BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9789

Length=960
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011089660.1|  PREDICTED: galacturonosyltransferase 8-like        434   2e-145   Sesamum indicum [beniseed]
ref|XP_009775386.1|  PREDICTED: galacturonosyltransferase 8             433   5e-145   Nicotiana sylvestris
gb|EYU40627.1|  hypothetical protein MIMGU_mgv1a003761mg                432   9e-145   Erythranthe guttata [common monkey flower]
ref|XP_009614844.1|  PREDICTED: galacturonosyltransferase 8             432   1e-144   Nicotiana tomentosiformis
emb|CAJ34814.1|  glycosyltransferase                                    422   2e-144   Plantago major [cart-track plant]
ref|XP_012085051.1|  PREDICTED: galacturonosyltransferase 8             431   2e-144   Jatropha curcas
ref|XP_010246719.1|  PREDICTED: galacturonosyltransferase 8             428   4e-143   Nelumbo nucifera [Indian lotus]
ref|XP_007140673.1|  hypothetical protein PHAVU_008G132200g             427   9e-143   Phaseolus vulgaris [French bean]
ref|XP_003552108.1|  PREDICTED: galacturonosyltransferase 8-like        427   1e-142   Glycine max [soybeans]
ref|XP_011024611.1|  PREDICTED: galacturonosyltransferase 8             426   2e-142   Populus euphratica
ref|XP_002301803.1|  hypothetical protein POPTR_0002s24790g             426   2e-142   Populus trichocarpa [western balsam poplar]
gb|ABK92560.1|  unknown                                                 426   2e-142   Populus trichocarpa [western balsam poplar]
ref|XP_006584621.1|  PREDICTED: uncharacterized protein LOC100817...    425   6e-142   
ref|XP_004515038.1|  PREDICTED: galacturonosyltransferase 8-like        424   9e-142   Cicer arietinum [garbanzo]
ref|XP_002273962.2|  PREDICTED: galacturonosyltransferase 8             424   1e-141   Vitis vinifera
ref|XP_004242412.1|  PREDICTED: galacturonosyltransferase 8-like        424   1e-141   Solanum lycopersicum
gb|KDO65982.1|  hypothetical protein CISIN_1g008561mg                   424   2e-141   Citrus sinensis [apfelsine]
ref|XP_002532733.1|  Glycosyltransferase QUASIMODO1, putative           424   2e-141   Ricinus communis
gb|KHG16505.1|  Galacturonosyltransferase 8 -like protein               424   2e-141   Gossypium arboreum [tree cotton]
gb|KJB08801.1|  hypothetical protein B456_001G104800                    417   2e-141   Gossypium raimondii
ref|NP_001242612.1|  uncharacterized protein LOC100817076               423   2e-141   
ref|XP_006479231.1|  PREDICTED: galacturonosyltransferase 8-like        423   2e-141   Citrus sinensis [apfelsine]
ref|XP_006352682.1|  PREDICTED: galacturonosyltransferase 8-like        423   3e-141   Solanum tuberosum [potatoes]
ref|XP_006418657.1|  hypothetical protein EUTSA_v10002465mg             423   4e-141   Eutrema salsugineum [saltwater cress]
gb|ABD65461.1|  transferring glycosyl protein                           409   6e-141   Gossypium hirsutum [American cotton]
ref|XP_003622860.1|  Glycosyltransferase CAZy family GT8                417   7e-141   
ref|XP_009136103.1|  PREDICTED: galacturonosyltransferase 8             422   7e-141   Brassica rapa
gb|KHG21596.1|  Galacturonosyltransferase 8 -like protein               422   8e-141   Gossypium arboreum [tree cotton]
gb|KJB10196.1|  hypothetical protein B456_001G188500                    416   8e-141   Gossypium raimondii
ref|XP_009102430.1|  PREDICTED: galacturonosyltransferase 8-like        422   9e-141   Brassica rapa
ref|XP_010513952.1|  PREDICTED: galacturonosyltransferase 8-like        422   9e-141   Camelina sativa [gold-of-pleasure]
emb|CDX93049.1|  BnaA03g37710D                                          421   9e-141   
emb|CDY61593.1|  BnaC03g74220D                                          421   9e-141   Brassica napus [oilseed rape]
ref|XP_010488624.1|  PREDICTED: galacturonosyltransferase 8-like        421   1e-140   Camelina sativa [gold-of-pleasure]
ref|NP_189150.1|  Galacturonosyltransferase 8                           421   1e-140   Arabidopsis thaliana [mouse-ear cress]
gb|KJB08802.1|  hypothetical protein B456_001G104800                    422   1e-140   Gossypium raimondii
ref|XP_010036787.1|  PREDICTED: galacturonosyltransferase 8             421   1e-140   Eucalyptus grandis [rose gum]
ref|XP_010466934.1|  PREDICTED: galacturonosyltransferase 8             421   1e-140   Camelina sativa [gold-of-pleasure]
ref|XP_006297348.1|  hypothetical protein CARUB_v10013367mg             421   2e-140   Capsella rubella
ref|XP_002863088.1|  hypothetical protein ARALYDRAFT_497166             421   2e-140   Arabidopsis lyrata subsp. lyrata
gb|KJB10198.1|  hypothetical protein B456_001G188500                    421   2e-140   Gossypium raimondii
ref|XP_010104168.1|  Galacturonosyltransferase 8                        421   3e-140   Morus notabilis
gb|KJB10199.1|  hypothetical protein B456_001G188500                    421   3e-140   Gossypium raimondii
gb|KJB10200.1|  hypothetical protein B456_001G188500                    421   6e-140   Gossypium raimondii
emb|CBI25666.3|  unnamed protein product                                417   9e-140   Vitis vinifera
ref|XP_010696262.1|  PREDICTED: galacturonosyltransferase 8             419   9e-140   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010527263.1|  PREDICTED: galacturonosyltransferase 8             419   1e-139   Tarenaya hassleriana [spider flower]
ref|XP_008382600.1|  PREDICTED: galacturonosyltransferase 8-like        418   2e-139   Malus domestica [apple tree]
ref|XP_009372229.1|  PREDICTED: galacturonosyltransferase 8-like        417   5e-139   Pyrus x bretschneideri [bai li]
ref|XP_010532909.1|  PREDICTED: galacturonosyltransferase 8-like        417   7e-139   Tarenaya hassleriana [spider flower]
ref|XP_008235436.1|  PREDICTED: galacturonosyltransferase 8             417   1e-138   Prunus mume [ume]
ref|XP_004149774.1|  PREDICTED: galacturonosyltransferase 8             416   2e-138   Cucumis sativus [cucumbers]
ref|XP_008458050.1|  PREDICTED: galacturonosyltransferase 8             416   3e-138   Cucumis melo [Oriental melon]
emb|CDX77366.1|  BnaA07g05040D                                          414   4e-138   
emb|CDP03909.1|  unnamed protein product                                415   5e-138   Coffea canephora [robusta coffee]
ref|XP_010257858.1|  PREDICTED: probable galacturonosyltransferase 9    414   9e-138   Nelumbo nucifera [Indian lotus]
ref|XP_007201169.1|  hypothetical protein PRUPE_ppa003603mg             413   2e-137   Prunus persica
ref|XP_007142473.1|  hypothetical protein PHAVU_008G283600g             412   2e-137   Phaseolus vulgaris [French bean]
ref|XP_008372509.1|  PREDICTED: galacturonosyltransferase 8             413   2e-137   
ref|XP_009404224.1|  PREDICTED: galacturonosyltransferase 8-like        413   2e-137   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009372029.1|  PREDICTED: galacturonosyltransferase 8-like        412   5e-137   Pyrus x bretschneideri [bai li]
ref|XP_008778166.1|  PREDICTED: galacturonosyltransferase 8-like        412   8e-137   Phoenix dactylifera
ref|XP_008803497.1|  PREDICTED: LOW QUALITY PROTEIN: galacturonos...    410   2e-136   Phoenix dactylifera
ref|XP_007049694.1|  Nucleotide-diphospho-sugar transferases supe...    411   2e-136   
ref|XP_008457595.1|  PREDICTED: galacturonosyltransferase 8-like        410   3e-136   Cucumis melo [Oriental melon]
ref|XP_010913084.1|  PREDICTED: galacturonosyltransferase 8             409   7e-136   Elaeis guineensis
ref|XP_006841268.1|  PREDICTED: galacturonosyltransferase 8             408   1e-135   Amborella trichopoda
ref|XP_010908797.1|  PREDICTED: galacturonosyltransferase 8-like        407   6e-135   Elaeis guineensis
ref|XP_009379995.1|  PREDICTED: galacturonosyltransferase 8-like        407   7e-135   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004290178.1|  PREDICTED: galacturonosyltransferase 8             406   1e-134   Fragaria vesca subsp. vesca
ref|NP_001168623.1|  uncharacterized protein LOC100382408               395   3e-134   Zea mays [maize]
gb|AID53187.1|  galacturonosyltransferase 8-like protein                403   1e-133   Dendrobium officinale
gb|AFW71494.1|  hypothetical protein ZEAMMB73_252708                    401   4e-133   
ref|XP_002453869.1|  hypothetical protein SORBIDRAFT_04g020140          400   1e-132   Sorghum bicolor [broomcorn]
ref|XP_004952528.1|  PREDICTED: galacturonosyltransferase 8-like        399   2e-132   Setaria italica
ref|XP_006384242.1|  hypothetical protein POPTR_0004s10980g             399   9e-132   Populus trichocarpa [western balsam poplar]
ref|XP_011012259.1|  PREDICTED: probable galacturonosyltransferase 9    398   1e-131   Populus euphratica
ref|XP_006373520.1|  hypothetical protein POPTR_0017s144802g            395   3e-131   
ref|XP_006482345.1|  PREDICTED: probable galacturonosyltransferas...    396   7e-131   Citrus sinensis [apfelsine]
ref|XP_006430887.1|  hypothetical protein CICLE_v10011396mg             396   7e-131   Citrus clementina [clementine]
ref|XP_012088081.1|  PREDICTED: probable galacturonosyltransferase 9    396   7e-131   Jatropha curcas
ref|XP_006648647.1|  PREDICTED: galacturonosyltransferase 8-like        391   1e-130   Oryza brachyantha
ref|XP_011021133.1|  PREDICTED: probable galacturonosyltransferase 9    395   2e-130   Populus euphratica
emb|CDP02368.1|  unnamed protein product                                395   2e-130   Coffea canephora [robusta coffee]
gb|EEC73220.1|  hypothetical protein OsI_07307                          393   6e-130   Oryza sativa Indica Group [Indian rice]
ref|XP_002530802.1|  Glycosyltransferase QUASIMODO1, putative           394   6e-130   Ricinus communis
dbj|BAD23465.1|  putative glycosyl transferase                          393   7e-130   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046899.1|  Os02g0498700                                       394   8e-130   
ref|XP_008230332.1|  PREDICTED: probable galacturonosyltransferase 9    393   1e-129   Prunus mume [ume]
gb|KJB10201.1|  hypothetical protein B456_001G188500                    392   2e-129   Gossypium raimondii
gb|EMS51766.1|  Galacturonosyltransferase 8                             380   1e-128   Triticum urartu
ref|XP_002987448.1|  Quasimodo1-like protein                            387   5e-128   
ref|XP_003572545.1|  PREDICTED: galacturonosyltransferase 8-like        388   6e-128   Brachypodium distachyon [annual false brome]
ref|XP_002980055.1|  Quasimodo1-like protein                            387   2e-127   
ref|XP_008379476.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    387   3e-127   
dbj|BAK03588.1|  predicted protein                                      387   3e-127   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009373741.1|  PREDICTED: probable galacturonosyltransferase 9    386   7e-127   Pyrus x bretschneideri [bai li]
ref|XP_008341825.1|  PREDICTED: probable galacturonosyltransferase 9    386   7e-127   
ref|XP_010100891.1|  putative galacturonosyltransferase 9               386   4e-126   
ref|XP_009603685.1|  PREDICTED: probable galacturonosyltransferase 9    383   6e-126   Nicotiana tomentosiformis
ref|XP_009792003.1|  PREDICTED: probable galacturonosyltransferase 9    383   6e-126   Nicotiana sylvestris
ref|XP_007032944.1|  Glycosyltransferase isoform 2                      380   2e-125   
ref|XP_004232120.1|  PREDICTED: probable galacturonosyltransferase 9    381   3e-125   
ref|XP_006338312.1|  PREDICTED: probable galacturonosyltransferas...    381   4e-125   Solanum tuberosum [potatoes]
ref|XP_007032943.1|  Glycosyltransferase isoform 1                      381   5e-125   
gb|AFV46220.1|  hypothetical protein                                    364   1e-122   Scutellaria baicalensis [Baikal skullcap]
ref|XP_010029444.1|  PREDICTED: probable galacturonosyltransferase 9    374   2e-122   Eucalyptus grandis [rose gum]
ref|XP_010660537.1|  PREDICTED: probable galacturonosyltransferase 9    374   3e-122   Vitis vinifera
ref|XP_010549958.1|  PREDICTED: probable galacturonosyltransferas...    373   8e-122   Tarenaya hassleriana [spider flower]
ref|XP_010558537.1|  PREDICTED: probable galacturonosyltransferase 9    372   3e-121   Tarenaya hassleriana [spider flower]
emb|CAN73730.1|  hypothetical protein VITISV_022574                     371   3e-121   Vitis vinifera
gb|AFK41629.1|  unknown                                                 360   1e-120   Lotus japonicus
ref|XP_003635905.1|  Glycosyltransferase                                370   1e-120   
gb|KHG03994.1|  putative galacturonosyltransferase 9 -like protein      370   2e-120   Gossypium arboreum [tree cotton]
ref|XP_010694564.1|  PREDICTED: probable galacturonosyltransferase 9    369   4e-120   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002310951.2|  hypothetical protein POPTR_0008s01050g             369   4e-120   
ref|XP_010549955.1|  PREDICTED: probable galacturonosyltransferas...    368   6e-120   Tarenaya hassleriana [spider flower]
ref|XP_011085570.1|  PREDICTED: probable galacturonosyltransferase 9    368   8e-120   Sesamum indicum [beniseed]
gb|KJB48245.1|  hypothetical protein B456_008G059800                    365   1e-119   Gossypium raimondii
gb|KJB10520.1|  hypothetical protein B456_001G205700                    365   2e-119   Gossypium raimondii
ref|XP_011033002.1|  PREDICTED: galacturonosyltransferase 8-like        367   2e-119   Populus euphratica
gb|KJB48243.1|  hypothetical protein B456_008G059800                    366   3e-119   Gossypium raimondii
gb|KJB10519.1|  hypothetical protein B456_001G205700                    365   1e-118   Gossypium raimondii
ref|XP_006593710.1|  PREDICTED: probable galacturonosyltransferas...    364   2e-118   
ref|XP_007151434.1|  hypothetical protein PHAVU_004G045900g             364   2e-118   Phaseolus vulgaris [French bean]
gb|KHN02656.1|  Putative galacturonosyltransferase 9                    364   2e-118   Glycine soja [wild soybean]
ref|XP_004507267.1|  PREDICTED: probable galacturonosyltransferas...    364   2e-118   Cicer arietinum [garbanzo]
ref|XP_006603944.1|  PREDICTED: probable galacturonosyltransferas...    364   2e-118   Glycine max [soybeans]
gb|KHG26626.1|  putative galacturonosyltransferase 9 -like protein      363   5e-118   Gossypium arboreum [tree cotton]
gb|EYU39355.1|  hypothetical protein MIMGU_mgv1a003891mg                363   8e-118   Erythranthe guttata [common monkey flower]
dbj|BAD94466.1|  hypothetical protein                                   349   6e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011099072.1|  PREDICTED: probable galacturonosyltransferase 9    359   2e-116   Sesamum indicum [beniseed]
gb|EPS65125.1|  glycosyltransferase                                     358   3e-116   Genlisea aurea
gb|KFK37701.1|  hypothetical protein AALP_AA3G017600                    358   6e-116   Arabis alpina [alpine rockcress]
ref|XP_010463640.1|  PREDICTED: probable galacturonosyltransferase 9    358   8e-116   Camelina sativa [gold-of-pleasure]
gb|AHL38785.1|  glycosyltransferase                                     357   1e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006408424.1|  hypothetical protein EUTSA_v10020416mg             357   1e-115   Eutrema salsugineum [saltwater cress]
ref|NP_566170.1|  putative galacturonosyltransferase 9                  357   2e-115   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882224.1|  hypothetical protein ARALYDRAFT_477468             357   2e-115   
gb|ABD96904.1|  hypothetical protein                                    355   2e-115   Tarenaya spinosa
ref|XP_006297346.1|  hypothetical protein CARUB_v10013365mg             357   2e-115   
ref|XP_008455575.1|  PREDICTED: probable galacturonosyltransferase 9    356   3e-115   Cucumis melo [Oriental melon]
ref|XP_009378304.1|  PREDICTED: probable galacturonosyltransferase 9    356   3e-115   Pyrus x bretschneideri [bai li]
ref|XP_004137150.1|  PREDICTED: probable galacturonosyltransferase 9    355   6e-115   Cucumis sativus [cucumbers]
ref|XP_009134662.1|  PREDICTED: probable galacturonosyltransferas...    354   1e-114   Brassica rapa
ref|XP_010476066.1|  PREDICTED: probable galacturonosyltransferase 9    355   1e-114   Camelina sativa [gold-of-pleasure]
ref|XP_009134660.1|  PREDICTED: probable galacturonosyltransferas...    353   2e-114   Brassica rapa
ref|XP_010485478.1|  PREDICTED: probable galacturonosyltransferase 9    354   2e-114   Camelina sativa [gold-of-pleasure]
emb|CDX91987.1|  BnaC03g32890D                                          353   2e-114   
emb|CDX74263.1|  BnaA03g27840D                                          353   2e-114   
emb|CDY34723.1|  BnaA01g33020D                                          352   3e-114   Brassica napus [oilseed rape]
ref|XP_009117942.1|  PREDICTED: probable galacturonosyltransferase 9    352   1e-113   
ref|XP_004304175.1|  PREDICTED: probable galacturonosyltransferase 9    348   2e-112   Fragaria vesca subsp. vesca
emb|CDY00812.1|  BnaCnng00120D                                          344   6e-112   
ref|XP_010326484.1|  PREDICTED: LOW QUALITY PROTEIN: galacturonos...    339   4e-109   Solanum lycopersicum
ref|NP_001131608.1|  uncharacterized protein LOC100192958               319   4e-105   
gb|AFW67949.1|  hypothetical protein ZEAMMB73_846223                    320   8e-105   
gb|AFW67950.1|  hypothetical protein ZEAMMB73_846223                    323   2e-104   
gb|AFW67951.1|  hypothetical protein ZEAMMB73_846223                    326   3e-104   
gb|ACF78990.1|  unknown                                                 318   8e-104   Zea mays [maize]
ref|XP_006657336.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    327   9e-104   Oryza brachyantha
ref|NP_001169332.1|  hypothetical protein precursor                     327   2e-103   Zea mays [maize]
ref|XP_008650863.1|  PREDICTED: uncharacterized protein LOC100192...    327   3e-103   Zea mays [maize]
gb|EEC81302.1|  hypothetical protein OsI_24438                          326   3e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_009409999.1|  PREDICTED: probable galacturonosyltransferase 9    323   6e-103   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001785716.1|  predicted protein                                  313   7e-103   
ref|XP_008671920.1|  PREDICTED: uncharacterized protein LOC100191...    324   7e-103   Zea mays [maize]
ref|XP_008650862.1|  PREDICTED: uncharacterized protein LOC100192...    327   1e-102   
ref|NP_001063757.1|  Os09g0531900                                       328   1e-102   
gb|EEC84934.1|  hypothetical protein OsI_32147                          328   1e-102   Oryza sativa Indica Group [Indian rice]
ref|XP_004982129.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    325   1e-102   
tpg|DAA50750.1|  TPA: hypothetical protein ZEAMMB73_194342              324   2e-102   
ref|NP_001130678.1|  uncharacterized protein LOC100191781 precursor     324   2e-102   Zea mays [maize]
ref|XP_010937117.1|  PREDICTED: probable galacturonosyltransferase 9    322   4e-102   Elaeis guineensis
ref|XP_002466644.1|  hypothetical protein SORBIDRAFT_01g011560          323   4e-102   Sorghum bicolor [broomcorn]
ref|XP_002462717.1|  hypothetical protein SORBIDRAFT_02g030820          326   5e-102   Sorghum bicolor [broomcorn]
ref|XP_008650861.1|  PREDICTED: uncharacterized protein LOC100192...    327   5e-102   Zea mays [maize]
ref|XP_006660882.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    326   5e-102   Oryza brachyantha
emb|CDY52336.1|  BnaA09g38850D                                          325   7e-102   Brassica napus [oilseed rape]
emb|CDX71763.1|  BnaC08g31110D                                          325   8e-102   
ref|XP_009116771.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    325   9e-102   Brassica rapa
ref|XP_008802618.1|  PREDICTED: probable galacturonosyltransferase 9    321   9e-102   Phoenix dactylifera
ref|XP_010523706.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    325   1e-101   Tarenaya hassleriana [spider flower]
gb|EMS50352.1|  Alpha-1,4-galacturonosyltransferase 1                   319   1e-101   Triticum urartu
ref|XP_011460082.1|  PREDICTED: probable galacturonosyltransferas...    323   2e-101   Fragaria vesca subsp. vesca
ref|XP_011460081.1|  PREDICTED: probable galacturonosyltransferas...    323   3e-101   Fragaria vesca subsp. vesca
ref|XP_006375320.1|  hypothetical protein POPTR_0014s06970g             317   3e-101   
ref|XP_011460080.1|  PREDICTED: probable galacturonosyltransferas...    323   3e-101   Fragaria vesca subsp. vesca
ref|XP_003578496.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    324   3e-101   
ref|XP_004957448.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    323   3e-101   Setaria italica
dbj|BAJ99110.1|  predicted protein                                      321   3e-101   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008670350.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    320   4e-101   
ref|XP_011628938.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    323   4e-101   Amborella trichopoda
gb|ERM96312.1|  hypothetical protein AMTR_s00001p00190810               323   5e-101   Amborella trichopoda
ref|XP_010231443.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    320   5e-101   Brachypodium distachyon [annual false brome]
ref|XP_002320745.2|  glycosyl transferase family 8 family protein       318   5e-101   
ref|XP_011628937.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    323   5e-101   
ref|XP_008784292.1|  PREDICTED: probable galacturonosyltransferase 9    318   8e-101   Phoenix dactylifera
emb|CDY42486.1|  BnaC04g21950D                                          322   1e-100   Brassica napus [oilseed rape]
ref|XP_008670348.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    320   1e-100   
ref|XP_010272612.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    322   1e-100   Nelumbo nucifera [Indian lotus]
gb|EMT14751.1|  Glycosyltransferase QUASIMODO1                          320   1e-100   
ref|XP_010512446.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    322   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010512444.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    322   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010512443.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    322   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010469034.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    322   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010512445.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    322   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010413456.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    322   1e-100   Camelina sativa [gold-of-pleasure]
emb|CDX89098.1|  BnaA04g00880D                                          322   1e-100   
ref|XP_006339506.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    322   2e-100   Solanum tuberosum [potatoes]
ref|XP_002962728.1|  GAUT1, alpha-1,4-galaturonosyltransferase-li...    317   2e-100   
ref|XP_008670347.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    320   2e-100   
ref|XP_002980359.1|  Glycosyltransferase, CAZy family GT8               317   2e-100   
ref|XP_001779123.1|  predicted protein                                  317   2e-100   
ref|XP_010939506.1|  PREDICTED: probable galacturonosyltransferase 9    317   2e-100   Elaeis guineensis
ref|XP_010056256.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    321   2e-100   Eucalyptus grandis [rose gum]
gb|KHN04100.1|  Alpha-1,4-galacturonosyltransferase 1                   321   3e-100   Glycine soja [wild soybean]
ref|XP_006576391.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    321   3e-100   Glycine max [soybeans]
ref|XP_004229870.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    321   3e-100   Solanum lycopersicum
ref|XP_008776919.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    321   3e-100   Phoenix dactylifera
ref|XP_009107093.1|  PREDICTED: probable galacturonosyltransferase 4    320   3e-100   Brassica rapa
ref|XP_002876594.1|  GAUT1/LGT1                                         320   4e-100   
ref|NP_191672.1|  alpha-1,4-galacturonosyltransferase 1                 320   4e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006402518.1|  hypothetical protein EUTSA_v10005820mg             320   4e-100   Eutrema salsugineum [saltwater cress]
ref|XP_007051985.1|  Galacturonosyltransferase 1                        320   4e-100   
ref|XP_002511763.1|  transferase, transferring glycosyl groups, p...    321   5e-100   
ref|XP_006290325.1|  hypothetical protein CARUB_v10016785mg             320   5e-100   
ref|XP_011002080.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    320   6e-100   Populus euphratica
ref|XP_011002081.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    320   6e-100   Populus euphratica
gb|KJB41168.1|  hypothetical protein B456_007G093500                    320   6e-100   Gossypium raimondii
ref|XP_004153994.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    320   7e-100   Cucumis sativus [cucumbers]
ref|XP_010910637.1|  PREDICTED: probable galacturonosyltransferas...    316   8e-100   Elaeis guineensis
ref|XP_008670346.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    320   1e-99    Zea mays [maize]
ref|XP_008232829.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    319   1e-99    Prunus mume [ume]
ref|XP_008232828.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    319   1e-99    Prunus mume [ume]
ref|XP_012083520.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    320   1e-99    Jatropha curcas
ref|XP_011469111.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    319   1e-99    Fragaria vesca subsp. vesca
dbj|BAJ53137.1|  JHL05D22.8                                             320   1e-99    Jatropha curcas
ref|XP_010647084.1|  PREDICTED: probable galacturonosyltransferase 4    318   1e-99    Vitis vinifera
gb|KJB67441.1|  hypothetical protein B456_010G190800                    311   1e-99    Gossypium raimondii
ref|XP_006398488.1|  hypothetical protein EUTSA_v10000819mg             318   1e-99    Eutrema salsugineum [saltwater cress]
ref|XP_008460145.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    319   1e-99    
ref|XP_010934420.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    320   2e-99    
ref|XP_007220901.1|  hypothetical protein PRUPE_ppa002418mg             319   2e-99    Prunus persica
ref|XP_009418721.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    318   2e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008670345.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    319   2e-99    Zea mays [maize]
ref|XP_002882844.1|  hypothetical protein ARALYDRAFT_478777             317   2e-99    
ref|XP_009138790.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    319   2e-99    
dbj|BAB11325.1|  unnamed protein product                                317   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010538434.1|  PREDICTED: probable galacturonosyltransferase 4    318   2e-99    Tarenaya hassleriana [spider flower]
ref|NP_568688.1|  probable galacturonosyltransferase 4                  317   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010647025.1|  PREDICTED: probable galacturonosyltransferas...    318   2e-99    Vitis vinifera
ref|XP_011654832.1|  PREDICTED: probable galacturonosyltransferase 4    318   2e-99    Cucumis sativus [cucumbers]
ref|XP_007147564.1|  hypothetical protein PHAVU_006G135100g             318   2e-99    Phaseolus vulgaris [French bean]
ref|XP_007213869.1|  hypothetical protein PRUPE_ppa018681mg             318   2e-99    
ref|XP_010647027.1|  PREDICTED: probable galacturonosyltransferas...    317   2e-99    Vitis vinifera
ref|XP_002302550.1|  hypothetical protein POPTR_0002s15270g             318   3e-99    
ref|XP_001770653.1|  predicted protein                                  314   3e-99    
ref|XP_006583368.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    318   3e-99    Glycine max [soybeans]
gb|KHN04587.1|  Alpha-1,4-galacturonosyltransferase 1                   318   3e-99    Glycine soja [wild soybean]
ref|XP_009381434.1|  PREDICTED: probable galacturonosyltransferase 9    313   3e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004499343.1|  PREDICTED: probable galacturonosyltransferas...    318   3e-99    Cicer arietinum [garbanzo]
ref|XP_009418719.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    319   3e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009589124.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    318   4e-99    Nicotiana tomentosiformis
ref|XP_010910636.1|  PREDICTED: probable galacturonosyltransferas...    317   4e-99    
gb|KDO85920.1|  hypothetical protein CISIN_1g005683mg                   318   4e-99    Citrus sinensis [apfelsine]
ref|XP_011014842.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    318   4e-99    Populus euphratica
ref|XP_011014841.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    318   4e-99    Populus euphratica
ref|XP_006445203.1|  hypothetical protein CICLE_v10019146mg             318   4e-99    Citrus clementina [clementine]
ref|XP_010910633.1|  PREDICTED: probable galacturonosyltransferas...    317   4e-99    Elaeis guineensis
ref|XP_011040799.1|  PREDICTED: probable galacturonosyltransferas...    316   5e-99    Populus euphratica
ref|XP_010667722.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    318   5e-99    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009785495.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    318   5e-99    Nicotiana sylvestris
ref|XP_009375839.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    318   6e-99    Pyrus x bretschneideri [bai li]
ref|XP_006279595.1|  hypothetical protein CARUB_v10026096mg             316   6e-99    Capsella rubella
ref|XP_009375840.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    317   6e-99    
ref|XP_007139968.1|  hypothetical protein PHAVU_008G074000g             317   7e-99    Phaseolus vulgaris [French bean]
ref|XP_011086294.1|  PREDICTED: probable galacturonosyltransferase 4    317   7e-99    Sesamum indicum [beniseed]
ref|XP_010495018.1|  PREDICTED: probable galacturonosyltransferas...    316   7e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010495019.1|  PREDICTED: probable galacturonosyltransferas...    316   8e-99    
ref|XP_008464310.1|  PREDICTED: probable galacturonosyltransferase 4    317   8e-99    
ref|XP_012067174.1|  PREDICTED: probable galacturonosyltransferas...    314   8e-99    
ref|XP_010661600.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    317   9e-99    
ref|XP_009101378.1|  PREDICTED: probable galacturonosyltransferase 4    316   1e-98    
ref|XP_009386175.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    316   1e-98    
ref|XP_006486598.1|  PREDICTED: probable galacturonosyltransferas...    315   1e-98    
ref|XP_010441403.1|  PREDICTED: probable galacturonosyltransferas...    315   1e-98    
ref|XP_010441404.1|  PREDICTED: probable galacturonosyltransferas...    315   1e-98    
gb|KDO78639.1|  hypothetical protein CISIN_1g005035mg                   314   1e-98    
emb|CAN70213.1|  hypothetical protein VITISV_038741                     319   1e-98    
emb|CAB81547.1|  68 kDa protein                                         314   1e-98    
ref|XP_011658097.1|  PREDICTED: probable galacturonosyltransferase 4    316   1e-98    
ref|XP_011040798.1|  PREDICTED: probable galacturonosyltransferas...    317   1e-98    
gb|AES80022.2|  CAZy family GT8 glycosyltransferase                     316   1e-98    
ref|XP_010481265.1|  PREDICTED: probable galacturonosyltransferas...    315   1e-98    
ref|XP_010481270.1|  PREDICTED: probable galacturonosyltransferas...    315   2e-98    
gb|KDO78642.1|  hypothetical protein CISIN_1g005035mg                   316   2e-98    
ref|XP_002308736.1|  hypothetical protein POPTR_0006s00320g             316   2e-98    
ref|XP_010481273.1|  PREDICTED: probable galacturonosyltransferas...    315   2e-98    
ref|XP_010481267.1|  PREDICTED: probable galacturonosyltransferas...    315   2e-98    
ref|XP_008775901.1|  PREDICTED: probable galacturonosyltransferase 4    316   2e-98    
gb|KHG15715.1|  Alpha-1,4-galacturonosyltransferase 1 -like protein     317   2e-98    
ref|XP_006449976.1|  hypothetical protein CICLE_v10014426mg             315   2e-98    
gb|KJB67439.1|  hypothetical protein B456_010G190800                    314   2e-98    
ref|XP_006467237.1|  PREDICTED: probable galacturonosyltransferas...    315   2e-98    
ref|XP_003594361.1|  Galacturonosyltransferase                          316   2e-98    
ref|XP_008342952.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    316   2e-98    
gb|KJB67440.1|  hypothetical protein B456_010G190800                    314   2e-98    
ref|XP_003623804.1|  Alpha-1,4-galacturonosyltransferase                316   2e-98    
ref|XP_011016525.1|  PREDICTED: probable galacturonosyltransferase 4    315   2e-98    
gb|KJB67437.1|  hypothetical protein B456_010G190800                    314   2e-98    
ref|XP_011040102.1|  PREDICTED: probable galacturonosyltransferase 4    315   3e-98    
gb|ABN08854.1|  Glycosyl transferase, family 8                          316   3e-98    
ref|XP_004510897.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    316   3e-98    
ref|XP_006422429.1|  hypothetical protein CICLE_v10027946mg             316   3e-98    
ref|XP_008440950.1|  PREDICTED: probable galacturonosyltransferas...    314   3e-98    
gb|KHF97487.1|  putative galacturonosyltransferase 4 -like protein      313   3e-98    
ref|XP_008349398.1|  PREDICTED: probable galacturonosyltransferase 4    312   3e-98    
ref|XP_009407928.1|  PREDICTED: probable galacturonosyltransferase 4    315   3e-98    
ref|XP_002970865.1|  Glycosyltransferase, CAZy family GT8               311   3e-98    
gb|KJB79717.1|  hypothetical protein B456_013G063700                    311   4e-98    
gb|EPS66373.1|  hypothetical protein M569_08404                         314   4e-98    
ref|XP_006656516.1|  PREDICTED: probable galacturonosyltransferas...    310   4e-98    
ref|XP_006486597.1|  PREDICTED: probable galacturonosyltransferas...    315   4e-98    
gb|EYU32902.1|  hypothetical protein MIMGU_mgv1a002354mg                315   4e-98    
ref|XP_010272524.1|  PREDICTED: probable galacturonosyltransferase 4    315   4e-98    
ref|XP_011083645.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    315   4e-98    
ref|XP_008440947.1|  PREDICTED: probable galacturonosyltransferas...    314   5e-98    
ref|XP_010255603.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    314   5e-98    
ref|XP_004492659.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    315   5e-98    
ref|XP_012067172.1|  PREDICTED: probable galacturonosyltransferas...    314   6e-98    
ref|XP_012067173.1|  PREDICTED: probable galacturonosyltransferas...    314   6e-98    
ref|XP_010918998.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    315   6e-98    
ref|XP_010106747.1|  Alpha-1,4-galacturonosyltransferase 1              315   6e-98    
ref|XP_012067170.1|  PREDICTED: probable galacturonosyltransferas...    315   7e-98    
ref|XP_008782990.1|  PREDICTED: probable galacturonosyltransferase 4    314   8e-98    
gb|KDP42036.1|  hypothetical protein JCGZ_03099                         314   8e-98    
ref|XP_012067171.1|  PREDICTED: probable galacturonosyltransferas...    314   8e-98    
gb|ERN05214.1|  hypothetical protein AMTR_s00007p00049440               306   9e-98    
ref|XP_011005782.1|  PREDICTED: probable galacturonosyltransferas...    314   9e-98    
ref|XP_007134929.1|  hypothetical protein PHAVU_010G087600g             314   9e-98    
gb|KJB09887.1|  hypothetical protein B456_001G172800                    314   1e-97    
ref|XP_011005780.1|  PREDICTED: probable galacturonosyltransferas...    314   1e-97    
ref|XP_007026431.1|  Galacturonosyltransferase 4 isoform 2              313   1e-97    
ref|XP_006449975.1|  hypothetical protein CICLE_v10014426mg             315   1e-97    
gb|KDO78641.1|  hypothetical protein CISIN_1g005035mg                   315   1e-97    
ref|XP_008384326.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    311   1e-97    
ref|XP_007154076.1|  hypothetical protein PHAVU_003G088900g             313   1e-97    
ref|NP_001064438.1|  Os10g0363100                                       309   1e-97    
ref|XP_007026430.1|  Galacturonosyltransferase 4 isoform 1              313   1e-97    
ref|XP_010255602.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    314   1e-97    
ref|XP_010052503.1|  PREDICTED: probable galacturonosyltransferas...    313   1e-97    
ref|XP_012082219.1|  PREDICTED: probable galacturonosyltransferas...    313   1e-97    
gb|KJB24654.1|  hypothetical protein B456_004G155600                    313   1e-97    
gb|KHG03188.1|  putative galacturonosyltransferase 3 -like protein      305   2e-97    
dbj|BAJ86220.1|  predicted protein                                      314   2e-97    
ref|XP_010255599.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    314   2e-97    
ref|XP_007154077.1|  hypothetical protein PHAVU_003G088900g             313   2e-97    
gb|AET04592.2|  CAZy family GT8 glycosyltransferase                     311   2e-97    
ref|XP_012082218.1|  PREDICTED: probable galacturonosyltransferas...    313   2e-97    
ref|XP_006384847.1|  hypothetical protein POPTR_0004s21600g             313   2e-97    
gb|KJB24655.1|  hypothetical protein B456_004G155600                    313   2e-97    
ref|XP_010052508.1|  PREDICTED: probable galacturonosyltransferas...    313   2e-97    
ref|XP_006656515.1|  PREDICTED: probable galacturonosyltransferas...    312   2e-97    
gb|KHG09589.1|  putative galacturonosyltransferase 3 -like protein      312   2e-97    
ref|XP_010052506.1|  PREDICTED: probable galacturonosyltransferas...    313   2e-97    
ref|XP_006373556.1|  hypothetical protein POPTR_0016s00360g             313   2e-97    
ref|XP_011095865.1|  PREDICTED: probable galacturonosyltransferase 4    313   2e-97    
ref|XP_004486385.1|  PREDICTED: probable galacturonosyltransferas...    313   2e-97    
gb|KHN29422.1|  Alpha-1,4-galacturonosyltransferase 1                   312   3e-97    
ref|XP_008447845.1|  PREDICTED: probable galacturonosyltransferas...    310   3e-97    
ref|XP_008224656.1|  PREDICTED: probable galacturonosyltransferase 4    313   3e-97    
ref|XP_003533632.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    313   3e-97    
ref|XP_008794739.1|  PREDICTED: probable galacturonosyltransferas...    313   3e-97    
gb|AIL52750.1|  polygalacturonate 4-alpha-galacturonosyltransfera...    314   3e-97    
ref|XP_002986778.1|  Glycosyltransferase, CAZy family GT8               306   3e-97    
ref|XP_008794740.1|  PREDICTED: probable galacturonosyltransferas...    312   3e-97    
ref|XP_008677252.1|  PREDICTED: transferase, transferring glycosy...    312   3e-97    
ref|XP_002969595.1|  GAUT1, alpha-1,4-galacturonosyltransferase-l...    308   3e-97    
ref|XP_008794742.1|  PREDICTED: probable galacturonosyltransferas...    312   3e-97    
ref|XP_008794741.1|  PREDICTED: probable galacturonosyltransferas...    312   4e-97    
ref|XP_008794737.1|  PREDICTED: probable galacturonosyltransferas...    312   4e-97    
ref|XP_008794738.1|  PREDICTED: probable galacturonosyltransferas...    312   4e-97    
ref|XP_010942295.1|  PREDICTED: probable galacturonosyltransferase 4    312   4e-97    
gb|KHN03164.1|  Alpha-1,4-galacturonosyltransferase 1                   309   4e-97    
ref|XP_008358828.1|  PREDICTED: probable galacturonosyltransferase 4    312   5e-97    
ref|NP_001148932.1|  transferase, transferring glycosyl groups          312   5e-97    
gb|KJB79715.1|  hypothetical protein B456_013G063700                    311   5e-97    
gb|AFW60920.1|  transferase                                             311   6e-97    
emb|CDP08918.1|  unnamed protein product                                312   6e-97    
ref|XP_009382742.1|  PREDICTED: probable galacturonosyltransferase 3    311   6e-97    
ref|XP_002444200.1|  hypothetical protein SORBIDRAFT_07g014890          311   6e-97    
gb|KHG01394.1|  Alpha-1,4-galacturonosyltransferase 1                   312   8e-97    
gb|KHG14424.1|  Alpha-1,4-galacturonosyltransferase 1 -like protein     312   8e-97    
ref|XP_010096508.1|  putative galacturonosyltransferase 4               311   1e-96    
gb|KJB79716.1|  hypothetical protein B456_013G063700                    312   1e-96    
ref|XP_004153622.2|  PREDICTED: probable galacturonosyltransferase 3    312   1e-96    
ref|XP_006597630.1|  PREDICTED: probable galacturonosyltransferas...    311   1e-96    
gb|EYU27625.1|  hypothetical protein MIMGU_mgv1a004359mg                307   1e-96    
gb|KHN40761.1|  Putative galacturonosyltransferase 4                    311   1e-96    
ref|XP_003535002.1|  PREDICTED: probable galacturonosyltransferas...    311   1e-96    
ref|XP_011034886.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    311   1e-96    
dbj|BAK02036.1|  predicted protein                                      303   2e-96    
ref|XP_008447844.1|  PREDICTED: probable galacturonosyltransferas...    311   2e-96    
ref|XP_008384215.1|  PREDICTED: probable galacturonosyltransferas...    311   2e-96    
ref|XP_006341726.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    310   2e-96    
ref|XP_010645848.1|  PREDICTED: probable galacturonosyltransferase 3    311   2e-96    
ref|XP_008384214.1|  PREDICTED: probable galacturonosyltransferas...    311   2e-96    
gb|AAM18739.1|AC092548_17  hypothetical protein                         309   2e-96    
ref|XP_002969509.1|  Glycosyltransferase, CAZy family GT8               306   2e-96    
ref|XP_010690224.1|  PREDICTED: probable galacturonosyltransferas...    310   2e-96    
gb|KJB12347.1|  hypothetical protein B456_002G013600                    309   2e-96    
ref|XP_010935289.1|  PREDICTED: probable galacturonosyltransferas...    310   3e-96    
ref|XP_011088710.1|  PREDICTED: probable galacturonosyltransferase 3    311   3e-96    
gb|KFK31342.1|  hypothetical protein AALP_AA6G099900                    310   3e-96    
ref|XP_010028843.1|  PREDICTED: probable galacturonosyltransferase 3    309   3e-96    
ref|XP_003551642.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    310   3e-96    
ref|XP_009374812.1|  PREDICTED: probable galacturonosyltransferase 4    310   3e-96    
ref|XP_006600275.1|  PREDICTED: probable galacturonosyltransferas...    310   4e-96    
emb|CAN79512.1|  hypothetical protein VITISV_014158                     310   4e-96    
ref|XP_009616855.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    310   4e-96    
ref|XP_011074569.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    310   4e-96    
ref|XP_003603462.1|  Alpha-1,4-galacturonosyltransferase                303   5e-96    
ref|XP_004966516.1|  PREDICTED: probable galacturonosyltransferas...    310   5e-96    
gb|EAY78177.1|  hypothetical protein OsI_33224                          310   5e-96    
ref|XP_004501287.1|  PREDICTED: probable galacturonosyltransferas...    307   5e-96    
gb|EAZ15816.1|  hypothetical protein OsJ_31235                          310   5e-96    
ref|XP_010690223.1|  PREDICTED: probable galacturonosyltransferas...    310   6e-96    
gb|EYU38036.1|  hypothetical protein MIMGU_mgv1a002760mg                308   6e-96    
ref|XP_010450980.1|  PREDICTED: probable galacturonosyltransferase 3    296   7e-96    
gb|KHG01393.1|  Alpha-1,4-galacturonosyltransferase 1                   311   7e-96    
ref|XP_010555175.1|  PREDICTED: probable galacturonosyltransferas...    309   7e-96    
ref|XP_009802392.1|  PREDICTED: probable galacturonosyltransferas...    310   7e-96    
ref|XP_006857626.1|  PREDICTED: probable galacturonosyltransferase 4    309   8e-96    
ref|XP_009802396.1|  PREDICTED: probable galacturonosyltransferas...    309   8e-96    
ref|XP_008809114.1|  PREDICTED: probable galacturonosyltransferase 3    304   8e-96    
gb|ABB47337.1|  Glycosyltransferase QUASIMODO1, putative, expressed     310   9e-96    
ref|XP_010555174.1|  PREDICTED: probable galacturonosyltransferas...    310   9e-96    
ref|XP_010935288.1|  PREDICTED: probable galacturonosyltransferas...    310   9e-96    
ref|XP_010239537.1|  PREDICTED: probable galacturonosyltransferas...    307   1e-95    
gb|AFW69586.1|  hypothetical protein ZEAMMB73_786543                    310   1e-95    
ref|XP_008645106.1|  PREDICTED: probable galacturonosyltransferas...    310   1e-95    
ref|NP_001058636.2|  Os06g0727300                                       307   1e-95    
ref|XP_008645105.1|  PREDICTED: probable galacturonosyltransferas...    310   1e-95    
ref|XP_008645104.1|  PREDICTED: probable galacturonosyltransferas...    310   1e-95    
ref|XP_006364356.1|  PREDICTED: probable galacturonosyltransferas...    309   1e-95    
ref|XP_009777396.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    309   1e-95    
ref|XP_004248575.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    308   1e-95    
ref|XP_004231097.1|  PREDICTED: probable galacturonosyltransferase 3    309   1e-95    
gb|KHN40223.1|  Putative galacturonosyltransferase 4                    308   1e-95    
ref|XP_010252974.1|  PREDICTED: probable galacturonosyltransferase 4    309   1e-95    
ref|XP_006584115.1|  PREDICTED: probable galacturonosyltransferas...    308   1e-95    
ref|XP_009623514.1|  PREDICTED: probable galacturonosyltransferas...    309   1e-95    
ref|XP_010239532.1|  PREDICTED: probable galacturonosyltransferas...    307   1e-95    
ref|XP_009766434.1|  PREDICTED: probable galacturonosyltransferas...    308   2e-95    
ref|XP_009623515.1|  PREDICTED: probable galacturonosyltransferas...    308   2e-95    
ref|XP_010686598.1|  PREDICTED: probable galacturonosyltransferase 4    307   2e-95    
ref|XP_010234583.1|  PREDICTED: probable galacturonosyltransferas...    307   2e-95    
gb|EMS52040.1|  putative galacturonosyltransferase 3                    306   2e-95    
ref|XP_003525683.1|  PREDICTED: probable galacturonosyltransferas...    308   2e-95    
ref|XP_009766433.1|  PREDICTED: probable galacturonosyltransferas...    308   2e-95    
ref|XP_011650779.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    307   3e-95    
ref|XP_007043045.1|  Galacturonosyltransferase 3 isoform 2              303   3e-95    
emb|CAB37483.1|  putative protein                                       307   3e-95    
ref|XP_003573698.1|  PREDICTED: probable galacturonosyltransferas...    307   3e-95    
ref|XP_007137299.1|  hypothetical protein PHAVU_009G115700g             307   3e-95    
ref|XP_011650778.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    307   3e-95    
ref|XP_006579796.1|  PREDICTED: probable galacturonosyltransferas...    308   3e-95    
ref|XP_004501286.1|  PREDICTED: probable galacturonosyltransferas...    307   4e-95    
ref|XP_008438124.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    307   4e-95    
ref|XP_004973216.1|  PREDICTED: probable galacturonosyltransferas...    307   4e-95    
ref|NP_001190952.1|  galacturonosyltransferase 3                        307   4e-95    
gb|KHN27481.1|  Putative galacturonosyltransferase 3                    307   4e-95    
ref|XP_010111700.1|  putative galacturonosyltransferase 3               308   4e-95    
gb|KEH35941.1|  polygalacturonate 4-alpha-galacturonosyltransferase     305   4e-95    
ref|NP_195540.2|  galacturonosyltransferase 3                           307   5e-95    
ref|XP_002525229.1|  Glycosyltransferase QUASIMODO1, putative           306   5e-95    
ref|XP_008438127.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    306   5e-95    
gb|KHN03562.1|  Putative galacturonosyltransferase 4                    306   6e-95    
dbj|BAF00667.1|  hypothetical protein                                   307   6e-95    
ref|XP_008438125.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    306   6e-95    
ref|XP_002439065.1|  hypothetical protein SORBIDRAFT_10g030870          307   6e-95    
ref|XP_010942524.1|  PREDICTED: probable galacturonosyltransferas...    306   7e-95    
ref|XP_011623142.1|  PREDICTED: polygalacturonate 4-alpha-galactu...    308   7e-95    
ref|XP_010942525.1|  PREDICTED: probable galacturonosyltransferas...    306   7e-95    
ref|XP_010942526.1|  PREDICTED: probable galacturonosyltransferas...    306   7e-95    
ref|XP_006660049.1|  PREDICTED: probable galacturonosyltransferas...    305   8e-95    
ref|XP_006661357.1|  PREDICTED: probable galacturonosyltransferas...    307   8e-95    
ref|XP_003630117.1|  Nudix hydrolase                                    311   9e-95    
gb|EPS65589.1|  hypothetical protein M569_09187                         305   9e-95    
ref|XP_009363241.1|  PREDICTED: LOW QUALITY PROTEIN: probable gal...    306   1e-94    
ref|XP_003630116.1|  Nudix hydrolase                                    311   1e-94    
gb|EEC83383.1|  hypothetical protein OsI_28798                          305   1e-94    
ref|XP_002533896.1|  Glycosyltransferase QUASIMODO1, putative           305   1e-94    
ref|XP_001756118.1|  predicted protein                                  301   2e-94    
ref|XP_009610681.1|  PREDICTED: probable galacturonosyltransferase 4    306   2e-94    
ref|XP_004959557.1|  PREDICTED: probable galacturonosyltransferas...    307   2e-94    
gb|EYU33824.1|  hypothetical protein MIMGU_mgv1a002625mg                305   2e-94    
ref|XP_002866790.1|  hypothetical protein ARALYDRAFT_912279             305   3e-94    
ref|NP_001061555.1|  Os08g0327100                                       305   3e-94    



