1 DnaJ protein [Euphorbia esula]
Length=418

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 179/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVF+LQQ+EH KFKR+GDD+ VEHTL+LTEALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPDTVTGDIVFILQQREHPKFKRRGDDLVVEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF V+FP++
Sbjct  287  GFQFILTHLDGRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFNVEFPDS  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQ KALEAVLP R + +++DME+DECEETTL+DVN EEEMRRKQQQ A E Y+EDED
Sbjct  347  LPPDQSKALEAVLPSRTSVQLSDMEVDECEETTLHDVNFEEEMRRKQQQSA-EAYDEDED  405

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  406  MPGGAQRVQCAQQ  418



>gb|EMT10718.1| DnaJ protein-like protein [Aegilops tauschii]
Length=421

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 179/194 (92%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADEAPDT+TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTEALC
Sbjct  228  VEKGMQHGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQ+VL HLD RQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP++
Sbjct  288  GFQYVLAHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDS  347

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQCKALE VLPP+PA++ TDMELDECEET  YD++IEEEMRR++QQQAQE Y+EDED
Sbjct  348  LSLDQCKALETVLPPKPASQYTDMELDECEETMAYDIDIEEEMRRREQQQAQEGYDEDED  407

Query  330  M-HGGAQRVQCAQQ  292
            M  GG QRVQCAQQ
Sbjct  408  MPGGGGQRVQCAQQ  421



>ref|NP_001242510.1| uncharacterized protein LOC100808604 [Glycine max]
 gb|ACU21221.1| unknown [Glycine max]
Length=410

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 180/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVFVLQQKEH KFKRK +D+FVEH L+LTEALC
Sbjct  219  VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKAEDLFVEHILSLTEALC  278

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQ+ FM+GKLYIHFTV+FP++
Sbjct  279  GFQFVLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRSFMKGKLYIHFTVEFPDS  338

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQ KALEAVLPP+P++++TDMELDECEETTL+DVN+EEE RRK QQQAQE Y+ED+D
Sbjct  339  LNPDQVKALEAVLPPKPSSQLTDMELDECEETTLHDVNMEEETRRK-QQQAQEAYDEDDD  397

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  398  MPGGAQRVQCAQQ  410



>ref|XP_006424068.1| hypothetical protein CICLE_v10028531mg [Citrus clementina]
 ref|XP_006487844.1| PREDICTED: dnaJ protein homolog ANJ1-like [Citrus sinensis]
 gb|ESR37308.1| hypothetical protein CICLE_v10028531mg [Citrus clementina]
 gb|KDO48965.1| hypothetical protein CISIN_1g014903mg [Citrus sinensis]
Length=416

 Score =   341 bits (874),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 178/193 (92%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKG+D+F EHTL+LTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFYEHTLSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS PGEVVKPD +KAIN+EGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  285  GFQFALTHLDGRQLLIKSNPGEVVKPDSYKAINEEGMPLYQRPFMKGKLYIHFTVEFPDS  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTPDQ KALEA+LP RP + +TDMELDECEETTL+DVNIEEEMRRK Q  AQE YEEDED
Sbjct  345  LTPDQVKALEAILPSRPLSGMTDMELDECEETTLHDVNIEEEMRRK-QAHAQEAYEEDED  403

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  404  MPGGAQRVQCAQQ  416



>ref|XP_006590333.1| PREDICTED: uncharacterized protein LOC100808604 isoform X1 [Glycine 
max]
 gb|KHN13055.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   341 bits (874),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 180/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVFVLQQKEH KFKRK +D+FVEH L+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKAEDLFVEHILSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQ+ FM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRSFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQ KALEAVLPP+P++++TDMELDECEETTL+DVN+EEE RRK QQQAQE Y+ED+D
Sbjct  346  LNPDQVKALEAVLPPKPSSQLTDMELDECEETTLHDVNMEEETRRK-QQQAQEAYDEDDD  404

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  405  MPGGAQRVQCAQQ  417



>gb|EMT20603.1| DnaJ protein-like protein [Aegilops tauschii]
Length=421

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 180/194 (93%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITFPGEADEAPDT+TGDIVFV+QQKEH KFKRKGDD+F EHT++LTEALC
Sbjct  228  VEKGMQHNQKITFPGEADEAPDTVTGDIVFVVQQKEHPKFKRKGDDLFYEHTISLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQ VLTHLDNRQLLIKS PGEVVKPD FKAI+DEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  288  GFQLVLTHLDNRQLLIKSNPGEVVKPDSFKAISDEGMPMYQRPFMKGKLYIHFTVEFPDS  347

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQCKALEAVLPP+PA+K+TDMELDECEETT++DVN+EEEMRRK    AQE Y+ED++
Sbjct  348  LAPDQCKALEAVLPPKPASKLTDMELDECEETTMHDVNMEEEMRRKAHAAAQEAYDEDDE  407

Query  330  M-HGGAQRVQCAQQ  292
            M  GGAQRVQCAQQ
Sbjct  408  MPGGGAQRVQCAQQ  421



>gb|KJB09149.1| hypothetical protein B456_001G126200 [Gossypium raimondii]
Length=416

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 179/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVFVLQQK+H KFKRKG+D+FVEHTL LTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKDHPKFKRKGEDLFVEHTLALTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFV+THLD RQLLIKS PGEVVKPD FKAINDEGMP+YQ+PF++GK+YIHFTV+FP++
Sbjct  285  GFQFVVTHLDGRQLLIKSIPGEVVKPDSFKAINDEGMPLYQRPFIKGKMYIHFTVEFPDS  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQ  ALEA+LPP+P + +TDMELDECEETTL+DVNIEEEMRRK QQ AQE Y+EDED
Sbjct  345  LNPDQIMALEAILPPKPTSHLTDMELDECEETTLHDVNIEEEMRRK-QQAAQEAYDEDED  403

Query  330  MHGGAQRVQCAQQ  292
             HGGAQRVQCAQQ
Sbjct  404  THGGAQRVQCAQQ  416



>gb|AAX95135.1| DnaJ protein, putative [Oryza sativa Japonica Group]
 gb|ABF97900.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
Length=416

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 184/194 (95%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITFPGEADEAPDT+TGDIVFVLQQK+H+KFKRKGDD+F EHTL+LTEALC
Sbjct  224  VEKGMQHNQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  284  GFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDE  334
            L P+QCKALEAVLPP+PA+++T+ME+DECEETT++DV NIEEEMRRK  Q AQE Y+ED+
Sbjct  344  LAPEQCKALEAVLPPKPASQLTEMEIDECEETTMHDVNNIEEEMRRK-AQAAQEAYDEDD  402

Query  333  DMHGGAQRVQCAQQ  292
            +M GGAQRVQCAQQ
Sbjct  403  EMPGGAQRVQCAQQ  416



>ref|NP_001050779.1| Os03g0648400 [Oryza sativa Japonica Group]
 gb|AAO72551.1| DNAJ-like protein [Oryza sativa Japonica Group]
 gb|AAU89194.1| DnaJ protein, putative [Oryza sativa Japonica Group]
 gb|ABF97899.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 gb|ABF97901.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12693.1| Os03g0648400 [Oryza sativa Japonica Group]
 gb|EAY94672.1| hypothetical protein OsI_16451 [Oryza sativa Indica Group]
 gb|EAZ27951.1| hypothetical protein OsJ_11911 [Oryza sativa Japonica Group]
 gb|ACA50510.1| DnaJ protein [Oryza sativa Japonica Group]
 dbj|BAG97073.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 184/194 (95%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITFPGEADEAPDT+TGDIVFVLQQK+H+KFKRKGDD+F EHTL+LTEALC
Sbjct  225  VEKGMQHNQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  285  GFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDE  334
            L P+QCKALEAVLPP+PA+++T+ME+DECEETT++DV NIEEEMRRK  Q AQE Y+ED+
Sbjct  345  LAPEQCKALEAVLPPKPASQLTEMEIDECEETTMHDVNNIEEEMRRK-AQAAQEAYDEDD  403

Query  333  DMHGGAQRVQCAQQ  292
            +M GGAQRVQCAQQ
Sbjct  404  EMPGGAQRVQCAQQ  417



>ref|NP_001234241.1| DnaJ-like protein [Solanum lycopersicum]
 gb|AAF28382.1|AF124139_1 DnaJ-like protein [Solanum lycopersicum]
Length=419

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 179/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVFVLQQKEH KFKRKGDD+FVEHTL+L E+LC
Sbjct  228  VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLDESLC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFM+GK+YIHFTVDFPE+
Sbjct  288  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMKGKMYIHFTVDFPES  347

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L  +QCK LEAVLPP+   +I+DMELDE EETTL+DVNIEEEMRRK QQ AQE  +ED+D
Sbjct  348  LHAEQCKNLEAVLPPKTKLQISDMELDEWEETTLHDVNIEEEMRRK-QQAAQEAQDEDDD  406

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  407  MPGGAQRVQCAQQ  419



>gb|AAD12055.1| DnaJ protein [Hevea brasiliensis]
Length=415

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 178/193 (92%), Gaps = 2/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEH KFKRKGDD+ V+HTL+LTEALC
Sbjct  225  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLIVDHTLSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
              QF+LTHLD   LLIKSQPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF+VDFP++
Sbjct  285  ASQFILTHLDG-DLLIKSQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFSVDFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQCKALEAVLP R + +++DMELDECEETTL+DVN +EEMRRK QQQAQE Y+ED+D
Sbjct  344  LPPDQCKALEAVLPSRTSVQLSDMELDECEETTLHDVNFDEEMRRK-QQQAQEAYDEDDD  402

Query  330  MHGGAQRVQCAQQ  292
            MHGG QRVQCAQQ
Sbjct  403  MHGGGQRVQCAQQ  415



>ref|XP_009789005.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=418

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 181/194 (93%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQK+H +FKRKGDD+FV+HTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKDHPRFKRKGDDLFVDHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF V+FP++
Sbjct  286  GFQFILTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFVVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+Q KALEA+LPPRP ++ TDMELDECEET+L+DVNIEEEMRRKQ  Q QE Y+ED++
Sbjct  346  LSPEQVKALEAILPPRPQSQYTDMELDECEETSLHDVNIEEEMRRKQAAQ-QEAYDEDDE  404

Query  330  MH-GGAQRVQCAQQ  292
            MH GG QRVQCAQQ
Sbjct  405  MHGGGGQRVQCAQQ  418



>ref|XP_004506241.1| PREDICTED: dnaJ protein homolog ANJ1-like [Cicer arietinum]
Length=418

 Score =   339 bits (869),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN Q+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRK +D+FVEHTL+LTEALC
Sbjct  226  VEKGMQNSQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTV+FPET
Sbjct  286  GFQFALTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVEFPET  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQ K LEAVLP +P++++TDMELDECEETTL+DVN+EEE RRKQ QQ QE Y+ED+D
Sbjct  346  LSLDQVKGLEAVLPAKPSSQLTDMELDECEETTLHDVNMEEETRRKQHQQQQEAYDEDDD  405

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  406  MPGGAQRVQCAQQ  418



>ref|XP_007132506.1| hypothetical protein PHAVU_011G100000g [Phaseolus vulgaris]
 gb|ESW04500.1| hypothetical protein PHAVU_011G100000g [Phaseolus vulgaris]
Length=418

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVFVLQQKEH KF+RK +D+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFRRKAEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQ+PFM+GKLY+HFTV+FP+ 
Sbjct  286  GFQFVLTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYLHFTVEFPDF  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+Q KALEAVLPP+  +++TDMELDECEETTL+DVN+E+E RR+QQQ AQE YEED+D
Sbjct  346  LNPEQVKALEAVLPPKQPSQLTDMELDECEETTLHDVNMEDETRRRQQQAAQEAYEEDDD  405

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  406  MPGGAQRVQCAQQ  418



>ref|XP_008385581.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=420

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 181/194 (93%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+T+TGDIVFV+QQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPETVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHF V+FPE+
Sbjct  287  GFQFVLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFNVEFPES  346

Query  510  LTPDQCKALEAVLPPRPA-TKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDE  334
            L+P+Q KALEA LP +P+ +++TDME+DECEETTL+DVN+EEEMRRKQQQ  QE Y+ED+
Sbjct  347  LSPEQVKALEAALPGKPSXSQLTDMEVDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDD  406

Query  333  DMHGGAQRVQCAQQ  292
            DM GGAQRVQCAQQ
Sbjct  407  DMPGGAQRVQCAQQ  420



>gb|AHA84223.1| seed maturation protein PM37 [Phaseolus vulgaris]
Length=418

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 180/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVFVLQQKEH KF+RK +D+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFRRKAEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQ+PFM+GKLY+HFTV+FP+ 
Sbjct  286  GFQFVLTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYLHFTVEFPDF  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+Q KALEAVLPP+  +++TDMELDECEETTL+DVN+E+E RR+QQQ AQE YEED+D
Sbjct  346  LNPEQVKALEAVLPPKQPSQLTDMELDECEETTLHDVNMEDETRRRQQQAAQEAYEEDDD  405

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  406  MPGGAQRVQCAQQ  418



>emb|CDP15561.1| unnamed protein product [Coffea canephora]
Length=417

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 181/194 (93%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT TGDIVFV+QQKEH K KRK DDIFVEHTL+LTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPDTATGDIVFVVQQKEHPKLKRKHDDIFVEHTLSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKS+PGEV+KPDQFKAI+DEGMPMYQ+PFMRGK+YIHFTV+FP++
Sbjct  285  GFQFILTHLDGRQLLIKSKPGEVIKPDQFKAIDDEGMPMYQRPFMRGKMYIHFTVEFPDS  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KALE +LPP+P +++TDMELDECEETTL+DVNIEEEMRRKQ  Q QE YEED+D
Sbjct  345  LSPDQVKALEGILPPKPQSQLTDMELDECEETTLHDVNIEEEMRRKQAAQ-QEAYEEDDD  403

Query  330  MH-GGAQRVQCAQQ  292
            MH GGAQRVQCAQQ
Sbjct  404  MHGGGAQRVQCAQQ  417



>ref|XP_008359180.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=424

 Score =   338 bits (866),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 181/194 (93%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+T+TGDIVFV+QQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  231  VEKGMQNGQKITFPGEADEAPETVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALC  290

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHF V+FPE+
Sbjct  291  GFQFVLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFNVEFPES  350

Query  510  LTPDQCKALEAVLPPRPA-TKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDE  334
            L+P+Q KALEA LP +P+ +++TDME+DECEETTL+DVN+EEEMRRKQQQ  QE Y+ED+
Sbjct  351  LSPEQVKALEAALPGKPSXSQLTDMEVDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDD  410

Query  333  DMHGGAQRVQCAQQ  292
            DM GGAQRVQCAQQ
Sbjct  411  DMPGGAQRVQCAQQ  424



>ref|XP_006650350.1| PREDICTED: dnaJ protein homolog 2-like [Oryza brachyantha]
Length=417

 Score =   338 bits (866),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 183/194 (94%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITFPGEADEAPDT+TGDIVFVLQQK+H+KFKRKGDD+F EHTL+LTEALC
Sbjct  225  VEKGMQHNQKITFPGEADEAPDTVTGDIVFVLQQKDHSKFKRKGDDLFYEHTLSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  285  GFQFVLTHLDNRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDE  334
            L P+QCKALEAVLP +PA+++T+ME+DECEETT++DV NIEEEMRRK  Q AQE Y+ED+
Sbjct  345  LAPEQCKALEAVLPAKPASQLTEMEIDECEETTMHDVSNIEEEMRRK-AQAAQEAYDEDD  403

Query  333  DMHGGAQRVQCAQQ  292
            +M GGAQRVQCAQQ
Sbjct  404  EMPGGAQRVQCAQQ  417



>ref|XP_011090296.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=417

 Score =   337 bits (865),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 178/193 (92%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+L+HLD RQLLIKSQPGEVVKPD +KAINDEGMPMYQ+PFM+GKLYIHF VDFP++
Sbjct  286  GFQFILSHLDGRQLLIKSQPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFNVDFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT DQ  AL  +LPP+  +++TDMELDECEETTL+DVNIEEEMRRKQ Q  QE Y+EDE+
Sbjct  346  LTADQVDALAKILPPKAQSQLTDMELDECEETTLHDVNIEEEMRRKQTQH-QEAYDEDEE  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>ref|XP_003561819.1| PREDICTED: dnaJ protein homolog [Brachypodium distachyon]
Length=420

 Score =   337 bits (865),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 180/195 (92%), Gaps = 2/195 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITFPGEADEAPDT+TGDIVFV+QQKEH KFKRKGDD+F EHTL+LTEALC
Sbjct  226  VEKGMQHNQKITFPGEADEAPDTVTGDIVFVVQQKEHPKFKRKGDDLFYEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQ VLTHLDNRQLLIKS PGE+VKPD FKAI+DEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQLVLTHLDNRQLLIKSNPGEIVKPDSFKAISDEGMPMYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYEEDE  334
            L P+QCKALEAVLPP+P +K+TDMELDECEETTL+DV N+EEEMRRK Q  AQE Y+ED+
Sbjct  346  LAPEQCKALEAVLPPKPVSKLTDMELDECEETTLHDVNNMEEEMRRKAQAAAQEAYDEDD  405

Query  333  DM-HGGAQRVQCAQQ  292
            DM  GGAQRVQCAQQ
Sbjct  406  DMPGGGAQRVQCAQQ  420



>ref|XP_003596916.1| DnaJ [Medicago truncatula]
 gb|AES67167.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=417

 Score =   337 bits (864),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 179/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FPE+
Sbjct  286  GFQFALTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPES  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT DQ KALE +LP RP +++TDMELDECEETTL+DVNIEEE RR+QQ Q QE Y+ED++
Sbjct  346  LTLDQVKALETILPARPVSQLTDMELDECEETTLHDVNIEEETRRRQQAQ-QEAYDEDDE  404

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  405  MPGGAQRVQCAQQ  417



>gb|AFK37703.1| unknown [Medicago truncatula]
Length=417

 Score =   337 bits (864),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 179/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FPE+
Sbjct  286  GFQFALTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPES  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT DQ KALE +LP RP +++TDMELDECEETTL+DVNIEEE RR+QQ Q QE Y+ED++
Sbjct  346  LTLDQVKALETILPARPVSQLTDMELDECEETTLHDVNIEEETRRRQQAQ-QEAYDEDDE  404

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  405  MPGGAQRVQCAQQ  417



>gb|ACJ84348.1| unknown [Medicago truncatula]
 gb|AFK39964.1| unknown [Medicago truncatula]
Length=256

 Score =   331 bits (848),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 177/193 (92%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  65   VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  124

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF  THLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV FPE+
Sbjct  125  GFQFAPTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVVFPES  184