>ref|XP_011089660.1| PREDICTED: galacturonosyltransferase 8-like [Sesamum indicum]
Length=570

 Score =   434 bits (1116),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 196/207 (95%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLH+ILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  364  KFRNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  423

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KF+PKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  424  FGSFHRYAQYMNFSHPLIKAKFSPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  483

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSIS DEI NAAV+HFNGNMKPWLDI
Sbjct  484  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEIKNAAVIHFNGNMKPWLDI  543

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            AI QFRPLWTKYVDYENEY+QACNFGL
Sbjct  544  AITQFRPLWTKYVDYENEYVQACNFGL  570



>ref|XP_009775386.1| PREDICTED: galacturonosyltransferase 8 [Nicotiana sylvestris]
Length=566

 Score =   433 bits (1113),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 194/207 (94%), Positives = 203/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNH+RFYLPE+YPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  360  KFRNPKYLSILNHIRFYLPELYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  419

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EK TEEYHYWQ+LNENR
Sbjct  420  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKLTEEYHYWQSLNENR  479

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDI
Sbjct  480  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDI  539

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTKYVDYENEY+QACNFGL
Sbjct  540  AMNQFRPLWTKYVDYENEYVQACNFGL  566



>gb|EYU40627.1| hypothetical protein MIMGU_mgv1a003761mg [Erythranthe guttata]
Length=565

 Score =   432 bits (1111),  Expect = 9e-145, Method: Compositional matrix adjust.
 Identities = 195/207 (94%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLH+ILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  359  KFRNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  418

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ +F+PKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  419  FGSFHRYAQYMNFSHPLIKARFSPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  478

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSIS DEINNAAV+HFNGNMKPWLDI
Sbjct  479  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEINNAAVIHFNGNMKPWLDI  538

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            AI QFRPLWTKYVDYENEY+Q CNFGL
Sbjct  539  AITQFRPLWTKYVDYENEYVQTCNFGL  565



>ref|XP_009614844.1| PREDICTED: galacturonosyltransferase 8 [Nicotiana tomentosiformis]
Length=564

 Score =   432 bits (1111),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 194/207 (94%), Positives = 203/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNH+RFYLPE+YPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  358  KFRNPKYLSILNHIRFYLPELYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  417

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EK TEEYHYWQ+LNENR
Sbjct  418  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKLTEEYHYWQSLNENR  477

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDI
Sbjct  478  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDI  537

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTKYVDYENEY+QACNFGL
Sbjct  538  AMNQFRPLWTKYVDYENEYVQACNFGL  564



>emb|CAJ34814.1| glycosyltransferase [Plantago major]
Length=318

 Score =   422 bits (1086),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 193/207 (93%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLH+ILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  112  KFRNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  171

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KF+PKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  172  FGSFHRYAQYMNFSHPLIKAKFSPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  231

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLITYYSTTKPL KSWHVLGLGYNPSIS DEINNAAV+HFNGNMKPWLDI
Sbjct  232  TLWKLGTLPPGLITYYSTTKPLHKSWHVLGLGYNPSISMDEINNAAVIHFNGNMKPWLDI  291

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            AI+QFRPLW KYVDYENEY+Q CNFGL
Sbjct  292  AISQFRPLWAKYVDYENEYVQTCNFGL  318



>ref|XP_012085051.1| PREDICTED: galacturonosyltransferase 8 [Jatropha curcas]
 gb|KDP26352.1| hypothetical protein JCGZ_17510 [Jatropha curcas]
Length=560

 Score =   431 bits (1108),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 193/207 (93%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  354  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  413

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLIR KFNPKACAWAYGMNFFDLDAWRKEKCTE+YHYWQ LNENR
Sbjct  414  FGSFHRYAQYMNFSHPLIREKFNPKACAWAYGMNFFDLDAWRKEKCTEQYHYWQNLNENR  473

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI+NAAVVHFNGNMKPWLDI
Sbjct  474  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEISNAAVVHFNGNMKPWLDI  533

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLWTKYVDYE E++Q+CNFGL
Sbjct  534  AMTQFKPLWTKYVDYEMEFVQSCNFGL  560



>ref|XP_010246719.1| PREDICTED: galacturonosyltransferase 8 [Nelumbo nucifera]
Length=569

 Score =   428 bits (1100),  Expect = 4e-143, Method: Compositional matrix adjust.
 Identities = 192/207 (93%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  363  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  422

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKAC WAYGMNFFDLDAWR+EKCTE+YHYWQ LNENR
Sbjct  423  FGSFHRYAQYMNFSHPLIKEKFNPKACGWAYGMNFFDLDAWRREKCTEQYHYWQNLNENR  482

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  483  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  542

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTKYVDYENE+IQ CNFG+
Sbjct  543  AMNQFRPLWTKYVDYENEFIQQCNFGI  569



>ref|XP_007140673.1| hypothetical protein PHAVU_008G132200g [Phaseolus vulgaris]
 gb|ESW12667.1| hypothetical protein PHAVU_008G132200g [Phaseolus vulgaris]
Length=556

 Score =   427 bits (1097),  Expect = 9e-143, Method: Compositional matrix adjust.
 Identities = 192/207 (93%), Positives = 203/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLH+ILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  350  KFRNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  409

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KF+PKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  410  FGSFHRYAQYMNFSHPLIKAKFSPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  469

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDI
Sbjct  470  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDI  529

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+AQF+PLWTKYVDYE +++QACNFG+
Sbjct  530  AMAQFKPLWTKYVDYELDFVQACNFGI  556



>ref|XP_003552108.1| PREDICTED: galacturonosyltransferase 8-like [Glycine max]
 gb|KHN41703.1| Galacturonosyltransferase 8 [Glycine soja]
Length=556

 Score =   427 bits (1097),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 192/207 (93%), Positives = 203/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLH+ILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  350  KFRNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  409

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  410  FGSFHRYAQYMNFSHPLIKAKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  469

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLITYY+TTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDI
Sbjct  470  TLWKLGTLPPGLITYYATTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDI  529

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+AQF+PLWTKYVDYE +++QACNFG+
Sbjct  530  AMAQFKPLWTKYVDYELDFVQACNFGI  556



>ref|XP_011024611.1| PREDICTED: galacturonosyltransferase 8 [Populus euphratica]
Length=554

 Score =   426 bits (1095),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 191/207 (92%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  348  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  407

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  408  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  467

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI +AAVVHFNGNMKPWLDI
Sbjct  468  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIQSAAVVHFNGNMKPWLDI  527

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLWTK+VDYE E++QACNFGL
Sbjct  528  AMTQFKPLWTKHVDYELEFVQACNFGL  554



>ref|XP_002301803.1| hypothetical protein POPTR_0002s24790g [Populus trichocarpa]
 gb|EEE81076.1| hypothetical protein POPTR_0002s24790g [Populus trichocarpa]
Length=554

 Score =   426 bits (1094),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 191/207 (92%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  348  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  407

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  408  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  467

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI +AAVVHFNGNMKPWLDI
Sbjct  468  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIQSAAVVHFNGNMKPWLDI  527

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLWTK+VDYE E++QACNFGL
Sbjct  528  AMTQFKPLWTKHVDYELEFVQACNFGL  554



>gb|ABK92560.1| unknown [Populus trichocarpa]
Length=554

 Score =   426 bits (1094),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 191/207 (92%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  348  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  407

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  408  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  467

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI +AAVVHFNGNMKPWLDI
Sbjct  468  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIQSAAVVHFNGNMKPWLDI  527

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLWTK+VDYE E++QACNFGL
Sbjct  528  AMTQFKPLWTKHVDYELEFVQACNFGL  554



>ref|XP_006584621.1| PREDICTED: uncharacterized protein LOC100817076 isoform X1 [Glycine 
max]
 gb|KHN10961.1| Galacturonosyltransferase 8 [Glycine soja]
Length=556

 Score =   425 bits (1092),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 191/207 (92%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLH+ILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  350  KFRNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  409

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  410  FGSFHRYAQYMNFSHPLIKAKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  469

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLITYY+TTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDI
Sbjct  470  TLWKLGTLPPGLITYYATTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDI  529

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLWTKYVDYE +++QACNFG+
Sbjct  530  AMTQFKPLWTKYVDYELDFVQACNFGI  556



>ref|XP_004515038.1| PREDICTED: galacturonosyltransferase 8-like [Cicer arietinum]
Length=555

 Score =   424 bits (1090),  Expect = 9e-142, Method: Compositional matrix adjust.
 Identities = 190/207 (92%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLH++LFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  349  KFRNPKYLSILNHLRFYLPEMYPKLHKVLFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  408

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ +FNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  409  FGSFHRYAQYMNFSHPLIKARFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  468

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDI
Sbjct  469  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDI  528

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLW+KYVDYE E++QACNFG+
Sbjct  529  AMTQFKPLWSKYVDYELEFVQACNFGI  555



>ref|XP_002273962.2| PREDICTED: galacturonosyltransferase 8 [Vitis vinifera]
Length=558

 Score =   424 bits (1090),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 190/207 (92%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  352  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  411

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKAC WAYGMNFFDLDAWRKEKCTE+YHYWQ LNENR
Sbjct  412  FGSFHRYAQYMNFSHPLIKEKFNPKACGWAYGMNFFDLDAWRKEKCTEQYHYWQNLNENR  471

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI+NAAVVHFNGNMKPWLDI
Sbjct  472  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIHNAAVVHFNGNMKPWLDI  531

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTK+VDY+ E++QACNFGL
Sbjct  532  AMNQFRPLWTKHVDYDMEFVQACNFGL  558



>ref|XP_004242412.1| PREDICTED: galacturonosyltransferase 8-like [Solanum lycopersicum]
Length=557

 Score =   424 bits (1089),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNH+RFYLPE+YPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  351  KFRNPKYLSILNHIRFYLPELYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  410

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI  KFNPKACAWAYGMNFFDLDAWR+EK TE+YHYWQ LNENR
Sbjct  411  FGSFHRYAQYMNFSHPLINSKFNPKACAWAYGMNFFDLDAWRREKLTEDYHYWQTLNENR  470

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EINNAAVVHFNGNMKPWLDI
Sbjct  471  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEINNAAVVHFNGNMKPWLDI  530

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+AQ+RPLW+KYVDYENEY+Q CNFG 
Sbjct  531  AMAQYRPLWSKYVDYENEYVQGCNFGF  557



>gb|KDO65982.1| hypothetical protein CISIN_1g008561mg [Citrus sinensis]
Length=561

 Score =   424 bits (1089),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  355  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  415  FGSFHRYAQYMNFSHPLIKAKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  475  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIQNAAVVHFNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ QF+PLWTKYVDY+ ++IQACNFG
Sbjct  535  AMNQFKPLWTKYVDYDLDFIQACNFG  560



>ref|XP_002532733.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
 gb|EEF29635.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Length=566

 Score =   424 bits (1089),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 190/207 (92%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  360  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  419

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWRKEKCTE+YHYWQ LNENR
Sbjct  420  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRKEKCTEQYHYWQNLNENR  479

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  480  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  539

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLWTK+VDY+ +++QACNFGL
Sbjct  540  AMTQFKPLWTKHVDYDLDFVQACNFGL  566



>gb|KHG16505.1| Galacturonosyltransferase 8 -like protein [Gossypium arboreum]
Length=569

 Score =   424 bits (1089),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 190/207 (92%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYP LHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  363  KFRNPKYLSILNHLRFYLPEMYPTLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  422

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  423  FGSFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  482

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI+NAAVVHFNGNMKPWLDI
Sbjct  483  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEISNAAVVHFNGNMKPWLDI  542

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLWTKYVDY+ E++QACNFG+
Sbjct  543  AMNQFKPLWTKYVDYDLEFVQACNFGV  569



>gb|KJB08801.1| hypothetical protein B456_001G104800 [Gossypium raimondii]
Length=396

 Score =   417 bits (1073),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYP LHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  190  KFRNPKYLSILNHLRFYLPEMYPTLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  249

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  250  FGSFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  309

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS DEI+NAAVVHFNGNMKPWLDI
Sbjct  310  TLWKLGTLPPGLITFYSTTKPLNKSWHVLGLGYNPSISMDEISNAAVVHFNGNMKPWLDI  369

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLWTKYVDY+ E++QACNFG+
Sbjct  370  AMNQFKPLWTKYVDYDLEFVQACNFGV  396



>ref|NP_001242612.1| uncharacterized protein LOC100817076 [Glycine max]
 gb|ACU20809.1| unknown [Glycine max]
Length=547

 Score =   423 bits (1087),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 190/207 (92%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLH+ILFLDDDIV Q+DLTGLWKIDMDGKVNGAVETC
Sbjct  341  KFRNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVAQKDLTGLWKIDMDGKVNGAVETC  400

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  401  FGSFHRYAQYMNFSHPLIKAKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  460

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLITYY+TTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDI
Sbjct  461  TLWKLGTLPPGLITYYATTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDI  520

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLWTKYVDYE +++QACNFG+
Sbjct  521  AMTQFKPLWTKYVDYELDFVQACNFGI  547



>ref|XP_006479231.1| PREDICTED: galacturonosyltransferase 8-like [Citrus sinensis]
Length=561

 Score =   423 bits (1088),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 191/206 (93%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  355  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  415  FGSFHRYAQYMNFSHPLIKAKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  475  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIQNAAVVHFNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ QF+PLWTKYVDY+ ++IQACNFG
Sbjct  535  AMNQFKPLWTKYVDYDLDFIQACNFG  560



>ref|XP_006352682.1| PREDICTED: galacturonosyltransferase 8-like [Solanum tuberosum]
Length=557

 Score =   423 bits (1087),  Expect = 3e-141, Method: Compositional matrix adjust.
 Identities = 189/206 (92%), Positives = 199/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNH+RFYLPE+YPKLHRILFLDDDIVVQ+DLTGLWKIDM GKVNGAVETC
Sbjct  351  KFRNPKYLSILNHIRFYLPELYPKLHRILFLDDDIVVQKDLTGLWKIDMGGKVNGAVETC  410

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EK TEEYHYWQ  NENR
Sbjct  411  FGSFHRYAQYMNFSHPLIKSKFNPKACAWAYGMNFFDLDAWRREKLTEEYHYWQTRNENR  470

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EINNAAVVHFNGNMKPWLDI
Sbjct  471  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEINNAAVVHFNGNMKPWLDI  530

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+AQ+RPLWTKYVDYENEY+Q CNFG
Sbjct  531  AMAQYRPLWTKYVDYENEYVQGCNFG  556



>ref|XP_006418657.1| hypothetical protein EUTSA_v10002465mg [Eutrema salsugineum]
 gb|ESQ37093.1| hypothetical protein EUTSA_v10002465mg [Eutrema salsugineum]
Length=562

 Score =   423 bits (1087),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGA+ETC
Sbjct  356  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAIETC  415

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  416  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  475

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  476  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  535

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTK+VDY+ E++QACNFGL
Sbjct  536  AMNQFRPLWTKHVDYDLEFVQACNFGL  562



>gb|ABD65461.1| transferring glycosyl protein [Gossypium hirsutum]
Length=207

 Score =   409 bits (1051),  Expect = 6e-141, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  1    KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  60

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  61   FGSFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  120

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  121  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  180

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLW+KYVD++ E++QACNFG+
Sbjct  181  AMNQFKPLWSKYVDFDLEFVQACNFGV  207



>ref|XP_003622860.1| Glycosyltransferase CAZy family GT8 [Medicago truncatula]
 gb|AES79078.1| glycosyltransferase Quasimodo protein, putative [Medicago truncatula]
 gb|KEH22795.1| glycosyltransferase Quasimodo protein, putative [Medicago truncatula]
Length=434

 Score =   417 bits (1073),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLH++LFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  228  KFRNPKYLSILNHLRFYLPEMYPKLHKVLFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  287

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+ KCTEEYHYWQ LNENR
Sbjct  288  FGSFHRYAQYMNFSHPLIKAKFNPKACAWAYGMNFFDLDAWRRVKCTEEYHYWQNLNENR  347

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSIS DEINNAAVVHFNGNMKPWLDI
Sbjct  348  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEINNAAVVHFNGNMKPWLDI  407

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLW+KYVD E E++QACNFG+
Sbjct  408  AMTQFKPLWSKYVDVELEFVQACNFGI  434



>ref|XP_009136103.1| PREDICTED: galacturonosyltransferase 8 [Brassica rapa]
Length=558

 Score =   422 bits (1085),  Expect = 7e-141, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  352  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  411

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  412  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  471

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  472  ALWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  531

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTK+VDY+ E++QACNFGL
Sbjct  532  AMNQFRPLWTKHVDYDLEFVQACNFGL  558



>gb|KHG21596.1| Galacturonosyltransferase 8 -like protein [Gossypium arboreum]
Length=564

 Score =   422 bits (1085),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  358  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  417

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  418  FGSFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  477

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  478  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  537

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLW+KYVD++ E++QACNFG+
Sbjct  538  AMNQFKPLWSKYVDFDLEFVQACNFGV  564



>gb|KJB10196.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
 gb|KJB10197.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=396

 Score =   416 bits (1069),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVV +DLTGLWKIDMDGKVNGAVETC
Sbjct  190  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVHKDLTGLWKIDMDGKVNGAVETC  249

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  250  FGSFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  309

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  310  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  369

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLW+KYVD++ E++QACNFG+
Sbjct  370  AMNQFKPLWSKYVDFDLEFVQACNFGV  396



>ref|XP_009102430.1| PREDICTED: galacturonosyltransferase 8-like [Brassica rapa]
Length=569

 Score =   422 bits (1085),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  363  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  422

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  423  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  482

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDK+WHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  483  TLWKLGTLPPGLITFYSTTKPLDKTWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  542

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTK+VD++ E++QACNFGL
Sbjct  543  AMNQFRPLWTKHVDHDLEFVQACNFGL  569



>ref|XP_010513952.1| PREDICTED: galacturonosyltransferase 8-like [Camelina sativa]
Length=561

 Score =   422 bits (1084),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  355  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  415  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  475  ALWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTK+VDY+ E++QACNFGL
Sbjct  535  AMNQFRPLWTKHVDYDLEFVQACNFGL  561



>emb|CDX93049.1| BnaA03g37710D [Brassica napus]
Length=553

 Score =   421 bits (1083),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  347  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  406

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  407  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  466

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  467  ALWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  526

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTK+VDY+ E++QACNFGL
Sbjct  527  AMNQFRPLWTKHVDYDLEFVQACNFGL  553



>emb|CDY61593.1| BnaC03g74220D [Brassica napus]
Length=553

 Score =   421 bits (1083),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  347  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  406

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  407  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  466

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  467  ALWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  526

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTK+VDY+ E++QACNFGL
Sbjct  527  AMNQFRPLWTKHVDYDLEFVQACNFGL  553



>ref|XP_010488624.1| PREDICTED: galacturonosyltransferase 8-like [Camelina sativa]
Length=561

 Score =   421 bits (1083),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  355  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  415  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  475  ALWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTK+VDY+ E++QACNFGL
Sbjct  535  AMNQFRPLWTKHVDYDLEFVQACNFGL  561



>ref|NP_189150.1| Galacturonosyltransferase 8 [Arabidopsis thaliana]
 sp|Q9LSG3.1|GAUT8_ARATH RecName: Full=Galacturonosyltransferase 8; AltName: Full=Glycosyltransferase 
QUASIMODO1 [Arabidopsis thaliana]
 dbj|BAB02072.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM20426.1| glycosyl transferase, putative [Arabidopsis thaliana]
 gb|AAQ56836.1| At3g25140 [Arabidopsis thaliana]
 gb|AEE76983.1| Galacturonosyltransferase 8 [Arabidopsis thaliana]
 gb|AHL38751.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=559

 Score =   421 bits (1083),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  353  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  412

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  413  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  472

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  473  ALWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  532

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTK+VDY+ E++QACNFGL
Sbjct  533  AMNQFRPLWTKHVDYDLEFVQACNFGL  559



>gb|KJB08802.1| hypothetical protein B456_001G104800 [Gossypium raimondii]
Length=569

 Score =   422 bits (1084),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 202/207 (98%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYP LHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  363  KFRNPKYLSILNHLRFYLPEMYPTLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  422

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  423  FGSFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  482

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS DEI+NAAVVHFNGNMKPWLDI
Sbjct  483  TLWKLGTLPPGLITFYSTTKPLNKSWHVLGLGYNPSISMDEISNAAVVHFNGNMKPWLDI  542

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLWTKYVDY+ E++QACNFG+
Sbjct  543  AMNQFKPLWTKYVDYDLEFVQACNFGV  569



>ref|XP_010036787.1| PREDICTED: galacturonosyltransferase 8 [Eucalyptus grandis]
 gb|KCW48431.1| hypothetical protein EUGRSUZ_K02133 [Eucalyptus grandis]
Length=555

 Score =   421 bits (1082),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 190/207 (92%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  349  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  408

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  409  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  468

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  469  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISLEEIRNAAVVHFNGNMKPWLDI  528

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A++ F+PLWTKYVDYE ++IQACNFG+
Sbjct  529  AMSLFKPLWTKYVDYELDFIQACNFGV  555



>ref|XP_010466934.1| PREDICTED: galacturonosyltransferase 8 [Camelina sativa]
Length=561

 Score =   421 bits (1083),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  355  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  415  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  475  ALWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTK+VDY+ E++QACNFGL
Sbjct  535  AMNQFRPLWTKHVDYDLEFVQACNFGL  561



>ref|XP_006297348.1| hypothetical protein CARUB_v10013367mg [Capsella rubella]
 gb|EOA30246.1| hypothetical protein CARUB_v10013367mg [Capsella rubella]
Length=561

 Score =   421 bits (1082),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  355  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  415  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  475  ALWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTK+VDY+ E++QACNFGL
Sbjct  535  AMNQFRPLWTKHVDYDLEFVQACNFGL  561



>ref|XP_002863088.1| hypothetical protein ARALYDRAFT_497166 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39347.1| hypothetical protein ARALYDRAFT_497166 [Arabidopsis lyrata subsp. 
lyrata]
Length=559

 Score =   421 bits (1082),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  353  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  412

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  413  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  472

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  473  ALWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  532

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTK+VDY+ E++QACNFGL
Sbjct  533  AMNQFRPLWTKHVDYDLEFVQACNFGL  559



>gb|KJB10198.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=564

 Score =   421 bits (1082),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVV +DLTGLWKIDMDGKVNGAVETC
Sbjct  358  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVHKDLTGLWKIDMDGKVNGAVETC  417

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  418  FGSFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  477

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  478  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  537

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLW+KYVD++ E++QACNFG+
Sbjct  538  AMNQFKPLWSKYVDFDLEFVQACNFGV  564



>ref|XP_010104168.1| Galacturonosyltransferase 8 [Morus notabilis]
 gb|EXB99100.1| Galacturonosyltransferase 8 [Morus notabilis]
Length=562

 Score =   421 bits (1081),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 201/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  356  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  415

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  416  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  475

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  476  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  535

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLWTKYVDY+ +++QACNFG+
Sbjct  536  AMNQFKPLWTKYVDYDLDFVQACNFGI  562



>gb|KJB10199.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=571

 Score =   421 bits (1081),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVV +DLTGLWKIDMDGKVNGAVETC
Sbjct  358  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVHKDLTGLWKIDMDGKVNGAVETC  417

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  418  FGSFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  477

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  478  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  537

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ QF+PLW+KYVD++ E++QACNFG
Sbjct  538  AMNQFKPLWSKYVDFDLEFVQACNFG  563



>gb|KJB10200.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=591

 Score =   421 bits (1081),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVV +DLTGLWKIDMDGKVNGAVETC
Sbjct  358  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVHKDLTGLWKIDMDGKVNGAVETC  417

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  418  FGSFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  477

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  478  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  537

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ QF+PLW+KYVD++ E++QACNFG
Sbjct  538  AMNQFKPLWSKYVDFDLEFVQACNFG  563



>emb|CBI25666.3| unnamed protein product [Vitis vinifera]
Length=503

 Score =   417 bits (1072),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 199/207 (96%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            +  NPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  297  QLENPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  356

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKAC WAYGMNFFDLDAWRKEKCTE+YHYWQ LNENR
Sbjct  357  FGSFHRYAQYMNFSHPLIKEKFNPKACGWAYGMNFFDLDAWRKEKCTEQYHYWQNLNENR  416

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI+NAAVVHFNGNMKPWLDI
Sbjct  417  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIHNAAVVHFNGNMKPWLDI  476

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFRPLWTK+VDY+ E++QACNFGL
Sbjct  477  AMNQFRPLWTKHVDYDMEFVQACNFGL  503



>ref|XP_010696262.1| PREDICTED: galacturonosyltransferase 8 [Beta vulgaris subsp. 
vulgaris]
Length=551

 Score =   419 bits (1077),  Expect = 9e-140, Method: Compositional matrix adjust.
 Identities = 187/207 (90%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYP LHRILFLDDDIVVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  345  KFRNPKYLSMLNHLRFYLPEMYPSLHRILFLDDDIVVQKDLTGLWEIDMDGKVNGAVETC  404

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWRKE CTE+YHYWQ +NENR
Sbjct  405  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRKEGCTEQYHYWQNMNENR  464

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  465  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISWDEIRNAAVVHFNGNMKPWLDI  524

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLWTKYVD ENEY+Q CNF L
Sbjct  525  AMGQFKPLWTKYVDNENEYVQGCNFAL  551



>ref|XP_010527263.1| PREDICTED: galacturonosyltransferase 8 [Tarenaya hassleriana]
Length=563

 Score =   419 bits (1076),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 188/206 (91%), Positives = 200/206 (97%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  357  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  416

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  417  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  476

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGN+KPWLDI
Sbjct  477  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNLKPWLDI  536

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ QFRPLWTK+VDY+ +++QACNFG
Sbjct  537  AMNQFRPLWTKHVDYDLDFVQACNFG  562



>ref|XP_008382600.1| PREDICTED: galacturonosyltransferase 8-like [Malus domestica]
Length=561

 Score =   418 bits (1075),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 199/207 (96%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  355  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWRIDMDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWRK+ CT EYHYWQ LNENR
Sbjct  415  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRKQNCTAEYHYWQNLNENR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  475  SLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A++QF+PLW K+VDY+ E++QACNFGL
Sbjct  535  AMSQFKPLWEKHVDYDMEFVQACNFGL  561



>ref|XP_009372229.1| PREDICTED: galacturonosyltransferase 8-like [Pyrus x bretschneideri]
Length=563

 Score =   417 bits (1073),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 186/207 (90%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  357  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWRIDMDGKVNGAVETC  416

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWRK+ CT EYHYWQ LNENR
Sbjct  417  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRKQNCTAEYHYWQNLNENR  476

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  477  SLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  536

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+PLW K+VDY+ E++QACNFGL
Sbjct  537  AMNQFKPLWEKHVDYDMEFVQACNFGL  563



>ref|XP_010532909.1| PREDICTED: galacturonosyltransferase 8-like [Tarenaya hassleriana]
Length=556

 Score =   417 bits (1071),  Expect = 7e-139, Method: Compositional matrix adjust.
 Identities = 187/206 (91%), Positives = 198/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYP LHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  350  KFRNPKYLSILNHLRFYLPEMYPNLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  409

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  410  FGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  469

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  470  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  529

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ QFRPLWTK+VDY+ +++Q CNFG
Sbjct  530  AMNQFRPLWTKHVDYDLDFVQQCNFG  555



>ref|XP_008235436.1| PREDICTED: galacturonosyltransferase 8 [Prunus mume]
Length=562

 Score =   417 bits (1071),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 185/207 (89%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  356  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  415

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNP ACAWAYGMNFFDLDAWR++ CT EYHYWQ LNENR
Sbjct  416  FGSFHRYAQYMNFSHPLIKEKFNPNACAWAYGMNFFDLDAWRRQNCTAEYHYWQNLNENR  475

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  476  SLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  535

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A++QFRPLW K+VDY+ E++QACNFGL
Sbjct  536  AMSQFRPLWEKHVDYDMEFVQACNFGL  562



>ref|XP_004149774.1| PREDICTED: galacturonosyltransferase 8 [Cucumis sativus]
 gb|KGN44629.1| hypothetical protein Csa_7G352420 [Cucumis sativus]
Length=566

 Score =   416 bits (1069),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  360  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  419

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KF+PKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ +NENR
Sbjct  420  FGSFHRYAQYMNFSHPLIKEKFDPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNMNENR  479

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDK+WHVLGLGYNPSIS  EI NAAVVHFNGNMKPWLDI
Sbjct  480  TLWKLGTLPPGLITFYSTTKPLDKTWHVLGLGYNPSISKGEIENAAVVHFNGNMKPWLDI  539

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            AI QFRP WTKYVDY  E++QACN GL
Sbjct  540  AITQFRPYWTKYVDYGLEFVQACNLGL  566



>ref|XP_008458050.1| PREDICTED: galacturonosyltransferase 8 [Cucumis melo]
Length=566

 Score =   416 bits (1068),  Expect = 3e-138, Method: Compositional matrix adjust.
 Identities = 188/207 (91%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  360  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  419

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KF+PKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ +NENR
Sbjct  420  FGSFHRYAQYMNFSHPLIKEKFDPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNMNENR  479

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDK+WHVLGLGYNPSIS  EI NAAVVHFNGNMKPWLDI
Sbjct  480  TLWKLGTLPPGLITFYSTTKPLDKTWHVLGLGYNPSISKGEIENAAVVHFNGNMKPWLDI  539

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            AI QFRP WTKYVDY  E++QACN GL
Sbjct  540  AITQFRPYWTKYVDYGLEFVQACNLGL  566



>emb|CDX77366.1| BnaA07g05040D [Brassica napus]
Length=536

 Score =   414 bits (1064),  Expect = 4e-138, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 199/205 (97%), Gaps = 0/205 (0%)
 Frame = -2

Query  953  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  774
            +NPKYLSILNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETCFG
Sbjct  332  KNPKYLSILNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETCFG  391

Query  773  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  594
            SFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENRTL
Sbjct  392  SFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENRTL  451

Query  593  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  414
            WKLGTLPPGLIT+YSTTKPLDK+WHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDIA+
Sbjct  452  WKLGTLPPGLITFYSTTKPLDKTWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDIAM  511

Query  413  AQFRPLWTKYVDYENEYIQACNFGL  339
             QFRPLWTK+VD++ E++QACNFGL
Sbjct  512  NQFRPLWTKHVDHDLEFVQACNFGL  536



>emb|CDP03909.1| unnamed protein product [Coffea canephora]
Length=566

 Score =   415 bits (1066),  Expect = 5e-138, Method: Compositional matrix adjust.
 Identities = 189/207 (91%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  360  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  419

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QYMNFSHPLI  KFNP ACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  420  FGSFHRYKQYMNFSHPLINAKFNPNACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  479

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNP I   EI NAAVVHFNGN+KPWLDI
Sbjct  480  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPFIDKAEITNAAVVHFNGNLKPWLDI  539

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
             + Q+RPLWTKYVDYENE+IQACNFGL
Sbjct  540  GMLQYRPLWTKYVDYENEHIQACNFGL  566



>ref|XP_010257858.1| PREDICTED: probable galacturonosyltransferase 9 [Nelumbo nucifera]
Length=569

 Score =   414 bits (1065),  Expect = 9e-138, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYP LHRILFLDDD+VVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  363  KFRNPKYLSMLNHLRFYLPEMYPNLHRILFLDDDVVVQKDLTGLWKIDMDGKVNGAVETC  422

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLIR +FNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ+LNENR
Sbjct  423  FGSFHRYAQYMNFSHPLIRERFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQSLNENR  482

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI  AAV+H+NGNMKPWLDI
Sbjct  483  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISIDEIKRAAVIHYNGNMKPWLDI  542

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q+RP W+KYVDYE E++Q CNFGL
Sbjct  543  AMNQYRPFWSKYVDYEMEFVQGCNFGL  569



>ref|XP_007201169.1| hypothetical protein PRUPE_ppa003603mg [Prunus persica]
 gb|EMJ02368.1| hypothetical protein PRUPE_ppa003603mg [Prunus persica]
Length=562

 Score =   413 bits (1062),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLW IDMDGKVNGAVETC
Sbjct  356  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWNIDMDGKVNGAVETC  415

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNP ACAWAYGMNFFDLDAWR++ CT EYHYWQ LNENR
Sbjct  416  FGSFHRYAQYMNFSHPLIKEKFNPNACAWAYGMNFFDLDAWRRQNCTAEYHYWQNLNENR  475

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  476  SLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  535

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A++QFRPLW K+VDY+ E++QACNFG+
Sbjct  536  AMSQFRPLWEKHVDYDMEFVQACNFGI  562



>ref|XP_007142473.1| hypothetical protein PHAVU_008G283600g [Phaseolus vulgaris]
 gb|ESW14467.1| hypothetical protein PHAVU_008G283600g [Phaseolus vulgaris]
Length=547

 Score =   412 bits (1060),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLH+ILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  341  KFRNPKYLSILNHLRFYLPEMYPKLHKILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  400