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT DQ KALE +LP RP +++TDMELDECEETTL+DVNIEEE RR+QQ Q QE Y+ED++
Sbjct  185  LTLDQVKALETILPARPVSQLTDMELDECEETTLHDVNIEEETRRRQQAQ-QEAYDEDDE  243

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  244  MPGGAQRVQCAQQ  256



>ref|XP_012066359.1| PREDICTED: dnaJ protein homolog [Jatropha curcas]
 gb|KDP42967.1| hypothetical protein JCGZ_23909 [Jatropha curcas]
Length=418

 Score =   336 bits (862),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADEAPDTITGDIVFVLQQKEH KFKRKGDD+ VEH L+LTE+LC
Sbjct  226  VEKGMQHGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLIVEHNLSLTESLC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+G+LYIHF V+FP++
Sbjct  286  GFQFVLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGRLYIHFNVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT DQ KALEA+LPPRP++ +TDMELDECEETTL+DVN+EEEMRRK Q+  QE Y+ED+D
Sbjct  346  LTLDQVKALEAILPPRPSSMLTDMELDECEETTLHDVNMEEEMRRKDQRSQQEAYDEDDD  405

Query  330  MHGGAQRVQCAQQ  292
            M  G QRVQCAQQ
Sbjct  406  MPSGGQRVQCAQQ  418



>gb|KJB35429.1| hypothetical protein B456_006G117100 [Gossypium raimondii]
Length=444

 Score =   337 bits (863),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 184/220 (84%), Gaps = 27/220 (12%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+T+TGDIVFVLQQK+H KFKRKG+D+F+EHTL+LTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPETVTGDIVFVLQQKDHPKFKRKGEDLFLEHTLSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQF---------------------------KAIN  592
            GFQFV+THLD RQLLIKS PGEVVKP +F                           KAIN
Sbjct  285  GFQFVITHLDGRQLLIKSNPGEVVKPGKFLEVSILKGIFYQLLGFKFVKLVIPDSCKAIN  344

Query  591  DEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKITDMELDECEETT  412
            DEGMP+YQ+PFM+GKLYI FTV+FP++L+PDQ KALEA+LPP+P ++++DMELDECEETT
Sbjct  345  DEGMPLYQRPFMKGKLYIQFTVEFPDSLSPDQVKALEAILPPKPTSQLSDMELDECEETT  404

Query  411  LYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  292
            LYDVNIEEEMRRKQQQ AQE YEEDEDMHGGAQRVQCAQQ
Sbjct  405  LYDVNIEEEMRRKQQQAAQEAYEEDEDMHGGAQRVQCAQQ  444



>ref|XP_007015641.1| DNAJ isoform 2 [Theobroma cacao]
 gb|EOY33260.1| DNAJ isoform 2 [Theobroma cacao]
Length=414

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 180/193 (93%), Gaps = 2/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADE PDTITGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  224  VEKGMQHGQKITFPGEADEVPDTITGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS  GE+VKPD FKAINDEGMP+YQ+PFM+GKLYIHFTVDFP++
Sbjct  284  GFQFVLTHLDGRQLLIKSNSGEIVKPDSFKAINDEGMPLYQRPFMKGKLYIHFTVDFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ +ALEA+LPP+P +++TDMELDECEETTL+DVNIEEEMRRK QQ AQE  +E E+
Sbjct  344  LSPDQVQALEAILPPKPTSQLTDMELDECEETTLHDVNIEEEMRRK-QQAAQETLDE-EE  401

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  402  MHGGAQRVQCAQQ  414



>ref|XP_009368443.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=420

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 180/194 (93%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+T+TGDIVFV+QQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPETVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQ+VLTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHF V+FPE+
Sbjct  287  GFQYVLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFNVEFPES  346

Query  510  LTPDQCKALEAVLPPR-PATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDE  334
            L+P+Q KALEA LP +  A+++TDME+DECEETTL+DVN+EEEMRRKQQQ  QE Y+ED+
Sbjct  347  LSPEQVKALEAALPGKASASQLTDMEVDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDD  406

Query  333  DMHGGAQRVQCAQQ  292
            DM GGAQRVQCAQQ
Sbjct  407  DMPGGAQRVQCAQQ  420



>gb|AGY48887.1| MIP1.4b [Nicotiana benthamiana]
Length=418

 Score =   335 bits (860),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 180/194 (93%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQK+H +FKRKGDD+FV+HTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKDHPRFKRKGDDLFVDHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF++THLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHF V+FP++
Sbjct  286  GFQFIITHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFVVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+Q K LEA+LPPRP ++ TDMELDECEET+L+DVNIEEEMRRKQ  Q QE Y+ED++
Sbjct  346  LSPEQVKTLEAILPPRPQSQYTDMELDECEETSLHDVNIEEEMRRKQAAQ-QEAYDEDDE  404

Query  330  MH-GGAQRVQCAQQ  292
            MH GG QRV+CAQQ
Sbjct  405  MHGGGGQRVECAQQ  418



>gb|AFK46626.1| unknown [Medicago truncatula]
Length=256

 Score =   329 bits (844),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 176/193 (91%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  65   VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  124

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF  THLD+RQLLIKS PGEVVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV FPE+
Sbjct  125  GFQFAPTHLDSRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVVFPES  184

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT DQ KALE +LP RP +++TDMELDECEETTL+DVNIEEE RR+QQ Q QE Y+ED++
Sbjct  185  LTLDQVKALETILPARPVSQLTDMELDECEETTLHDVNIEEETRRRQQAQ-QEAYDEDDE  243

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQC QQ
Sbjct  244  MPGGAQRVQCGQQ  256



>gb|AFW67420.1| putative dnaJ chaperone family protein [Zea mays]
Length=415

 Score =   335 bits (859),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 176/193 (91%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT TGDI+FVLQQKEH KFKRKGDD+F EHTL LTE+LC
Sbjct  224  VEKGMQNGQKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFYEHTLILTESLC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++
Sbjct  284  GFQFVLTHLDNRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCK LEAVLP +P ++ TDMELDECEET  YDVNIEEEMRR+QQQ  QE Y+ED+D
Sbjct  344  LSPEQCKTLEAVLPLKPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQH-QEAYDEDDD  402

Query  330  MHGGAQRVQCAQQ  292
            + GG QRVQCAQQ
Sbjct  403  VPGGGQRVQCAQQ  415



>gb|AFW67421.1| putative dnaJ chaperone family protein [Zea mays]
Length=417

 Score =   335 bits (859),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 176/193 (91%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT TGDI+FVLQQKEH KFKRKGDD+F EHTL LTE+LC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFYEHTLILTESLC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHF+V+FP++
Sbjct  286  GFQFVLTHLDNRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFSVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCK LEAVLP +P ++ TDMELDECEET  YDVNIEEEMRR+QQQ  QE Y+ED+D
Sbjct  346  LSPEQCKTLEAVLPLKPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQH-QEAYDEDDD  404

Query  330  MHGGAQRVQCAQQ  292
            + GG QRVQCAQQ
Sbjct  405  VPGGGQRVQCAQQ  417



>gb|AFK38714.1| unknown [Lotus japonicus]
Length=247

 Score =   328 bits (842),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/193 (80%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN Q+ITFPGEADEAPDT TGDIVFVLQ KEH KFKRK +D+FVEHTL+LTEALC
Sbjct  55   VEKGMQNQQKITFPGEADEAPDTTTGDIVFVLQLKEHPKFKRKAEDLFVEHTLSLTEALC  114

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  115  GFQFVLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  174

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+Q K LEA LP +P++++TDMELDECEETTL+DVN+EEE RRK+QQ  QE Y+ED+D
Sbjct  175  LNPNQVKDLEAALPAKPSSQLTDMELDECEETTLHDVNMEEENRRKEQQAQQEAYDEDDD  234

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  235  MPGGAQRVQCAQQ  247



>ref|XP_002313505.1| seed maturation protein PM37 [Populus trichocarpa]
 gb|EEE87460.1| seed maturation protein PM37 [Populus trichocarpa]
Length=415

 Score =   335 bits (858),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 178/193 (92%), Gaps = 2/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL LTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLPLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGE VKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP++
Sbjct  285  GFQFVLTHLDGRQLLIKSNPGEAVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDS  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTPDQ KA+E +L PRP++++TDMELDECEETTL+DVNIEEEMRRKQQ + +E Y+EDE+
Sbjct  345  LTPDQVKAIETIL-PRPSSQLTDMELDECEETTLHDVNIEEEMRRKQQAR-EEAYDEDEE  402

Query  330  MHGGAQRVQCAQQ  292
            M  G QRVQCAQQ
Sbjct  403  MPHGGQRVQCAQQ  415



>gb|AFK48086.1| unknown [Medicago truncatula]
Length=227

 Score =   328 bits (840),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN Q+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRK +D+FVEHTL+LTEALC
Sbjct  35   VEKGMQNSQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALC  94

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FP+T
Sbjct  95   GFQFVLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDT  154

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQ K LEAVLP +P++++TDME+DECEETTL+DVN+EEE RRKQQQQ QE Y+ED+D
Sbjct  155  LSLDQVKGLEAVLPAKPSSQLTDMEIDECEETTLHDVNMEEENRRKQQQQQQEAYDEDDD  214

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  215  MPGGAQRVQCAQQ  227



>gb|ADK35105.1| DnaJ-like protein 1 [Astragalus sinicus]
Length=236

 Score =   328 bits (840),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 179/194 (92%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVF+LQQKEH KF+RKG+D+FVEHTL+LTE+LC
Sbjct  44   VEKGMQNGQKITFPGEADEAPDTVTGDIVFILQQKEHPKFRRKGEDLFVEHTLSLTESLC  103

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  104  GFQFVLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  163

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L  DQ K+LE +LPPRP +++TDMELDECEETTL+DVNIEEE RR+QQ Q QE Y+ED+D
Sbjct  164  LGVDQVKSLETILPPRPVSQLTDMELDECEETTLHDVNIEEESRRRQQAQ-QEAYDEDDD  222

Query  330  M-HGGAQRVQCAQQ  292
            M  GGAQRV+CAQQ
Sbjct  223  MPGGGAQRVRCAQQ  236



>ref|NP_001240264.1| uncharacterized protein LOC100818805 [Glycine max]
 gb|ACU23708.1| unknown [Glycine max]
Length=417

 Score =   334 bits (856),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 179/193 (93%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRK DD+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKADDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD+RQLLIKS PGEVVKP+ FKAINDEGMP YQ+ F++GKLYIHF+V+FP+T
Sbjct  286  GFQFVLTHLDSRQLLIKSNPGEVVKPESFKAINDEGMPNYQRHFLKGKLYIHFSVEFPDT  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQ KALEAVLP +P ++++DMELDECEETTL+DVN+EEE RR+QQ Q QE Y+EDED
Sbjct  346  LSLDQVKALEAVLPSKPTSQLSDMELDECEETTLHDVNMEEETRRRQQAQ-QEAYDEDED  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>gb|EYU37228.1| hypothetical protein MIMGU_mgv1a006942mg [Erythranthe guttata]
Length=425

 Score =   334 bits (856),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 159/195 (82%), Positives = 178/195 (91%), Gaps = 2/195 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ++TFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  231  VEKGMQHGQKVTFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALC  290

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLDNRQLLIKS+ GEV+KPDQFKAINDEGMPMYQK FM+GKLYI F+VDFPE+
Sbjct  291  GFQFILTHLDNRQLLIKSESGEVIKPDQFKAINDEGMPMYQKSFMKGKLYIQFSVDFPES  350

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDE  334
            L P+Q KA+  VLP +   ++TDMELDECEETTL+DVN+EEEMRRKQ Q AQE Y EED+
Sbjct  351  LNPEQSKAIGTVLPSKSTNQLTDMELDECEETTLHDVNMEEEMRRKQHQHAQEAYDEEDD  410

Query  333  DMH-GGAQRVQCAQQ  292
            DMH GGAQRVQCAQQ
Sbjct  411  DMHGGGAQRVQCAQQ  425



>gb|EYU36023.1| hypothetical protein MIMGU_mgv1a007093mg [Erythranthe guttata]
Length=420

 Score =   334 bits (856),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 178/194 (92%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ++TFPGEADEAPDTITGDIVFVLQQKEH KFKRKGDD+F+EHTL L EALC
Sbjct  227  VEKGMQNGQKVTFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFIEHTLPLAEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVL+HLD RQLLIKSQPGEVVKPD +KAINDEGMPMYQ+PFM+GKLYIHF V+FP++
Sbjct  287  GFQFVLSHLDGRQLLIKSQPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFNVEFPDS  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDE  334
            L+ +Q  ALE +LPP+P +++TDME+DECEETTL+DVNIE+EMRRKQ  + QE Y +EDE
Sbjct  347  LSAEQVAALEKILPPKPQSELTDMEVDECEETTLHDVNIEDEMRRKQAHRQQEAYDDEDE  406

Query  333  DMHGGAQRVQCAQQ  292
            DMHGGAQRVQCAQQ
Sbjct  407  DMHGGAQRVQCAQQ  420



>ref|XP_004291531.1| PREDICTED: dnaJ protein homolog [Fragaria vesca subsp. vesca]
Length=423

 Score =   333 bits (854),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 177/194 (91%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVF++QQKEH KFKRK DD+FVEH+L+LT+ALC
Sbjct  230  VEKGMQNGQKITFPGEADEAPDTVTGDIVFIIQQKEHPKFKRKMDDLFVEHSLSLTDALC  289

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVL HLD RQLLIKS PGEVVKPD FKA+NDEGMPMYQ+PFM+GKLYIHF+VDFPET
Sbjct  290  GFQFVLNHLDGRQLLIKSNPGEVVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVDFPET  349

Query  510  LTPDQCKALEAVLPPRPAT-KITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDE  334
            L+P+Q KALEA LP R ++ ++TDMELDECEETTL+DVN+EEEMRRKQ Q   E Y+ED+
Sbjct  350  LSPEQVKALEAALPSRASSQQLTDMELDECEETTLHDVNMEEEMRRKQHQAHSEAYDEDD  409

Query  333  DMHGGAQRVQCAQQ  292
            DM GGAQRVQCAQQ
Sbjct  410  DMPGGAQRVQCAQQ  423



>ref|XP_009592511.1| PREDICTED: dnaJ protein homolog [Nicotiana tomentosiformis]
Length=418

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 178/194 (92%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVFVLQQK+H +FKRKGDD+FV+HTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKDHPRFKRKGDDLFVDHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF++THLD RQLLIKS PGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYI F V+FP++
Sbjct  286  GFQFIMTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIRFVVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L  +Q KALEA+LPPRP ++ TDMELDECEET+L+DVNIEEEMRRKQ  Q QE Y+ED++
Sbjct  346  LNTEQVKALEAILPPRPQSQYTDMELDECEETSLHDVNIEEEMRRKQAAQ-QEAYDEDDE  404

Query  330  MH-GGAQRVQCAQQ  292
            MH GG QRVQCAQQ
Sbjct  405  MHGGGGQRVQCAQQ  418



>gb|AHA84264.1| seed maturation protein PM37 [Phaseolus vulgaris]
Length=418

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVFVLQQKEH KF+RK +D+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTITGDIVFVLQQKEHPKFRRKAEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD+RQL IK  PGEVVKPD +KAINDEGMPMYQ+PFM+GKLY HFTV+FP+ 
Sbjct  286  GFQFVLTHLDSRQLFIKFNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYFHFTVEFPDF  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L P+Q KALEAVLPP+  +++TDMELDECEETTL+DVN+E+E RR+QQQ AQE YEED+D
Sbjct  346  LNPEQVKALEAVLPPKQPSQLTDMELDECEETTLHDVNMEDETRRRQQQAAQEAYEEDDD  405

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  406  MPGGAQRVQCAQQ  418



>gb|KHN17991.1| DnaJ protein like [Glycine soja]
Length=417

 Score =   333 bits (853),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 177/193 (92%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRK DD+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKADDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVL HLD RQLLIKS PGEVVKPD +KAINDEGMP YQ+ F++GKLYIHF+V+FP+T
Sbjct  286  GFQFVLAHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPNYQRHFLKGKLYIHFSVEFPDT  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQ KALEA LP +P +++TDMELDECEETTL+DVN+EEE+RR+QQ Q QE YEEDED
Sbjct  346  LSLDQVKALEATLPLKPTSQLTDMELDECEETTLHDVNMEEEIRRRQQAQ-QEAYEEDED  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>ref|XP_008230416.1| PREDICTED: dnaJ protein homolog [Prunus mume]
Length=418

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 155/194 (80%), Positives = 180/194 (93%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+I+FPGEADEAP+T+TGDIVF++ QKEH KFKRKG+D+FVEH+L+LTEALC
Sbjct  226  VEKGMQSGQKISFPGEADEAPETVTGDIVFIIHQKEHPKFKRKGEDLFVEHSLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD FKAINDEGMP+YQ+PFM+GKLYIHF VDFPE+
Sbjct  286  GFQFVLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPLYQRPFMKGKLYIHFNVDFPES  345

Query  510  LTPDQCKALEAVLPPRP-ATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDE  334
            L PDQ KALEA+LP +P A+++TDME+DECEETTL+DVN+EEEMRRKQQ QA E Y+ED+
Sbjct  346  LNPDQVKALEAILPSKPGASQLTDMEVDECEETTLHDVNMEEEMRRKQQAQA-EAYDEDD  404

Query  333  DMHGGAQRVQCAQQ  292
            DM GGAQRVQCAQQ
Sbjct  405  DMPGGAQRVQCAQQ  418



>ref|XP_009336413.1| PREDICTED: dnaJ protein homolog [Pyrus x bretschneideri]
Length=420

 Score =   332 bits (851),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 178/194 (92%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+T+TGDIVFV+QQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPETVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD FKAINDEGMP+YQ+ FM+GKLYIHF V+FPE+
Sbjct  287  GFQFVLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPIYQRSFMKGKLYIHFNVEFPES  346

Query  510  LTPDQCKALEAVLPPRP-ATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDE  334
            L P+Q KALEA LP +P A+++ DME+DECEETTL+DVN+EEEMRRKQQQ  QE Y+ED+
Sbjct  347  LNPEQVKALEAALPGKPSASQLMDMEVDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDD  406

Query  333  DMHGGAQRVQCAQQ  292
            DM GGAQRVQCAQQ
Sbjct  407  DMPGGAQRVQCAQQ  420



>ref|XP_008361658.1| PREDICTED: dnaJ protein homolog [Malus domestica]
 ref|XP_008355256.1| PREDICTED: dnaJ protein homolog [Malus domestica]
Length=420

 Score =   332 bits (851),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 177/194 (91%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAP+T+TGDIVFV+QQKEH KFKRKG+D+FVEHTL LTEALC
Sbjct  227  VEKGMQNGQKITFPGEADEAPETVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLPLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHF V+FPE+
Sbjct  287  GFQFVLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFNVEFPES  346

Query  510  LTPDQCKALEAVLPPRP-ATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDE  334
            L P+Q KALEA LP +P A+++TDME+ ECEETTL+DVN+EEEMRRKQ Q  QE Y+ED+
Sbjct  347  LNPEQVKALEAALPGKPSASQLTDMEVXECEETTLHDVNMEEEMRRKQLQAQQEAYDEDD  406

Query  333  DMHGGAQRVQCAQQ  292
            DM GGAQRVQCAQQ
Sbjct  407  DMPGGAQRVQCAQQ  420



>ref|XP_002515865.1| Chaperone protein dnaJ, putative [Ricinus communis]
 gb|EEF46534.1| Chaperone protein dnaJ, putative [Ricinus communis]
Length=418

 Score =   332 bits (850),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADEAPDTITGDIVFVLQQK+H KFKRK DD+ V+H L+LTEALC
Sbjct  226  VEKGMQHGQKITFPGEADEAPDTITGDIVFVLQQKDHPKFKRKEDDLVVDHNLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKP  FKAINDEGMPMYQ+PFM+GKLYIHF VDFP++
Sbjct  286  GFQFVLTHLDGRQLLIKSTPGEVVKPGSFKAINDEGMPMYQRPFMKGKLYIHFNVDFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LT DQ KALEA+LP R +T++TDMELDECEETTL+DVN+EEEMRRKQQQ  QE Y+ED+D
Sbjct  346  LTADQVKALEAILPLRSSTQLTDMELDECEETTLHDVNMEEEMRRKQQQAQQEAYDEDDD  405

Query  330  MHGGAQRVQCAQQ  292
            M  GAQRVQCAQQ
Sbjct  406  MPSGAQRVQCAQQ  418



>ref|XP_008670357.1| PREDICTED: dnaJ protein homolog 2-like [Zea mays]
Length=267

 Score =   326 bits (835),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 172/193 (89%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT TGDI+FVLQQKEH KFKRKGDD+F +HTLTLTE+LC
Sbjct  76   VEKGMQNGQKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFHKHTLTLTESLC  135

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVL HLDNRQLLIKS PGEVVKP  FK INDEGMPMYQ PFM+GKLYIHF+V+FP +
Sbjct  136  GFQFVLAHLDNRQLLIKSNPGEVVKPGSFKTINDEGMPMYQWPFMKGKLYIHFSVEFPNS  195

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALE VLPP+P ++ TDMELDECEET  YDVNIEEEMRR+QQQ  QE Y+ED+D
Sbjct  196  LSPEQCKALEVVLPPKPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQH-QEAYDEDDD  254

Query  330  MHGGAQRVQCAQQ  292
            +  G QRVQCAQQ
Sbjct  255  VPSGGQRVQCAQQ  267



>tpg|DAA40640.1| TPA: putative dnaJ chaperone family protein [Zea mays]
Length=301

 Score =   327 bits (838),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 172/193 (89%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT TGDI+FVLQQKEH KFKRKGDD+F +HTLTLTE+LC
Sbjct  110  VEKGMQNGQKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFHKHTLTLTESLC  169

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVL HLDNRQLLIKS PGEVVKP  FK INDEGMPMYQ PFM+GKLYIHF+V+FP +
Sbjct  170  GFQFVLAHLDNRQLLIKSNPGEVVKPGSFKTINDEGMPMYQWPFMKGKLYIHFSVEFPNS  229

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALE VLPP+P ++ TDMELDECEET  YDVNIEEEMRR+QQQ  QE Y+ED+D
Sbjct  230  LSPEQCKALEVVLPPKPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQH-QEAYDEDDD  288

Query  330  MHGGAQRVQCAQQ  292
            +  G QRVQCAQQ
Sbjct  289  VPSGGQRVQCAQQ  301



>ref|XP_003540271.1| PREDICTED: dnaJ protein homolog [Glycine max]
Length=417

 Score =   331 bits (848),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 176/193 (91%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRK DD+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKADDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVL HLD RQLLIKS PGEVVKPD +KAINDEGMP YQ+ F++GKLYIHF+V+FP+T
Sbjct  286  GFQFVLAHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPNYQRHFLKGKLYIHFSVEFPDT  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQ KALE  LP +P +++TDMELDECEETTL+DVN+EEE+RR+QQ Q QE YEEDED
Sbjct  346  LSLDQVKALETTLPLKPTSQLTDMELDECEETTLHDVNMEEEIRRRQQAQ-QEAYEEDED  404

Query  330  MHGGAQRVQCAQQ  292
            MHGGAQRVQCAQQ
Sbjct  405  MHGGAQRVQCAQQ  417



>ref|XP_007205259.1| hypothetical protein PRUPE_ppa006299mg [Prunus persica]
 gb|EMJ06458.1| hypothetical protein PRUPE_ppa006299mg [Prunus persica]
Length=418

 Score =   330 bits (847),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 180/194 (93%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+I+FPGEADEAP+T+TGDIVF++ QKEH KFKRKG+D+FVEH+L+LTEALC
Sbjct  226  VEKGMQSGQKISFPGEADEAPETVTGDIVFIIHQKEHPKFKRKGEDLFVEHSLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD FKAINDEGMP+YQ+PFM+GKLYIHF VDFPE+
Sbjct  286  GFQFVLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPLYQRPFMKGKLYIHFNVDFPES  345

Query  510  LTPDQCKALEAVLPPRP-ATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDE  334
            L P+Q KALEA+LP +P A+++TDME+DECEETTL+DVN+EEEMRRKQQ QA E Y+ED+
Sbjct  346  LNPEQVKALEAILPSKPGASQLTDMEVDECEETTLHDVNMEEEMRRKQQAQA-EAYDEDD  404

Query  333  DMHGGAQRVQCAQQ  292
            DM GGAQRVQCAQQ
Sbjct  405  DMPGGAQRVQCAQQ  418



>gb|AFW89867.1| putative dnaJ chaperone family protein [Zea mays]
Length=344

 Score =   327 bits (838),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT TGDI+FVLQQKEH KFKRKGDD+F +HTLTLTE+LC
Sbjct  153  VEKGMQNGQKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFHKHTLTLTESLC  212

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVL HLDNRQLLIKS PGEVVKP  FK INDEGMPMYQ PFM+GKLYIHF+V+FP++
Sbjct  213  GFQFVLAHLDNRQLLIKSNPGEVVKPGSFKTINDEGMPMYQWPFMKGKLYIHFSVEFPDS  272

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALE VLPP+P ++ TDMELDECEET  YDVNI+EEMRR+QQQ  QE Y+ED+D
Sbjct  273  LSPEQCKALEVVLPPKPVSQYTDMELDECEETMPYDVNIKEEMRRRQQQH-QEAYDEDDD  331

Query  330  MHGGAQRVQCAQQ  292
            +  G QRVQCAQQ
Sbjct  332  VPSGGQRVQCAQQ  344



>ref|XP_008661261.1| PREDICTED: dnaJ protein homolog 2-like [Zea mays]
Length=312

 Score =   326 bits (835),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT TGDI+FVLQQKEH KFKRKGDD+F +HTLTLTE+LC
Sbjct  121  VEKGMQNGQKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFHKHTLTLTESLC  180

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVL HLDNRQLLIKS PGEVVKP  FK INDEGMPMYQ PFM+GKLYIHF+V+FP++
Sbjct  181  GFQFVLAHLDNRQLLIKSNPGEVVKPGSFKTINDEGMPMYQWPFMKGKLYIHFSVEFPDS  240

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALE VLPP+P ++ TDMELDECEET  YDVNI+EEMRR+QQQ  QE Y+ED+D
Sbjct  241  LSPEQCKALEVVLPPKPVSQYTDMELDECEETMPYDVNIKEEMRRRQQQH-QEAYDEDDD  299

Query  330  MHGGAQRVQCAQQ  292
            +  G QRVQCAQQ
Sbjct  300  VPSGGQRVQCAQQ  312



>ref|XP_003605981.1| DnaJ [Medicago truncatula]
Length=413

 Score =   329 bits (843),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN Q+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRK +D+FVEHTL+LTEALC
Sbjct  221  VEKGMQNSQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALC  280

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FP+T
Sbjct  281  GFQFVLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDT  340

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQ K LEAVLP +P++++TDME+DECEETTL+DVN+EEE RRKQQQQ QE Y+ED+D
Sbjct  341  LSLDQVKGLEAVLPAKPSSQLTDMEIDECEETTLHDVNMEEENRRKQQQQQQEAYDEDDD  400

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  401  MPGGAQRVQCAQQ  413



>ref|XP_003605980.1| DnaJ [Medicago truncatula]
 gb|AES88177.1| DnaJ-class molecular chaperone [Medicago truncatula]
Length=416

 Score =   329 bits (843),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 179/193 (93%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN Q+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRK +D+FVEHTL+LTEALC
Sbjct  224  VEKGMQNSQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FP+T
Sbjct  284  GFQFVLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDT  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQ K LEAVLP +P++++TDME+DECEETTL+DVN+EEE RRKQQQQ QE Y+ED+D
Sbjct  344  LSLDQVKGLEAVLPAKPSSQLTDMEIDECEETTLHDVNMEEENRRKQQQQQQEAYDEDDD  403

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  404  MPGGAQRVQCAQQ  416



>ref|XP_006650701.1| PREDICTED: dnaJ protein homolog 2-like [Oryza brachyantha]
Length=418

 Score =   328 bits (842),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 166/194 (86%), Positives = 182/194 (94%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS+PGEVVKPD FKA+NDEGMPMYQ+PFM+GKLYIHF+V+FP++
Sbjct  285  GFQFVLTHLDNRQLLIKSKPGEVVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVEFPDS  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQCKALE VLPPRP ++ TDMELDECEET  YDVNIEEEMRR+QQQQ QE Y+EDED
Sbjct  345  LNPDQCKALETVLPPRPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQQQQEAYDEDED  404

Query  330  MH-GGAQRVQCAQQ  292
            MH GGAQRVQCAQQ
Sbjct  405  MHGGGAQRVQCAQQ  418



>gb|EYU36024.1| hypothetical protein MIMGU_mgv1a007013mg [Erythranthe guttata]
Length=422

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 178/194 (92%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            V+KGMQNGQ+ITFPGEADEAPDT+TGDIVFV+QQKEH K+KRKGDD+F+EHTL L EALC
Sbjct  229  VDKGMQNGQKITFPGEADEAPDTVTGDIVFVVQQKEHPKYKRKGDDLFIEHTLPLGEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF L+HLD RQLLIKSQPGEVVKPD +KAINDEGMP+YQ+PFM+GKLYIHF V+FP++
Sbjct  289  GFQFALSHLDGRQLLIKSQPGEVVKPDSYKAINDEGMPIYQRPFMKGKLYIHFNVEFPDS  348

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EEDE  334
            L+ +Q +ALE +LPP+P +K+TDME+DECEETTL+DVNIE+EMRRKQ  + QE Y ++DE
Sbjct  349  LSTEQVEALEKILPPKPQSKLTDMEVDECEETTLHDVNIEDEMRRKQAHRQQEAYDDDDE  408

Query  333  DMHGGAQRVQCAQQ  292
            DMHGGAQRVQCAQQ
Sbjct  409  DMHGGAQRVQCAQQ  422



>ref|NP_001051497.1| Os03g0787300 [Oryza sativa Japonica Group]
 gb|AAT75262.1| putative DnaJ like protein [Oryza sativa Japonica Group]
 gb|ABF99246.1| DnaJ protein, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13411.1| Os03g0787300 [Oryza sativa Japonica Group]
 gb|EAZ28837.1| hypothetical protein OsJ_12871 [Oryza sativa Japonica Group]
 dbj|BAG87697.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96593.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 181/194 (93%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDI+FVLQQKEH KFKRKGDD+F EHTL LTEALC
Sbjct  224  VEKGMQNGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLNLTEALC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS+PGEVVKPD FKA+NDEGMPMYQ+PFM+GKLYIHF+V+FP++
Sbjct  284  GFQFVLTHLDNRQLLIKSKPGEVVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVEFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQCKALE VLPPRP ++ TDMELDECEET  YDVNIEEEMRR+QQQQ QE Y+EDED
Sbjct  344  LNPDQCKALETVLPPRPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQQQQEAYDEDED  403

Query  330  MH-GGAQRVQCAQQ  292
            MH GGAQRVQCAQQ
Sbjct  404  MHGGGAQRVQCAQQ  417



>gb|EAY92107.1| hypothetical protein OsI_13813 [Oryza sativa Indica Group]
Length=417

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/194 (85%), Positives = 181/194 (93%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDI+FVLQQKEH KFKRKGDD+F EHTL LTEALC
Sbjct  224  VEKGMQNGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLNLTEALC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS+PGEVVKPD FKA+NDEGMPMYQ+PFM+GKLYIHF+V+FP++
Sbjct  284  GFQFVLTHLDNRQLLIKSKPGEVVKPDSFKAVNDEGMPMYQRPFMKGKLYIHFSVEFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQCKALE VLPPRP ++ TDMELDECEET  YDVNIEEEMRR+QQQQ QE Y+EDED
Sbjct  344  LNPDQCKALETVLPPRPVSQYTDMELDECEETMPYDVNIEEEMRRRQQQQQQEAYDEDED  403

Query  330  MH-GGAQRVQCAQQ  292
            MH GGAQRVQCAQQ
Sbjct  404  MHGGGAQRVQCAQQ  417



>ref|XP_004291528.1| PREDICTED: dnaJ protein homolog [Fragaria vesca subsp. vesca]
Length=423

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 174/194 (90%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVF++QQKEH KFKRKGDD+FVEH+L LT+ALC
Sbjct  230  VEKGMQNGQKITFPGEADEAPDTITGDIVFIIQQKEHPKFKRKGDDLFVEHSLLLTDALC  289

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVL HLD RQLLIKS PGEVVKPD FKA+NDEGMPMY +PFM+GKLYIHF+V+FPET
Sbjct  290  GFQFVLNHLDGRQLLIKSNPGEVVKPDSFKAVNDEGMPMYGRPFMKGKLYIHFSVEFPET  349

Query  510  LTPDQCKALEAVLPPRPAT-KITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDE  334
            L+ +Q KALEA LP R ++ ++TDMELDECEETTL+DVN+EEEMRRKQ     E Y+EDE
Sbjct  350  LSLEQVKALEAALPTRASSQQLTDMELDECEETTLHDVNMEEEMRRKQHHAHSEAYDEDE  409

Query  333  DMHGGAQRVQCAQQ  292
            DM GGAQRVQCAQQ
Sbjct  410  DMPGGAQRVQCAQQ  423



>ref|XP_006340319.1| PREDICTED: dnaJ protein homolog ANJ1-like isoform X2 [Solanum 
tuberosum]
Length=337

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 178/194 (92%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            V+KGMQNGQ+ITFPGEADEAPDT+TGD+VFVLQQKEH KFKRKG+D+FV+HTLTLTEALC
Sbjct  145  VDKGMQNGQKITFPGEADEAPDTVTGDVVFVLQQKEHPKFKRKGEDLFVDHTLTLTEALC  204

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKS PGEVVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  205  GFQFILTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPVYQRPFMKGKLYIHFTVEFPDS  264

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+  Q + LEA+LPPRP ++ +DMELDECEETTL+DVN+EEEMRRKQ  Q QE Y+EDE+
Sbjct  265  LSLPQVQLLEAILPPRPTSQYSDMELDECEETTLHDVNMEEEMRRKQAAQ-QEAYDEDEE  323

Query  330  MHG-GAQRVQCAQQ  292
            M G G QRVQCAQQ
Sbjct  324  MSGSGGQRVQCAQQ  337



>ref|XP_006340318.1| PREDICTED: dnaJ protein homolog ANJ1-like isoform X1 [Solanum 
tuberosum]
Length=419

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 178/194 (92%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            V+KGMQNGQ+ITFPGEADEAPDT+TGD+VFVLQQKEH KFKRKG+D+FV+HTLTLTEALC
Sbjct  227  VDKGMQNGQKITFPGEADEAPDTVTGDVVFVLQQKEHPKFKRKGEDLFVDHTLTLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKS PGEVVKPDQFKAINDEGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  287  GFQFILTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPVYQRPFMKGKLYIHFTVEFPDS  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+  Q + LEA+LPPRP ++ +DMELDECEETTL+DVN+EEEMRRKQ  Q QE Y+EDE+
Sbjct  347  LSLPQVQLLEAILPPRPTSQYSDMELDECEETTLHDVNMEEEMRRKQAAQ-QEAYDEDEE  405

Query  330  MHG-GAQRVQCAQQ  292
            M G G QRVQCAQQ
Sbjct  406  MSGSGGQRVQCAQQ  419



>gb|EYU37227.1| hypothetical protein MIMGU_mgv1a006922mg [Erythranthe guttata]
Length=426

 Score =   326 bits (835),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/196 (81%), Positives = 178/196 (91%), Gaps = 3/196 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ++TFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTLTLTEALC
Sbjct  231  VEKGMQHGQKVTFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALC  290

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLDNRQLLIKS+PGEV+KPDQFKAINDEGMPMY+K FM+GKLYI FTVDFPE+
Sbjct  291  GFQFVLTHLDNRQLLIKSEPGEVIKPDQFKAINDEGMPMYEKSFMKGKLYIQFTVDFPES  350

Query  510  LTPDQCKALEAVLPPRPA-TKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EED  337
            L P Q KAL  VLP + + T++TDMELDECEETTL+DVN+EEEMRRK QQ+A E Y ++D
Sbjct  351  LNPQQIKALATVLPSKKSTTQLTDMELDECEETTLHDVNMEEEMRRKPQQRAHEAYDDDD  410

Query  336  EDMH-GGAQRVQCAQQ  292
            EDMH GGAQ V CAQQ
Sbjct  411  EDMHGGGAQSVPCAQQ  426



>ref|XP_007150008.1| hypothetical protein PHAVU_005G118100g [Phaseolus vulgaris]
 gb|ESW22002.1| hypothetical protein PHAVU_005G118100g [Phaseolus vulgaris]
Length=418

 Score =   325 bits (833),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/194 (80%), Positives = 177/194 (91%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN Q+ITFPGEADEAPDTITGDIVFVLQQKEH KFKRK +D+FVEHTL+LTEALC
Sbjct  226  VEKGMQNAQKITFPGEADEAPDTITGDIVFVLQQKEHPKFKRKIEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPA-TKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDE  334
            L+PDQ  A+EAVLP + +  K+T+MELDECEETTL+ VN+EEE+RR+ QQ  QE YEED+
Sbjct  346  LSPDQVTAIEAVLPAKTSPQKLTEMELDECEETTLHGVNMEEELRRR-QQIPQEAYEEDD  404

Query  333  DMHGGAQRVQCAQQ  292
            DMHGGAQRVQCAQQ
Sbjct  405  DMHGGAQRVQCAQQ  418



>ref|NP_001275059.1| DnaJ-like protein [Solanum tuberosum]
 gb|ABB55383.1| DnaJ-like protein-like [Solanum tuberosum]
Length=445