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KF+PKACAWAYGMNFFDLDAWR+ KCTEEYHYWQ LNENR
Sbjct  401  FGSFHRYAQYMNFSHPLIKEKFSPKACAWAYGMNFFDLDAWRRTKCTEEYHYWQNLNENR  460

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLITYYSTTKPL KSWHVLGLGYNPSI  DEI NAAVVHFNGNMKPWLDI
Sbjct  461  TLWKLGTLPPGLITYYSTTKPLHKSWHVLGLGYNPSIGMDEIKNAAVVHFNGNMKPWLDI  520

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++QF+PLWTKYVDYE ++++ACNF
Sbjct  521  AMSQFKPLWTKYVDYELDFVRACNF  545



>ref|XP_008372509.1| PREDICTED: galacturonosyltransferase 8 [Malus domestica]
Length=563

 Score =   413 bits (1062),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  357  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWRIDMDGKVNGAVETC  416

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNP ACAWAYGMNFFDLDAWRK+ CT EYHYWQ LNENR
Sbjct  417  FGSFHRYAQYMNFSHPLIKEKFNPNACAWAYGMNFFDLDAWRKQNCTAEYHYWQNLNENR  476

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  477  SLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  536

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A++QF+PLW K+V Y+ E++QACNFGL
Sbjct  537  AMSQFKPLWEKHVSYDMEFVQACNFGL  563



>ref|XP_009404224.1| PREDICTED: galacturonosyltransferase 8-like [Musa acuminata subsp. 
malaccensis]
Length=557

 Score =   413 bits (1061),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 197/206 (96%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEM+PKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  351  KFRNPKYLSMLNHLRFYLPEMHPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  410

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNPKAC WAYGMNFFDLDAWRKEKCTE+YHYWQ LNENR
Sbjct  411  FGSFHRYAQYMNFSHPLIKEKFNPKACGWAYGMNFFDLDAWRKEKCTEQYHYWQNLNENR  470

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EINNAAVVHFNGNMKPWLDI
Sbjct  471  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEINNAAVVHFNGNMKPWLDI  530

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ QFR LWTKYVDY+ E+++ CNF 
Sbjct  531  AMNQFRHLWTKYVDYDMEFVRQCNFA  556



>ref|XP_009372029.1| PREDICTED: galacturonosyltransferase 8-like [Pyrus x bretschneideri]
Length=575

 Score =   412 bits (1060),  Expect = 5e-137, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  369  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWRIDMDGKVNGAVETC  428

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNP ACAWAYGMNFFDLDAWRK+ CT EYHYWQ LNENR
Sbjct  429  FGSFHRYAQYMNFSHPLIKEKFNPNACAWAYGMNFFDLDAWRKQNCTAEYHYWQNLNENR  488

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  489  SLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  548

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A++QF+PLW K+V Y+ E++QACNFGL
Sbjct  549  AMSQFKPLWEKHVSYDMEFVQACNFGL  575



>ref|XP_008778166.1| PREDICTED: galacturonosyltransferase 8-like [Phoenix dactylifera]
Length=559

 Score =   412 bits (1058),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 185/206 (90%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  353  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  412

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ +FNPKAC WAYGMNFFDLDAWR+EKCTE+YHYWQ LNENR
Sbjct  413  FGSFHRYAQYMNFSHPLIKERFNPKACGWAYGMNFFDLDAWRREKCTEQYHYWQNLNENR  472

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  473  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  532

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ QFR LWTKYVDYE E+I+ CNF 
Sbjct  533  AMNQFRHLWTKYVDYEMEFIRQCNFA  558



>ref|XP_008803497.1| PREDICTED: LOW QUALITY PROTEIN: galacturonosyltransferase 8-like 
[Phoenix dactylifera]
Length=556

 Score =   410 bits (1055),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 196/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDM+GKVNGAVETC
Sbjct  350  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMEGKVNGAVETC  409

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ +FNPKAC WAYGMNFFDLDAWRKEKCTE+YHYWQ LNENR
Sbjct  410  FGSFHRYAQYMNFSHPLIKERFNPKACGWAYGMNFFDLDAWRKEKCTEQYHYWQNLNENR  469

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  470  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIKNAAVVHFNGNMKPWLDI  529

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ QFR LWTKYVDY+ E+I+ CNF 
Sbjct  530  AMNQFRHLWTKYVDYDMEFIRQCNFA  555



>ref|XP_007049694.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
 gb|EOX93851.1| Nucleotide-diphospho-sugar transferases superfamily protein [Theobroma 
cacao]
Length=568

 Score =   411 bits (1056),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 196/202 (97%), Gaps = 0/202 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYP LHRILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  359  KFRNPKYLSILNHLRFYLPEMYPTLHRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  418

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  419  FGSFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  478

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  479  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  538

Query  419  AIAQFRPLWTKYVDYENEYIQA  354
            A+ QF+PLWTKYVDY+ E++QA
Sbjct  539  AMNQFKPLWTKYVDYDLEFVQA  560



>ref|XP_008457595.1| PREDICTED: galacturonosyltransferase 8-like [Cucumis melo]
Length=567

 Score =   410 bits (1055),  Expect = 3e-136, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 200/207 (97%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQ+DLTGLWKIDM+GKVNGAVETC
Sbjct  361  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQKDLTGLWKIDMNGKVNGAVETC  420

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI++KF+PKACAWAYGMNFFDLDAWR+E CTE+YHYWQ +NENR
Sbjct  421  FGSFHRYAQYMNFSHPLIKQKFDPKACAWAYGMNFFDLDAWRRENCTEDYHYWQNMNENR  480

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDK+WHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  481  TLWKLGTLPPGLITFYSTTKPLDKTWHVLGLGYNPSISKDEIQNAAVVHFNGNMKPWLDI  540

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            AI+QF+P WT+YVDY+ E++Q+CN G+
Sbjct  541  AISQFKPYWTRYVDYDLEFVQSCNLGV  567



>ref|XP_010913084.1| PREDICTED: galacturonosyltransferase 8 [Elaeis guineensis]
Length=557

 Score =   409 bits (1051),  Expect = 7e-136, Method: Compositional matrix adjust.
 Identities = 184/206 (89%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  351  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  410

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ +FNPKAC WAYGMNFFDLDAWR+EKCTE+YHYWQ LNENR
Sbjct  411  FGSFHRYAQYMNFSHPLIKARFNPKACGWAYGMNFFDLDAWRREKCTEQYHYWQNLNENR  470

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  471  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIKNAAVVHFNGNMKPWLDI  530

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ QFR LWTKYVDY+ E+I  CNF 
Sbjct  531  AMNQFRHLWTKYVDYDMEFIHQCNFA  556



>ref|XP_006841268.1| PREDICTED: galacturonosyltransferase 8 [Amborella trichopoda]
 gb|ERN02943.1| hypothetical protein AMTR_s00135p00111710 [Amborella trichopoda]
Length=561

 Score =   408 bits (1049),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLTGLW IDMDGKVNGAVETC
Sbjct  355  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTGLWNIDMDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY +YMNFSHPLI+ +FNPKAC WAYGMNFFDLDAWR EKCTE+YHYWQ LNENR
Sbjct  415  FGSFHRYDKYMNFSHPLIKERFNPKACGWAYGMNFFDLDAWRSEKCTEQYHYWQNLNENR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  475  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIQNAAVVHFNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QFR LWTKYVDY+ E++Q CNFGL
Sbjct  535  AMNQFRHLWTKYVDYDMEFVQMCNFGL  561



>ref|XP_010908797.1| PREDICTED: galacturonosyltransferase 8-like [Elaeis guineensis]
Length=557

 Score =   407 bits (1045),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 195/206 (95%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDM+GKVNGAVETC
Sbjct  351  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMEGKVNGAVETC  410

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ +F+PKAC WAYGMNFFDLDAWR+EKCTE+YHYWQ LNENR
Sbjct  411  FGSFHRYAQYMNFSHPLIKERFSPKACGWAYGMNFFDLDAWRREKCTEQYHYWQNLNENR  470

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  471  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIKNAAVVHFNGNMKPWLDI  530

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ QFR LWTKYVDY+ E+I  CNF 
Sbjct  531  AMNQFRHLWTKYVDYDMEFIHQCNFA  556



>ref|XP_009379995.1| PREDICTED: galacturonosyltransferase 8-like [Musa acuminata subsp. 
malaccensis]
Length=557

 Score =   407 bits (1045),  Expect = 7e-135, Method: Compositional matrix adjust.
 Identities = 182/206 (88%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLT LWKIDMDGKVNGAVETC
Sbjct  351  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTALWKIDMDGKVNGAVETC  410

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDLDAWRKEKCTE+YHYWQ LNENR
Sbjct  411  FGSFHRYTQYMNFSHPLIKEKFNPNACGWAYGMNFFDLDAWRKEKCTEQYHYWQNLNENR  470

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  471  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIKNAAVVHFNGNMKPWLDI  530

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ QFR LWTKYVDY+ E+++ CNF 
Sbjct  531  AMNQFRHLWTKYVDYDLEFVRQCNFA  556



>ref|XP_004290178.1| PREDICTED: galacturonosyltransferase 8 [Fragaria vesca subsp. 
vesca]
Length=562

 Score =   406 bits (1044),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKL+RILFLDDDIVVQ+DLTGLWKIDMDGKVNGAVETC
Sbjct  356  KFRNPKYLSILNHLRFYLPEMYPKLNRILFLDDDIVVQKDLTGLWKIDMDGKVNGAVETC  415

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNP ACAWAYGMNFFDLDAWR+  CT +YHYWQ LNENR
Sbjct  416  FGSFHRYAQYMNFSHPLIKEKFNPNACAWAYGMNFFDLDAWRRVNCTADYHYWQNLNENR  475

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  476  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  535

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ QF+P+W K+VDY+ E++Q CNFG+
Sbjct  536  AMNQFKPIWEKHVDYDLEFVQGCNFGM  562



>ref|NP_001168623.1| uncharacterized protein LOC100382408 [Zea mays]
 gb|ACN28889.1| unknown [Zea mays]
Length=274

 Score =   395 bits (1014),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  67   KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  126

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EKCTE+YHYWQ  NENR
Sbjct  127  FGSFHRYAQYMNFSHPLIKAKFNPNACGWAYGMNFFDLDSWRREKCTEQYHYWQNQNENR  186

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  187  TLWKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  246

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             + QFR LWTKYVDY++ YI+ CNF 
Sbjct  247  GMNQFRHLWTKYVDYDDSYIRQCNFA  272



>gb|AID53187.1| galacturonosyltransferase 8-like protein [Dendrobium catenatum]
Length=551

 Score =   403 bits (1035),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHR+LFLDDD+VVQRDLT LWK+DMDGKVNGAVETC
Sbjct  345  KFRNPKYLSMLNHLRFYLPEMYPKLHRVLFLDDDVVVQRDLTALWKLDMDGKVNGAVETC  404

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ +FNP AC WAYGMNFFDLDAWRKEK TE+YHYWQ LNENR
Sbjct  405  FGSFHRYAQYMNFSHPLIKERFNPNACGWAYGMNFFDLDAWRKEKSTEQYHYWQNLNENR  464

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  465  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMNEIRNAAVVHFNGNMKPWLDI  524

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             + QFRPLW +YVDY+N++I  CNFG
Sbjct  525  GMNQFRPLWARYVDYDNDFISLCNFG  550



>gb|AFW71494.1| hypothetical protein ZEAMMB73_252708 [Zea mays]
Length=521

 Score =   401 bits (1030),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  314  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  373

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EKCTE+YHYWQ  NENR
Sbjct  374  FGSFHRYAQYMNFSHPLIKAKFNPNACGWAYGMNFFDLDSWRREKCTEQYHYWQNQNENR  433

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  434  TLWKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  493

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             + QFR LWTKYVDY++ YI+ CNF 
Sbjct  494  GMNQFRHLWTKYVDYDDSYIRQCNFA  519



>ref|XP_002453869.1| hypothetical protein SORBIDRAFT_04g020140 [Sorghum bicolor]
 gb|EES06845.1| hypothetical protein SORBIDRAFT_04g020140 [Sorghum bicolor]
Length=534

 Score =   400 bits (1028),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  327  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  386

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EKCTE+YHYWQ  NENR
Sbjct  387  FGSFHRYAQYMNFSHPLIKAKFNPNACGWAYGMNFFDLDSWRREKCTEQYHYWQNQNENR  446

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  447  TLWKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  506

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             + QFR LWTKYVDY++ YI+ CNF 
Sbjct  507  GMNQFRHLWTKYVDYDDSYIRQCNFA  532



>ref|XP_004952528.1| PREDICTED: galacturonosyltransferase 8-like [Setaria italica]
Length=533

 Score =   399 bits (1026),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 193/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  326  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  385

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QYMNFSHPLI+ KF+P AC WAYGMNFFDLD+WR+EKCTE+YHYWQ  NENR
Sbjct  386  FGSFHRYWQYMNFSHPLIKAKFSPNACGWAYGMNFFDLDSWRREKCTEQYHYWQNQNENR  445

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  446  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  505

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             + QFR LWTKYVDY++EYI+ CNF 
Sbjct  506  GMNQFRHLWTKYVDYDDEYIRQCNFA  531



>ref|XP_006384242.1| hypothetical protein POPTR_0004s10980g [Populus trichocarpa]
 gb|ERP62039.1| hypothetical protein POPTR_0004s10980g [Populus trichocarpa]
Length=562

 Score =   399 bits (1024),  Expect = 9e-132, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWK+D+DGKVNGAVETC
Sbjct  356  KFRNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKVDLDGKVNGAVETC  415

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLI+ +FNPKACAWA+GMN FDLDAWR+EKCTE+YHYWQ+LNE R
Sbjct  416  FGSFHRYAQYLNFSHPLIKERFNPKACAWAFGMNIFDLDAWRREKCTEQYHYWQSLNEER  475

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NGNMKPWLDI
Sbjct  476  TLWKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEISNAAVIHYNGNMKPWLDI  535

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFGL
Sbjct  536  AMNQYKNLWTKYVDNDMEFVQTCNFGL  562



>ref|XP_011012259.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
Length=562

 Score =   398 bits (1023),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLH+ILF+DDD+VVQ+DLTGLWK+D+DGKVNGAVETC
Sbjct  356  KFRNPKYLSMLNHLRFYLPEMYPKLHKILFMDDDVVVQKDLTGLWKVDLDGKVNGAVETC  415

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLI+ +FNPKACAWA+GMN FDLDAWR+EKCTE+YHYWQ+ NE R
Sbjct  416  FGSFHRYAQYLNFSHPLIKERFNPKACAWAFGMNIFDLDAWRREKCTEQYHYWQSRNEER  475

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NGNMKPWLDI
Sbjct  476  TLWKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEISNAAVIHYNGNMKPWLDI  535

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++QACNFGL
Sbjct  536  AMNQYKNLWTKYVDNDMEFVQACNFGL  562



>ref|XP_006373520.1| hypothetical protein POPTR_0017s144802g, partial [Populus trichocarpa]
 gb|ERP51317.1| hypothetical protein POPTR_0017s144802g, partial [Populus trichocarpa]
Length=504

 Score =   395 bits (1016),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 197/207 (95%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKY+S+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWK+D+DGKVNGAVETC
Sbjct  298  KFRNPKYMSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKVDLDGKVNGAVETC  357

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLI+ +FNPKACAWA+GMN FDLDAWR+EKCTE YHYWQ+LNE+R
Sbjct  358  FGSFHRYAQYLNFSHPLIKERFNPKACAWAFGMNIFDLDAWRREKCTEHYHYWQSLNEDR  417

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NGNMKPWLDI
Sbjct  418  TLWKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEISNAAVIHYNGNMKPWLDI  477

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFGL
Sbjct  478  AMNQYKNLWTKYVDNDMEFVQMCNFGL  504



>ref|XP_006482345.1| PREDICTED: probable galacturonosyltransferase 9-like [Citrus 
sinensis]
Length=559

 Score =   396 bits (1018),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLW ID+DGKVNGAVETC
Sbjct  353  KFRNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWNIDLDGKVNGAVETC  412

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLIR KFNPKACAWA+GMN FDLDAWR+EKCT++YHYWQ LNE+R
Sbjct  413  FGSFHRYAQYLNFSHPLIREKFNPKACAWAFGMNIFDLDAWRREKCTDQYHYWQNLNEDR  472

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEIN AAV+H+NGNMKPWLDI
Sbjct  473  TLWKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINKAAVIHYNGNMKPWLDI  532

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFGL
Sbjct  533  AMNQYKSLWTKYVDNDMEFVQVCNFGL  559



>ref|XP_006430887.1| hypothetical protein CICLE_v10011396mg [Citrus clementina]
 gb|ESR44127.1| hypothetical protein CICLE_v10011396mg [Citrus clementina]
Length=559

 Score =   396 bits (1018),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLW ID+DGKVNGAVETC
Sbjct  353  KFRNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWNIDLDGKVNGAVETC  412

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLIR KFNPKACAWA+GMN FDLDAWR+EKCT++YHYWQ LNE+R
Sbjct  413  FGSFHRYAQYLNFSHPLIREKFNPKACAWAFGMNIFDLDAWRREKCTDQYHYWQNLNEDR  472

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEIN AAV+H+NGNMKPWLDI
Sbjct  473  TLWKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINKAAVIHYNGNMKPWLDI  532

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFGL
Sbjct  533  AMNQYKSLWTKYVDNDMEFVQVCNFGL  559



>ref|XP_012088081.1| PREDICTED: probable galacturonosyltransferase 9 [Jatropha curcas]
 gb|KDP24309.1| hypothetical protein JCGZ_25605 [Jatropha curcas]
Length=562

 Score =   396 bits (1018),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+DGKVNGAVETC
Sbjct  356  KFRNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLDGKVNGAVETC  415

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLIR +FNPK+CAWAYGMN FDLD+WR+EKCTE+YHYWQ LNE+R
Sbjct  416  FGSFHRYAQYLNFSHPLIRERFNPKSCAWAYGMNIFDLDSWRREKCTEQYHYWQNLNEDR  475

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+ STTK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDI
Sbjct  476  TLWKLGTLPPGLITFCSTTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDI  535

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFGL
Sbjct  536  AMNQYKNLWTKYVDNDMEFVQMCNFGL  562



>ref|XP_006648647.1| PREDICTED: galacturonosyltransferase 8-like, partial [Oryza brachyantha]
Length=420

 Score =   391 bits (1004),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  213  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  272

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EK TE+YHYWQ  NENR
Sbjct  273  FGSFHRYWQYMNFSHPLIKEKFNPNACGWAYGMNFFDLDSWRREKSTEQYHYWQNQNENR  332

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  333  TLWKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  392

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             + QFR LWTKYVDY++ +I+ CNF 
Sbjct  393  GMNQFRHLWTKYVDYDDSFIRQCNFA  418



>ref|XP_011021133.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
 ref|XP_011021134.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
 ref|XP_011021136.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
 ref|XP_011021137.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
 ref|XP_011021138.1| PREDICTED: probable galacturonosyltransferase 9 [Populus euphratica]
Length=558

 Score =   395 bits (1015),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKY+S+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWK+D+DGKVNGAVETC
Sbjct  352  KFRNPKYMSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKVDLDGKVNGAVETC  411

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLI+ KFNPKACAWA+GMN FDLDAWR+EKCTE YHYWQ+LNE+R
Sbjct  412  FGSFHRYAQYLNFSHPLIKEKFNPKACAWAFGMNIFDLDAWRREKCTEHYHYWQSLNEDR  471

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YS TK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NGNMKPWLDI
Sbjct  472  TLWKLGTLPPGLITFYSRTKSLDKSWHVLGLGYNPSISMDEISNAAVIHYNGNMKPWLDI  531

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFGL
Sbjct  532  AMNQYKNLWTKYVDNDMEFVQMCNFGL  558



>emb|CDP02368.1| unnamed protein product [Coffea canephora]
Length=565

 Score =   395 bits (1016),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 175/207 (85%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLT LW+IDMDGKVNGAVETC
Sbjct  359  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTALWRIDMDGKVNGAVETC  418

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHR+AQYMNFSHPLIR KFNPKACAWA+GMN FDLDAWR+EKCTEEYHYWQ LNE+R
Sbjct  419  FGSFHRFAQYMNFSHPLIREKFNPKACAWAFGMNIFDLDAWRREKCTEEYHYWQNLNEDR  478

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLW LGTLPPGL+T+YSTTK LDKSWHVLGLG+NPSIS DEINNAAV+HFNGNMKPWLDI
Sbjct  479  TLWMLGTLPPGLMTFYSTTKSLDKSWHVLGLGFNPSISMDEINNAAVIHFNGNMKPWLDI  538

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD +  ++Q CNFG+
Sbjct  539  AMNQYKHLWTKYVDSDMIFVQMCNFGM  565



>gb|EEC73220.1| hypothetical protein OsI_07307 [Oryza sativa Indica Group]
Length=533

 Score =   393 bits (1010),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  326  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  385

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EK TE+YHYWQ+ NENR
Sbjct  386  FGSFHRYWQYMNFSHPLIKEKFNPNACGWAYGMNFFDLDSWRREKSTEQYHYWQSQNENR  445

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  446  TLWKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  505

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             + QFR LWTKYVDY++ +I+ CNF 
Sbjct  506  GMNQFRHLWTKYVDYDDSFIRQCNFA  531



>ref|XP_002530802.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
 gb|EEF31570.1| Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Length=563

 Score =   394 bits (1012),  Expect = 6e-130, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 194/206 (94%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+DGKVNGA ETC
Sbjct  357  KFRNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLDGKVNGAAETC  416

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLI+ KFNPKACAWAYGMN FDLDAWR+EK TE+YHYWQ LNE+R
Sbjct  417  FGSFHRYAQYLNFSHPLIKEKFNPKACAWAYGMNVFDLDAWRREKSTEQYHYWQNLNEDR  476

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NGNMKPWLDI
Sbjct  477  TLWKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEISNAAVIHYNGNMKPWLDI  536

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ Q++ LWTKYVD + E++Q CNFG
Sbjct  537  AMNQYKNLWTKYVDSDMEFVQMCNFG  562



>dbj|BAD23465.1| putative glycosyl transferase [Oryza sativa Japonica Group]
 gb|EEE57037.1| hypothetical protein OsJ_06821 [Oryza sativa Japonica Group]
Length=533

 Score =   393 bits (1009),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  326  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  385

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EK TE+YHYWQ+ NENR
Sbjct  386  FGSFHRYWQYMNFSHPLIKEKFNPNACGWAYGMNFFDLDSWRREKSTEQYHYWQSQNENR  445

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  446  TLWKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  505

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             + QFR LWTKYVDY++ +I+ CNF 
Sbjct  506  GMNQFRHLWTKYVDYDDSFIRQCNFA  531



>ref|NP_001046899.1| Os02g0498700 [Oryza sativa Japonica Group]
 dbj|BAF08813.1| Os02g0498700, partial [Oryza sativa Japonica Group]
Length=563

 Score =   394 bits (1012),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 192/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  356  KFRNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  415

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EK TE+YHYWQ+ NENR
Sbjct  416  FGSFHRYWQYMNFSHPLIKEKFNPNACGWAYGMNFFDLDSWRREKSTEQYHYWQSQNENR  475

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPL+KSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  476  TLWKLGTLPPGLITFYSTTKPLEKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  535

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             + QFR LWTKYVDY++ +I+ CNF 
Sbjct  536  GMNQFRHLWTKYVDYDDSFIRQCNFA  561



>ref|XP_008230332.1| PREDICTED: probable galacturonosyltransferase 9 [Prunus mume]
Length=562

 Score =   393 bits (1010),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+DGKVNGAVETC
Sbjct  356  KYRNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLDGKVNGAVETC  415

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLIR +FNP+ACAWAYGMN FDLDAWR+EKCTE+YHYWQ LNE+R
Sbjct  416  FGSFHRYAQYLNFSHPLIRERFNPRACAWAYGMNIFDLDAWRQEKCTEQYHYWQNLNEDR  475

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI NAAV+H+NGNMKPWLDI
Sbjct  476  TLWKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEIRNAAVIHYNGNMKPWLDI  535

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWT Y+D + E++Q CNFGL
Sbjct  536  AMNQYKKLWTYYLDNDMEFVQMCNFGL  562



>gb|KJB10201.1| hypothetical protein B456_001G188500 [Gossypium raimondii]
Length=555

 Score =   392 bits (1008),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 177/189 (94%), Positives = 184/189 (97%), Gaps = 0/189 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVV +DLTGLWKIDMDGKVNGAVETC
Sbjct  358  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVHKDLTGLWKIDMDGKVNGAVETC  417

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQYMNFSHPLI++KFNPKACAWAYGMNFFDLDAWR+EKCTEEYHYWQ LNENR
Sbjct  418  FGSFHRYAQYMNFSHPLIKQKFNPKACAWAYGMNFFDLDAWRREKCTEEYHYWQNLNENR  477

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS DEI NAAVVHFNGNMKPWLDI
Sbjct  478  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMDEIRNAAVVHFNGNMKPWLDI  537

Query  419  AIAQFRPLW  393
            A+ QF+PLW
Sbjct  538  AMNQFKPLW  546



>gb|EMS51766.1| Galacturonosyltransferase 8 [Triticum urartu]
Length=269

 Score =   380 bits (976),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 173/206 (84%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKL +ILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  62   KFRNPKYLSMLNHLRFYLPEMYPKLQKILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  121

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDL++WR+EK TE+YH+WQ  NENR
Sbjct  122  FGSFHRYWQYMNFSHPLIKAKFNPNACGWAYGMNFFDLNSWRREKSTEQYHHWQTQNENR  181

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  182  LLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  241

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             + QFR LWTKYVDY++ +I+ CNF 
Sbjct  242  GMNQFRQLWTKYVDYDDSFIRQCNFA  267



>ref|XP_002987448.1| Quasimodo1-like protein [Selaginella moellendorffii]
 gb|EFJ11535.1| Quasimodo1-like protein [Selaginella moellendorffii]
Length=497

 Score =   387 bits (994),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKL RILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  291  KFRNPKYLSMLNHLRFYLPEMYPKLDRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  350

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY +YMNFSHPLI  +FNPKAC WAYGMNFFDL+AWR+EKCTEEYHYWQ+ NENR
Sbjct  351  FGSFHRYDKYMNFSHPLIASRFNPKACGWAYGMNFFDLNAWRREKCTEEYHYWQSKNENR  410

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LWKLGTLPPGLIT+Y TTKPLDKSWHVLGLGYNPSIS ++I +AAV+HFNGNMKPWLD+
Sbjct  411  SLWKLGTLPPGLITFYKTTKPLDKSWHVLGLGYNPSISLEKIRSAAVIHFNGNMKPWLDL  470

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ Q+R  WT+YVDY+ E +Q CNFG
Sbjct  471  AMNQYREFWTRYVDYDMELVQMCNFG  496



>ref|XP_003572545.1| PREDICTED: galacturonosyltransferase 8-like [Brachypodium distachyon]
Length=523

 Score =   388 bits (996),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 176/206 (85%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKL +ILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  316  KFRNPKYLSMLNHLRFYLPEMYPKLQQILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  375

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDLD+WR+EK TE+YHYWQ  NENR
Sbjct  376  FGSFHRYWQYMNFSHPLIKEKFNPNACGWAYGMNFFDLDSWRREKSTEQYHYWQNHNENR  435

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  436  TLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  495

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             + QFR LWTKYVDY + +I+ CNF 
Sbjct  496  GMNQFRHLWTKYVDYGDSFIRQCNFA  521



>ref|XP_002980055.1| Quasimodo1-like protein [Selaginella moellendorffii]
 gb|EFJ18925.1| Quasimodo1-like protein [Selaginella moellendorffii]
Length=541

 Score =   387 bits (994),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 170/206 (83%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKL RILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  335  KFRNPKYLSMLNHLRFYLPEMYPKLDRILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  394

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY +YMNFSHPLI  +FNPKAC WAYGMNFFDL+AWR+EKCTEEYHYWQ+ NENR
Sbjct  395  FGSFHRYDKYMNFSHPLIASRFNPKACGWAYGMNFFDLNAWRREKCTEEYHYWQSKNENR  454

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LWKLGTLPPGLIT+Y TTKPLDKSWHVLGLGYNPSIS ++I +AAV+HFNGNMKPWLD+
Sbjct  455  SLWKLGTLPPGLITFYKTTKPLDKSWHVLGLGYNPSISLEKIRSAAVIHFNGNMKPWLDL  514

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ Q+R  WT+YVDY+ E +Q CNFG
Sbjct  515  AMNQYREFWTRYVDYDMELVQMCNFG  540



>ref|XP_008379476.1| PREDICTED: LOW QUALITY PROTEIN: probable galacturonosyltransferase 
9 [Malus domestica]
Length=553

 Score =   387 bits (993),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 171/207 (83%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+DGKVNGAVETC
Sbjct  347  KYRNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLDGKVNGAVETC  406

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLIR +FNP+ACAWAYGMN FDLDAWR EK TE+YHYWQ LNE+R
Sbjct  407  FGSFHRYAQYLNFSHPLIRERFNPRACAWAYGMNIFDLDAWRLEKSTEQYHYWQNLNEDR  466

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI  AAV+H+NGNMKPWLDI
Sbjct  467  TLWKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEIRKAAVIHYNGNMKPWLDI  526

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWT Y+D + E++Q CNFGL
Sbjct  527  AMNQYKKLWTNYLDNDMEFVQMCNFGL  553



>dbj|BAK03588.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=562

 Score =   387 bits (994),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 174/206 (84%), Positives = 189/206 (92%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKL +ILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  355  KFRNPKYLSMLNHLRFYLPEMYPKLQKILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QYMNFSHPLI+ KFNP AC WAYGMNFFDL++WR+EK TE+YHYWQ  NENR
Sbjct  415  FGSFHRYWQYMNFSHPLIKAKFNPNACGWAYGMNFFDLNSWRREKSTEQYHYWQTQNENR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+YSTTKPLDKSWHVLGLGYNPSIS +EI NAAVVHFNGNMKPWLDI
Sbjct  475  LLWKLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPSISMEEIRNAAVVHFNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             + QFR LWTKYVDY++ +I+ CNF 
Sbjct  535  GMNQFRQLWTKYVDYDDSFIRQCNFA  560



>ref|XP_009373741.1| PREDICTED: probable galacturonosyltransferase 9 [Pyrus x bretschneideri]
Length=562

 Score =   386 bits (992),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+DGKVNGAVETC
Sbjct  356  KYRNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLDGKVNGAVETC  415

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLIR +FNP+ACAWAYGMN FDLDAWR+EK TE+YHYWQ LNE+R
Sbjct  416  FGSFHRYAQYVNFSHPLIRERFNPRACAWAYGMNIFDLDAWRREKSTEQYHYWQNLNEDR  475

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI  AAV+H+NGNMKPWLD+
Sbjct  476  TLWKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEIRKAAVIHYNGNMKPWLDV  535

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWT Y+D + E++Q CNFGL
Sbjct  536  AMNQYKKLWTYYLDNDMEFVQMCNFGL  562



>ref|XP_008341825.1| PREDICTED: probable galacturonosyltransferase 9 [Malus domestica]
Length=562

 Score =   386 bits (992),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+DGKVNGAVETC
Sbjct  356  KYRNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLDGKVNGAVETC  415

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLIR +FNP+ACAWAYGMN FDLDAWR+EK TE+YHYWQ LNE+R
Sbjct  416  FGSFHRYAQYLNFSHPLIRERFNPRACAWAYGMNIFDLDAWRQEKSTEQYHYWQNLNEDR  475

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI  AAV+H+NGNMKPWLD+
Sbjct  476  TLWKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEIRKAAVIHYNGNMKPWLDV  535

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWT Y+D + E++Q CNFGL
Sbjct  536  AMNQYKKLWTYYLDNDMEFVQMCNFGL  562



>ref|XP_010100891.1| putative galacturonosyltransferase 9 [Morus notabilis]
 gb|EXB85815.1| putative galacturonosyltransferase 9 [Morus notabilis]
Length=612

 Score =   386 bits (991),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 204/231 (88%), Gaps = 4/231 (2%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPE+YPKLH+ILFLDDD+VVQ+DLTGLWKID+DGKVNGAVETC
Sbjct  357  KFRNPKYLSMLNHLRFYLPEIYPKLHKILFLDDDVVVQKDLTGLWKIDLDGKVNGAVETC  416

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLI+ KFNPKACAWAYGMN FDLDAWR+EK TE+YHYWQ LNE+R
Sbjct  417  FGSFHRYAQYLNFSHPLIKEKFNPKACAWAYGMNIFDLDAWRREKSTEQYHYWQNLNEDR  476

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS D IN A+V+H+NGNMKPWLDI
Sbjct  477  TLWKLGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDAINRASVIHYNGNMKPWLDI  536

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL*VMVIVEALLRGFLQVLSMSLISS  267
            A+ Q++ LWTKYVD + E++Q    G   + +VE    G L +LS +++S+
Sbjct  537  AMNQYKNLWTKYVDNDMEFVQIAKLGD-SLFLVE---NGGLMILSFNVLSA  583



>ref|XP_009603685.1| PREDICTED: probable galacturonosyltransferase 9 [Nicotiana tomentosiformis]
Length=547

 Score =   383 bits (984),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLT LW ID+DGKVNGAVETC
Sbjct  341  KFKNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTALWTIDLDGKVNGAVETC  400

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPL+R KF PKACAWA+GMN FDLDAWR+E+CTE+YHYWQ LNE+R
Sbjct  401  FGSFHRYAQYLNFSHPLVREKFTPKACAWAFGMNIFDLDAWRREQCTEQYHYWQNLNEDR  460

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLP GL+T+YS TK LDKSWHVLGLGYNPS+S DEI+ AAV+H+NG+MKPWLDI
Sbjct  461  TLWKLGTLPAGLMTFYSKTKSLDKSWHVLGLGYNPSVSMDEIHKAAVIHYNGDMKPWLDI  520

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKY+D E E++Q CNFG+
Sbjct  521  ALNQYKELWTKYIDSEMEFVQMCNFGV  547



>ref|XP_009792003.1| PREDICTED: probable galacturonosyltransferase 9 [Nicotiana sylvestris]
Length=547

 Score =   383 bits (984),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKLHRILFLDDD+VVQ+DLT LW ID+DGKVNGAVETC
Sbjct  341  KFKNPKYLSMLNHLRFYLPEMYPKLHRILFLDDDVVVQKDLTALWTIDLDGKVNGAVETC  400

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPL+R KF PKACAWA+GMN FDLDAWR+E+CTE+YHYWQ LNE+R
Sbjct  401  FGSFHRYAQYLNFSHPLVREKFTPKACAWAFGMNIFDLDAWRREQCTEQYHYWQNLNEDR  460

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLP GL+T+YS TK LDKSWHVLGLGYNPS+S DEI+ AAV+H+NG+MKPWLDI
Sbjct  461  TLWKLGTLPAGLMTFYSKTKSLDKSWHVLGLGYNPSVSMDEIHKAAVIHYNGDMKPWLDI  520

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKY+D E E++Q CNFG+
Sbjct  521  ALNQYKELWTKYIDSEMEFVQMCNFGV  547



>ref|XP_007032944.1| Glycosyltransferase isoform 2 [Theobroma cacao]
 gb|EOY03870.1| Glycosyltransferase isoform 2 [Theobroma cacao]
Length=488

 Score =   380 bits (976),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNP Y+ +LNHLRFYLPEMYPKLH+IL LDDD+VVQ+DLTGLWKID+ GKVNGAVETC
Sbjct  282  KFRNPNYMPMLNHLRFYLPEMYPKLHKILLLDDDVVVQKDLTGLWKIDLAGKVNGAVETC  341

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHR++QY+NFSHPLI+ +FNPKACAWAYGMN FDLDAWR+EKCTE YH WQ LNE+R
Sbjct  342  FGSFHRFSQYLNFSHPLIKERFNPKACAWAYGMNIFDLDAWRREKCTETYHNWQNLNEDR  401

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YS TK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDI
Sbjct  402  TLWKLGTLPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDI  461

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFG+
Sbjct  462  AMNQYKNLWTKYVDNDMEFVQMCNFGV  488



>ref|XP_004232120.1| PREDICTED: probable galacturonosyltransferase 9 [Solanum lycopersicum]
Length=547

 Score =   381 bits (979),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYP LHRILFLDDD+VVQ+DLT LW ID+DGKVNGAVETC
Sbjct  341  KFKNPKYLSMLNHLRFYLPEMYPTLHRILFLDDDVVVQKDLTALWTIDLDGKVNGAVETC  400

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY+QY+NFSHPL+R KFNPKACAWA+GMN FDLDAWR+EKCTE+YHYWQ LNE+R
Sbjct  401  FGSFHRYSQYLNFSHPLVREKFNPKACAWAFGMNIFDLDAWRREKCTEQYHYWQNLNEDR  460

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLP GL+T++S TK LDKSWHVLGLG+NPS+S DEI+ AAV+H+NG+MKPWLDI
Sbjct  461  TLWKLGTLPAGLMTFFSKTKSLDKSWHVLGLGFNPSVSMDEIHKAAVIHYNGDMKPWLDI  520

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKY+D E E++Q CNFG+
Sbjct  521  ALNQYKELWTKYIDSEMEFVQMCNFGV  547



>ref|XP_006338312.1| PREDICTED: probable galacturonosyltransferase 9-like [Solanum 
tuberosum]
Length=547

 Score =   381 bits (979),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYP LHRILFLDDD+VVQ+DLT LW ID+DGKVNGAVETC
Sbjct  341  KFKNPKYLSMLNHLRFYLPEMYPTLHRILFLDDDVVVQKDLTALWTIDLDGKVNGAVETC  400

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY+QY+NFSHPL+R KFNPKACAWA+GMN FDLDAWR+EKCTE+YHYWQ LNE+R
Sbjct  401  FGSFHRYSQYLNFSHPLVREKFNPKACAWAFGMNIFDLDAWRREKCTEQYHYWQNLNEDR  460

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLP GL+T++S TK LDKSWHVLGLG+NPS+S DEI+ AAV+H+NG+MKPWLDI
Sbjct  461  TLWKLGTLPAGLMTFFSKTKSLDKSWHVLGLGFNPSVSMDEIHKAAVIHYNGDMKPWLDI  520

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKY+D E E++Q CNFG+
Sbjct  521  ALNQYKELWTKYIDSEMEFVQMCNFGV  547



>ref|XP_007032943.1| Glycosyltransferase isoform 1 [Theobroma cacao]
 gb|EOY03869.1| Glycosyltransferase isoform 1 [Theobroma cacao]
Length=554

 Score =   381 bits (979),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNP Y+ +LNHLRFYLPEMYPKLH+IL LDDD+VVQ+DLTGLWKID+ GKVNGAVETC
Sbjct  348  KFRNPNYMPMLNHLRFYLPEMYPKLHKILLLDDDVVVQKDLTGLWKIDLAGKVNGAVETC  407

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHR++QY+NFSHPLI+ +FNPKACAWAYGMN FDLDAWR+EKCTE YH WQ LNE+R
Sbjct  408  FGSFHRFSQYLNFSHPLIKERFNPKACAWAYGMNIFDLDAWRREKCTETYHNWQNLNEDR  467

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YS TK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDI
Sbjct  468  TLWKLGTLPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDI  527

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFG+
Sbjct  528  AMNQYKNLWTKYVDNDMEFVQMCNFGV  554



>gb|AFV46220.1| hypothetical protein, partial [Scutellaria baicalensis]
Length=258

 Score =   364 bits (935),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFY+PEMYPKLH+ILFLDDD+VVQ+DLT LWKID+DGKVNGA+ TC
Sbjct  52   KFRNPKYLSMLNHLRFYMPEMYPKLHKILFLDDDVVVQKDLTALWKIDLDGKVNGAINTC  111

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHR ++Y+NFSHPLI+ KFNP+ACAWA GMN FDLDAWR EKCTE+YHYWQ LNE+R
Sbjct  112  FGSFHRLSEYLNFSHPLIKEKFNPRACAWALGMNIFDLDAWRLEKCTEQYHYWQNLNEDR  171

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWK+GTLP GL+T+YSTTKPLDK+WHVLGLG NPSIS +EI  AAV+HF+G+MKPWLDI
Sbjct  172  TLWKMGTLPAGLVTFYSTTKPLDKAWHVLGLGSNPSISMEEIEKAAVIHFSGDMKPWLDI  231

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+  ++ LWTKYVD E E++Q CNFG+
Sbjct  232  AMNHYKHLWTKYVDNEMEFVQMCNFGM  258



>ref|XP_010029444.1| PREDICTED: probable galacturonosyltransferase 9 [Eucalyptus grandis]
 gb|KCW56357.1| hypothetical protein EUGRSUZ_I02091 [Eucalyptus grandis]
Length=554

 Score =   374 bits (961),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K RNP  LS+LNHLRFYLPEMYPKLH+IL+LDDD+VVQ+DLTGLW IDM GKVNGAVETC
Sbjct  348  KSRNPGELSMLNHLRFYLPEMYPKLHKILYLDDDVVVQKDLTGLWNIDMAGKVNGAVETC  407

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY+QY+NFSHPLI+ +FNPKACAWAYGMN FDLDAWR+EKCTEEYHYWQ LN ++
Sbjct  408  FGSFHRYSQYLNFSHPLIKERFNPKACAWAYGMNLFDLDAWRREKCTEEYHYWQNLNGDQ  467

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWK GTLPPGLIT+YS+TK LDKSWHVLGLGYNPSIS DEIN+AAV+H++GNMKPWLD+
Sbjct  468  TLWKSGTLPPGLITFYSSTKSLDKSWHVLGLGYNPSISMDEINHAAVIHYSGNMKPWLDV  527

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFGL
Sbjct  528  ALNQYKNLWTKYVDNDMEFVQMCNFGL  554



>ref|XP_010660537.1| PREDICTED: probable galacturonosyltransferase 9 [Vitis vinifera]
 emb|CBI16902.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   374 bits (960),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 188/207 (91%), Gaps = 1/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K RNP Y S+LNHLRFYLPEMYPKLHRILFLDDD+VVQ+DL+ LW+ID+DGKVNGAVETC
Sbjct  338  KLRNPNY-SLLNHLRFYLPEMYPKLHRILFLDDDVVVQKDLSALWRIDLDGKVNGAVETC  396

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYA Y+NFS+ +IR KFNPKACAWAYGMN FDLDAWR+EKCT++YHYWQ LNE+ 
Sbjct  397  FGSFHRYAHYLNFSNSVIREKFNPKACAWAYGMNIFDLDAWRREKCTDQYHYWQNLNEDG  456

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWK G LPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEIN+AAV+HFNGNMKPWLDI
Sbjct  457  TLWKSGMLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINHAAVIHFNGNMKPWLDI  516

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            AI QF+ LWTKYVD + E++Q CNFGL
Sbjct  517  AINQFKNLWTKYVDNDMEFVQVCNFGL  543



>ref|XP_010549958.1| PREDICTED: probable galacturonosyltransferase 9 isoform X2 [Tarenaya 
hassleriana]
 gb|ABD96860.1| hypothetical protein [Cleome spinosa]
Length=556

 Score =   373 bits (957),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+N K+LS+LNHLRFYLPEMYPKL ++LFLDDD+VVQ+DLTGLWKI++DGKVNGAVETC
Sbjct  350  KFKNAKHLSMLNHLRFYLPEMYPKLRKMLFLDDDVVVQKDLTGLWKINLDGKVNGAVETC  409

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLI+  FNP +CAWA+GMN FDLDAWR+EKCTE+YHYWQ LNE++
Sbjct  410  FGSFHRYAQYLNFSHPLIKESFNPNSCAWAFGMNIFDLDAWRREKCTEQYHYWQNLNEDQ  469

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LW++GTLPPGLIT+YS TK LDK+WHV+GLGYNPS+  DEI NAAV+H+NGNMKPWLDI
Sbjct  470  SLWRVGTLPPGLITFYSKTKSLDKAWHVMGLGYNPSVGMDEIRNAAVIHYNGNMKPWLDI  529

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  530  AMNQYKSLWTKYVDGEMEFVQMCNFGL  556



>ref|XP_010558537.1| PREDICTED: probable galacturonosyltransferase 9 [Tarenaya hassleriana]
Length=564

 Score =   372 bits (954),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  956  FRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCF  777
            F+NP Y+S+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKI++DGKVNGAVETCF
Sbjct  359  FKNPNYISMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKINLDGKVNGAVETCF  418

Query  776  GSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRT  597
            GSFHRY+QY+NFSHPLI+  FNP ACAWA+GMN FDLDAWR+EKCTE+ H+WQ LNE + 
Sbjct  419  GSFHRYSQYLNFSHPLIKESFNPNACAWAFGMNIFDLDAWRREKCTEQLHHWQNLNEEQN  478

Query  596  LWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIA  417
            LW+LGTLPPGLIT+YS TK LDK+WHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDIA
Sbjct  479  LWRLGTLPPGLITFYSKTKSLDKTWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDIA  538

Query  416  IAQFRPLWTKYVDYENEYIQACNFGL  339
            + Q++ LWTKYVD E E++Q CNFGL
Sbjct  539  MNQYKSLWTKYVDNEMEFVQMCNFGL  564



>emb|CAN73730.1| hypothetical protein VITISV_022574 [Vitis vinifera]
Length=543

 Score =   371 bits (952),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 187/207 (90%), Gaps = 1/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K RNP Y S+LNHLRFYLPEMYPKLHRILFLDDD+VVQ+DL+ LW+ID+DGKVNGAVETC
Sbjct  338  KLRNPNY-SLLNHLRFYLPEMYPKLHRILFLDDDVVVQKDLSALWRIDLDGKVNGAVETC  396

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYA Y+NFS+ +IR K NPKACAWAYGMN FDLDAWR+EKCT++YHYWQ LNE+ 
Sbjct  397  FGSFHRYAHYLNFSNSVIREKXNPKACAWAYGMNIFDLDAWRREKCTDQYHYWQNLNEDG  456

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWK G LPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEIN+AAV+HFNGNMKPWLDI
Sbjct  457  TLWKSGMLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINHAAVIHFNGNMKPWLDI  516

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            AI QF+ LWTKYVD + E++Q CNFGL
Sbjct  517  AINQFKNLWTKYVDNDMEFVQVCNFGL  543



>gb|AFK41629.1| unknown [Lotus japonicus]
Length=274

 Score =   360 bits (924),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF++ KYLS+L+HLRFYLP+MYP LH IL LDDD+VVQ+DLTGLWKID+ GKVNGAVE C
Sbjct  68   KFKSAKYLSMLDHLRFYLPQMYPNLHHILLLDDDVVVQKDLTGLWKIDLGGKVNGAVEIC  127

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLI+  FNPK CAWAYGMN FDL+AWR+EKCTE YHYWQ  NE++
Sbjct  128  FGSFHRYAQYLNFSHPLIKDSFNPKTCAWAYGMNIFDLEAWRREKCTENYHYWQNKNEDQ  187

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWK GTL PGLIT+YSTTK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDI
Sbjct  188  TLWKSGTLSPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDI  247

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFGL
Sbjct  248  ALNQYKNLWTKYVDNDMEFVQMCNFGL  274



>ref|XP_003635905.1| Glycosyltransferase [Medicago truncatula]
 gb|KEH25211.1| glycosyltransferase Quasimodo protein, putative [Medicago truncatula]
Length=555

 Score =   370 bits (949),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K RN KYLS+L++L+FYLPEMYPKL  IL LDDD+VVQ+DLTGLWKID+DGKVNGAVE C
Sbjct  349  KLRNAKYLSMLDYLQFYLPEMYPKLRNILLLDDDVVVQKDLTGLWKIDLDGKVNGAVEIC  408

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY+QY+NFSHPLI+  FNPKACAW YGMN FDLDAWR+EKCTE YHYWQ  NE++
Sbjct  409  FGSFHRYSQYVNFSHPLIKETFNPKACAWTYGMNIFDLDAWRREKCTEHYHYWQNKNEDQ  468

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            T+WK GTLPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDI
Sbjct  469  TIWKSGTLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDI  528

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFGL
Sbjct  529  ALNQYKNLWTKYVDSDMEFVQMCNFGL  555



>gb|KHG03994.1| putative galacturonosyltransferase 9 -like protein [Gossypium 
arboreum]
Length=557

 Score =   370 bits (949),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K +NP+ +S+LNHLRFYLPEMYPKLH+IL LDDD+VVQ+DLTGLWKID+ GKVNGAVETC
Sbjct  351  KLKNPESMSMLNHLRFYLPEMYPKLHKILLLDDDVVVQKDLTGLWKIDLAGKVNGAVETC  410

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHR++QY+NF+HPLI+ +FNPKACAWAYGMN FDLDAWR+EKCTE Y  WQ LNE+R
Sbjct  411  FGSFHRFSQYLNFTHPLIKERFNPKACAWAYGMNIFDLDAWRREKCTETYEEWQNLNEDR  470

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKL  LPPGLIT+YS TK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDI
Sbjct  471  TLWKLDALPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDI  530

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFG+
Sbjct  531  AMNQYKNLWTKYVDNDMEFVQMCNFGV  557



>ref|XP_010694564.1| PREDICTED: probable galacturonosyltransferase 9 [Beta vulgaris 
subsp. vulgaris]
Length=560

 Score =   369 bits (947),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF NPKYLS+L+HLRFYLPEMYP LHRI+ LDDD+VVQ+DLT LW ID+DGKVNGAVETC
Sbjct  354  KFTNPKYLSMLSHLRFYLPEMYPDLHRIMLLDDDVVVQKDLTDLWNIDLDGKVNGAVETC  413

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY+ Y+NFSHPLIR  FNPKACAWAYGMN FDLDAWR+EKCTE+YHYWQ LNE  
Sbjct  414  FGSFHRYSHYLNFSHPLIRENFNPKACAWAYGMNIFDLDAWRREKCTEQYHYWQNLNEES  473

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLW+LGTLP GL T+YS TK LDKSWH+LGLGYNPS+S DEI NAAVVHF+G+MKPWLDI
Sbjct  474  TLWQLGTLPAGLATFYSKTKSLDKSWHILGLGYNPSVSMDEITNAAVVHFSGSMKPWLDI  533

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFGL
Sbjct  534  AMNQYKELWTKYVDNDMEFVQMCNFGL  560



>ref|XP_002310951.2| hypothetical protein POPTR_0008s01050g [Populus trichocarpa]
 gb|EEE88318.2| hypothetical protein POPTR_0008s01050g [Populus trichocarpa]
Length=554

 Score =   369 bits (946),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 187/206 (91%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  348  KFRNPKYLSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  407

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY +Y+ F HPLI+  F+PKACAWAYGMN FDLD+WR++ CTE+YHYWQ LN NR
Sbjct  408  FGSFHRYDKYLKFDHPLIKETFDPKACAWAYGMNIFDLDSWRRDNCTEKYHYWQELNGNR  467

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLW+LGTLPPGLIT+YSTTKPLDKSWHVLGLGYNP +S ++I NAAV+H+NG+ KPWL  
Sbjct  468  TLWRLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPGLSEEKIQNAAVIHYNGDSKPWLAT  527

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            AI +++PLWTKYVDY+ E+ +ACNF 
Sbjct  528  AIPRYQPLWTKYVDYDLEFFRACNFA  553



>ref|XP_010549955.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549956.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010549957.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Tarenaya 
hassleriana]
Length=557

 Score =   368 bits (945),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 190/208 (91%), Gaps = 1/208 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+N K+LS+LNHLRFYLPEMYPKL ++LFLDDD+VVQ+DLTGLWKI++DGKVNGAVETC
Sbjct  350  KFKNAKHLSMLNHLRFYLPEMYPKLRKMLFLDDDVVVQKDLTGLWKINLDGKVNGAVETC  409

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQAL-NEN  603
            FGSFHRYAQY+NFSHPLI+  FNP +CAWA+GMN FDLDAWR+EKCTE+YHYWQ L NE+
Sbjct  410  FGSFHRYAQYLNFSHPLIKESFNPNSCAWAFGMNIFDLDAWRREKCTEQYHYWQNLQNED  469

Query  602  RTLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLD  423
            ++LW++GTLPPGLIT+YS TK LDK+WHV+GLGYNPS+  DEI NAAV+H+NGNMKPWLD
Sbjct  470  QSLWRVGTLPPGLITFYSKTKSLDKAWHVMGLGYNPSVGMDEIRNAAVIHYNGNMKPWLD  529

Query  422  IAIAQFRPLWTKYVDYENEYIQACNFGL  339
            IA+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  530  IAMNQYKSLWTKYVDGEMEFVQMCNFGL  557



>ref|XP_011085570.1| PREDICTED: probable galacturonosyltransferase 9 [Sesamum indicum]
Length=557

 Score =   368 bits (944),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS LNHLRFYLPE+YP+LH+ILFLDDD+VVQ+DLT LWKIDMDGKVNGAV TC
Sbjct  351  KFRNPKYLSKLNHLRFYLPELYPRLHKILFLDDDVVVQKDLTALWKIDMDGKVNGAVNTC  410

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FG FHR ++Y+NFSHPLI+ KFNP++CAWA+GMN FDLDAWR+EKCTE+YHYWQ LNE+R
Sbjct  411  FGPFHRLSEYLNFSHPLIKEKFNPRSCAWAFGMNMFDLDAWRREKCTEQYHYWQNLNEDR  470

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLP GLIT+YSTTK LDK+WHVLGLG NPSIS +EI+ AAV+HF+G+MKPWLDI
Sbjct  471  TLWKLGTLPAGLITFYSTTKSLDKAWHVLGLGINPSISMEEIDKAAVIHFSGDMKPWLDI  530

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+  ++ LWTKY+D E E++Q CNFG+
Sbjct  531  AMNHYKHLWTKYIDNEMEFLQMCNFGM  557



>gb|KJB48245.1| hypothetical protein B456_008G059800 [Gossypium raimondii]
Length=494

 Score =   365 bits (938),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFR  +++S+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+ GKVNGAVETC
Sbjct  288  KFRYLEHMSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLSGKVNGAVETC  347

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHR++QY+NFSHPLIR +FNPKACAWAYGMN FDLDAWR++KCTE YH WQ LN +R
Sbjct  348  FGSFHRFSQYLNFSHPLIRERFNPKACAWAYGMNIFDLDAWRRKKCTETYHNWQNLNVDR  407

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWK GTLPPGLIT+YS TK LDKSWHVLGLGYNPSIS D INNAAV+H+NGNMKPWLDI
Sbjct  408  ALWKSGTLPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDVINNAAVIHYNGNMKPWLDI  467

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFG+
Sbjct  468  AMNQYKNLWTKYVDNDMEFLQTCNFGV  494



>gb|KJB10520.1| hypothetical protein B456_001G205700 [Gossypium raimondii]
Length=491

 Score =   365 bits (936),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K +NP+ +S+LNHLRFYLPEMYPKLH+IL LDDD+VVQ+DLTGLWKID+ GKVNGAVETC
Sbjct  285  KLKNPESMSMLNHLRFYLPEMYPKLHKILLLDDDVVVQKDLTGLWKIDLAGKVNGAVETC  344

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSF R++QY+NF+HPLI+ +FNPKACAWAYGMN FDLD WR+EKCTE Y  WQ LNE+R
Sbjct  345  FGSFRRFSQYLNFTHPLIKERFNPKACAWAYGMNIFDLDGWRREKCTETYEEWQNLNEDR  404