 Score =   325 bits (832),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 176/191 (92%), Gaps = 4/191 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL L    C
Sbjct  227  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLKLKPRPC  286

Query  690  -GFQFV-LTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFP  517
             GFQF+ LTHLD RQL+IK QPGEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTV+FP
Sbjct  287  VGFQFIFLTHLDYRQLIIKPQPGEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVEFP  346

Query  516  ETLTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-EE  340
            +TL+P+QCK LEAVLPP+P T++TDMELDECEETTL+DVNIEEEMRRK QQQAQE Y E+
Sbjct  347  DTLSPEQCKNLEAVLPPKPKTQMTDMELDECEETTLHDVNIEEEMRRK-QQQAQEAYDED  405

Query  339  DEDMHGGAQRV  307
            DEDMHGGAQRV
Sbjct  406  DEDMHGGAQRV  416



>gb|KHG16063.1| DnaJ protein [Gossypium arboreum]
Length=299

 Score =   319 bits (817),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  810  PDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQP  631
            PDT+TGDIVFVLQQK+H KFKRKGDD+FVEHTLTLTEALCGFQF+LTHLD RQLLIK+ P
Sbjct  127  PDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLTLTEALCGFQFILTHLDGRQLLIKTHP  186

Query  630  GEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATK  451
            GEVVKPDQ KAINDEGMPMYQ+PFMRGKLYIHFTVDFP++L P+QCKALEAVLP R + +
Sbjct  187  GEVVKPDQCKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLAPEQCKALEAVLPSRASVQ  246

Query  450  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  292
            +TDMELDECEETTLYDVNIEEEMRRKQ Q AQE YEED+DMHGGAQRVQCAQQ
Sbjct  247  LTDMELDECEETTLYDVNIEEEMRRKQAQAAQEAYEEDDDMHGGAQRVQCAQQ  299



>ref|XP_007015640.1| DNAJ isoform 1 [Theobroma cacao]
 gb|EOY33259.1| DNAJ isoform 1 [Theobroma cacao]
Length=431

 Score =   323 bits (829),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 175/188 (93%), Gaps = 2/188 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADE PDTITGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  224  VEKGMQHGQKITFPGEADEVPDTITGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS  GE+VKPD FKAINDEGMP+YQ+PFM+GKLYIHFTVDFP++
Sbjct  284  GFQFVLTHLDGRQLLIKSNSGEIVKPDSFKAINDEGMPLYQRPFMKGKLYIHFTVDFPDS  343

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ +ALEA+LPP+P +++TDMELDECEETTL+DVNIEEEMRRK QQ AQE  +E E+
Sbjct  344  LSPDQVQALEAILPPKPTSQLTDMELDECEETTLHDVNIEEEMRRK-QQAAQETLDE-EE  401

Query  330  MHGGAQRV  307
            MHGGAQR+
Sbjct  402  MHGGAQRL  409



>ref|XP_010685460.1| PREDICTED: dnaJ protein homolog ANJ1 [Beta vulgaris subsp. vulgaris]
Length=417

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 176/193 (91%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGM +GQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKG+D+F EHTL+LTE+LC
Sbjct  226  VEKGMLHGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFYEHTLSLTESLC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GF+FVLTHLD RQLLIKS PGEV+KPDQFKAI+DEGMP+YQ+PFM+GK+YIHFTV+FP++
Sbjct  286  GFRFVLTHLDGRQLLIKSNPGEVIKPDQFKAIDDEGMPIYQRPFMKGKMYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQ KALEA+LPP+P   +TDMELDECEETT++DVN+EEEMRRKQ Q  QE Y+ED++
Sbjct  346  LNPDQVKALEAILPPKPTMTLTDMELDECEETTMHDVNMEEEMRRKQTQAQQEAYDEDDE  405

Query  330  MHGGAQRVQCAQQ  292
              GG QRVQCAQQ
Sbjct  406  PQGG-QRVQCAQQ  417



>ref|XP_008660777.1| PREDICTED: dnaJ protein homolog 2-like [Zea mays]
Length=324

 Score =   317 bits (813),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 172/193 (89%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNG +ITFPGEADEAPDT TGDI+FVLQQKEH KFKRKGDD+F EHTLTL E+LC
Sbjct  133  VEKGMQNGHKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLIESLC  192

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
             FQFVLTH+DNRQ+LIK   GEVVKP+ FKAINDEGMPMYQ+PF++GKLYIHF+V+F ++
Sbjct  193  SFQFVLTHMDNRQMLIKLNHGEVVKPNSFKAINDEGMPMYQRPFIKGKLYIHFSVEFSDS  252

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALE VLPP+P ++ TDMELDECE+T  YDVNIEEEMRR+QQQ  QE Y+ED++
Sbjct  253  LSPEQCKALEVVLPPKPVSQYTDMELDECEDTMPYDVNIEEEMRRRQQQH-QEAYDEDDN  311

Query  330  MHGGAQRVQCAQQ  292
            + GG QRVQCAQQ
Sbjct  312  VPGGGQRVQCAQQ  324



>gb|KHG01500.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
 gb|KHG06497.1| Chaperone dnaJ 3 -like protein [Gossypium arboreum]
Length=318

 Score =   317 bits (812),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = -2

Query  810  PDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQP  631
            PDT+TGDIVFVLQQK+H KFKRKGDD+FVEHTL LTEALCGFQF+LTHLD RQLLIK+QP
Sbjct  146  PDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLALTEALCGFQFILTHLDGRQLLIKTQP  205

Query  630  GEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATK  451
            GEVVKPDQFKAINDEGMP+YQ+PFMRGKLYI FTVDFP++LTPDQCKALEAVLPP+ + +
Sbjct  206  GEVVKPDQFKAINDEGMPIYQRPFMRGKLYIQFTVDFPDSLTPDQCKALEAVLPPKASVQ  265

Query  450  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  292
            +TDMELDECEETTL+DVNIEE MRRKQ Q  QE Y+EDEDMHGGAQRVQCAQQ
Sbjct  266  LTDMELDECEETTLHDVNIEEVMRRKQTQAQQEAYDEDEDMHGGAQRVQCAQQ  318



>ref|XP_011008852.1| PREDICTED: dnaJ protein homolog isoform X1 [Populus euphratica]
Length=415

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 174/193 (90%), Gaps = 2/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEH L LTEALC
Sbjct  225  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHVLPLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGE VKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP++
Sbjct  285  GFQFVLTHLDGRQLLIKSNPGEAVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDS  344

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTPDQ KA+E +L PRP+ ++TDMELDECEETTL+DVNIEEEMRRKQQ + +   E++E 
Sbjct  345  LTPDQVKAIETIL-PRPSRQLTDMELDECEETTLHDVNIEEEMRRKQQAREEAYEEDEEM  403

Query  330  MHGGAQRVQCAQQ  292
             HGG QRVQCAQQ
Sbjct  404  PHGG-QRVQCAQQ  415



>ref|XP_011008853.1| PREDICTED: dnaJ protein homolog isoform X2 [Populus euphratica]
Length=409

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 174/193 (90%), Gaps = 2/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEH L LTEALC
Sbjct  219  VEKGMQNGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHVLPLTEALC  278

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGE VKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP++
Sbjct  279  GFQFVLTHLDGRQLLIKSNPGEAVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDS  338

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            LTPDQ KA+E +L PRP+ ++TDMELDECEETTL+DVNIEEEMRRKQQ + +   E++E 
Sbjct  339  LTPDQVKAIETIL-PRPSRQLTDMELDECEETTLHDVNIEEEMRRKQQAREEAYEEDEEM  397

Query  330  MHGGAQRVQCAQQ  292
             HGG QRVQCAQQ
Sbjct  398  PHGG-QRVQCAQQ  409



>ref|XP_003558043.1| PREDICTED: dnaJ protein homolog [Brachypodium distachyon]
Length=420

 Score =   319 bits (817),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 162/194 (84%), Positives = 179/194 (92%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADEAPDT+TGDI+FVLQQKEH KFKRK DD+F EHTLTLTEALC
Sbjct  227  VEKGMQHGQKITFPGEADEAPDTLTGDIIFVLQQKEHPKFKRKSDDLFYEHTLTLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQ+VLTHLD RQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP++
Sbjct  287  GFQYVLTHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDS  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQCKALEAVLPP+PA++ TDMELDECEET  YD++IEEEMRR+QQQQ QE Y+EDED
Sbjct  347  LNPDQCKALEAVLPPKPASQYTDMELDECEETMAYDIDIEEEMRRRQQQQQQEAYDEDED  406

Query  330  M-HGGAQRVQCAQQ  292
            M  GG QRVQCAQQ
Sbjct  407  MPGGGGQRVQCAQQ  420



>ref|XP_004251216.1| PREDICTED: dnaJ protein homolog [Solanum lycopersicum]
Length=418

 Score =   318 bits (816),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDT+TGD+VFVLQQK+H KFKRKGDD+FV+HTLTLTEALC
Sbjct  226  VEKGMQNGQKITFPGEADEAPDTVTGDVVFVLQQKDHPKFKRKGDDLFVDHTLTLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+L HLD R+LL+KS PGEVVKPDQFKAINDEGMP+YQ+PFM+GKLYIHF V+FP++
Sbjct  286  GFQFILAHLDGRRLLVKSNPGEVVKPDQFKAINDEGMPVYQRPFMKGKLYIHFIVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+  Q + LEA+LP RP ++ +DMELDECEETTL+DVN+EEEMRRKQ  Q QE Y+EDE+
Sbjct  346  LSLPQVQLLEAMLPSRPTSQYSDMELDECEETTLHDVNMEEEMRRKQAAQ-QEAYDEDEE  404

Query  330  MH-GGAQRVQCAQQ  292
            M  GG QRVQCAQQ
Sbjct  405  MSGGGGQRVQCAQQ  418



>ref|XP_010544327.1| PREDICTED: dnaJ protein homolog [Tarenaya hassleriana]
 ref|XP_010544328.1| PREDICTED: dnaJ protein homolog [Tarenaya hassleriana]
Length=419

 Score =   318 bits (814),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 176/197 (89%), Gaps = 4/197 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPG ADEAPDT+TGD+VFV+QQKEH KFKRKG+++F EHTL+LTEALC
Sbjct  223  VEKGMQNGQKITFPGAADEAPDTVTGDVVFVIQQKEHPKFKRKGENLFYEHTLSLTEALC  282

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD FKAI+DEGMP++Q+PFM+GKLYIHF V+FP++
Sbjct  283  GFQFVLTHLDGRQLLIKSNPGEVVKPDSFKAIDDEGMPVHQRPFMKGKLYIHFMVEFPDS  342

Query  510  LTPDQCKALEAVL-PPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQ-QAQEVYEED  337
            L+ DQ KALEA+L PPR +++ TDMELDECEETTL+DVNIEEEMRRK QQ Q  E YEED
Sbjct  343  LSSDQVKALEAILPPPRTSSQFTDMELDECEETTLHDVNIEEEMRRKHQQPQRGEAYEED  402

Query  336  ED--MHGGAQRVQCAQQ  292
             D   HGGAQRVQCAQQ
Sbjct  403  GDDSGHGGAQRVQCAQQ  419



>sp|P43644.1|DNJH_ATRNU RecName: Full=DnaJ protein homolog ANJ1; Flags: Precursor [Atriplex 
nummularia]
Length=417

 Score =   317 bits (812),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/193 (78%), Positives = 175/193 (91%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKG+D+F EHTL+LTEALC
Sbjct  226  VEKGMQHGQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFYEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GF+FVLTHLD RQLLIKS  GEVVKPDQFKAI DEGMP+YQ+PFM+GK+YIHFTV+FP++
Sbjct  286  GFRFVLTHLDGRQLLIKSNLGEVVKPDQFKAIEDEGMPIYQRPFMKGKMYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L PDQ K+LEA+LPP+P+  +T MELDECEETTL++VNIEEEM+RKQ Q  QE Y+ED++
Sbjct  346  LNPDQVKSLEAILPPKPSMSLTYMELDECEETTLHNVNIEEEMKRKQTQAQQEAYDEDDE  405

Query  330  MHGGAQRVQCAQQ  292
              GG QRVQCAQQ
Sbjct  406  PAGG-QRVQCAQQ  417



>gb|KDP22008.1| hypothetical protein JCGZ_03128 [Jatropha curcas]
Length=326

 Score =   313 bits (802),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 147/173 (85%), Positives = 161/173 (93%), Gaps = 1/173 (1%)
 Frame = -2

Query  810  PDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQP  631
            PDTITGDIVFVLQQKEH KFKRKGDD+ V+HTL+LTEALCGFQF+LTHLD RQLLIKSQP
Sbjct  155  PDTITGDIVFVLQQKEHPKFKRKGDDLIVDHTLSLTEALCGFQFILTHLDGRQLLIKSQP  214

Query  630  GEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATK  451
            GEVVKPDQFKAINDEGMPMYQ+PFMRGKLYIHFTVDFP++L PDQCKALEAVLP R + +
Sbjct  215  GEVVKPDQFKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLPPDQCKALEAVLPSRSSVQ  274

Query  450  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  292
            ++DMELDECEETTL+DVN EEEMRRK QQ A E Y+EDEDMHGG+QRVQCAQQ
Sbjct  275  LSDMELDECEETTLHDVNFEEEMRRK-QQHAAEAYDEDEDMHGGSQRVQCAQQ  326



>ref|XP_002874044.1| hypothetical protein ARALYDRAFT_489058 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50303.1| hypothetical protein ARALYDRAFT_489058 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   316 bits (810),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  227  VEKGMQHNQKITFNGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FPE+
Sbjct  287  GFQFVLTHLDKRQLLIKSSPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPES  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KA+EAVLP      I+DME+DECEETTL+DVNIE+EM+RK Q Q +E Y++DED
Sbjct  347  LSPDQTKAIEAVLPKPTKAAISDMEIDECEETTLHDVNIEDEMKRKAQAQ-REAYDDDED  405

Query  330  MH-GGAQRVQCAQQ  292
             H GGAQRVQCAQQ
Sbjct  406  EHPGGAQRVQCAQQ  419



>ref|XP_010521621.1| PREDICTED: dnaJ protein homolog ANJ1-like [Tarenaya hassleriana]
Length=423

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 154/195 (79%), Positives = 171/195 (88%), Gaps = 2/195 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPGEADEAPDTITGDIVF+LQQKEH KFKRKGDD+F EHTL LTEALC
Sbjct  229  VEKGMQNGQKITFPGEADEAPDTITGDIVFILQQKEHPKFKRKGDDLFYEHTLCLTEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGM--PMYQKPFMRGKLYIHFTVDFP  517
            GFQFVLTHLD RQLLIKS PGEVVKP +    +  G   PMYQ+PFM+GKLYIHFTV+FP
Sbjct  289  GFQFVLTHLDGRQLLIKSNPGEVVKPGKHFPRSGFGCHPPMYQRPFMKGKLYIHFTVEFP  348

Query  516  ETLTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
            ETL PDQ KALE VLPP+P+T++++MELDECEETTL+DVNIEEEMRRKQQ Q QE Y+ED
Sbjct  349  ETLKPDQVKALEKVLPPKPSTQMSEMELDECEETTLHDVNIEEEMRRKQQSQQQEAYDED  408

Query  336  EDMHGGAQRVQCAQQ  292
            +D   GAQRVQCAQQ
Sbjct  409  DDEPHGAQRVQCAQQ  423



>emb|CAC12824.1| putative DNAJ protein [Nicotiana tabacum]
Length=418

 Score =   314 bits (805),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 171/194 (88%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+ITFPG+ADE PD ITGDIVFVLQQK+    KRKGDD+FV+HTL+LTEALC
Sbjct  226  VEKGMQNGQKITFPGKADETPDAITGDIVFVLQQKDTRGSKRKGDDLFVDHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF++THLD RQLLIKS  GEVVKPDQFKAINDEG PMYQ+PFMRGKLYI F V+FP++
Sbjct  286  GFQFIMTHLDGRQLLIKSNLGEVVKPDQFKAINDEGTPMYQRPFMRGKLYIRFVVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L  +Q KALEA+LPPRP ++ TDMELDECEET+L+DVNIEEEMRRKQ  Q QE Y+ED++
Sbjct  346  LNTEQVKALEAILPPRPQSQYTDMELDECEETSLHDVNIEEEMRRKQAAQ-QEAYDEDDE  404

Query  330  MH-GGAQRVQCAQQ  292
            MH GG QRVQCAQQ
Sbjct  405  MHGGGGQRVQCAQQ  418



>gb|EMS60670.1| DnaJ protein-like protein [Triticum urartu]
Length=446

 Score =   314 bits (805),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 179/194 (92%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADEAPDT+TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTEALC
Sbjct  253  VEKGMQHGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTEALC  312

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQ+VL HLD RQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP++
Sbjct  313  GFQYVLAHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDS  372

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQCKALE VLPP+PA++ TDMELDECEET  YD++IEEEMRR+QQQQAQE Y+EDED
Sbjct  373  LSLDQCKALETVLPPKPASQYTDMELDECEETMAYDIDIEEEMRRRQQQQAQEAYDEDED  432

Query  330  M-HGGAQRVQCAQQ  292
            M  GG QRVQCAQQ
Sbjct  433  MPGGGGQRVQCAQQ  446



>gb|AFW86285.1| putative dnaJ chaperone family protein [Zea mays]
Length=641

 Score =   319 bits (818),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/193 (76%), Positives = 172/193 (89%), Gaps = 1/193 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNG +ITFPGEADEAPDT TGDI+FVLQQKEH KFKRKGDD+F EHTLTL E+LC
Sbjct  450  VEKGMQNGHKITFPGEADEAPDTATGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLIESLC  509

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
             FQFVLTH+DNRQ+LIK   GEVVKP+ FKAINDEGMPMYQ+PF++GKLYIHF+V+F ++
Sbjct  510  SFQFVLTHMDNRQMLIKLNHGEVVKPNSFKAINDEGMPMYQRPFIKGKLYIHFSVEFSDS  569

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALE VLPP+P ++ TDMELDECE+T  YDVNIEEEMRR+QQQ  QE Y+ED++
Sbjct  570  LSPEQCKALEVVLPPKPVSQYTDMELDECEDTMPYDVNIEEEMRRRQQQH-QEAYDEDDN  628

Query  330  MHGGAQRVQCAQQ  292
            + GG QRVQCAQQ
Sbjct  629  VPGGGQRVQCAQQ  641



>gb|ABG78615.1| J-domain protein [Triticum aestivum]
Length=420

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 177/194 (91%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADEAPDT+TGDI+FVLQQKEH KFKRKGDD+F EHTLTLTEALC
Sbjct  227  VEKGMQHGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKRKGDDLFYEHTLTLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQ+VL HLD RQLLIKS PGEV KPD FKAINDEGMPMYQ+PFM+GKLYIHFTVDFP++
Sbjct  287  GFQYVLAHLDGRQLLIKSNPGEVAKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVDFPDS  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L  DQCKALE VLPP+PA++ TDMELDECEET  YD++IEEEMRR+QQQQAQE Y+EDED
Sbjct  347  LNLDQCKALETVLPPKPASQYTDMELDECEETMAYDIDIEEEMRRRQQQQAQEAYDEDED  406

Query  330  M-HGGAQRVQCAQQ  292
            M  GG QRVQCAQQ
Sbjct  407  MPGGGGQRVQCAQQ  420



>ref|NP_568412.1| chaperone protein dnaJ 2 [Arabidopsis thaliana]
 sp|P42825.2|DNAJ2_ARATH RecName: Full=Chaperone protein dnaJ 2; Short=AtDjA2; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC34499.1| DNAJ PROTEIN HOMOLOG ATJ [Arabidopsis thaliana]
 dbj|BAC42997.1| putative DnaJ protein homolog ATJ [Arabidopsis thaliana]
 gb|ABH04586.1| At5g22060 [Arabidopsis thaliana]
 gb|AED92977.1| chaperone protein dnaJ 2 [Arabidopsis thaliana]
Length=419

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 176/194 (91%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+QQKEH KFKRKG+D+FVEHT++LTEALC
Sbjct  227  VEKGMQHNQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGEDLFVEHTISLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS+PGEVVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FPE+
Sbjct  287  GFQFVLTHLDKRQLLIKSKPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPES  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KA+EAVLP      I+DME+D+CEETTL+DVNIE+EM+RK Q Q +E Y++DE+
Sbjct  347  LSPDQTKAIEAVLPKPTKAAISDMEIDDCEETTLHDVNIEDEMKRKAQAQ-REAYDDDEE  405

Query  330  MH-GGAQRVQCAQQ  292
             H GGAQRVQCAQQ
Sbjct  406  DHPGGAQRVQCAQQ  419



>gb|ACN39991.1| unknown [Picea sitchensis]
Length=421

 Score =   309 bits (792),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/195 (77%), Positives = 174/195 (89%), Gaps = 4/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQRI F GEADEAPDTITGDIVFVLQ K+H+KFKRKGDD++VEHTL LTEALC
Sbjct  229  VEKGMQHGQRIVFQGEADEAPDTITGDIVFVLQLKDHSKFKRKGDDLYVEHTLNLTEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS PGE++KP Q+KAINDEGMP YQ+PFM+G+LYIHF V+FPE+
Sbjct  289  GFQFPLTHLDGRQLLIKSSPGEIIKPSQYKAINDEGMPQYQRPFMKGRLYIHFNVEFPES  348

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+P+QCKALE++LPPRPA  +TDMELDECEETTL+DVNIE+E+RRKQQQQ QE YEED
Sbjct  349  GALSPEQCKALESILPPRPAGYMTDMELDECEETTLHDVNIEDELRRKQQQQQQEAYEED  408

Query  336  EDMHGGAQRVQCAQQ  292
            ++  G   RVQCAQQ
Sbjct  409  DEPQG--HRVQCAQQ  421



>ref|XP_006400711.1| hypothetical protein EUTSA_v10013655mg [Eutrema salsugineum]
 gb|ESQ42164.1| hypothetical protein EUTSA_v10013655mg [Eutrema salsugineum]
Length=420

 Score =   309 bits (791),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+QQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  228  VEKGMQHSQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGEDLFVEHTLSLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD ++AI+DEGMP++Q+PFM+GKLYIHFTV+FPE+
Sbjct  288  GFQFVLTHLDTRQLLIKSNPGEVVKPDSYRAISDEGMPIHQRPFMKGKLYIHFTVEFPES  347

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KA+EAVLP      ++DME+DECEETTL+DVNIE+EMRRK Q Q +   +++ED
Sbjct  348  LSPDQTKAIEAVLPKPSKAALSDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDEED  407

Query  330  MHGGAQRVQCAQQ  292
              GGAQRVQCAQQ
Sbjct  408  GPGGAQRVQCAQQ  420



>dbj|BAJ91943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=421

 Score =   308 bits (790),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 177/194 (91%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADEAPDT+TGDI+FVLQQKEH KFKRK DD+F EHTLTLTEALC
Sbjct  228  VEKGMQHGQKITFPGEADEAPDTVTGDIIFVLQQKEHPKFKRKADDLFYEHTLTLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQ+VL HLD RQLLIKS PGEVVKPD FKAINDEGMPMYQ+PFM+GKLYIHFTV FP++
Sbjct  288  GFQYVLAHLDGRQLLIKSNPGEVVKPDSFKAINDEGMPMYQRPFMKGKLYIHFTVVFPDS  347

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+ DQCKALE VLPP+PA++ TDMELDECEET  YD++IEEEMRR+QQQQAQE Y+EDED
Sbjct  348  LSLDQCKALETVLPPKPASQYTDMELDECEETMAYDIDIEEEMRRQQQQQAQEAYDEDED  407

Query  330  M-HGGAQRVQCAQQ  292
            M  GG QRVQCAQQ
Sbjct  408  MPGGGGQRVQCAQQ  421



>ref|XP_011088982.1| PREDICTED: dnaJ protein homolog [Sesamum indicum]
Length=413

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 170/194 (88%), Gaps = 7/194 (4%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN Q+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+        TEALC
Sbjct  226  VEKGMQNLQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDL----XXXXTEALC  281

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+L+HLD RQLLIKSQPGEVVKP+ +KAINDEGMPMYQ+PFM+GKLYIHF V+FP++
Sbjct  282  GFQFILSHLDGRQLLIKSQPGEVVKPNSYKAINDEGMPMYQRPFMKGKLYIHFNVEFPDS  341

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEE-DE  334
            L+ DQ  ALE +LPP+P +++TDME+DECEETTL+DVNIE+EMRRK Q   QE YEE DE
Sbjct  342  LSLDQVGALEKILPPKPQSQLTDMEIDECEETTLHDVNIEDEMRRKAQH--QEAYEEDDE  399

Query  333  DMHGGAQRVQCAQQ  292
            DMHGGAQRVQCAQQ
Sbjct  400  DMHGGAQRVQCAQQ  413



>ref|XP_001782829.1| predicted protein [Physcomitrella patens]
 gb|EDQ52343.1| predicted protein [Physcomitrella patens]
Length=415

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 149/195 (76%), Positives = 172/195 (88%), Gaps = 5/195 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGM +GQ+ITF GEADEAPDT+TGDIVFVLQ K+H KFKRKGDD+FVEH+L LTEALC
Sbjct  224  VEKGMVHGQKITFQGEADEAPDTVTGDIVFVLQLKDHPKFKRKGDDLFVEHSLNLTEALC  283

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS PGE+VKP QFKAINDEGMP YQ+PFM+G+LY+HF+V+FPE+
Sbjct  284  GFQFPLTHLDGRQLLIKSNPGEIVKPGQFKAINDEGMPHYQRPFMKGRLYLHFSVEFPES  343

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              LTP+Q KALE +LPPRP +++TDMELDECEETTL DVNIE+EMRRKQQQQ QE Y+ED
Sbjct  344  GALTPEQLKALEVILPPRPTSQMTDMELDECEETTLIDVNIEDEMRRKQQQQ-QEAYDED  402

Query  336  EDMHGGAQRVQCAQQ  292
            E+  G   R+QCAQQ
Sbjct  403  EESSG--PRIQCAQQ  415



>gb|AAB86799.1| putative [Arabidopsis thaliana]
 prf||2118338A AtJ2 protein
Length=419

 Score =   307 bits (786),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/194 (75%), Positives = 173/194 (89%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+QQKEH KFKRKG+D+FVEHT++LTEALC
Sbjct  227  VEKGMQHNQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGEDLFVEHTISLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS+PGEVVKPD +KAI+DEGMP+YQ PFM+GKLYIHFTV+FPE+
Sbjct  287  GFQFVLTHLDKRQLLIKSKPGEVVKPDSYKAISDEGMPIYQSPFMKGKLYIHFTVEFPES  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KA+EAVLP      I+DME+D+CEETTL+DVNIE+EM+RK Q Q +E Y+ DE+
Sbjct  347  LSPDQTKAIEAVLPKPTKAAISDMEIDDCEETTLHDVNIEDEMKRKAQAQ-REAYDVDEE  405

Query  330  MH-GGAQRVQCAQQ  292
             H GGA RVQCAQQ
Sbjct  406  DHPGGAHRVQCAQQ  419



>gb|ABK21047.1| unknown [Picea sitchensis]
Length=189

 Score =   299 bits (765),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/191 (77%), Positives = 170/191 (89%), Gaps = 4/191 (2%)
 Frame = -2

Query  858  MQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQF  679
            MQ+GQRI F GEADEAPDTITGDIVFVLQ K+H+KFKRKGDD++VEHTL LTEALCGFQF
Sbjct  1    MQHGQRIVFQGEADEAPDTITGDIVFVLQLKDHSKFKRKGDDLYVEHTLNLTEALCGFQF  60

Query  678  VLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET--LT  505
             LTHLD RQLLIKS PGE++KP Q+KAINDEGMP YQ+PFM+G+LYIHF V+FPE+  L+
Sbjct  61   PLTHLDGRQLLIKSSPGEIIKPSQYKAINDEGMPQYQRPFMKGRLYIHFNVEFPESGALS  120

Query  504  PDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMH  325
            P+QCKALE++LPPRPA  +TDMELDECEETTL+DVNIE+E+RRKQQQQ QE YEED++  
Sbjct  121  PEQCKALESILPPRPAGYMTDMELDECEETTLHDVNIEDELRRKQQQQQQEAYEEDDEPQ  180

Query  324  GGAQRVQCAQQ  292
            G   RVQCAQQ
Sbjct  181  G--HRVQCAQQ  189



>ref|XP_008666814.1| PREDICTED: dnaJ protein homolog 1-like [Zea mays]
Length=515

 Score =   310 bits (793),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/223 (69%), Positives = 176/223 (79%), Gaps = 30/223 (13%)
 Frame = -2

Query  870  VEKGMQNGQRITFP-----------------------------GEADEAPDTITGDIVFV  778
            VEKGMQ+ Q+ITFP                              EADEAPDT+TGDIVFV
Sbjct  293  VEKGMQHNQKITFPGEADEAPAEAAAAAPAAGELAGDEGRGGSAEADEAPDTVTGDIVFV  352

Query  777  LQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGEVVKPDQFKA  598
            L+QK+H+KFKRKG+D+  EHTL+LTEALCG QFVLTHLDNRQLLIKS PGEVVKPDQFKA
Sbjct  353  LRQKDHSKFKRKGEDLLYEHTLSLTEALCGCQFVLTHLDNRQLLIKSDPGEVVKPDQFKA  412

Query  597  INDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATKITDMELDECEE  418
            INDEGMP+YQ+PFM+GKLYIHFTV+FP++L P+QCKALE VLPPR ++K+TDME DECEE
Sbjct  413  INDEGMPIYQRPFMKGKLYIHFTVEFPDSLAPEQCKALETVLPPRLSSKLTDMETDECEE  472

Query  417  TTLYDV-NIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  292
            TT++DV NIEEEM RKQ   A E YEED++M GGAQRVQCAQQ
Sbjct  473  TTMHDVNNIEEEMHRKQAHAAHEAYEEDDEMPGGAQRVQCAQQ  515



>ref|XP_001774283.1| predicted protein [Physcomitrella patens]
 gb|EDQ60919.1| predicted protein [Physcomitrella patens]
Length=417

 Score =   305 bits (782),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 171/195 (88%), Gaps = 5/195 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGM +GQ+ITF GEADEAPDT+TGDIVFVLQ KEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  226  VEKGMAHGQKITFQGEADEAPDTVTGDIVFVLQLKEHPKFKRKGDDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPE-  514
            GFQF LTHLD RQLLIK+ PGE+VKP QFKAINDEGMP YQ+PFM+GKLY+HFTV+FPE 
Sbjct  286  GFQFPLTHLDGRQLLIKTNPGEIVKPGQFKAINDEGMPQYQRPFMKGKLYLHFTVEFPES  345

Query  513  -TLTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
             +L+ +QC+ LE++LPPR ++ +TDM+LDECEETTL DVNIEEEMRRK QQQ QE Y+ED
Sbjct  346  GSLSSEQCRMLESILPPRASSHLTDMDLDECEETTLIDVNIEEEMRRKHQQQ-QEAYDED  404

Query  336  EDMHGGAQRVQCAQQ  292
            E+  G   R+QCAQQ
Sbjct  405  EESSG--PRIQCAQQ  417



>ref|XP_002275918.1| PREDICTED: dnaJ protein homolog 2 [Vitis vinifera]
Length=419

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 172/195 (88%), Gaps = 3/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+G+RI F GEAD+APDTITGDIVFVLQ K+HAKFKRK DD++VEHTL+LTEALC
Sbjct  226  VEKGMQHGERIVFQGEADQAPDTITGDIVFVLQLKDHAKFKRKYDDLYVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS PGE++KPDQ+KAINDEGMP +Q+PFM+GKLYIHF V+FPE+
Sbjct  286  GFQFALTHLDGRQLLIKSNPGEIIKPDQYKAINDEGMPHHQRPFMKGKLYIHFDVEFPES  345

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PDQCKALE++LP + + +I+ ME+DE EETTLYDVNIEEEMRRKQQQQ  E Y+ED
Sbjct  346  GILSPDQCKALESILPQKRSKQISAMEVDEAEETTLYDVNIEEEMRRKQQQQQHEAYDED  405

Query  336  EDMHGGAQRVQCAQQ  292
            +D   GA RVQCAQQ
Sbjct  406  DDDF-GAPRVQCAQQ  419



>ref|XP_010919645.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
 ref|XP_010919646.1| PREDICTED: dnaJ protein homolog [Elaeis guineensis]
Length=417

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 167/195 (86%), Gaps = 5/195 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ ++I F GEADEAPDT+TGDI+F+LQQKEH KFKRK DD+FVEHTL LTEALC
Sbjct  226  VEKGMQHSEKIVFQGEADEAPDTVTGDIIFMLQQKEHPKFKRKYDDLFVEHTLCLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS PGEV+KP QFKAINDEGMP + +PFM+G+LYI F V+FP++
Sbjct  286  GFQFALTHLDGRQLLIKSNPGEVIKPGQFKAINDEGMPHHGRPFMKGRLYIQFNVEFPDS  345

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PDQC  LE +LPPRP+  ++DMELDECEETTLYDVN+EEEMRRKQQQQ QE Y+ED
Sbjct  346  GALSPDQCHVLETLLPPRPSNHLSDMELDECEETTLYDVNMEEEMRRKQQQQPQEAYDED  405

Query  336  EDMHGGAQRVQCAQQ  292
            ED    A RVQCAQQ
Sbjct  406  ED---AAPRVQCAQQ  417



>ref|XP_009120689.1| PREDICTED: chaperone protein dnaJ 3-like [Brassica rapa]
Length=422

 Score =   304 bits (779),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 175/196 (89%), Gaps = 5/196 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  229  VEKGMQHSQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD ++AI DEGMPM+Q+PFM+GKLYIHFTVDFP++
Sbjct  289  GFQFVLTHLDKRQLLIKSSPGEVVKPDSYRAITDEGMPMHQRPFMKGKLYIHFTVDFPDS  348

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---EE  340
            L+PDQ KA+EAVL P+P   ++DME+DECEETTL++VNIE+EMRRK Q Q +E Y   ++
Sbjct  349  LSPDQTKAIEAVL-PKPKADLSDMEIDECEETTLHEVNIEDEMRRKAQAQ-REAYDDDDD  406

Query  339  DEDMHGGAQRVQCAQQ  292
            DE+  GGAQRVQCAQQ
Sbjct  407  DEEGPGGAQRVQCAQQ  422



>emb|CDX92385.1| BnaA10g14240D [Brassica napus]
Length=422

 Score =   304 bits (779),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 175/196 (89%), Gaps = 5/196 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  229  VEKGMQHSQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD ++AI DEGMPM+Q+PFM+GKLYIHFTVDFP++
Sbjct  289  GFQFVLTHLDKRQLLIKSSPGEVVKPDSYRAITDEGMPMHQRPFMKGKLYIHFTVDFPDS  348

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---EE  340
            L+PDQ KA+EAVL P+P   ++DME+DECEETTL++VNIE+EMRRK Q Q +E Y   ++
Sbjct  349  LSPDQTKAIEAVL-PKPKADLSDMEIDECEETTLHEVNIEDEMRRKAQAQ-REAYDDDDD  406

Query  339  DEDMHGGAQRVQCAQQ  292
            DE+  GGAQRVQCAQQ
Sbjct  407  DEEGPGGAQRVQCAQQ  422



>ref|XP_009120690.1| PREDICTED: chaperone protein dnaJ 3-like [Brassica rapa]
Length=422

 Score =   304 bits (778),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 175/196 (89%), Gaps = 5/196 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  229  VEKGMQHSQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD ++AI DEGMPM+Q+PFM+GKLYIHFTVDFP++
Sbjct  289  GFQFVLTHLDKRQLLIKSSPGEVVKPDSYRAITDEGMPMHQRPFMKGKLYIHFTVDFPDS  348

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---EE  340
            L+PDQ KA+EAVL P+P   ++DME+DECEETTL++VNIE+EMRRK Q Q +E Y   ++
Sbjct  349  LSPDQTKAIEAVL-PKPKADLSDMEIDECEETTLHEVNIEDEMRRKAQAQ-REAYDDDDD  406

Query  339  DEDMHGGAQRVQCAQQ  292
            DE+  GGAQRVQCAQQ
Sbjct  407  DEEGPGGAQRVQCAQQ  422



>emb|CDX92386.1| BnaA10g14250D [Brassica napus]
Length=422

 Score =   303 bits (776),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 174/196 (89%), Gaps = 5/196 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  229  VEKGMQHSQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD ++AI DEGMPM+Q+PFM+GKLYIHFTVDFP++
Sbjct  289  GFQFVLTHLDKRQLLIKSSPGEVVKPDSYRAITDEGMPMHQRPFMKGKLYIHFTVDFPDS  348

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---EE  340
            L+PDQ KA+EAVL P+P   ++DME+DECEETTL+DVNI +EMRRK Q Q +E Y   ++
Sbjct  349  LSPDQTKAIEAVL-PKPKADLSDMEIDECEETTLHDVNIGDEMRRKAQAQ-REAYDDDDD  406

Query  339  DEDMHGGAQRVQCAQQ  292
            DE+  GGAQRVQCAQQ
Sbjct  407  DEEGPGGAQRVQCAQQ  422



>ref|XP_010420996.1| PREDICTED: chaperone protein dnaJ 2 isoform X1 [Camelina sativa]
 ref|XP_010420997.1| PREDICTED: chaperone protein dnaJ 2 isoform X2 [Camelina sativa]
Length=421