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKL  LPPGLIT+YS TK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDI
Sbjct  405  TLWKLDALPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDI  464

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFG+
Sbjct  465  AMNQYKNLWTKYVDNDMEFVQMCNFGV  491



>ref|XP_011033002.1| PREDICTED: galacturonosyltransferase 8-like [Populus euphratica]
Length=554

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPEMYPKL +ILFLDDD+VVQ+DLTGLW+IDMDGKVNGAVETC
Sbjct  348  KFRNPKYLSMLNHLRFYLPEMYPKLLKILFLDDDVVVQKDLTGLWEIDMDGKVNGAVETC  407

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY +Y+ F HPLI+  F+PKACAWAYGMN FDLDAWR++ CTE+YHYWQ LN NR
Sbjct  408  FGSFHRYDKYLKFDHPLIKETFDPKACAWAYGMNIFDLDAWRRDNCTEKYHYWQELNGNR  467

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLW+LGTLPPGLIT+YSTTKPLDKSWHVLGLGYNP +S ++I NAAV+H+NG+ KPWL  
Sbjct  468  TLWRLGTLPPGLITFYSTTKPLDKSWHVLGLGYNPGLSEEKIQNAAVIHYNGDSKPWLAT  527

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            AI +++PLWTKYVDY+ E+ +ACNF 
Sbjct  528  AIPRYQPLWTKYVDYDLEFFRACNFA  553



>gb|KJB48243.1| hypothetical protein B456_008G059800 [Gossypium raimondii]
 gb|KJB48244.1| hypothetical protein B456_008G059800 [Gossypium raimondii]
Length=560

 Score =   366 bits (940),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFR  +++S+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+ GKVNGAVETC
Sbjct  354  KFRYLEHMSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLSGKVNGAVETC  413

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHR++QY+NFSHPLIR +FNPKACAWAYGMN FDLDAWR++KCTE YH WQ LN +R
Sbjct  414  FGSFHRFSQYLNFSHPLIRERFNPKACAWAYGMNIFDLDAWRRKKCTETYHNWQNLNVDR  473

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWK GTLPPGLIT+YS TK LDKSWHVLGLGYNPSIS D INNAAV+H+NGNMKPWLDI
Sbjct  474  ALWKSGTLPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDVINNAAVIHYNGNMKPWLDI  533

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFG+
Sbjct  534  AMNQYKNLWTKYVDNDMEFLQTCNFGV  560



>gb|KJB10519.1| hypothetical protein B456_001G205700 [Gossypium raimondii]
Length=557

 Score =   365 bits (936),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K +NP+ +S+LNHLRFYLPEMYPKLH+IL LDDD+VVQ+DLTGLWKID+ GKVNGAVETC
Sbjct  351  KLKNPESMSMLNHLRFYLPEMYPKLHKILLLDDDVVVQKDLTGLWKIDLAGKVNGAVETC  410

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSF R++QY+NF+HPLI+ +FNPKACAWAYGMN FDLD WR+EKCTE Y  WQ LNE+R
Sbjct  411  FGSFRRFSQYLNFTHPLIKERFNPKACAWAYGMNIFDLDGWRREKCTETYEEWQNLNEDR  470

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKL  LPPGLIT+YS TK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDI
Sbjct  471  TLWKLDALPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDI  530

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFG+
Sbjct  531  AMNQYKNLWTKYVDNDMEFVQMCNFGV  557



>ref|XP_006593710.1| PREDICTED: probable galacturonosyltransferase 9-like [Glycine 
max]
Length=552

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -2

Query  956  FRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCF  777
             +N K LS+L+HLRFYLPEMYPKL++IL LDDD+VVQ+DLTGLWKID+DGKVNGAVE CF
Sbjct  347  MKNAKSLSMLDHLRFYLPEMYPKLYKILLLDDDVVVQKDLTGLWKIDLDGKVNGAVEICF  406

Query  776  GSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRT  597
            GSFHRYAQY+NFSHPLI+  FNPKACAWAYGMN F+LDAWR EKCT+ YHYWQ LNE++T
Sbjct  407  GSFHRYAQYLNFSHPLIKESFNPKACAWAYGMNIFNLDAWRHEKCTDNYHYWQNLNEDQT  466

Query  596  LWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIA  417
            LW  GTL PGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NGNMKPWLDIA
Sbjct  467  LWTAGTLSPGLITFYSTTKTLDKSWHVLGLGYNPSISMDEISNAAVIHYNGNMKPWLDIA  526

Query  416  IAQFRPLWTKYVDYENEYIQACNFGL  339
            + Q++ LWTKYVD   E++Q CNFGL
Sbjct  527  LNQYKNLWTKYVDNNMEFVQMCNFGL  552



>ref|XP_007151434.1| hypothetical protein PHAVU_004G045900g [Phaseolus vulgaris]
 gb|ESW23428.1| hypothetical protein PHAVU_004G045900g [Phaseolus vulgaris]
Length=546

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 160/206 (78%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  956  FRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCF  777
             +N K LS+++HLRFYLP+MYPKL++IL LD+D+VVQ+DLTGLWKID+DGKVNGAVE CF
Sbjct  341  MKNAKSLSMMDHLRFYLPDMYPKLYKILLLDEDVVVQKDLTGLWKIDLDGKVNGAVEICF  400

Query  776  GSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRT  597
            GSFHRYA YMNFSHPLI+ KFNPKACAWAYGMN F+LDAWR+EKCT+ Y YWQ LNE++T
Sbjct  401  GSFHRYAHYMNFSHPLIKEKFNPKACAWAYGMNIFNLDAWRREKCTDNYQYWQNLNEDQT  460

Query  596  LWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIA  417
            LWK G LPPGLIT+YSTTK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDIA
Sbjct  461  LWKAGPLPPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDIA  520

Query  416  IAQFRPLWTKYVDYENEYIQACNFGL  339
            + Q++ LWTKYVD + E++Q CNFGL
Sbjct  521  LNQYKNLWTKYVDNDMEFVQMCNFGL  546



>gb|KHN02656.1| Putative galacturonosyltransferase 9 [Glycine soja]
Length=552

 Score =   364 bits (935),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 161/206 (78%), Positives = 184/206 (89%), Gaps = 0/206 (0%)
 Frame = -2

Query  956  FRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCF  777
             +N K LS+L+HLRFYLPEMYPKL++IL LDDD+VVQ+DLTGLWKID+DGKVNGAVE CF
Sbjct  347  MKNAKSLSMLDHLRFYLPEMYPKLYKILLLDDDVVVQKDLTGLWKIDLDGKVNGAVEICF  406

Query  776  GSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRT  597
            GSFHRYAQY+NFSHPLI+  FNPKACAWAYGMN F+LDAWR EKCT+ YHYWQ LNE++T
Sbjct  407  GSFHRYAQYLNFSHPLIKESFNPKACAWAYGMNIFNLDAWRHEKCTDNYHYWQNLNEDQT  466

Query  596  LWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIA  417
            LW  GTL PGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NGNMKPWLDIA
Sbjct  467  LWTAGTLSPGLITFYSTTKTLDKSWHVLGLGYNPSISMDEISNAAVIHYNGNMKPWLDIA  526

Query  416  IAQFRPLWTKYVDYENEYIQACNFGL  339
            + Q++ LWTKYVD   E++Q CNFGL
Sbjct  527  LNQYKNLWTKYVDNNMEFVQMCNFGL  552



>ref|XP_004507267.1| PREDICTED: probable galacturonosyltransferase 9-like [Cicer arietinum]
Length=555

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 160/207 (77%), Positives = 184/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K RN KYLS+L++L+FYLPEMYPKL  IL LDDD+VVQ+DLTGLWKID+D KVNGAVE C
Sbjct  349  KLRNAKYLSMLDYLQFYLPEMYPKLRNILLLDDDVVVQKDLTGLWKIDLDDKVNGAVEIC  408

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY+QY+NFSHPLI+  FNPKAC+W YGMN FDLDAWR++KCTE YHYWQ  NE++
Sbjct  409  FGSFHRYSQYLNFSHPLIKESFNPKACSWTYGMNIFDLDAWRRQKCTERYHYWQNKNEDQ  468

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWK GTL PGLIT+YSTTK LDKSWHVLGLGYNPSIS DEINNAAV+H+NGNMKPWLDI
Sbjct  469  TLWKSGTLAPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINNAAVIHYNGNMKPWLDI  528

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFGL
Sbjct  529  ALNQYKNLWTKYVDSDMEFVQMCNFGL  555



>ref|XP_006603944.1| PREDICTED: probable galacturonosyltransferase 9-like [Glycine 
max]
 gb|KHN30760.1| Putative galacturonosyltransferase 9 [Glycine soja]
Length=552

 Score =   364 bits (934),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 159/206 (77%), Positives = 186/206 (90%), Gaps = 0/206 (0%)
 Frame = -2

Query  956  FRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCF  777
             +N K LS+L+HLRFYLPEMYP L++IL LDDD+VVQ+DLTGLWKID+DGKVNGAVE CF
Sbjct  347  LKNTKSLSMLDHLRFYLPEMYPNLYKILLLDDDVVVQKDLTGLWKIDLDGKVNGAVEICF  406

Query  776  GSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRT  597
            GSFHRYAQY+NFSHPLI+  FNPK+CAWAYGMN F+LDAWR+EKCT+ YHYWQ LNE++T
Sbjct  407  GSFHRYAQYLNFSHPLIKESFNPKSCAWAYGMNIFNLDAWRREKCTDNYHYWQNLNEDQT  466

Query  596  LWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIA  417
            LWK GTL PGLIT+YSTTK LDKSWHVLGLGYNPSIS DEI+NAAV+H+NG+MKPWLDIA
Sbjct  467  LWKAGTLSPGLITFYSTTKSLDKSWHVLGLGYNPSISMDEISNAAVIHYNGDMKPWLDIA  526

Query  416  IAQFRPLWTKYVDYENEYIQACNFGL  339
            + Q++ LWTKYVD + E++Q CNFGL
Sbjct  527  LNQYKNLWTKYVDNDMEFVQMCNFGL  552



>gb|KHG26626.1| putative galacturonosyltransferase 9 -like protein [Gossypium 
arboreum]
Length=559

 Score =   363 bits (932),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFR  +++S+LNHLRFYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKID+ GKVNGAVETC
Sbjct  353  KFRYLEHMSMLNHLRFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKIDLSGKVNGAVETC  412

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHR++QY+NFSHPLIR +FN KACAWAYGMN FDLDAWR+EKCTE YH WQ LN +R
Sbjct  413  FGSFHRFSQYLNFSHPLIRERFNHKACAWAYGMNIFDLDAWRREKCTETYHNWQNLNVDR  472

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWK GTLPPGLIT+YS TK LDKSWHVLGLGYNPSIS D INNAA++H+NGNMKPWLDI
Sbjct  473  ALWKSGTLPPGLITFYSLTKSLDKSWHVLGLGYNPSISMDVINNAALIHYNGNMKPWLDI  532

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD + E++Q CNFG+
Sbjct  533  AMNQYKNLWTKYVDNDMEFLQTCNFGV  559



>gb|EYU39355.1| hypothetical protein MIMGU_mgv1a003891mg [Erythranthe guttata]
Length=557

 Score =   363 bits (931),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPE+YP L +ILFLDDD+VVQ+DLT LWKIDMDGKVNGAV TC
Sbjct  351  KFRNPKYLSMLNHLRFYLPELYPNLQKILFLDDDVVVQKDLTALWKIDMDGKVNGAVNTC  410

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHR+++Y+NFSHPLI+ KFNP+ACAWA+GMN FDLDAWR EK T++YHYWQ LNE+R
Sbjct  411  FGSFHRFSEYLNFSHPLIKEKFNPRACAWAFGMNMFDLDAWRLEKSTDQYHYWQNLNEDR  470

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWK+GTLP GL+T+YSTTK LDK+WHV GLG NPSIS +EI+ AAV+HF+G+MKPWLDI
Sbjct  471  TLWKMGTLPAGLVTFYSTTKSLDKAWHVQGLGINPSISMEEIDKAAVIHFSGDMKPWLDI  530

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ +++ LWTKYVD E E++Q CNFG+
Sbjct  531  AMNRYKHLWTKYVDNEMEFVQMCNFGM  557



>dbj|BAD94466.1| hypothetical protein [Arabidopsis thaliana]
Length=230

 Score =   349 bits (895),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  24   KFKNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  83

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NFSHPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R
Sbjct  84   FGSFHRYGQYLNFSHPLIKENFNPSACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDR  143

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NA V+H+NGNMKPWLDI
Sbjct  144  TLWKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAGVIHYNGNMKPWLDI  203

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  204  AMNQYKSLWTKYVDNEMEFVQMCNFGL  230



>ref|XP_011099072.1| PREDICTED: probable galacturonosyltransferase 9 [Sesamum indicum]
Length=557

 Score =   359 bits (922),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 156/207 (75%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS++NHLRFYLPE+YPKL++ILFLDDD+VVQ+DLT LWKIDMDG VN AVETC
Sbjct  351  KFRNPKYLSMINHLRFYLPELYPKLNKILFLDDDVVVQKDLTALWKIDMDGNVNAAVETC  410

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSF R+++Y+NFSHPLI++KFNP+ACAWA+GMN FDL+AWR+EKCTE+YHYWQ LNE+R
Sbjct  411  FGSFRRFSEYLNFSHPLIKQKFNPRACAWAFGMNMFDLEAWRREKCTEKYHYWQNLNEDR  470

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLP GL T+YSTTK L+K+WHVLGLG NPSIS +EI+ AAV+HF+G+MKPWLDI
Sbjct  471  TLWKLGTLPAGLATFYSTTKSLEKAWHVLGLGINPSISMEEIDKAAVIHFSGDMKPWLDI  530

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+  ++ LWTKYVD E E++Q CNFG+
Sbjct  531  ALNGYKHLWTKYVDNEMEFLQMCNFGM  557



>gb|EPS65125.1| glycosyltransferase [Genlisea aurea]
Length=557

 Score =   358 bits (920),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLS+LNHLRFYLPE+YPKLH+ILFLDDD+VVQ+DLT LWKIDMDGKVN AV TC
Sbjct  351  KFRNPKYLSLLNHLRFYLPELYPKLHKILFLDDDVVVQKDLTDLWKIDMDGKVNAAVNTC  410

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHR A+Y+NFSHPLI+ KFN ++CAWA+GMN FDLDAWR+EKCTEEYHYWQ  N+ R
Sbjct  411  FGSFHRLAEYLNFSHPLIKEKFNSRSCAWAFGMNMFDLDAWRREKCTEEYHYWQNKNQGR  470

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LWKLGTLP GL+T+YS TK LDK+WH LGLG NPSIS +EI  AAV+HFNG+MKPWLDI
Sbjct  471  SLWKLGTLPAGLVTFYSKTKALDKAWHALGLGINPSISMEEIKKAAVIHFNGDMKPWLDI  530

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
             +  ++  WTKYVD E E++Q CNFG+
Sbjct  531  GMNHYKQFWTKYVDNEMEFVQMCNFGM  557



>gb|KFK37701.1| hypothetical protein AALP_AA3G017600 [Arabis alpina]
Length=560

 Score =   358 bits (918),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  354  KFKNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  413

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NFSHPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R
Sbjct  414  FGSFHRYGQYLNFSHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDR  473

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDI
Sbjct  474  TLWKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDI  533

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKY+D E E++Q CNFGL
Sbjct  534  AMNQYKSLWTKYIDNEMEFVQMCNFGL  560



>ref|XP_010463640.1| PREDICTED: probable galacturonosyltransferase 9 [Camelina sativa]
Length=561

 Score =   358 bits (918),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  355  KFKNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R
Sbjct  415  FGSFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDI
Sbjct  475  TLWKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  535  AMNQYKSLWTKYVDNEMEFVQMCNFGL  561



>gb|AHL38785.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=561

 Score =   357 bits (917),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  355  KFKNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NFSHPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R
Sbjct  415  FGSFHRYGQYLNFSHPLIKENFNPSACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NA V+H+NGNMKPWLDI
Sbjct  475  TLWKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAGVIHYNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  535  AMNQYKSLWTKYVDNEMEFVQMCNFGL  561



>ref|XP_006408424.1| hypothetical protein EUTSA_v10020416mg [Eutrema salsugineum]
 gb|ESQ49877.1| hypothetical protein EUTSA_v10020416mg [Eutrema salsugineum]
Length=561

 Score =   357 bits (916),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  355  KFKNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT +YHYWQ LNE+R
Sbjct  415  FGSFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTNQYHYWQNLNEDR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDI
Sbjct  475  TLWKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  535  AMNQYKSLWTKYVDNEMEFVQMCNFGL  561



>ref|NP_566170.1| putative galacturonosyltransferase 9 [Arabidopsis thaliana]
 sp|Q9FWA4.1|GAUT9_ARATH RecName: Full=Probable galacturonosyltransferase 9 [Arabidopsis 
thaliana]
 gb|AAG12603.1|AC068900_9 unknown protein; 9779-11709 [Arabidopsis thaliana]
 gb|AAL84957.1| AT3g02350/F11A12_103 [Arabidopsis thaliana]
 gb|AAM61096.1| glycosyl transferase, putative [Arabidopsis thaliana]
 gb|AAO42776.1| At3g02350/F11A12_103 [Arabidopsis thaliana]
 gb|AEE73795.1| putative galacturonosyltransferase 9 [Arabidopsis thaliana]
Length=561

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  355  KFKNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NFSHPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R
Sbjct  415  FGSFHRYGQYLNFSHPLIKENFNPSACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NA V+H+NGNMKPWLDI
Sbjct  475  TLWKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAGVIHYNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  535  AMNQYKSLWTKYVDNEMEFVQMCNFGL  561



>ref|XP_002882224.1| hypothetical protein ARALYDRAFT_477468 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58483.1| hypothetical protein ARALYDRAFT_477468 [Arabidopsis lyrata subsp. 
lyrata]
Length=561

 Score =   357 bits (916),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  355  KFKNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NFSHPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R
Sbjct  415  FGSFHRYGQYLNFSHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NA V+H+NGNMKPWLDI
Sbjct  475  TLWKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAGVIHYNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  535  AMNQYKSLWTKYVDNEMEFVQMCNFGL  561



>gb|ABD96904.1| hypothetical protein [Cleome spinosa]
Length=528

 Score =   355 bits (912),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 183/210 (87%), Gaps = 3/210 (1%)
 Frame = -2

Query  959  KFRNPKYLSILNHL---RFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAV  789
            KF N  Y+ +L  L   +FYLPEMYPKLH+ILFLDDD+VVQ+DLTGLWKI++DGKVNGAV
Sbjct  319  KFLNSSYVPVLRQLESAKFYLPEMYPKLHKILFLDDDVVVQKDLTGLWKINLDGKVNGAV  378

Query  788  ETCFGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALN  609
            ETCFGSFHRY+QY+NFSHPLI+  FNP ACAWA+GMN FDLDAWR+EKCTE+ H+WQ LN
Sbjct  379  ETCFGSFHRYSQYLNFSHPLIKESFNPNACAWAFGMNIFDLDAWRREKCTEQLHHWQNLN  438

Query  608  ENRTLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPW  429
            E + LW+LGTLPPGLIT+YS TK LDK+WHVLGLGYNP +S DEI NAAV+H+NGNMKPW
Sbjct  439  EEQNLWRLGTLPPGLITFYSKTKSLDKTWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPW  498

Query  428  LDIAIAQFRPLWTKYVDYENEYIQACNFGL  339
            LDIA+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  499  LDIAMNQYKSLWTKYVDNEMEFVQMCNFGL  528



>ref|XP_006297346.1| hypothetical protein CARUB_v10013365mg [Capsella rubella]
 gb|EOA30244.1| hypothetical protein CARUB_v10013365mg [Capsella rubella]
Length=561

 Score =   357 bits (915),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  355  KFKNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NF+HPLI+  F+P ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R
Sbjct  415  FGSFHRYGQYLNFTHPLIKESFSPSACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDI
Sbjct  475  TLWKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  535  AMNQYKSLWTKYVDNEMEFVQMCNFGL  561



>ref|XP_008455575.1| PREDICTED: probable galacturonosyltransferase 9 [Cucumis melo]
 ref|XP_008455576.1| PREDICTED: probable galacturonosyltransferase 9 [Cucumis melo]
Length=550

 Score =   356 bits (914),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 155/207 (75%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPK  S+LNHLRFYLPEM+PKL +I+FL+DD+VVQ+DLTGLWKID+DG+VNGAVETC
Sbjct  344  KFKNPKDTSLLNHLRFYLPEMFPKLQKIIFLEDDVVVQKDLTGLWKIDLDGRVNGAVETC  403

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHR+A Y+NFS+PLI+ KFN KACAW+YG+N FDLDAWR EKCTEEY+YWQ LNE+ 
Sbjct  404  FGSFHRFAHYLNFSNPLIKEKFNAKACAWSYGINIFDLDAWRSEKCTEEYNYWQNLNEDG  463

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LW  GTLPPGLIT+YS TK LD+SWHVLGLGYNPSIS D I+NAAV+H+NGNMKPWLDI
Sbjct  464  SLWSGGTLPPGLITFYSKTKSLDRSWHVLGLGYNPSISMDAISNAAVIHYNGNMKPWLDI  523

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++  WTKYVD + E++Q CNFGL
Sbjct  524  AMNQYKGFWTKYVDSDMEFVQVCNFGL  550



>ref|XP_009378304.1| PREDICTED: probable galacturonosyltransferase 9 [Pyrus x bretschneideri]
Length=561

 Score =   356 bits (914),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 167/207 (81%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPEMYPKL +ILFLDDD+VVQ+D+TGLWKID+DGKVNGAVETC
Sbjct  355  KYRNPKYLSMLNHLRFYLPEMYPKLRKILFLDDDVVVQKDVTGLWKIDLDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRYAQY+NFSHPLIR +FN +ACAWAYGMN FDLDAWR EK TE+YHYWQ LNE+R
Sbjct  415  FGSFHRYAQYLNFSHPLIRERFNSRACAWAYGMNIFDLDAWRLEKSTEQYHYWQNLNEDR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YS TK LDKSWHVLGLGYNPSIS DEI  AAV+H+NGNMKPWLDI
Sbjct  475  TLWKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPSISMDEIRKAAVIHYNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWT Y+D + E++Q CNFGL
Sbjct  535  AMNQYKKLWTNYLDNDMEFVQMCNFGL  561



>ref|XP_004137150.1| PREDICTED: probable galacturonosyltransferase 9 [Cucumis sativus]
 gb|KGN53749.1| hypothetical protein Csa_4G119780 [Cucumis sativus]
Length=550

 Score =   355 bits (911),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPK  S+L+HLRFYLPEM+PKL +I+FL+DD+VVQ+DLTGLWKID+DG+VNGAVETC
Sbjct  344  KFKNPKDTSLLSHLRFYLPEMFPKLQKIIFLEDDVVVQKDLTGLWKIDLDGRVNGAVETC  403

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHR+A Y+NFS+PLI+ KFN KACAW+YG+N FDLDAWR EKCTEEY+YWQ LNE+ 
Sbjct  404  FGSFHRFAHYLNFSNPLIKEKFNAKACAWSYGINIFDLDAWRSEKCTEEYNYWQNLNEDA  463

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LW  GTLPPGLIT+YS TK LD+SWHVLGLGYNPSIS D I+NAAV+H+NGNMKPWLDI
Sbjct  464  SLWSGGTLPPGLITFYSKTKSLDRSWHVLGLGYNPSISMDAISNAAVIHYNGNMKPWLDI  523

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++  WTKYVD + E++Q CNFGL
Sbjct  524  AMNQYKGFWTKYVDSDMEFVQVCNFGL  550



>ref|XP_009134662.1| PREDICTED: probable galacturonosyltransferase 9 isoform X2 [Brassica 
rapa]
 ref|XP_009134664.1| PREDICTED: probable galacturonosyltransferase 9 isoform X2 [Brassica 
rapa]
Length=534

 Score =   354 bits (909),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  328  KFKNPKYLSVLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  387

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R
Sbjct  388  FGSFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDR  447

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LWKLGTLPPGL+T+YS TK LDKSWHVLGLGYNP +S DEI  AAV+H+NGNMKPWLDI
Sbjct  448  SLWKLGTLPPGLMTFYSKTKSLDKSWHVLGLGYNPGVSMDEIKKAAVIHYNGNMKPWLDI  507

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  508  AMNQYKSLWTKYVDNEMEFVQMCNFGL  534



>ref|XP_010476066.1| PREDICTED: probable galacturonosyltransferase 9 [Camelina sativa]
Length=561

 Score =   355 bits (910),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMY KL+++LFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  355  KFKNPKYLSMLNHLRFYLPEMYSKLNKVLFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R
Sbjct  415  FGSFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDI
Sbjct  475  TLWKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  535  AMNQYKSLWTKYVDNEMEFVQMCNFGL  561



>ref|XP_009134660.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Brassica 
rapa]
 ref|XP_009134661.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Brassica 
rapa]
 ref|XP_009134663.1| PREDICTED: probable galacturonosyltransferase 9 isoform X1 [Brassica 
rapa]
Length=539

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  333  KFKNPKYLSVLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  392

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R
Sbjct  393  FGSFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDR  452

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LWKLGTLPPGL+T+YS TK LDKSWHVLGLGYNP +S DEI  AAV+H+NGNMKPWLDI
Sbjct  453  SLWKLGTLPPGLMTFYSKTKSLDKSWHVLGLGYNPGVSMDEIKKAAVIHYNGNMKPWLDI  512

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  513  AMNQYKSLWTKYVDNEMEFVQMCNFGL  539



>ref|XP_010485478.1| PREDICTED: probable galacturonosyltransferase 9 [Camelina sativa]
Length=561

 Score =   354 bits (908),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 163/207 (79%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  355  KFKNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  414

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NF+H LI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R
Sbjct  415  FGSFHRYGQYLNFTHLLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDR  474

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+YS TK LDKSWHVLGLGYNP +S DEI NAAV+H+NGNMKPWLDI
Sbjct  475  TLWKLGTLPPGLITFYSKTKSLDKSWHVLGLGYNPGVSMDEIRNAAVIHYNGNMKPWLDI  534

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  535  AMNQYKSLWTKYVDNEMEFVQMCNFGL  561



>emb|CDX91987.1| BnaC03g32890D [Brassica napus]
Length=544

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  338  KFKNPKYLSVLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  397

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R
Sbjct  398  FGSFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDR  457

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LWKLGTLPPGL+T+YS TK LDKSWHVLGLGYNP +S DEI  AAV+H+NGNMKPWLDI
Sbjct  458  SLWKLGTLPPGLMTFYSKTKSLDKSWHVLGLGYNPGVSMDEIKKAAVIHYNGNMKPWLDI  517

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  518  AMNQYKSLWTKYVDNEMEFVQMCNFGL  544



>emb|CDX74263.1| BnaA03g27840D [Brassica napus]
Length=544

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  338  KFKNPKYLSVLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  397

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R
Sbjct  398  FGSFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDR  457

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LWKLGTLPPGL+T+YS TK LDKSWHVLGLGYNP +S DEI  AAV+H+NGNMKPWLDI
Sbjct  458  SLWKLGTLPPGLMTFYSKTKSLDKSWHVLGLGYNPGVSMDEIKKAAVIHYNGNMKPWLDI  517

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  518  AMNQYKSLWTKYVDNEMEFVQMCNFGL  544



>emb|CDY34723.1| BnaA01g33020D [Brassica napus]
Length=491

 Score =   352 bits (902),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  285  KFKNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  344

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNE+R
Sbjct  345  FGSFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNEDR  404