 Score =   303 bits (775),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 172/194 (89%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+QQKEH  FKRKGDD+FVEHTL+LTEALC
Sbjct  229  VEKGMQHNQKITFSGQADEAPDTVTGDIVFVIQQKEHPMFKRKGDDLFVEHTLSLTEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD+R+LLIKS PGEVVKPD +KAINDEGM MYQ+PFM+GKLYIHFTV+FPE+
Sbjct  289  GFQFVLTHLDSRKLLIKSNPGEVVKPDSYKAINDEGMVMYQRPFMKGKLYIHFTVEFPES  348

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ K +E VLP      ++DM++D+CEETTL+DVNIE+EMRRK Q Q +E Y++D++
Sbjct  349  LSPDQTKTIEEVLPKPTKATMSDMDIDDCEETTLHDVNIEDEMRRKAQTQ-REAYDDDDE  407

Query  330  MH-GGAQRVQCAQQ  292
             H GGAQRVQCAQQ
Sbjct  408  EHPGGAQRVQCAQQ  421



>ref|XP_002969107.1| hypothetical protein SELMODRAFT_267228 [Selaginella moellendorffii]
 ref|XP_002973957.1| hypothetical protein SELMODRAFT_149573 [Selaginella moellendorffii]
 gb|EFJ24912.1| hypothetical protein SELMODRAFT_149573 [Selaginella moellendorffii]
 gb|EFJ30223.1| hypothetical protein SELMODRAFT_267228 [Selaginella moellendorffii]
Length=414

 Score =   302 bits (774),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 176/195 (90%), Gaps = 4/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGM + Q+ITF GEADEAPDTITGDI+FVLQQKEH KFKRKGDD+F+EH+L+L +ALC
Sbjct  222  VEKGMSHNQKITFQGEADEAPDTITGDIIFVLQQKEHPKFKRKGDDLFLEHSLSLLDALC  281

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPE-  514
            GFQF +THLD RQLL+KS+PGE++KP QFKAINDEGMP +Q+PFM+G LYIHF+VDFPE 
Sbjct  282  GFQFTITHLDGRQLLVKSRPGEIIKPGQFKAINDEGMPHHQRPFMKGTLYIHFSVDFPES  341

Query  513  -TLTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
             +LTP+QCKALEAVLPPRP++++T+MELDECEETTL+DVN+EEEMR+KQQQQ QE Y+ED
Sbjct  342  GSLTPEQCKALEAVLPPRPSSQLTEMELDECEETTLHDVNLEEEMRKKQQQQQQEAYDED  401

Query  336  EDMHGGAQRVQCAQQ  292
            ++  G   RVQCAQQ
Sbjct  402  DEPAG--PRVQCAQQ  414



>ref|NP_189997.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
 sp|Q94AW8.2|DNAJ3_ARATH RecName: Full=Chaperone protein dnaJ 3; Short=AtDjA3; Short=AtJ3; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAB86892.1| AtJ3 [Arabidopsis thaliana]
 emb|CAB88419.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AAK59592.1| putative dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AAM44926.1| putative DnaJ-like protein atj3 [Arabidopsis thaliana]
 gb|AAM65624.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 dbj|BAE98606.1| dnaJ protein homolog atj3 [Arabidopsis thaliana]
 gb|AEE77863.1| chaperone protein dnaJ 3 [Arabidopsis thaliana]
Length=420

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 174/196 (89%), Gaps = 4/196 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  226  VEKGMQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD R LLIKS PGEVVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDGRSLLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KALEAVLP     +++DME+DECEETTL+DVNIE+EMRRK Q Q +E Y++D++
Sbjct  346  LSPDQTKALEAVLPKPSTAQLSDMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDE  404

Query  330  MH---GGAQRVQCAQQ  292
                 GGAQRVQCAQQ
Sbjct  405  DDDHPGGAQRVQCAQQ  420



>ref|XP_010089281.1| DnaJ-like protein [Morus notabilis]
 gb|EXB37606.1| DnaJ-like protein [Morus notabilis]
Length=419

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/195 (73%), Positives = 167/195 (86%), Gaps = 3/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN Q+I F G+ADEAPDTITGDIVF+LQ KEH +FKRK DD++VEHTL+LTEALC
Sbjct  226  VEKGMQNNQKIVFEGQADEAPDTITGDIVFILQLKEHPRFKRKYDDLYVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF L HLD RQLLIKS PGE++KPDQ+KAINDEGMP +Q+PFM+G+LYIHF V FP+ 
Sbjct  286  GFQFALNHLDGRQLLIKSNPGEIIKPDQYKAINDEGMPHHQRPFMKGRLYIHFNVVFPDA  345

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PDQC+ LE +LPPRP+  +TDME+D+CEETTL+DVNIEEEMRRKQQQQ QE Y+ED
Sbjct  346  GVLSPDQCRTLEKILPPRPSKCLTDMEVDDCEETTLHDVNIEEEMRRKQQQQYQEAYDED  405

Query  336  EDMHGGAQRVQCAQQ  292
            +D      RVQCAQQ
Sbjct  406  DD-ESSMPRVQCAQQ  419



>ref|XP_002877319.1| hypothetical protein ARALYDRAFT_905503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53578.1| hypothetical protein ARALYDRAFT_905503 [Arabidopsis lyrata subsp. 
lyrata]
Length=421

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 147/196 (75%), Positives = 175/196 (89%), Gaps = 4/196 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  227  VEKGMQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD R LLIKS PGEVVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  287  GFQFVLTHLDGRNLLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDS  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KALEAVLP    T+++DME+DECEETTL+DVNIE+EM+RK Q Q +E Y++D++
Sbjct  347  LSPDQTKALEAVLPKPSTTQLSDMEIDECEETTLHDVNIEDEMKRKAQAQ-REAYDDDDE  405

Query  330  MH---GGAQRVQCAQQ  292
                 GGAQRVQCAQQ
Sbjct  406  DDDHPGGAQRVQCAQQ  421



>ref|XP_006292339.1| hypothetical protein CARUB_v10018551mg [Capsella rubella]
 gb|EOA25237.1| hypothetical protein CARUB_v10018551mg [Capsella rubella]
Length=420

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 174/196 (89%), Gaps = 4/196 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  226  VEKGMQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD R LLIKS PGEVVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDGRNLLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KALEAVLP     +++DME+DECEETTL+DVNIE+EMRRK Q Q +E Y++D+D
Sbjct  346  LSPDQTKALEAVLPKPSTAQLSDMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDD  404

Query  330  MH---GGAQRVQCAQQ  292
                 GGAQRVQCAQQ
Sbjct  405  DDDHPGGAQRVQCAQQ  420



>ref|XP_010454471.1| PREDICTED: chaperone protein dnaJ 2 [Camelina sativa]
Length=420

 Score =   301 bits (772),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 143/194 (74%), Positives = 171/194 (88%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  228  VEKGMQHNQKITFNGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVL HLD+R+LLIKS PGEVVKPD +KAINDEGM MYQ+PFM+GKLYIHFTV+FPE+
Sbjct  288  GFQFVLNHLDSRKLLIKSNPGEVVKPDSYKAINDEGMVMYQRPFMKGKLYIHFTVEFPES  347

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ K +E VLP      ++DM++D+CEETTL+DVNIE+EMRRK Q Q +E Y++D++
Sbjct  348  LSPDQTKTIEEVLPKPTKATMSDMDIDDCEETTLHDVNIEDEMRRKAQAQ-REAYDDDDE  406

Query  330  MH-GGAQRVQCAQQ  292
             H GG QRVQCAQQ
Sbjct  407  EHPGGGQRVQCAQQ  420



>emb|CBI28261.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   300 bits (769),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/193 (75%), Positives = 160/193 (83%), Gaps = 24/193 (12%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ++TFPGEADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  226  VEKGMQNGQKVTFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF+LTHLD RQLLIKS PGEVVKPDQFKAINDEGMP+YQ+PFMRGKLYI F V+FP+T
Sbjct  286  GFQFILTHLDGRQLLIKSNPGEVVKPDQFKAINDEGMPIYQRPFMRGKLYIQFNVEFPDT  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+QCKALEAVLP R  T++TDMELDECEETTL+                        D
Sbjct  346  LSPEQCKALEAVLPARATTQLTDMELDECEETTLH------------------------D  381

Query  330  MHGGAQRVQCAQQ  292
            M GGAQRVQCAQQ
Sbjct  382  MPGGAQRVQCAQQ  394



>ref|XP_006404506.1| hypothetical protein EUTSA_v10010407mg [Eutrema salsugineum]
 gb|ESQ45959.1| hypothetical protein EUTSA_v10010407mg [Eutrema salsugineum]
Length=421

 Score =   301 bits (771),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 174/195 (89%), Gaps = 2/195 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  227  VEKGMQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD R LL+KS PGEVVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  287  GFQFVLTHLDGRNLLVKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDS  346

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQ--AQEVYEED  337
            L+P+Q KALEAVLP    T+++DME+DECEETTL+DVNIE+EMRRK Q Q  A +  ++D
Sbjct  347  LSPNQTKALEAVLPKPSTTQLSDMEIDECEETTLHDVNIEDEMRRKAQAQREAYDDDDDD  406

Query  336  EDMHGGAQRVQCAQQ  292
            ++  GGAQRVQCAQQ
Sbjct  407  DEHPGGAQRVQCAQQ  421



>ref|XP_006287824.1| hypothetical protein CARUB_v10001042mg [Capsella rubella]
 gb|EOA20722.1| hypothetical protein CARUB_v10001042mg [Capsella rubella]
Length=421

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 172/194 (89%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFVLQQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  228  VEKGMQHSQKITFSGQADEAPDTVTGDIVFVLQQKEHPKFKRKGDDLFVEHTLSLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD+R+LLIKS PGEVVKPD +KAINDEGM +YQ+PFM+GKLYIHFTV FPE+
Sbjct  288  GFQFVLTHLDSRKLLIKSNPGEVVKPDSYKAINDEGMVIYQRPFMKGKLYIHFTVVFPES  347

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KA+EAVLP      ++DM++D+CEETTL+DVNIE+EMRRK Q Q +   ++D++
Sbjct  348  LSPDQTKAIEAVLPKPTKAAMSDMDIDDCEETTLHDVNIEDEMRRKAQAQREAYDDDDDE  407

Query  330  MH-GGAQRVQCAQQ  292
             H GGAQRVQCAQQ
Sbjct  408  DHPGGAQRVQCAQQ  421



>ref|XP_010535721.1| PREDICTED: chaperone protein dnaJ 3 [Tarenaya hassleriana]
Length=423

 Score =   301 bits (771),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 178/199 (89%), Gaps = 7/199 (4%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFVLQQKEH +FKRKGDD+FVEHTL+LTEALC
Sbjct  226  VEKGMQHSQKITFSGQADEAPDTVTGDIVFVLQQKEHPRFKRKGDDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF  THLD RQLLI+S PGEVVKPD +KAINDEGMP+YQ+PFM+GKLYIHF+V+FPE+
Sbjct  286  GFQFAQTHLDGRQLLIRSNPGEVVKPDSYKAINDEGMPIYQRPFMKGKLYIHFSVEFPES  345

Query  510  LTPDQCKALEAVLPPRPAT---KITDMELDECEETTLYDV-NIEEEMRRKQQQQAQEVYE  343
            L+PDQ KA+EAVLP RP++   ++T+ME+DECEETTL+DV N+EEEMRRKQQ Q +E Y+
Sbjct  346  LSPDQAKAIEAVLPGRPSSSKKQLTEMEIDECEETTLHDVSNMEEEMRRKQQAQ-REAYD  404

Query  342  EDEDMHG--GAQRVQCAQQ  292
            +D+D  G  GAQRVQCAQQ
Sbjct  405  DDDDDDGPHGAQRVQCAQQ  423



>ref|XP_010427107.1| PREDICTED: chaperone protein dnaJ 3 isoform X1 [Camelina sativa]
 ref|XP_010427108.1| PREDICTED: chaperone protein dnaJ 3 isoform X2 [Camelina sativa]
Length=420

 Score =   301 bits (771),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 173/196 (88%), Gaps = 4/196 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  226  VEKGMQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD R LLIKS PGEVVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTVDFP++
Sbjct  286  GFQFVLTHLDGRSLLIKSNPGEVVKPDSYKAISDEGMPVYQRPFMKGKLYIHFTVDFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+Q KALEAVLP     ++ DME+DECEETTL+DVNIE+EMRRK Q Q +E Y++D+D
Sbjct  346  LSPEQTKALEAVLPKPSTAQLNDMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDD  404

Query  330  MH---GGAQRVQCAQQ  292
                 GGAQRVQCAQQ
Sbjct  405  DDDHPGGAQRVQCAQQ  420



>ref|XP_010514755.1| PREDICTED: chaperone protein dnaJ 3-like [Camelina sativa]
Length=420

 Score =   301 bits (770),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 173/196 (88%), Gaps = 4/196 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  226  VEKGMQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD R LLIKS PGEVVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTVDFP++
Sbjct  286  GFQFVLTHLDGRSLLIKSNPGEVVKPDSYKAISDEGMPVYQRPFMKGKLYIHFTVDFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+P+Q KALEAVLP     ++ DME+DECEETTL+DVNIE+EMRRK Q Q +E Y++D+D
Sbjct  346  LSPEQTKALEAVLPKPSTAQLNDMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDD  404

Query  330  MH---GGAQRVQCAQQ  292
                 GGAQRVQCAQQ
Sbjct  405  DDDHPGGAQRVQCAQQ  420



>gb|AAK74013.1| AT3g44110/F26G5_60 [Arabidopsis thaliana]
Length=420

 Score =   301 bits (770),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 174/196 (89%), Gaps = 4/196 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            V+KGMQ+ Q+ITF G+ADEAPDT+TGDIVFVLQQKEH KFKRKG+D+FVEHTL+LTEALC
Sbjct  226  VKKGMQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPKFKRKGEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD R LLIKS PGEVVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDGRSLLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KALEAVLP     +++DME+DECEETTL+DVNIE+EMRRK Q Q +E Y++D++
Sbjct  346  LSPDQTKALEAVLPKPSTAQLSDMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDE  404

Query  330  MH---GGAQRVQCAQQ  292
                 GGAQRVQCAQQ
Sbjct  405  DDDHPGGAQRVQCAQQ  420



>gb|AAB49030.1| DnaJ homolog [Arabidopsis thaliana]
Length=420

 Score =   301 bits (770),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 146/196 (74%), Positives = 174/196 (89%), Gaps = 4/196 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFVLQQKEH +FKRKG+D+FVEHTL+LTEALC
Sbjct  226  VEKGMQHSQKITFEGQADEAPDTVTGDIVFVLQQKEHPQFKRKGEDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD R LLIKS PGEVVKPD +KAI+DEGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  286  GFQFVLTHLDGRSLLIKSNPGEVVKPDSYKAISDEGMPIYQRPFMKGKLYIHFTVEFPDS  345

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ KALEAVLP     +++DME+DECEETTL+DVNIE+EMRRK Q Q +E Y++D++
Sbjct  346  LSPDQTKALEAVLPKPSTAQLSDMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDDE  404

Query  330  MH---GGAQRVQCAQQ  292
                 GGAQRVQCAQQ
Sbjct  405  DDDHPGGAQRVQCAQQ  420



>ref|XP_009126521.1| PREDICTED: chaperone protein dnaJ 3 [Brassica rapa]
Length=423

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 177/197 (90%), Gaps = 6/197 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+QQKEH+ FKRKGDD+FVEHTL+LTEALC
Sbjct  229  VEKGMQHSQKITFRGQADEAPDTVTGDIVFVIQQKEHSTFKRKGDDLFVEHTLSLTEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD ++AI+DEGMP++Q+PFM+GKLYIHFTV+FP++
Sbjct  289  GFQFVLTHLDTRQLLIKSSPGEVVKPDSYRAISDEGMPIHQRPFMKGKLYIHFTVEFPDS  348

Query  510  LTPDQCKALEAVLPPRPATK-ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---E  343
            L+PDQ KA+EAVL PRPA   ++DME+DECEETTL+DVNIE+EMRRK Q Q +E Y   +
Sbjct  349  LSPDQTKAIEAVL-PRPANATLSDMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDD  406

Query  342  EDEDMHGGAQRVQCAQQ  292
            +DE+  GGAQRVQCAQQ
Sbjct  407  DDEEGPGGAQRVQCAQQ  423



>emb|CDY16617.1| BnaC09g36560D [Brassica napus]
Length=208

 Score =   293 bits (749),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 172/195 (88%), Gaps = 3/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            +EKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  15   IEKGMQHSQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALC  74

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD ++AI DEGMP++Q+PFM+GKLYIHFTVDFP++
Sbjct  75   GFQFVLTHLDKRQLLIKSSPGEVVKPDSYRAITDEGMPVHQRPFMKGKLYIHFTVDFPDS  134

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQ--AQEVYEED  337
            L+PDQ KA+EAVL P+P   ++DME DECEETTL++VNIE+EMRRK Q Q  A +  ++D
Sbjct  135  LSPDQTKAIEAVL-PKPKADLSDMETDECEETTLHEVNIEDEMRRKAQAQREAYDDDDDD  193

Query  336  EDMHGGAQRVQCAQQ  292
            E+  GG QRVQCAQQ
Sbjct  194  EEGPGGPQRVQCAQQ  208



>emb|CDY09117.1| BnaA02g05430D [Brassica napus]
Length=423

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/197 (75%), Positives = 177/197 (90%), Gaps = 6/197 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+QQKEH+ FKRKGDD+FVEHTL+LTEALC
Sbjct  229  VEKGMQHSQKITFRGQADEAPDTVTGDIVFVIQQKEHSTFKRKGDDLFVEHTLSLTEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD ++AI+DEGMP++Q+PFM+GKLYIHFTV+FP++
Sbjct  289  GFQFVLTHLDTRQLLIKSNPGEVVKPDSYRAISDEGMPIHQRPFMKGKLYIHFTVEFPDS  348

Query  510  LTPDQCKALEAVLPPRPATK-ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY---E  343
            L+PDQ KA+EAVL PRPA   ++DME+DECEETTL+DVNIE+EMRRK Q Q +E Y   +
Sbjct  349  LSPDQTKAIEAVL-PRPANATLSDMEIDECEETTLHDVNIEDEMRRKAQAQ-REAYDDDD  406

Query  342  EDEDMHGGAQRVQCAQQ  292
            +DE+  GGAQRVQCAQQ
Sbjct  407  DDEEGPGGAQRVQCAQQ  423



>gb|KFK26344.1| hypothetical protein AALP_AA8G235700 [Arabis alpina]
Length=421

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/196 (73%), Positives = 175/196 (89%), Gaps = 4/196 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            V+KGMQ+ Q+IT  G+ADEAPDT+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  227  VDKGMQHSQKITMTGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD +KAI++EGMP+YQ+PFM+GKLYIHFTV+FP++
Sbjct  287  GFQFVLTHLDKRQLLIKSNPGEVVKPDSYKAISEEGMPIYQRPFMKGKLYIHFTVEFPDS  346

Query  510  LTPDQCKALEAVLP-PRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDE  334
            L+PDQ KA+EAVLP P  A + +DM++DECEETTL+DVNIE+EM+RK Q Q +E Y++D+
Sbjct  347  LSPDQTKAIEAVLPKPAKAAQTSDMDIDECEETTLHDVNIEDEMKRKAQAQ-REAYDDDD  405

Query  333  DMH--GGAQRVQCAQQ  292
            +    GGAQRVQCAQQ
Sbjct  406  EGEGPGGAQRVQCAQQ  421



>ref|XP_010493266.1| PREDICTED: chaperone protein dnaJ 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010493267.1| PREDICTED: chaperone protein dnaJ 2-like isoform X2 [Camelina 
sativa]
Length=420

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 142/194 (73%), Positives = 171/194 (88%), Gaps = 2/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+Q KEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  228  VEKGMQHNQKITFSGQADEAPDTVTGDIVFVIQLKEHPKFKRKGDDLFVEHTLSLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GF FVLTHLD+R+LLIKS PGEVVKPD +KAINDEGM MYQ+PFM+GKLYIHFTV+FPE+
Sbjct  288  GFHFVLTHLDSRKLLIKSNPGEVVKPDSYKAINDEGMVMYQRPFMKGKLYIHFTVEFPES  347

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDED  331
            L+PDQ K +E VLP      ++DM++D+CEETTL+DVNIE+EM+RK Q Q +E Y++D++
Sbjct  348  LSPDQTKTIEEVLPKPTKATMSDMDIDDCEETTLHDVNIEDEMKRKAQAQ-REAYDDDDE  406

Query  330  MH-GGAQRVQCAQQ  292
             H GGAQRVQCAQQ
Sbjct  407  EHPGGAQRVQCAQQ  420



>ref|XP_010520679.1| PREDICTED: chaperone protein dnaJ 3-like [Tarenaya hassleriana]
Length=484

 Score =   301 bits (772),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/194 (74%), Positives = 174/194 (90%), Gaps = 1/194 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            V+KGMQ+ Q++TF G+ADEAPDTITGDIVFVLQQKEH +FKRKGDD+FVEHTL+L EALC
Sbjct  291  VDKGMQHNQKVTFSGQADEAPDTITGDIVFVLQQKEHPRFKRKGDDLFVEHTLSLAEALC  350

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD+RQLLI+S PGEVVKPD +KAINDEGMP+YQ+PFM+GKLYIHF+V+FPE+
Sbjct  351  GFQFVLTHLDDRQLLIRSSPGEVVKPDSYKAINDEGMPVYQRPFMKGKLYIHFSVEFPES  410

Query  510  LTPDQCKALEAVLPPRPA-TKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDE  334
            L+PDQ KALEAVLP +P+  ++T+ME+DECEETTL+ VN+EEEMRRKQQ Q +   ++D+
Sbjct  411  LSPDQAKALEAVLPQKPSGNQLTEMEIDECEETTLHQVNMEEEMRRKQQSQREAYDDDDD  470

Query  333  DMHGGAQRVQCAQQ  292
            D   G QRVQCAQQ
Sbjct  471  DGDDGPQRVQCAQQ  484



>gb|KHG16062.1| Chaperone protein dnaJ 3 [Gossypium arboreum]
Length=321

 Score =   295 bits (756),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -2

Query  810  PDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQP  631
            PDT+TGDIVFVLQQK+H KFKRKGDD+FVEHTLTLTEALCGFQF+LTHLD RQLLIK+ P
Sbjct  127  PDTVTGDIVFVLQQKDHPKFKRKGDDLFVEHTLTLTEALCGFQFILTHLDGRQLLIKTHP  186

Query  630  GEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATK  451
            GEVVKPDQ KAINDEGMPMYQ+PFMRGKLYIHFTVDFP++L P+QCKALEAVLP R + +
Sbjct  187  GEVVKPDQCKAINDEGMPMYQRPFMRGKLYIHFTVDFPDSLAPEQCKALEAVLPSRASVQ  246

Query  450  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHG  322
            +TDMELDECEETTLYDVNIEEEMRRKQ Q AQE YEED+DMH 
Sbjct  247  LTDMELDECEETTLYDVNIEEEMRRKQAQAAQEAYEEDDDMHA  289



>ref|XP_001755408.1| predicted protein [Physcomitrella patens]
 gb|EDQ79888.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   298 bits (763),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 147/195 (75%), Positives = 169/195 (87%), Gaps = 6/195 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGM +GQ+ITF GEADEAPDT TGDIVFVLQ KEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  229  VEKGMMHGQKITFQGEADEAPDTQTGDIVFVLQLKEHPKFKRKGDDLFVEHTLSLTEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GF+F L HLD RQLLIKS  GE++KP QFKAINDEGMP YQ+PFM+G+L++HF V+FPE+
Sbjct  289  GFRFPLVHLDGRQLLIKSDAGEIIKPGQFKAINDEGMPHYQRPFMKGRLFLHFNVEFPES  348

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              LTPDQCKALE +LPPRP +++TDMELDECEETTL DVN E+EMRRKQQQQ QE Y+ED
Sbjct  349  GGLTPDQCKALETILPPRP-SQMTDMELDECEETTLIDVNFEDEMRRKQQQQ-QEAYDED  406

Query  336  EDMHGGAQRVQCAQQ  292
            E+  G   R+QCAQQ
Sbjct  407  EESSG--PRIQCAQQ  419



>ref|XP_001768102.1| predicted protein [Physcomitrella patens]
 gb|EDQ66975.1| predicted protein [Physcomitrella patens]
Length=419

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 167/195 (86%), Gaps = 5/195 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITF GEADEAPDTITGDIVFVLQ KEH KFKRK DD+FVEHTL+LTEALC
Sbjct  228  VEKGMQHGQKITFQGEADEAPDTITGDIVFVLQLKEHPKFKRKVDDLFVEHTLSLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPE-  514
            GFQF LTHLD RQLLIKS PGE++KP QFKAINDEGMP + +PFM+G+LY+HFTV+ PE 
Sbjct  288  GFQFPLTHLDGRQLLIKSAPGEIIKPGQFKAINDEGMPHHLRPFMKGRLYLHFTVEVPES  347

Query  513  -TLTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
             +L+ +Q KALE VLPPRP  ++TDMELDECEETTLYDVNI+EEMRRK Q  AQE YEED
Sbjct  348  GSLSLEQIKALETVLPPRPTRQMTDMELDECEETTLYDVNIDEEMRRK-QVHAQEAYEED  406

Query  336  EDMHGGAQRVQCAQQ  292
            E+  G   R QCAQQ
Sbjct  407  EESSG--PRTQCAQQ  419



>gb|KHN36510.1| DnaJ protein like [Glycine soja]
Length=298

 Score =   292 bits (748),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 158/173 (91%), Gaps = 1/173 (1%)
 Frame = -2

Query  810  PDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQP  631
            PDT+TGDIVFVLQQKEH KFKRK DD+FVEHTL+LTEALCGFQFVLTHLD+RQLLIKS P
Sbjct  127  PDTVTGDIVFVLQQKEHPKFKRKADDLFVEHTLSLTEALCGFQFVLTHLDSRQLLIKSNP  186

Query  630  GEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPDQCKALEAVLPPRPATK  451
            GEVVKP+ FKAINDEGMP YQ+ F++GKLYIHF+V+FP+TL+ DQ KALEA LP +P ++
Sbjct  187  GEVVKPESFKAINDEGMPNYQRHFLKGKLYIHFSVEFPDTLSLDQVKALEATLPLKPTSQ  246

Query  450  ITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEEDEDMHGGAQRVQCAQQ  292
            +TDMELDECEETTL+DVN+EEE RR+QQ Q QE Y+EDEDMHGGAQRVQCAQQ
Sbjct  247  LTDMELDECEETTLHDVNMEEETRRRQQAQ-QEAYDEDEDMHGGAQRVQCAQQ  298



>ref|XP_010933633.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Elaeis guineensis]
Length=416

 Score =   296 bits (758),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 167/195 (86%), Gaps = 5/195 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ  Q+I F GEADEAPDT+TGDIVFV+QQKEH KFKRK DD++VEHTL+L+EALC
Sbjct  225  VEKGMQQSQKIVFQGEADEAPDTVTGDIVFVVQQKEHPKFKRKYDDLYVEHTLSLSEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS PGEVVKP QFKAINDEGMP + +PFMRG+LYI F V+FP++
Sbjct  285  GFQFALTHLDGRQLLIKSNPGEVVKPGQFKAINDEGMPHHGRPFMRGRLYIQFNVEFPDS  344

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PDQC+ LE  LPPRP+ +++DMELDECEETTLYDVNIEEEMRRKQQQQ QE Y+ED
Sbjct  345  GVLSPDQCRMLETFLPPRPSNRLSDMELDECEETTLYDVNIEEEMRRKQQQQQQEAYDED  404

Query  336  EDMHGGAQRVQCAQQ  292
            +D      RVQCAQQ
Sbjct  405  DD---AIPRVQCAQQ  416



>ref|XP_010933632.1| PREDICTED: dnaJ protein homolog isoform X1 [Elaeis guineensis]
Length=421

 Score =   296 bits (758),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 167/195 (86%), Gaps = 5/195 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ  Q+I F GEADEAPDT+TGDIVFV+QQKEH KFKRK DD++VEHTL+L+EALC
Sbjct  230  VEKGMQQSQKIVFQGEADEAPDTVTGDIVFVVQQKEHPKFKRKYDDLYVEHTLSLSEALC  289

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS PGEVVKP QFKAINDEGMP + +PFMRG+LYI F V+FP++
Sbjct  290  GFQFALTHLDGRQLLIKSNPGEVVKPGQFKAINDEGMPHHGRPFMRGRLYIQFNVEFPDS  349

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PDQC+ LE  LPPRP+ +++DMELDECEETTLYDVNIEEEMRRKQQQQ QE Y+ED
Sbjct  350  GVLSPDQCRMLETFLPPRPSNRLSDMELDECEETTLYDVNIEEEMRRKQQQQQQEAYDED  409

Query  336  EDMHGGAQRVQCAQQ  292
            +D      RVQCAQQ
Sbjct  410  DD---AIPRVQCAQQ  421



>ref|XP_008803820.1| PREDICTED: dnaJ protein homolog 2-like [Phoenix dactylifera]
Length=417

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 167/195 (86%), Gaps = 5/195 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ ++I F GEADEAPDT+TGDI+F+LQQKEH KFKRK DD+FVEHTL+LTEALC
Sbjct  226  VEKGMQHSEKIVFQGEADEAPDTVTGDIIFILQQKEHPKFKRKYDDLFVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS PGEVVKP QFKAINDEGMP + +PFM+G+LYI F V+FP++
Sbjct  286  GFQFALTHLDGRQLLIKSNPGEVVKPGQFKAINDEGMPHHGRPFMKGRLYIQFNVEFPDS  345

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PDQC ALE +LPPRP+  + DMELDECEETTLYDVN+EEE RRKQQQQ Q+ Y+ED
Sbjct  346  GALSPDQCHALETLLPPRPSNHLLDMELDECEETTLYDVNMEEETRRKQQQQQQDAYDED  405

Query  336  EDMHGGAQRVQCAQQ  292
            ED    A RVQCAQQ
Sbjct  406  ED---AAPRVQCAQQ  417



>ref|XP_006445374.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 ref|XP_006445375.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 gb|ESR58614.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 gb|ESR58615.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
Length=337

 Score =   291 bits (745),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 166/195 (85%), Gaps = 4/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+I F G+ADEAPDTITGDIVF+LQ KEH KFKRK DD++V+HTL+LTEALC
Sbjct  145  VEKGMQHGQKIAFEGQADEAPDTITGDIVFILQLKEHPKFKRKFDDLYVDHTLSLTEALC  204

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS PGE++KP Q+KAINDEGMP +Q+PFM+G+LYI F V+FPE 
Sbjct  205  GFQFALTHLDGRQLLIKSNPGEIIKPGQYKAINDEGMPHHQRPFMKGRLYIQFNVEFPEC  264

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PDQC+ LE+VLPPRP   ++DMELD+CEE T++DVNI+EEMRRK+ QQ QE Y+ED
Sbjct  265  GILSPDQCRTLESVLPPRPGKNLSDMELDDCEEVTMHDVNIDEEMRRKRYQQQQEAYDED  324

Query  336  EDMHGGAQRVQCAQQ  292
            ++      RVQCAQQ
Sbjct  325  DEP--AMPRVQCAQQ  337



>ref|XP_009779099.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
 ref|XP_009779100.1| PREDICTED: dnaJ protein homolog [Nicotiana sylvestris]
Length=423

 Score =   293 bits (749),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 132/195 (68%), Positives = 166/195 (85%), Gaps = 2/195 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+I F GEADEAPDTITGDI+F+LQQK+H+KF+RK DD++ EH L+LTEALC
Sbjct  229  VEKGMQHGQKIVFDGEADEAPDTITGDIIFILQQKDHSKFRRKSDDLYAEHNLSLTEALC  288

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD R LLIKS PGEV+KPDQ+KAINDEGMP Y +PF++G+LYIHF V+FPE+
Sbjct  289  GFQFVLTHLDGRLLLIKSSPGEVIKPDQYKAINDEGMPHYGRPFIKGRLYIHFNVEFPES  348

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              LTP++C+ LE+VLPPRP  + +DMEL+ CEETTL+DVN+EEEMR+K+Q++ QE Y+ D
Sbjct  349  GFLTPEKCRILESVLPPRPGKRASDMELNNCEETTLHDVNMEEEMRQKEQRRRQEAYDMD  408

Query  336  EDMHGGAQRVQCAQQ  292
            +D      R+ C QQ
Sbjct  409  DDDEPNVHRMACNQQ  423



>ref|XP_010248011.1| PREDICTED: dnaJ protein homolog 2-like [Nelumbo nucifera]
 ref|XP_010248012.1| PREDICTED: dnaJ protein homolog 2-like [Nelumbo nucifera]
Length=417

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/195 (74%), Positives = 170/195 (87%), Gaps = 4/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            +EKGMQ+GQ+I F GEADEAPDTITGDIVFVLQ KEH KFKRK DD++VEHTL+LTEALC
Sbjct  225  IEKGMQHGQKIVFRGEADEAPDTITGDIVFVLQLKEHPKFKRKFDDLYVEHTLSLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS PGEV+KP Q+KAINDEGMP +Q+PFM+G+LYI F+VDFP+T
Sbjct  285  GFQFALTHLDGRQLLIKSNPGEVIKPGQYKAINDEGMPHHQRPFMKGRLYIEFSVDFPDT  344

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PDQC+ LE +LPPR ++ +++MELDECEETTL+DVNIEEEMRRKQQQQ QE Y+ED
Sbjct  345  GVLSPDQCRTLETILPPRTSSHLSEMELDECEETTLHDVNIEEEMRRKQQQQQQEAYDED  404

Query  336  EDMHGGAQRVQCAQQ  292
            ++      RVQCAQQ
Sbjct  405  DEP--SMPRVQCAQQ  417



>ref|XP_006445376.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 ref|XP_006464459.1| PREDICTED: dnaJ protein homolog 2-like [Citrus sinensis]
 gb|ESR58616.1| hypothetical protein CICLE_v10020330mg [Citrus clementina]
 gb|KDO85581.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
 gb|KDO85582.1| hypothetical protein CISIN_1g014800mg [Citrus sinensis]
Length=418

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 166/195 (85%), Gaps = 4/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+I F G+ADEAPDTITGDIVF+LQ KEH KFKRK DD++V+HTL+LTEALC
Sbjct  226  VEKGMQHGQKIAFEGQADEAPDTITGDIVFILQLKEHPKFKRKFDDLYVDHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS PGE++KP Q+KAINDEGMP +Q+PFM+G+LYI F V+FPE 
Sbjct  286  GFQFALTHLDGRQLLIKSNPGEIIKPGQYKAINDEGMPHHQRPFMKGRLYIQFNVEFPEC  345

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PDQC+ LE+VLPPRP   ++DMELD+CEE T++DVNI+EEMRRK+ QQ QE Y+ED
Sbjct  346  GILSPDQCRTLESVLPPRPGKNLSDMELDDCEEVTMHDVNIDEEMRRKRYQQQQEAYDED  405

Query  336  EDMHGGAQRVQCAQQ  292
            ++      RVQCAQQ
Sbjct  406  DEP--AMPRVQCAQQ  418



>emb|CDY65546.1| BnaCnng47600D [Brassica napus]
Length=421

 Score =   291 bits (746),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 172/195 (88%), Gaps = 3/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+ITF G+ADEAPDT+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  228  VEKGMQHSQKITFSGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD ++AI DEGMP++Q+PFM+GKLYIHFTVDFP++
Sbjct  288  GFQFVLTHLDKRQLLIKSSPGEVVKPDSYRAITDEGMPVHQRPFMKGKLYIHFTVDFPDS  347

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQ--AQEVYEED  337
            L+PDQ KA+EAVL P+P   ++DME DECEETTL++VNIE+EMRRK Q Q  A +  ++D
Sbjct  348  LSPDQTKAIEAVL-PKPKADLSDMETDECEETTLHEVNIEDEMRRKAQAQREAYDDDDDD  406

Query  336  EDMHGGAQRVQCAQQ  292
            E+  GG QRVQCAQQ
Sbjct  407  EEGPGGPQRVQCAQQ  421



>ref|XP_002963792.1| hypothetical protein SELMODRAFT_230221 [Selaginella moellendorffii]
 gb|EFJ35663.1| hypothetical protein SELMODRAFT_230221 [Selaginella moellendorffii]
Length=413

 Score =   291 bits (745),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 165/195 (85%), Gaps = 4/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADE PD ITGD++F+LQ+KEH+KFKRKGDD+F EH LTL EALC
Sbjct  221  VEKGMQHGQKITFPGEADECPDAITGDVIFILQEKEHSKFKRKGDDLFTEHKLTLVEALC  280

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPE-  514
            GFQFVLT LD RQLLIKS PGE++KP QFKA+NDEGMP +Q+PF++G+LYI F+VDFPE 
Sbjct  281  GFQFVLTQLDGRQLLIKSAPGEIIKPGQFKAVNDEGMPQHQRPFVKGRLYIQFSVDFPEP  340

Query  513  -TLTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L PD  K LE+VLPPRPA ++T +ELDECEE TL+DVNI+EEM+ K QQQ +E Y++D
Sbjct  341  RALNPDMLKTLESVLPPRPALQLTQVELDECEEATLHDVNIDEEMKSKHQQQ-REAYDDD  399