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLW+LGTLPPGL+T+YS TK LDKSWHVLGLGYNP +S DEI  AAV+H+NGNMKPWLDI
Sbjct  405  TLWELGTLPPGLMTFYSKTKSLDKSWHVLGLGYNPGVSMDEIKKAAVIHYNGNMKPWLDI  464

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  465  AMNQYKSLWTKYVDNEMEFVQMCNFGL  491



>ref|XP_009117942.1| PREDICTED: probable galacturonosyltransferase 9 [Brassica rapa]
Length=551

 Score =   352 bits (903),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 161/207 (78%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KF+NPKYLS+LNHLRFYLPEMYPKL++ILFLDDD+VVQ+D+TGLWKI++DGKVNGAVETC
Sbjct  345  KFKNPKYLSMLNHLRFYLPEMYPKLNKILFLDDDVVVQKDVTGLWKINLDGKVNGAVETC  404

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
            FGSFHRY QY+NF+HPLI+  FNP ACAWA+GMN FDL+AWR+EKCT++YHYWQ LNENR
Sbjct  405  FGSFHRYGQYLNFTHPLIKESFNPNACAWAFGMNIFDLNAWRREKCTDQYHYWQNLNENR  464

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLW+LGTLPPGL+ +YS TK LDKSWHVLGLGYNP +S DEI  AAV+H+NGNMKPWLDI
Sbjct  465  TLWELGTLPPGLMAFYSKTKSLDKSWHVLGLGYNPGVSMDEIKKAAVIHYNGNMKPWLDI  524

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
            A+ Q++ LWTKYVD E E++Q CNFGL
Sbjct  525  AMNQYKSLWTKYVDNEMEFVQMCNFGL  551



>ref|XP_004304175.1| PREDICTED: probable galacturonosyltransferase 9 [Fragaria vesca 
subsp. vesca]
Length=542

 Score =   348 bits (894),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/205 (76%), Positives = 182/205 (89%), Gaps = 1/205 (0%)
 Frame = -2

Query  953  RNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFG  774
            RNP Y S+L+ LRFY+PEMYPKL++ILFLDDD+VVQ+DLTGLW ID+DGKVNGAVETCFG
Sbjct  339  RNP-YSSLLHELRFYMPEMYPKLNKILFLDDDVVVQKDLTGLWNIDLDGKVNGAVETCFG  397

Query  773  SFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTL  594
            SF RYAQY+NFSHPLIR +FNP++CAWAYGMN FDLDAWR+E CTE+YH WQ LNEN+TL
Sbjct  398  SFRRYAQYLNFSHPLIRERFNPRSCAWAYGMNIFDLDAWRQEGCTEQYHSWQNLNENQTL  457

Query  593  WKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAI  414
            +K GT   GLIT+YSTTK LDKSWHVLGLGYNPSIS DEIN AAV+H+NG+MKPWLDIA+
Sbjct  458  YKSGTSAAGLITFYSTTKSLDKSWHVLGLGYNPSISMDEINKAAVIHYNGHMKPWLDIAM  517

Query  413  AQFRPLWTKYVDYENEYIQACNFGL  339
             Q++ LWTKY+D   E++Q CNFGL
Sbjct  518  NQYKNLWTKYMDNGMEFVQMCNFGL  542



>emb|CDY00812.1| BnaCnng00120D [Brassica napus]
Length=460

 Score =   344 bits (883),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 153/172 (89%), Positives = 164/172 (95%), Gaps = 0/172 (0%)
 Frame = -2

Query  854  VVQRDLTGLWKIDMDGKVNGAVETCFGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNF  675
            V  +DLTGLW+IDMDGKVNGAVETCFGSFHRYAQYMNFSHPLI+ KFNPKACAWAYGMNF
Sbjct  289  VFHKDLTGLWEIDMDGKVNGAVETCFGSFHRYAQYMNFSHPLIKEKFNPKACAWAYGMNF  348

Query  674  FDLDAWRKEKCTEEYHYWQALNENRTLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNP  495
            FDLDAWRKEKCTEEYHYWQ LNENRTLWKLGTLPPGLIT+YSTTKPLDK+WHVLGLGYNP
Sbjct  349  FDLDAWRKEKCTEEYHYWQNLNENRTLWKLGTLPPGLITFYSTTKPLDKTWHVLGLGYNP  408

Query  494  SISTDEINNAAVVHFNGNMKPWLDIAIAQFRPLWTKYVDYENEYIQACNFGL  339
            SIS DEI NAAVVHFNGNMKPWLDIA+ QFRPLWTK+VD++ E++QACNFGL
Sbjct  409  SISMDEIRNAAVVHFNGNMKPWLDIAMNQFRPLWTKHVDHDLEFVQACNFGL  460



>ref|XP_010326484.1| PREDICTED: LOW QUALITY PROTEIN: galacturonosyltransferase 8 [Solanum 
lycopersicum]
Length=510

 Score =   339 bits (869),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 160/228 (70%), Positives = 186/228 (82%), Gaps = 12/228 (5%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRN  +LSI+NHL FYLPEMYPKLHRILFLDDD+VVQRDLTGLWKIDMDGKVNGAVETC
Sbjct  265  KFRNSIHLSIMNHLMFYLPEMYPKLHRILFLDDDVVVQRDLTGLWKIDMDGKVNGAVETC  324

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALN---  609
            FGSF+RY   M+FSHPLI+ KFNPKACAWA+GMNFFD +AWR+EK TEEYHY Q +    
Sbjct  325  FGSFYRYRXLMDFSHPLIKNKFNPKACAWAFGMNFFDFNAWRREKSTEEYHYLQNMVRCT  384

Query  608  ------ENRTLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFN  447
                  ENRTLW+LGTLPPGLIT+YSTTK LDKSWHVL   +NPS+S ++I N +VVHFN
Sbjct  385  TNILHIENRTLWRLGTLPPGLITFYSTTKVLDKSWHVLDPHFNPSVSMNDIGNVSVVHFN  444

Query  446  GNMKPWLDIAIAQFRPLWTKYVDYENEYIQACNFGL*VMVIVEALLRG  303
            GNM+PWLD AI +FRPLW+KYVD E   +  C + +  +V+VE +L G
Sbjct  445  GNMRPWLDNAINKFRPLWSKYVDKE---MSMCRYVISSLVMVEHMLDG  489



>ref|NP_001131608.1| uncharacterized protein LOC100192958 [Zea mays]
 gb|ACF80095.1| unknown [Zea mays]
Length=228

 Score =   319 bits (817),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC
Sbjct  22   KYRNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETC  81

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  82   GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLREWKKKDITGIYHKWQNMNEDR  141

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++
Sbjct  142  VLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLEL  201

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ Y++ YI+ CN  
Sbjct  202  AMTKYRPYWTKYIKYDHPYIRGCNLS  227



>gb|AFW67949.1| hypothetical protein ZEAMMB73_846223 [Zea mays]
Length=269

 Score =   320 bits (819),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 175/206 (85%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC
Sbjct  63   KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETC  122

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR
Sbjct  123  GESFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENR  182

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI+NAAV+H+NGNMKPWL+I
Sbjct  183  LLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTVERSEIDNAAVIHYNGNMKPWLEI  242

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY++YE+ YI  C F 
Sbjct  243  AMTKYRPYWTKYINYEHPYIHGCKFS  268



>gb|AFW67950.1| hypothetical protein ZEAMMB73_846223 [Zea mays]
Length=399

 Score =   323 bits (828),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 175/206 (85%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC
Sbjct  193  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETC  252

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR
Sbjct  253  GESFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENR  312

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI+NAAV+H+NGNMKPWL+I
Sbjct  313  LLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTVERSEIDNAAVIHYNGNMKPWLEI  372

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY++YE+ YI  C F 
Sbjct  373  AMTKYRPYWTKYINYEHPYIHGCKFS  398



>gb|AFW67951.1| hypothetical protein ZEAMMB73_846223 [Zea mays]
Length=507

 Score =   326 bits (836),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 175/206 (85%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC
Sbjct  301  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETC  360

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR
Sbjct  361  GESFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENR  420

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI+NAAV+H+NGNMKPWL+I
Sbjct  421  LLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTVERSEIDNAAVIHYNGNMKPWLEI  480

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY++YE+ YI  C F 
Sbjct  481  AMTKYRPYWTKYINYEHPYIHGCKFS  506



>gb|ACF78990.1| unknown [Zea mays]
 tpg|DAA50752.1| TPA: hypothetical protein ZEAMMB73_194342 [Zea mays]
Length=291

 Score =   318 bits (814),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 174/203 (86%), Gaps = 0/203 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC
Sbjct  85   KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETC  144

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR
Sbjct  145  GESFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENR  204

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP+I   EI+NAAV+H+NGNMKPWL+I
Sbjct  205  LLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTIERSEIDNAAVIHYNGNMKPWLEI  264

Query  419  AIAQFRPLWTKYVDYENEYIQAC  351
            A+ ++RP WTKY++Y++ YI  C
Sbjct  265  AMIKYRPYWTKYINYQHSYIHGC  287



>ref|XP_006657336.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Oryza brachyantha]
Length=584

 Score =   327 bits (839),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 175/206 (85%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW++D++G VNGAVETC
Sbjct  378  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWEVDLNGNVNGAVETC  437

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR
Sbjct  438  GESFHRFDKYLNFSNPNIARNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENR  497

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAV+H+NGNMKPWL+I
Sbjct  498  LLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIERSEIDNAAVIHYNGNMKPWLEI  557

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY++YE+ Y++ C   
Sbjct  558  AMTKYRPYWTKYINYEHTYVRGCKIS  583



>ref|NP_001169332.1| hypothetical protein precursor [Zea mays]
 gb|ACN33451.1| unknown [Zea mays]
 gb|AFW67952.1| hypothetical protein ZEAMMB73_846223 [Zea mays]
Length=590

 Score =   327 bits (838),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 175/206 (85%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC
Sbjct  384  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETC  443

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR
Sbjct  444  GESFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENR  503

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI+NAAV+H+NGNMKPWL+I
Sbjct  504  LLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTVERSEIDNAAVIHYNGNMKPWLEI  563

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY++YE+ YI  C F 
Sbjct  564  AMTKYRPYWTKYINYEHPYIHGCKFS  589



>ref|XP_008650863.1| PREDICTED: uncharacterized protein LOC100192958 isoform X3 [Zea 
mays]
Length=608

 Score =   327 bits (838),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC
Sbjct  402  KYRNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETC  461

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  462  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLREWKKKDITGIYHKWQNMNEDR  521

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++
Sbjct  522  VLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLEL  581

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ Y++ YI+ CN  
Sbjct  582  AMTKYRPYWTKYIKYDHPYIRGCNLS  607



>gb|EEC81302.1| hypothetical protein OsI_24438 [Oryza sativa Indica Group]
 gb|EEE66344.1| hypothetical protein OsJ_22634 [Oryza sativa Japonica Group]
Length=588

 Score =   326 bits (836),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW++D++G VNGAVETC
Sbjct  382  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWEVDLNGNVNGAVETC  441

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR
Sbjct  442  GESFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENR  501

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAV+H+NGNMKPWL+I
Sbjct  502  LLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIERSEIDNAAVIHYNGNMKPWLEI  561

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A++++RP WTKY++YE+ Y++ C   
Sbjct  562  AMSKYRPYWTKYINYEHTYVRGCKIS  587



>ref|XP_009409999.1| PREDICTED: probable galacturonosyltransferase 9 [Musa acuminata 
subsp. malaccensis]
Length=519

 Score =   323 bits (828),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 176/201 (88%), Gaps = 1/201 (0%)
 Frame = -2

Query  938  LSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFHRY  759
            LS+L+HLRFYLPEMYPKL RI+ L+DD+VVQ+DLTGLW++D+DG VNGAVETCFG F RY
Sbjct  319  LSMLDHLRFYLPEMYPKLRRIVLLEDDVVVQKDLTGLWRVDLDGMVNGAVETCFGGFRRY  378

Query  758  AQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWK-LG  582
            ++Y+NFS P +R +F+P+ACAWAYG+N FDLDAWR+E+CT+ +H +Q+LNE+ TLW    
Sbjct  379  SRYLNFSIPQVRDQFSPRACAWAYGVNVFDLDAWRRERCTDRFHQYQSLNEDGTLWNPAS  438

Query  581  TLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQFR  402
             LP GL+T+Y+TTKPLDK+WHV+GLGYNPS+S DEI NAAV+HF+GNMKPWLD+A+ Q++
Sbjct  439  VLPAGLVTFYTTTKPLDKTWHVMGLGYNPSVSPDEIRNAAVIHFDGNMKPWLDVALNQYK  498

Query  401  PLWTKYVDYENEYIQACNFGL  339
             LWTKYVD E +++Q CNFG+
Sbjct  499  HLWTKYVDTEMDFLQLCNFGI  519



>ref|XP_001785716.1| predicted protein [Physcomitrella patens]
 gb|EDQ49475.1| predicted protein [Physcomitrella patens]
Length=228

 Score =   313 bits (802),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE++PKL +ILFLDDDIVVQ+DLT LW ID++G VNGAVETC
Sbjct  22   KYRNPKYLSMLNHLRFYLPEVFPKLDKILFLDDDIVVQKDLTPLWDIDLNGNVNGAVETC  81

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+PLI   F+P AC WAYGMN FDL  W+KE  T  YH WQ+LNE+R
Sbjct  82   GASFHRFDKYLNFSNPLISENFDPNACGWAYGMNVFDLKQWKKEDITGIYHRWQSLNEDR  141

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y+ T+PL+KSWHVLGLGYNP+I   EI  AAV+H+NGNMKPWL+I
Sbjct  142  TLWKLGTLPPGLITFYNLTQPLEKSWHVLGLGYNPAIEESEIETAAVIHWNGNMKPWLEI  201

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
             + +F+P WTK+V Y + ++Q CN 
Sbjct  202  GMVKFKPYWTKFVKYNHPFLQQCNI  226



>ref|XP_008671920.1| PREDICTED: uncharacterized protein LOC100191781 isoform X1 [Zea 
mays]
Length=553

 Score =   324 bits (831),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC
Sbjct  347  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETC  406

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR
Sbjct  407  GESFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENR  466

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP+I   EI+NAAV+H+NGNMKPWL+I
Sbjct  467  LLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTIERSEIDNAAVIHYNGNMKPWLEI  526

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY++Y++ YI  C   
Sbjct  527  AMIKYRPYWTKYINYQHSYIHGCKIS  552



>ref|XP_008650862.1| PREDICTED: uncharacterized protein LOC100192958 isoform X2 [Zea 
mays]
 tpg|DAA62449.1| TPA: hypothetical protein ZEAMMB73_004043 [Zea mays]
Length=683

 Score =   327 bits (839),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC
Sbjct  477  KYRNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETC  536

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  537  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLREWKKKDITGIYHKWQNMNEDR  596

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++
Sbjct  597  VLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLEL  656

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ Y++ YI+ CN  
Sbjct  657  AMTKYRPYWTKYIKYDHPYIRGCNLS  682



>ref|NP_001063757.1| Os09g0531900 [Oryza sativa Japonica Group]
 dbj|BAD46018.1| glycosyl transferase family 8 protein-like [Oryza sativa Japonica 
Group]
 dbj|BAD46265.1| glycosyl transferase family 8 protein-like [Oryza sativa Japonica 
Group]
 dbj|BAF25671.1| Os09g0531900 [Oryza sativa Japonica Group]
 gb|EEE70102.1| hypothetical protein OsJ_30110 [Oryza sativa Japonica Group]
Length=695

 Score =   328 bits (840),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC
Sbjct  489  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETC  548

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ++NE+R
Sbjct  549  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQSMNEDR  608

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++
Sbjct  609  VLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLEL  668

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WT+Y+ Y++ YI+ CN  
Sbjct  669  AMTKYRPYWTRYIKYDHPYIRGCNLA  694



>gb|EEC84934.1| hypothetical protein OsI_32147 [Oryza sativa Indica Group]
Length=695

 Score =   328 bits (840),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC
Sbjct  489  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETC  548

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ++NE+R
Sbjct  549  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQSMNEDR  608

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++
Sbjct  609  VLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLEL  668

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WT+Y+ Y++ YI+ CN  
Sbjct  669  AMTKYRPYWTRYIKYDHPYIRGCNLA  694



>ref|XP_004982129.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Setaria italica]
Length=589

 Score =   325 bits (832),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC
Sbjct  383  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETC  442

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+++  T  YH WQ +NENR
Sbjct  443  GESFHRFDKYLNFSNPNISQNFDPNACGWAYGMNMFDLEEWKRKDITGIYHKWQNMNENR  502

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP+I   EI+NAAV+H+NGNMKPWL+I
Sbjct  503  LLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTIERSEIDNAAVIHYNGNMKPWLEI  562

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY++YE+ YI  C   
Sbjct  563  AMTKYRPYWTKYINYEHPYIHGCKIS  588



>tpg|DAA50750.1| TPA: hypothetical protein ZEAMMB73_194342 [Zea mays]
Length=593

 Score =   324 bits (831),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC
Sbjct  387  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETC  446

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR
Sbjct  447  GESFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENR  506

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP+I   EI+NAAV+H+NGNMKPWL+I
Sbjct  507  LLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTIERSEIDNAAVIHYNGNMKPWLEI  566

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY++Y++ YI  C   
Sbjct  567  AMIKYRPYWTKYINYQHSYIHGCKIS  592



>ref|NP_001130678.1| uncharacterized protein LOC100191781 precursor [Zea mays]
 gb|ACF78549.1| unknown [Zea mays]
 tpg|DAA50751.1| TPA: hypothetical protein ZEAMMB73_194342 [Zea mays]
Length=588

 Score =   324 bits (830),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC
Sbjct  382  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETC  441

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR
Sbjct  442  GESFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENR  501

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP+I   EI+NAAV+H+NGNMKPWL+I
Sbjct  502  LLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTIERSEIDNAAVIHYNGNMKPWLEI  561

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY++Y++ YI  C   
Sbjct  562  AMIKYRPYWTKYINYQHSYIHGCKIS  587



>ref|XP_010937117.1| PREDICTED: probable galacturonosyltransferase 9 [Elaeis guineensis]
Length=533

 Score =   322 bits (824),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 138/201 (69%), Positives = 175/201 (87%), Gaps = 1/201 (0%)
 Frame = -2

Query  938  LSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFHRY  759
            LS+L++LRFYLPEMYP L R++FL+DD+VVQ+DL GLW++D+DGKVNGAVE CFG F RY
Sbjct  333  LSLLHYLRFYLPEMYPSLQRVVFLEDDVVVQKDLAGLWRVDLDGKVNGAVEMCFGGFRRY  392

Query  758  AQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWKLGT  579
             +YMNFSHP++R +F P+ACAW+YG+N FDLDAWR+E+CTE++H +Q LNE+  +W  GT
Sbjct  393  NRYMNFSHPVVRERFTPRACAWSYGVNVFDLDAWRRERCTEKFHEYQDLNEDGMIWNPGT  452

Query  578  -LPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQFR  402
             LP GL+T+Y+TTKPLDKSWHV+GLGYNPSIS+D I NAAVVHFNG+MKPWLD+A+ Q++
Sbjct  453  VLPAGLMTFYTTTKPLDKSWHVMGLGYNPSISSDAIRNAAVVHFNGHMKPWLDVALNQYK  512

Query  401  PLWTKYVDYENEYIQACNFGL  339
             LWTKYVD E E++  CNFGL
Sbjct  513  HLWTKYVDTEMEFLPLCNFGL  533



>ref|XP_002466644.1| hypothetical protein SORBIDRAFT_01g011560 [Sorghum bicolor]
 gb|EER93642.1| hypothetical protein SORBIDRAFT_01g011560 [Sorghum bicolor]
Length=588

 Score =   323 bits (828),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQRDLTGLW++D++G VNGAVETC
Sbjct  382  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQRDLTGLWEVDLNGNVNGAVETC  441

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+ +  T  YH WQ +NENR
Sbjct  442  GESFHRFDKYLNFSNPNISQNFDPNACGWAYGMNMFDLEEWKNKDITGIYHKWQNMNENR  501

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP+I   EI+NAAV+H+NGNMKPWL+I
Sbjct  502  LLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPTIERSEIDNAAVIHYNGNMKPWLEI  561

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY++YE+ YI  C   
Sbjct  562  AMTKYRPYWTKYINYEHPYIHGCKIS  587



>ref|XP_002462717.1| hypothetical protein SORBIDRAFT_02g030820 [Sorghum bicolor]
 gb|EER99238.1| hypothetical protein SORBIDRAFT_02g030820 [Sorghum bicolor]
Length=683

 Score =   326 bits (835),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC
Sbjct  477  KYRNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETC  536

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ LNE+R
Sbjct  537  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLREWKKKDITGIYHKWQNLNEDR  596

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI++AAVVH+NGNMKPWL++
Sbjct  597  ALWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDSAAVVHYNGNMKPWLEL  656

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ Y++ YI+ CN  
Sbjct  657  AMTKYRPYWTKYIKYDHPYIRGCNLS  682



>ref|XP_008650861.1| PREDICTED: uncharacterized protein LOC100192958 isoform X1 [Zea 
mays]
Length=725

 Score =   327 bits (838),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 143/206 (69%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC
Sbjct  519  KYRNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETC  578

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  579  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLREWKKKDITGIYHKWQNMNEDR  638

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++
Sbjct  639  VLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLEL  698

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ Y++ YI+ CN  
Sbjct  699  AMTKYRPYWTKYIKYDHPYIRGCNLS  724



>ref|XP_006660882.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Oryza brachyantha]
Length=693

 Score =   326 bits (835),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC
Sbjct  487  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETC  546

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  547  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHRWQNMNEDR  606

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++
Sbjct  607  VLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLEL  666

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WT+Y+ Y++ YI+ CN  
Sbjct  667  AMTKYRPYWTRYIKYDHPYIRGCNLA  692



>emb|CDY52336.1| BnaA09g38850D [Brassica napus]
Length=671

 Score =   325 bits (833),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  465  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  524

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  525  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  584

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI+  +I NAAVVH+NGNMKPWL++
Sbjct  585  TLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIAKKDIQNAAVVHYNGNMKPWLEL  644

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  645  AMSKYRPYWTKYIKFDHPYLRRCNL  669



>emb|CDX71763.1| BnaC08g31110D [Brassica napus]
Length=673

 Score =   325 bits (833),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  467  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  526

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  527  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  586

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI+  +I NAAVVH+NGNMKPWL++
Sbjct  587  TLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIAKKDIQNAAVVHYNGNMKPWLEL  646

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  647  AMSKYRPYWTKYIKFDHPYLRRCNL  671



>ref|XP_009116771.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Brassica rapa]
Length=671

 Score =   325 bits (832),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  465  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  524

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  525  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  584

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI+  +I NAAVVH+NGNMKPWL++
Sbjct  585  TLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIAKKDIQNAAVVHYNGNMKPWLEL  644

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  645  AMSKYRPYWTKYIKFDHPYLRRCNL  669



>ref|XP_008802618.1| PREDICTED: probable galacturonosyltransferase 9 [Phoenix dactylifera]
Length=536

 Score =   321 bits (822),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 136/201 (68%), Positives = 179/201 (89%), Gaps = 1/201 (0%)
 Frame = -2

Query  938  LSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFHRY  759
            L++L++LRFYLPEMYP+L R++FL+DD+VVQ+DL GLW++D+DGKVNGAVE CFGSF RY
Sbjct  336  LALLDYLRFYLPEMYPRLRRVVFLEDDLVVQKDLAGLWRVDLDGKVNGAVEMCFGSFRRY  395

Query  758  AQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWKLGT  579
             +YMNFSHP+++ +F+P+ACAWAYG+N FDLDAWR+++CTE++H +Q LNE+  LW   T
Sbjct  396  NRYMNFSHPVVQERFSPRACAWAYGVNVFDLDAWRRDRCTEQFHQYQDLNEDGMLWNPET  455

Query  578  -LPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQFR  402
             LP GL+T+Y+TTKPLDKSWHV+GLGYNP++S DEI+NAAV+HFNGNMKPWLD+A+ Q++
Sbjct  456  VLPAGLMTFYTTTKPLDKSWHVMGLGYNPNVSPDEIHNAAVIHFNGNMKPWLDVALNQYK  515

Query  401  PLWTKYVDYENEYIQACNFGL  339
             LWTKYVD E +++Q CNFGL
Sbjct  516  HLWTKYVDTEMQFLQLCNFGL  536



>ref|XP_010523706.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Tarenaya hassleriana]
Length=682

 Score =   325 bits (832),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLT LW++D+ GKVNGAVETC
Sbjct  476  KYRNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTPLWEVDLKGKVNGAVETC  535

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  536  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  595

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+K+WHVLGLGYNPSI   EI NAAV+H+NGNMKPWL++
Sbjct  596  TLWKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIDKKEIENAAVIHYNGNMKPWLEL  655

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A++++RP WTKY+ Y++ Y++ CN  
Sbjct  656  AMSKYRPYWTKYIKYDHPYVRRCNLS  681



>gb|EMS50352.1| Alpha-1,4-galacturonosyltransferase 1 [Triticum urartu]
Length=507

 Score =   319 bits (818),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW++D++G VNGAVETC
Sbjct  301  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWEVDLNGNVNGAVETC  360

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR
Sbjct  361  GESFHRFDKYLNFSNPNISQNFDPNACGWAYGMNIFDLEEWKKKDITGIYHKWQNMNENR  420

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI+ AAV+H+NGNMKPWL+I
Sbjct  421  LLWKLGTLPPGLMTFYKLTHPLDKSWHVLGLGYNPTVEHAEIDTAAVIHYNGNMKPWLEI  480

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WT+Y++YE+ Y++ C   
Sbjct  481  AMTKYRPYWTQYINYEHSYVRGCKIS  506



>ref|XP_011460082.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=644

 Score =   323 bits (828),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPE++PKL+++LFLDDDIVV++DLTGLW +D+ G VNGAVETC
Sbjct  438  KFRNPKYLSILNHLRFYLPEIFPKLNKVLFLDDDIVVRKDLTGLWSLDLKGNVNGAVETC  497

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+PLI + F+P AC WAYGMN FDL+ W+K+  TE YH WQ LN +R
Sbjct  498  GESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLEQWKKQNITEVYHRWQKLNHDR  557

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT++  T PLD+SWHVLGLGYNPS+S  EI+ AAV+H+NGNMKPWL+I
Sbjct  558  QLWKLGTLPPGLITFWKHTYPLDRSWHVLGLGYNPSVSQKEIDRAAVIHYNGNMKPWLEI  617

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
             I ++R  W KYVDY+++Y++ CN 
Sbjct  618  GIPKYRSYWAKYVDYDHKYMRECNI  642



>ref|XP_011460081.1| PREDICTED: probable galacturonosyltransferase 4 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=647

 Score =   323 bits (827),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPE++PKL+++LFLDDDIVV++DLTGLW +D+ G VNGAVETC
Sbjct  441  KFRNPKYLSILNHLRFYLPEIFPKLNKVLFLDDDIVVRKDLTGLWSLDLKGNVNGAVETC  500

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+PLI + F+P AC WAYGMN FDL+ W+K+  TE YH WQ LN +R
Sbjct  501  GESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLEQWKKQNITEVYHRWQKLNHDR  560

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT++  T PLD+SWHVLGLGYNPS+S  EI+ AAV+H+NGNMKPWL+I
Sbjct  561  QLWKLGTLPPGLITFWKHTYPLDRSWHVLGLGYNPSVSQKEIDRAAVIHYNGNMKPWLEI  620

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             I ++R  W KYVDY+++Y++ CN  
Sbjct  621  GIPKYRSYWAKYVDYDHKYMRECNIN  646