Query  336  EDMHGGAQRVQCAQQ  292
            +D   G  RVQCAQQ
Sbjct  400  DDPSAG-HRVQCAQQ  413



>ref|XP_009622737.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana tomentosiformis]
 ref|XP_009622738.1| PREDICTED: dnaJ protein homolog 2-like [Nicotiana tomentosiformis]
Length=421

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 164/195 (84%), Gaps = 3/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+ Q+I F GEADEAPDTITGDIVFVLQQK+H+KFKRK DD+++EHTLTLTEALC
Sbjct  228  VEKGMQHNQKIVFEGEADEAPDTITGDIVFVLQQKDHSKFKRKFDDLYMEHTLTLTEALC  287

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEV+KPDQ+KAINDEGMP Y +PF++G+LYIHF VDFPE+
Sbjct  288  GFQFVLTHLDGRQLLIKSNPGEVIKPDQYKAINDEGMPSYGRPFIKGRLYIHFNVDFPES  347

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+P+ C+ +  +LP RP    ++MELD+CEETT+++VNIEEEMRRK++Q+ QE Y+ D
Sbjct  348  GVLSPETCRGIGTILPARPGKGSSEMELDKCEETTMHNVNIEEEMRRKEKQRQQEAYDSD  407

Query  336  EDMHGGAQRVQCAQQ  292
            +D      RV C QQ
Sbjct  408  DD-EPNVHRVACNQQ  421



>ref|XP_009382439.1| PREDICTED: dnaJ protein homolog [Musa acuminata subsp. malaccensis]
Length=423

 Score =   290 bits (741),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 141/195 (72%), Positives = 168/195 (86%), Gaps = 5/195 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+I F GEADEAPDT+TGDIVFVLQ KEH KFKRK DD++V+ TL+LTEALC
Sbjct  232  VEKGMQHGQKIVFAGEADEAPDTVTGDIVFVLQHKEHPKFKRKYDDLYVDRTLSLTEALC  291

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEV+KP Q+KAI+DEGMP + +PFM+G+LYI F V+FPET
Sbjct  292  GFQFVLTHLDGRQLLIKSSPGEVIKPGQYKAIDDEGMPHHGRPFMKGRLYIQFNVEFPET  351

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
               +PDQC++LE +LPPRP+  I++MELDECEETT+YDVNIEEEMRR++ Q+ QE Y+ED
Sbjct  352  GVFSPDQCRSLEKILPPRPSNHISNMELDECEETTMYDVNIEEEMRRQRLQRQQEAYDED  411

Query  336  EDMHGGAQRVQCAQQ  292
            ED    A RVQCAQQ
Sbjct  412  ED---AAPRVQCAQQ  423



>ref|XP_011621168.1| PREDICTED: dnaJ protein homolog 2 [Amborella trichopoda]
Length=415

 Score =   288 bits (736),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 146/195 (75%), Positives = 171/195 (88%), Gaps = 6/195 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQNGQ+I F GEADEAPDT+TGDIVFVLQ KEH KFKRK DD+FVEHTLTLTEALC
Sbjct  225  VEKGMQNGQKIVFQGEADEAPDTVTGDIVFVLQLKEHPKFKRKLDDLFVEHTLTLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS  GE++KP Q+KAINDEGMP YQ+PFM+G+LYIHF VDFPE+
Sbjct  285  GFQFALTHLDGRQLLIKS--GEIIKPGQYKAINDEGMPHYQRPFMKGRLYIHFNVDFPES  342

Query  510  LTPDQCKALEAVLPPRP-ATKITDMELDECEETTLYDVNIEEEMRRK-QQQQAQEVYEED  337
            LTPDQ +ALE +LP +P +++++DME+DECEETT++DVNIE+EMR+K QQQQ QE Y+ED
Sbjct  343  LTPDQSRALEKILPAKPGSSQLSDMEVDECEETTMHDVNIEDEMRKKQQQQQQQEAYDED  402

Query  336  EDMHGGAQRVQCAQQ  292
            E+    A RVQCAQQ
Sbjct  403  EEP--SAPRVQCAQQ  415



>ref|XP_002974881.1| hypothetical protein SELMODRAFT_232411 [Selaginella moellendorffii]
 gb|EFJ24401.1| hypothetical protein SELMODRAFT_232411 [Selaginella moellendorffii]
Length=412

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/195 (70%), Positives = 164/195 (84%), Gaps = 4/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+GQ+ITFPGEADE PD ITGD++F+LQ+KEH+KFKRKGDD+F EH LTL EALC
Sbjct  220  VEKGMQHGQKITFPGEADEYPDAITGDVIFILQEKEHSKFKRKGDDLFTEHKLTLVEALC  279

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPE-  514
            GFQFVLT LD RQLLIKS  GE++KP QFKA+NDEGMP +Q+PF++G+LYI F+VDFPE 
Sbjct  280  GFQFVLTQLDGRQLLIKSAAGEIIKPGQFKAVNDEGMPQHQRPFVKGRLYIQFSVDFPEP  339

Query  513  -TLTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L PD  K LE+VLPPRPA ++T +ELDECEE TL+DVNI+EEM+ K QQQ +E Y++D
Sbjct  340  RALNPDMLKTLESVLPPRPALQLTQVELDECEEATLHDVNIDEEMKSKHQQQ-REAYDDD  398

Query  336  EDMHGGAQRVQCAQQ  292
            +D   G  RVQCAQQ
Sbjct  399  DDPSAG-HRVQCAQQ  412



>ref|XP_010258833.1| PREDICTED: dnaJ protein homolog 2-like isoform X2 [Nelumbo nucifera]
Length=332

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 169/195 (87%), Gaps = 4/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            +EKGMQ+GQ+I F GEADEAPDTITGDIVFVLQ KEH+KFKRK DD++VEHTL+LTEALC
Sbjct  140  IEKGMQHGQKIVFQGEADEAPDTITGDIVFVLQLKEHSKFKRKFDDLYVEHTLSLTEALC  199

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD+RQLLIKS PGEV+KP Q+KAINDEGMP +Q+PFM+G+LYI F VDFP++
Sbjct  200  GFQFALTHLDSRQLLIKSNPGEVIKPGQYKAINDEGMPHHQRPFMKGRLYIQFHVDFPDS  259

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PD+C+ LE +LPPR  + ++ M+LD+CEETTL+DVN++EEMRRKQQQQ QE Y+ED
Sbjct  260  AVLSPDECRTLETILPPRANSHLSGMDLDDCEETTLHDVNVDEEMRRKQQQQQQEAYDED  319

Query  336  EDMHGGAQRVQCAQQ  292
            ++      RVQCAQQ
Sbjct  320  DEP--SMPRVQCAQQ  332



>ref|XP_002983333.1| hypothetical protein SELMODRAFT_118063 [Selaginella moellendorffii]
 ref|XP_002987616.1| hypothetical protein SELMODRAFT_426414 [Selaginella moellendorffii]
 gb|EFJ11191.1| hypothetical protein SELMODRAFT_426414 [Selaginella moellendorffii]
 gb|EFJ15675.1| hypothetical protein SELMODRAFT_118063 [Selaginella moellendorffii]
Length=419

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 162/195 (83%), Gaps = 2/195 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGM + Q+ITF GEADEAPDTITGDIVFV+Q K+H KFKR+GDD+F EHTLTLTEALC
Sbjct  225  VEKGMMHNQKITFQGEADEAPDTITGDIVFVIQVKDHPKFKRRGDDLFYEHTLTLTEALC  284

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPE-  514
            GFQF+LTHLD R LL+KS PGE++KPDQFK I+DEGMP YQ+PFM+G+L+I F VDFP+ 
Sbjct  285  GFQFILTHLDGRSLLVKSTPGEIIKPDQFKGIDDEGMPHYQRPFMKGRLFIQFHVDFPDS  344

Query  513  -TLTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
             +L+P+QCK LE +LPPRP   +TDMELDECEETTL DVNIEEEMRRKQQ Q Q+    D
Sbjct  345  GSLSPEQCKMLETILPPRPTNHLTDMELDECEETTLLDVNIEEEMRRKQQHQQQQQEAYD  404

Query  336  EDMHGGAQRVQCAQQ  292
            ED      RVQCAQQ
Sbjct  405  EDDEPSGPRVQCAQQ  419



>emb|CBI16632.3| unnamed protein product [Vitis vinifera]
Length=692

 Score =   295 bits (754),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 167/191 (87%), Gaps = 3/191 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ+G+RI F GEAD+APDTITGDIVFVLQ K+HAKFKRK DD++VEHTL+LTEALC
Sbjct  226  VEKGMQHGERIVFQGEADQAPDTITGDIVFVLQLKDHAKFKRKYDDLYVEHTLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD RQLLIKS PGE++KPDQ+KAINDEGMP +Q+PFM+GKLYIHF V+FPE+
Sbjct  286  GFQFALTHLDGRQLLIKSNPGEIIKPDQYKAINDEGMPHHQRPFMKGKLYIHFDVEFPES  345

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PDQCKALE++LP + + +I+ ME+DE EETTLYDVNIEEEMRRKQQQQ  E Y+ED
Sbjct  346  GILSPDQCKALESILPQKRSKQISAMEVDEAEETTLYDVNIEEEMRRKQQQQQHEAYDED  405

Query  336  EDMHGGAQRVQ  304
            +D   GA RV 
Sbjct  406  DDDF-GAPRVH  415



>gb|ACJ83716.1| unknown [Medicago truncatula]
Length=156

 Score =   278 bits (710),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/156 (81%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -2

Query  858  MQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALCGFQF  679
            MQN Q+ITFPGEADEAPDT+TGDIVFVLQQKEH KFKRK +D+FVEHTL+LTEALCGFQF
Sbjct  1    MQNSQKITFPGEADEAPDTVTGDIVFVLQQKEHPKFKRKSEDLFVEHTLSLTEALCGFQF  60

Query  678  VLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPETLTPD  499
            VLTHLD RQLLIKS PGEVVKPD +KAINDEGMPMYQ+PFM+GKLYIHFTV+FP+TL+ D
Sbjct  61   VLTHLDGRQLLIKSNPGEVVKPDSYKAINDEGMPMYQRPFMKGKLYIHFTVEFPDTLSLD  120

Query  498  QCKALEAVLPPRPATKITDMELDECEETTLYDVNIE  391
            Q K LEAVLP +P++++TDME+DECEETTL+DVN+E
Sbjct  121  QVKGLEAVLPAKPSSQLTDMEIDECEETTLHDVNME  156



>ref|XP_007052233.1| DNAJ [Theobroma cacao]
 gb|EOX96390.1| DNAJ [Theobroma cacao]
Length=421

 Score =   286 bits (732),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 167/197 (85%), Gaps = 5/197 (3%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            +EKGMQNGQ+ITF G+ADEAPDTITGDIVF+LQ K+H KF+RK DD++VEH L+LTEALC
Sbjct  226  IEKGMQNGQKITFEGQADEAPDTITGDIVFLLQLKKHPKFERKFDDLYVEHNLSLTEALC  285

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            G+QF LTHLD RQLLIKS PGEV+KP Q+KAINDEGMP +Q+PFM+G+L+IHF VDFPE+
Sbjct  286  GYQFALTHLDGRQLLIKSNPGEVIKPGQYKAINDEGMPHHQRPFMKGRLFIHFNVDFPES  345

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQ--EVYE  343
               +P+QC+ LE +LP R +  +TDME+D+CEETTL+DVNIEEEMRRK+QQQ +  E Y+
Sbjct  346  GVFSPEQCRTLETILPMRSSKHLTDMEVDDCEETTLHDVNIEEEMRRKEQQQHRHHEAYD  405

Query  342  EDEDMHGGAQRVQCAQQ  292
            ED+D      RVQCAQQ
Sbjct  406  EDDD-EPSMPRVQCAQQ  421



>ref|XP_010258832.1| PREDICTED: dnaJ protein homolog 2-like isoform X1 [Nelumbo nucifera]
Length=413

 Score =   285 bits (729),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 169/195 (87%), Gaps = 4/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            +EKGMQ+GQ+I F GEADEAPDTITGDIVFVLQ KEH+KFKRK DD++VEHTL+LTEALC
Sbjct  221  IEKGMQHGQKIVFQGEADEAPDTITGDIVFVLQLKEHSKFKRKFDDLYVEHTLSLTEALC  280

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF LTHLD+RQLLIKS PGEV+KP Q+KAINDEGMP +Q+PFM+G+LYI F VDFP++
Sbjct  281  GFQFALTHLDSRQLLIKSNPGEVIKPGQYKAINDEGMPHHQRPFMKGRLYIQFHVDFPDS  340

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PD+C+ LE +LPPR  + ++ M+LD+CEETTL+DVN++EEMRRKQQQQ QE Y+ED
Sbjct  341  AVLSPDECRTLETILPPRANSHLSGMDLDDCEETTLHDVNVDEEMRRKQQQQQQEAYDED  400

Query  336  EDMHGGAQRVQCAQQ  292
            ++      RVQCAQQ
Sbjct  401  DEP--SMPRVQCAQQ  413



>ref|XP_008232370.1| PREDICTED: dnaJ protein homolog 2-like [Prunus mume]
Length=415

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 166/195 (85%), Gaps = 2/195 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGM++GQ+I F G+ADEAPDTITGDIVFVLQ KEHAKFKRK DD++VEHTL LT ALC
Sbjct  221  VEKGMEHGQKIVFEGQADEAPDTITGDIVFVLQLKEHAKFKRKLDDLYVEHTLNLTAALC  280

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLL+KS PGEV+KP Q KAINDEGMP YQ+PFM+G L+IHF V+FP++
Sbjct  281  GFQFVLTHLDGRQLLVKSNPGEVIKPGQSKAINDEGMPHYQRPFMKGNLFIHFNVEFPDS  340

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PDQ + L+ VL P+P+ ++TDMELDECEETT++DVNIE+EMRRK +QQ +E Y+ED
Sbjct  341  GILSPDQSRNLQTVLSPKPSKRLTDMELDECEETTMHDVNIEDEMRRKPRQQYREAYDED  400

Query  336  EDMHGGAQRVQCAQQ  292
            +D      RVQCAQQ
Sbjct  401  DDDDEPMPRVQCAQQ  415



>ref|XP_009131855.1| PREDICTED: chaperone protein dnaJ 3-like [Brassica rapa]
 emb|CDX88812.1| BnaA03g08370D [Brassica napus]
Length=408

 Score =   283 bits (725),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/199 (71%), Positives = 165/199 (83%), Gaps = 11/199 (6%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQN Q+ITF G+ADEAPDT+TGDIVFV+QQKEH KFKRKGDD+FVEHTL+LTEALC
Sbjct  215  VEKGMQNSQKITFRGQADEAPDTVTGDIVFVIQQKEHPKFKRKGDDLFVEHTLSLTEALC  274

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLLIKS PGEVVKPD +KAI+DEGMP++Q+PFM+GKLYIHFTV+FPE+
Sbjct  275  GFQFVLTHLDARQLLIKSSPGEVVKPDSYKAISDEGMPIHQRPFMKGKLYIHFTVEFPES  334

Query  510  LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVY-----  346
            L+ DQ KA EAVLP    + ++DME+DECEETTL++VNIE EM+RK Q + +E Y     
Sbjct  335  LSRDQTKAFEAVLPKPAKSAMSDMEIDECEETTLHEVNIEAEMKRKAQAK-REAYDDDDD  393

Query  345  -EEDEDMHGGAQRVQCAQQ  292
             E     HG    VQCAQQ
Sbjct  394  EEGPGGGHG----VQCAQQ  408



>ref|XP_003521084.1| PREDICTED: dnaJ protein homolog 2-like [Glycine max]
 gb|KHN43746.1| Chaperone protein dnaJ 2 [Glycine soja]
Length=420

 Score =   283 bits (725),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 164/195 (84%), Gaps = 3/195 (2%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGMQ GQ+I F G+ADEAPDTITGDIVFVLQ K+H KF+R+ DD++++H L+LTEALC
Sbjct  227  VEKGMQQGQKIVFEGQADEAPDTITGDIVFVLQVKDHPKFRREQDDLYIDHNLSLTEALC  286

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQF + HLD RQLLIKS PGEV+KP Q+KAINDEGMP + +PFM+G+LYI F VDFP++
Sbjct  287  GFQFAVKHLDGRQLLIKSNPGEVIKPGQYKAINDEGMPQHNRPFMKGRLYIQFNVDFPDS  346

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PDQC+ LE VLP + +  ++DMELD+CEETTL+DVN +EEMRRKQQQQ +E Y+ED
Sbjct  347  GFLSPDQCQLLEKVLPQKSSKHVSDMELDDCEETTLHDVNFKEEMRRKQQQQYREAYDED  406

Query  336  EDMHGGAQRVQCAQQ  292
            +D   G QRVQCAQQ
Sbjct  407  DDEPSG-QRVQCAQQ  420



>ref|XP_007220469.1| hypothetical protein PRUPE_ppa006364mg [Prunus persica]
 gb|EMJ21668.1| hypothetical protein PRUPE_ppa006364mg [Prunus persica]
Length=415

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/195 (70%), Positives = 166/195 (85%), Gaps = 2/195 (1%)
 Frame = -2

Query  870  VEKGMQNGQRITFPGEADEAPDTITGDIVFVLQQKEHAKFKRKGDDIFVEHTLTLTEALC  691
            VEKGM++GQ+I F G+ADEAPDTITGDIVF+LQ KEHAKFKRK DD++VEHTL LTEALC
Sbjct  221  VEKGMEHGQKIVFEGQADEAPDTITGDIVFILQLKEHAKFKRKLDDLYVEHTLNLTEALC  280

Query  690  GFQFVLTHLDNRQLLIKSQPGEVVKPDQFKAINDEGMPMYQKPFMRGKLYIHFTVDFPET  511
            GFQFVLTHLD RQLL+KS PGEV+KP Q KAINDEGMP YQ+PFM+G L+IHF V+FP++
Sbjct  281  GFQFVLTHLDGRQLLVKSNPGEVIKPGQSKAINDEGMPHYQRPFMKGNLFIHFNVEFPDS  340

Query  510  --LTPDQCKALEAVLPPRPATKITDMELDECEETTLYDVNIEEEMRRKQQQQAQEVYEED  337
              L+PDQ + L+ VL P+P+  +TD+ELDECEETT++DVNIE+EMRRK +QQ +E Y+ED
Sbjct  341  GILSPDQSRNLQTVLSPKPSKHLTDVELDECEETTMHDVNIEDEMRRKPRQQYREAYDED  400

Query  336  EDMHGGAQRVQCAQQ  292
            +D      RVQCAQQ
Sbjct  401  DDDDEPMPRVQCAQQ  415



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1949878542686