>ref|XP_006375320.1| hypothetical protein POPTR_0014s06970g [Populus trichocarpa]
 gb|ERP53117.1| hypothetical protein POPTR_0014s06970g [Populus trichocarpa]
Length=468

 Score =   317 bits (813),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLT LW +D++GKVNGAVETC
Sbjct  262  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTKLWSVDLNGKVNGAVETC  321

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P +C WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  322  GESFHRFDKYLNFSNPHIARHFDPNSCGWAYGMNIFDLKVWKKKDITGIYHKWQNMNEDR  381

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y+ T PL KSWHVLGLGYNPSI   EI NAAVVH+NGNMKPWL++
Sbjct  382  VLWKLGTLPPGLITFYNLTHPLQKSWHVLGLGYNPSIDRSEIENAAVVHYNGNMKPWLEL  441

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ Y++ Y++ CN  
Sbjct  442  AMTKYRPYWTKYIKYDHPYLRNCNLS  467



>ref|XP_011460080.1| PREDICTED: probable galacturonosyltransferase 4 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=648

 Score =   323 bits (827),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPE++PKL+++LFLDDDIVV++DLTGLW +D+ G VNGAVETC
Sbjct  442  KFRNPKYLSILNHLRFYLPEIFPKLNKVLFLDDDIVVRKDLTGLWSLDLKGNVNGAVETC  501

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+PLI + F+P AC WAYGMN FDL+ W+K+  TE YH WQ LN +R
Sbjct  502  GESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNVFDLEQWKKQNITEVYHRWQKLNHDR  561

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT++  T PLD+SWHVLGLGYNPS+S  EI+ AAV+H+NGNMKPWL+I
Sbjct  562  QLWKLGTLPPGLITFWKHTYPLDRSWHVLGLGYNPSVSQKEIDRAAVIHYNGNMKPWLEI  621

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             I ++R  W KYVDY+++Y++ CN  
Sbjct  622  GIPKYRSYWAKYVDYDHKYMRECNIN  647



>ref|XP_003578496.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Brachypodium distachyon]
Length=691

 Score =   324 bits (830),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC
Sbjct  485  KYRNPKYLSMLNHLRFYLPQIYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETC  544

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+ +  T  YH WQ +NE+R
Sbjct  545  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKQWKNKDITGIYHRWQNMNEDR  604

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+NAAVVH+NGNMKPWL++
Sbjct  605  VLWKLGTLPPGLMTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDNAAVVHYNGNMKPWLEL  664

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WT+Y+ Y++ YI+ CN  
Sbjct  665  AMTKYRPYWTRYIKYDHPYIRGCNLS  690



>ref|XP_004957448.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Setaria italica]
Length=682

 Score =   323 bits (829),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC
Sbjct  476  KYRNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWDVDLNGKVNGAVETC  535

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  536  GESFHRFDKYLNFSNPHIAQNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEDR  595

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI+ AAVVH+NGNMKPWL++
Sbjct  596  VLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIDGAAVVHYNGNMKPWLEL  655

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ Y++ YI+ CN  
Sbjct  656  AMTKYRPYWTKYIKYDHPYIRGCNLS  681



>dbj|BAJ99110.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=591

 Score =   321 bits (822),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW++D++G VNGAVETC
Sbjct  385  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWEVDLNGNVNGAVETC  444

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR
Sbjct  445  GESFHRFDKYLNFSNPNISQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENR  504

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI+ AAV+H+NGNMKPWL+I
Sbjct  505  LLWKLGTLPPGLMTFYKLTHPLDKSWHVLGLGYNPTVEHAEIDTAAVIHYNGNMKPWLEI  564

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY++YE+ Y++ C   
Sbjct  565  AMTKYRPYWTKYINYEHSYVRGCKIS  590



>ref|XP_008670350.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X5 [Zea mays]
 ref|XP_008670351.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X5 [Zea mays]
Length=557

 Score =   320 bits (819),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPK+ +ILFLDDDIVVQ+DLTGLW ++++GKVNGAVETC
Sbjct  351  KYRNPKYLSMLNHLRFYLPEVYPKVDKILFLDDDIVVQKDLTGLWDVNLNGKVNGAVETC  410

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE R
Sbjct  411  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEGR  470

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPS+   EI++AAVVH+NGNMKPWL++
Sbjct  471  VLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSVDRSEIDSAAVVHYNGNMKPWLEL  530

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A+ ++RP WT+Y+ Y++ YI+ CN 
Sbjct  531  AMTKYRPYWTRYIKYDHPYIRGCNL  555



>ref|XP_011628938.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
isoform X2 [Amborella trichopoda]
Length=683

 Score =   323 bits (828),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC
Sbjct  477  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWLVDLHGKVNGAVETC  536

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL AW+K+  T  YH WQ +NE+R
Sbjct  537  GESFHRFDKYLNFSNPRISRNFDPYACGWAYGMNVFDLIAWKKKDITGIYHKWQNMNEDR  596

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPS+   EI NAAV+HFNGNMKPWL++
Sbjct  597  TLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSVDKSEIENAAVIHFNGNMKPWLEL  656

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ +++P WTKY+ Y++ YI  CN  
Sbjct  657  AMTKYKPYWTKYIKYDHPYITRCNLS  682



>gb|ERM96312.1| hypothetical protein AMTR_s00001p00190810 [Amborella trichopoda]
Length=684

 Score =   323 bits (828),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC
Sbjct  478  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWLVDLHGKVNGAVETC  537

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL AW+K+  T  YH WQ +NE+R
Sbjct  538  GESFHRFDKYLNFSNPRISRNFDPYACGWAYGMNVFDLIAWKKKDITGIYHKWQNMNEDR  597

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPS+   EI NAAV+HFNGNMKPWL++
Sbjct  598  TLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSVDKSEIENAAVIHFNGNMKPWLEL  657

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ +++P WTKY+ Y++ YI  CN  
Sbjct  658  AMTKYKPYWTKYIKYDHPYITRCNLS  683



>ref|XP_010231443.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Brachypodium distachyon]
Length=589

 Score =   320 bits (821),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 175/206 (85%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW++D++G VNGAVETC
Sbjct  383  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWEVDLNGNVNGAVETC  442

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR
Sbjct  443  GESFHRFDKYLNFSNPNIAQNFDPNACGWAYGMNMFDLEEWKKKDITGIYHKWQNMNENR  502

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI++AAV+H+NGNMKPWL+I
Sbjct  503  LLWKLGTLPPGLMTFYKLTHPLDKSWHVLGLGYNPTVEHSEIDSAAVIHYNGNMKPWLEI  562

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WT+Y++YE+ Y++ C   
Sbjct  563  AMTKYRPYWTRYINYEHSYVRGCKIS  588



>ref|XP_002320745.2| glycosyl transferase family 8 family protein [Populus trichocarpa]
 gb|EEE99060.2| glycosyl transferase family 8 family protein [Populus trichocarpa]
Length=520

 Score =   318 bits (816),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLT LW +D++GKVNGAVETC
Sbjct  314  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTKLWSVDLNGKVNGAVETC  373

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P +C WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  374  GESFHRFDKYLNFSNPHIARHFDPNSCGWAYGMNIFDLKVWKKKDITGIYHKWQNMNEDR  433

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y+ T PL KSWHVLGLGYNPSI   EI NAAVVH+NGNMKPWL++
Sbjct  434  VLWKLGTLPPGLITFYNLTHPLQKSWHVLGLGYNPSIDRSEIENAAVVHYNGNMKPWLEL  493

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ Y++ Y++ CN  
Sbjct  494  AMTKYRPYWTKYIKYDHPYLRNCNLS  519



>ref|XP_011628937.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
isoform X1 [Amborella trichopoda]
Length=691

 Score =   323 bits (828),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC
Sbjct  485  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWLVDLHGKVNGAVETC  544

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL AW+K+  T  YH WQ +NE+R
Sbjct  545  GESFHRFDKYLNFSNPRISRNFDPYACGWAYGMNVFDLIAWKKKDITGIYHKWQNMNEDR  604

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPS+   EI NAAV+HFNGNMKPWL++
Sbjct  605  TLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSVDKSEIENAAVIHFNGNMKPWLEL  664

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ +++P WTKY+ Y++ YI  CN  
Sbjct  665  AMTKYKPYWTKYIKYDHPYITRCNLS  690



>ref|XP_008784292.1| PREDICTED: probable galacturonosyltransferase 9 [Phoenix dactylifera]
Length=531

 Score =   318 bits (815),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 174/201 (87%), Gaps = 1/201 (0%)
 Frame = -2

Query  938  LSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFHRY  759
            LS+L++LRFYLPEMYP L R++FL+DD+VVQ+DL GLW++D+DGK NGAVE CFG F RY
Sbjct  331  LSLLHYLRFYLPEMYPSLQRVVFLEDDVVVQKDLAGLWRVDLDGKANGAVEMCFGGFRRY  390

Query  758  AQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWKLGT  579
            ++YMNFSHP+IR +F+P+ACAWAYG+N FDLDAWR+E+ TE++H +Q LNE+  +W  GT
Sbjct  391  SRYMNFSHPVIRERFSPRACAWAYGVNVFDLDAWRRERSTEKFHEYQDLNEDGIIWNPGT  450

Query  578  -LPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQFR  402
             LP GL+T+Y+TTKPL+KSWHV GLGYNPSIS DEI NAAV+HFNG+MKPWLD+A+ Q++
Sbjct  451  VLPAGLMTFYTTTKPLEKSWHVTGLGYNPSISLDEIRNAAVIHFNGHMKPWLDVALNQYK  510

Query  401  PLWTKYVDYENEYIQACNFGL  339
             LWTKYVD E E++  CNFGL
Sbjct  511  HLWTKYVDTEMEFLPLCNFGL  531



>emb|CDY42486.1| BnaC04g21950D [Brassica napus]
Length=670

 Score =   322 bits (825),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  464  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  523

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  524  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  583

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+K+WHVLGLGYNPSI+  +I NAAVVH+NGNMKPWL++
Sbjct  584  TLWKLGTLPPGLITFYELTHPLNKAWHVLGLGYNPSIAKKDIENAAVVHYNGNMKPWLEL  643

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  644  AMSKYRPYWTKYIQFDHPYLRRCNL  668



>ref|XP_008670348.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X4 [Zea mays]
 ref|XP_008670349.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X4 [Zea mays]
Length=606

 Score =   320 bits (820),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPK+ +ILFLDDDIVVQ+DLTGLW ++++GKVNGAVETC
Sbjct  400  KYRNPKYLSMLNHLRFYLPEVYPKVDKILFLDDDIVVQKDLTGLWDVNLNGKVNGAVETC  459

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE R
Sbjct  460  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEGR  519

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPS+   EI++AAVVH+NGNMKPWL++
Sbjct  520  VLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSVDRSEIDSAAVVHYNGNMKPWLEL  579

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A+ ++RP WT+Y+ Y++ YI+ CN 
Sbjct  580  AMTKYRPYWTRYIKYDHPYIRGCNL  604



>ref|XP_010272612.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Nelumbo nucifera]
 ref|XP_010272613.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Nelumbo nucifera]
Length=682

 Score =   322 bits (826),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 168/206 (82%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC
Sbjct  476  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWSVDLHGKVNGAVETC  535

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NE R
Sbjct  536  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNIFDLKEWKKRDITGIYHKWQNMNEER  595

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y  T PL KSWHVLGLGYNPSI   EI NAAV+H+NGNMKPWL+I
Sbjct  596  VLWKLGTLPPGLITFYGLTHPLQKSWHVLGLGYNPSIDRSEIENAAVIHYNGNMKPWLEI  655

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WT+Y+ Y++ Y++ CN  
Sbjct  656  AMTKYRPYWTRYIKYDHPYLRNCNLS  681



>gb|EMT14751.1| Glycosyltransferase QUASIMODO1 [Aegilops tauschii]
Length=587

 Score =   320 bits (819),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 174/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW++D++G VNGAVETC
Sbjct  381  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWEVDLNGNVNGAVETC  440

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ +NENR
Sbjct  441  GESFHRFDKYLNFSNPNISQNFDPNACGWAYGMNIFDLEEWKKKDITGIYHKWQNMNENR  500

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNP++   EI+ AAV+H+NGNMKPWL+I
Sbjct  501  LLWKLGTLPPGLMTFYKLTHPLDKSWHVLGLGYNPTVEHAEIDTAAVIHYNGNMKPWLEI  560

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WT+Y++YE+ Y++ C   
Sbjct  561  AMTKYRPYWTQYINYEHSYVRGCKIS  586



>ref|XP_010512446.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X4 [Camelina sativa]
Length=673

 Score =   322 bits (825),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  467  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  526

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  527  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  586

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++
Sbjct  587  TLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVVHYNGNMKPWLEL  646

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  647  AMSKYRPYWTKYIKFDHPYLRRCNL  671



>ref|XP_010512444.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Camelina sativa]
Length=675

 Score =   322 bits (825),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  469  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  528

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  529  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  588

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++
Sbjct  589  TLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVVHYNGNMKPWLEL  648

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  649  AMSKYRPYWTKYIKFDHPYLRRCNL  673



>ref|XP_010512443.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Camelina sativa]
Length=676

 Score =   322 bits (825),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  470  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  529

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  530  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  589

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++
Sbjct  590  TLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVVHYNGNMKPWLEL  649

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  650  AMSKYRPYWTKYIKFDHPYLRRCNL  674



>ref|XP_010469034.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Camelina sativa]
Length=673

 Score =   322 bits (824),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  467  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  526

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  527  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  586

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++
Sbjct  587  TLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVVHYNGNMKPWLEL  646

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  647  AMSKYRPYWTKYIKFDHPYLRRCNL  671



>ref|XP_010512445.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X3 [Camelina sativa]
Length=674

 Score =   322 bits (824),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  468  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  527

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  528  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  587

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++
Sbjct  588  TLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVVHYNGNMKPWLEL  647

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  648  AMSKYRPYWTKYIKFDHPYLRRCNL  672



>ref|XP_010413456.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Camelina sativa]
Length=673

 Score =   322 bits (824),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  467  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  526

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  527  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  586

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++
Sbjct  587  TLWKLGTLPPGLITFYGLTHPLNKSWHVLGLGYNPSIDRKDIENAAVVHYNGNMKPWLEL  646

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  647  AMSKYRPYWTKYIKFDHPYLRRCNL  671



>emb|CDX89098.1| BnaA04g00880D [Brassica napus]
Length=671

 Score =   322 bits (824),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 175/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  465  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  524

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  525  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  584

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+K+WHVLGLGYNPSI+  +I NAAVVH+NGNMKPWL++
Sbjct  585  TLWKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIAKKDIENAAVVHYNGNMKPWLEL  644

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  645  AMSKYRPYWTKYIQFDHPYLRRCNL  669



>ref|XP_006339506.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Solanum tuberosum]
Length=688

 Score =   322 bits (825),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC
Sbjct  482  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWSVDLHGKVNGAVETC  541

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  542  GQSFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKQDITGIYHKWQNMNEDR  601

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++
Sbjct  602  VLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIDRSDIENAAVVHYNGNMKPWLEL  661

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ +++ Y+++C   
Sbjct  662  AMTKYRPYWTKYIKFDHPYMRSCKLS  687



>ref|XP_002962728.1| GAUT1, alpha-1,4-galaturonosyltransferase-like protein [Selaginella 
moellendorffii]
 gb|EFJ36191.1| GAUT1, alpha-1,4-galaturonosyltransferase-like protein [Selaginella 
moellendorffii]
Length=533

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW ID+ GKVNGAVETC
Sbjct  327  KYRNPKYLSMLNHLRFYLPQIYPKLDKILFLDDDIVVQKDLTGLWSIDLQGKVNGAVETC  386

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W++   T  YH WQ +NE+R
Sbjct  387  GASFHRFDKYLNFSNPHIARNFNPDACGWAYGMNVFDLKEWKRRDITGIYHKWQNMNEDR  446

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y+ T PLDKSWHVLGLGYNPSI   +++ AAVVH+NGN+KPWLDI
Sbjct  447  LLWKLGTLPPGLITFYNLTHPLDKSWHVLGLGYNPSIDKADMDAAAVVHYNGNLKPWLDI  506

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
             +++++  WT+YV Y++ Y+Q CN 
Sbjct  507  GLSRYKSYWTRYVSYDHPYLQQCNI  531



>ref|XP_008670347.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X3 [Zea mays]
Length=624

 Score =   320 bits (820),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPK+ +ILFLDDDIVVQ+DLTGLW ++++GKVNGAVETC
Sbjct  418  KYRNPKYLSMLNHLRFYLPEVYPKVDKILFLDDDIVVQKDLTGLWDVNLNGKVNGAVETC  477

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE R
Sbjct  478  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEGR  537

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPS+   EI++AAVVH+NGNMKPWL++
Sbjct  538  VLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSVDRSEIDSAAVVHYNGNMKPWLEL  597

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A+ ++RP WT+Y+ Y++ YI+ CN 
Sbjct  598  AMTKYRPYWTRYIKYDHPYIRGCNL  622



>ref|XP_002980359.1| Glycosyltransferase, CAZy family GT8 [Selaginella moellendorffii]
 gb|EFJ18619.1| Glycosyltransferase, CAZy family GT8 [Selaginella moellendorffii]
Length=533

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW ID+ GKVNGAVETC
Sbjct  327  KYRNPKYLSMLNHLRFYLPQIYPKLDKILFLDDDIVVQKDLTGLWSIDLQGKVNGAVETC  386

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W++   T  YH WQ +NE+R
Sbjct  387  GASFHRFDKYLNFSNPHIARNFNPDACGWAYGMNVFDLKEWKRRDITGIYHKWQNMNEDR  446

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y+ T PLDKSWHVLGLGYNPSI   +++ AAVVH+NGN+KPWLDI
Sbjct  447  LLWKLGTLPPGLITFYNLTHPLDKSWHVLGLGYNPSIDKADMDAAAVVHYNGNLKPWLDI  506

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
             +++++  WT+YV Y++ Y+Q CN 
Sbjct  507  GLSRYKSYWTRYVSYDHPYLQQCNI  531



>ref|XP_001779123.1| predicted protein [Physcomitrella patens]
 gb|EDQ56069.1| predicted protein, partial [Physcomitrella patens]
Length=516

 Score =   317 bits (811),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 170/204 (83%), Gaps = 0/204 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW ID+ G VNGAVETC
Sbjct  310  KYRNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWDIDLKGNVNGAVETC  369

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+  Y+NFS+PLI R F   AC WAYGMN FDL  W+ +  T  YH WQ++NE R
Sbjct  370  GPSFHRFNTYLNFSNPLIARNFKSDACGWAYGMNIFDLKQWKIQDITGIYHKWQSMNEER  429

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T+PL+KSWHVLGLGYNP+I   +I +AAV+H+NGNMKPWL+I
Sbjct  430  TLWKLGTLPPGLITFYKLTQPLEKSWHVLGLGYNPAIEETDIESAAVIHWNGNMKPWLEI  489

Query  419  AIAQFRPLWTKYVDYENEYIQACN  348
            AI++F+P W+KYV Y++ ++Q CN
Sbjct  490  AISKFKPYWSKYVKYDHPFLQQCN  513



>ref|XP_010939506.1| PREDICTED: probable galacturonosyltransferase 9 [Elaeis guineensis]
Length=536

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 176/201 (88%), Gaps = 1/201 (0%)
 Frame = -2

Query  938  LSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETCFGSFHRY  759
            L++L++LRFYLPEMYP+L R++FL+DD+VVQ+DL GLW++D+DGKVNGAVE CFG F RY
Sbjct  336  LALLDNLRFYLPEMYPRLRRVVFLEDDVVVQKDLAGLWRVDLDGKVNGAVEMCFGGFRRY  395

Query  758  AQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENRTLWKLGT  579
             +YMNFSHP+++ +F+P+ACAWAYG+N FDLDAWR+E+CTE++H +Q LNE+  LW  GT
Sbjct  396  GRYMNFSHPVVQERFSPRACAWAYGVNVFDLDAWRRERCTEQFHEYQDLNEDGMLWNPGT  455

Query  578  -LPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDIAIAQFR  402
             LP GL+T+ +TTKPLDKSWHV+GLGYNPSIS ++I NAAV+HFNGNMKPWLD+A+ Q++
Sbjct  456  VLPAGLMTFSTTTKPLDKSWHVMGLGYNPSISPEKILNAAVIHFNGNMKPWLDVALNQYK  515

Query  401  PLWTKYVDYENEYIQACNFGL  339
             LWTKYVD E +++  CNFGL
Sbjct  516  HLWTKYVDTEMQFLPLCNFGL  536



>ref|XP_010056256.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Eucalyptus grandis]
 gb|KCW72890.1| hypothetical protein EUGRSUZ_E01335 [Eucalyptus grandis]
 gb|KCW72891.1| hypothetical protein EUGRSUZ_E01335 [Eucalyptus grandis]
Length=675

 Score =   321 bits (823),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +++ GKVNGAVETC
Sbjct  469  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWSVNLHGKVNGAVETC  528

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K   T  YH WQ +NE+R
Sbjct  529  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNEDR  588

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPS+   +I+NAAVVH+NGNMKPWL++
Sbjct  589  VLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSVDRSDIDNAAVVHYNGNMKPWLEL  648

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ Y++ Y++ CN  
Sbjct  649  AMTKYRPYWTKYIKYDHPYLRTCNLS  674



>gb|KHN04100.1| Alpha-1,4-galacturonosyltransferase 1 [Glycine soja]
Length=666

 Score =   321 bits (822),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC
Sbjct  460  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWAVDLNGKVNGAVETC  519

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  520  GQSFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKVWKKKDITGIYHKWQNMNEDR  579

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPS+   EI NAAVVH+NGNMKPWL+I
Sbjct  580  VLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSLDRSEIENAAVVHYNGNMKPWLEI  639

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A+ ++R  WTKYV Y + Y+Q C  
Sbjct  640  AMTKYRSYWTKYVKYNHPYLQNCKL  664



>ref|XP_006576391.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Glycine max]
 ref|XP_006576392.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Glycine max]
Length=666

 Score =   321 bits (822),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 142/205 (69%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D++GKVNGAVETC
Sbjct  460  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWAVDLNGKVNGAVETC  519

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  520  GQSFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKVWKKKDITGIYHKWQNMNEDR  579

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPS+   EI NAAVVH+NGNMKPWL+I
Sbjct  580  VLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSLDRSEIENAAVVHYNGNMKPWLEI  639

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A+ ++R  WTKYV Y + Y+Q C  
Sbjct  640  AMTKYRSYWTKYVKYNHPYLQNCKL  664



>ref|XP_004229870.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Solanum lycopersicum]
Length=688

 Score =   321 bits (823),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC
Sbjct  482  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWSVDLHGKVNGAVETC  541

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  542  GQSFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKKDITGIYHKWQNMNEDR  601

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++
Sbjct  602  VLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIDRSDIENAAVVHYNGNMKPWLEL  661

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ +++ Y+++C   
Sbjct  662  AMTKYRPYWTKYIKFDHPYMRSCKLS  687



>ref|XP_008776919.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Phoenix dactylifera]
Length=697

 Score =   321 bits (823),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 170/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDIVVQ+DLT LW ID+ G VNGAVETC
Sbjct  491  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIVVQKDLTALWSIDLRGNVNGAVETC  550

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I + F+P AC WAYGMN FDL+ W+K+  T  YH WQ+LNENR
Sbjct  551  GQSFHRFDKYLNFSNPHIAKNFDPNACGWAYGMNMFDLNEWKKKDITGIYHKWQSLNENR  610

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI NAAVVH+NGNMKPWL+I
Sbjct  611  ALWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDRSEIENAAVVHYNGNMKPWLEI  670

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             + ++R  WT+Y+ Y++ Y++ CN  
Sbjct  671  GMTKYRHYWTRYISYDDPYVKICNLS  696



>ref|XP_009107093.1| PREDICTED: probable galacturonosyltransferase 4 [Brassica rapa]
Length=631

 Score =   320 bits (819),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPE++PKL ++LFLDDDIVVQ+DL+GLW +D+ G VNGAVETC
Sbjct  425  KFRNPKYLSILNHLRFYLPEIFPKLSKVLFLDDDIVVQKDLSGLWSVDLKGNVNGAVETC  484

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+PLI + F+P+AC WAYGMN FDLD W+++  TE YH WQ LN++R
Sbjct  485  GESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITEVYHRWQNLNQDR  544

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT++  T PLD+ WHVLGLGYNPS++  +I  AAVVH+NGN+KPWL+I
Sbjct  545  DLWKLGTLPPGLITFWKRTYPLDRKWHVLGLGYNPSVNQRDIERAAVVHYNGNLKPWLEI  604

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             I ++R LW+K+VDY++ Y++ CN  
Sbjct  605  GIPKYRGLWSKHVDYQHVYLRECNIN  630



>ref|XP_002876594.1| GAUT1/LGT1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52853.1| GAUT1/LGT1 [Arabidopsis lyrata subsp. lyrata]
Length=673

 Score =   320 bits (821),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  467  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  526

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  527  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  586

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+K+WHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++
Sbjct  587  TLWKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIDRKDIENAAVVHYNGNMKPWLEL  646

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  647  AMSKYRPYWTKYIKFDHPYLRRCNL  671



>ref|NP_191672.1| alpha-1,4-galacturonosyltransferase 1 [Arabidopsis thaliana]
 sp|Q9LE59.1|GAUT1_ARATH RecName: Full=Polygalacturonate 4-alpha-galacturonosyltransferase; 
AltName: Full=Alpha-1,4-galacturonosyltransferase 1; AltName: 
Full=Galacturonosyltransferase 1; AltName: Full=Like 
glycosyl transferase 1 [Arabidopsis thaliana]
 emb|CAB71043.1| putative protein [Arabidopsis thaliana]
 emb|CAB91508.1| like glycosyl transferase 1 [Arabidopsis thaliana]
 gb|ABD14404.1| homogalacturonan alpha-1,4-galacturonosyltransferase [Arabidopsis 
thaliana]
 gb|AEE80159.1| alpha-1,4-galacturonosyltransferase 1 [Arabidopsis thaliana]
 gb|AHL38722.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=673

 Score =   320 bits (821),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  467  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  526

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  527  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  586

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+K+WHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++
Sbjct  587  TLWKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIDKKDIENAAVVHYNGNMKPWLEL  646

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  647  AMSKYRPYWTKYIKFDHPYLRRCNL  671



>ref|XP_006402518.1| hypothetical protein EUTSA_v10005820mg [Eutrema salsugineum]
 gb|ESQ43971.1| hypothetical protein EUTSA_v10005820mg [Eutrema salsugineum]
Length=674

 Score =   320 bits (821),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  468  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  527

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  528  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  587

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+K+WHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++
Sbjct  588  TLWKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIDKKDIENAAVVHYNGNMKPWLEL  647

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  648  AMSKYRPYWTKYIKFDHPYLRRCNL  672



>ref|XP_007051985.1| Galacturonosyltransferase 1 [Theobroma cacao]
 gb|EOX96142.1| Galacturonosyltransferase 1 [Theobroma cacao]
Length=676

 Score =   320 bits (821),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC
Sbjct  470  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWSVDLHGKVNGAVETC  529

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  530  GESFHRFDKYLNFSNPHISRNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEDR  589

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPS+   EI+ AAV+H+NGNMKPWL++
Sbjct  590  VLWKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVDRREIDRAAVIHYNGNMKPWLEL  649

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP W KY+ Y++ Y+++CN  
Sbjct  650  AMTKYRPYWAKYIKYDHPYLRSCNLS  675



>ref|XP_002511763.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF50432.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=710

 Score =   321 bits (823),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDIVVQ+DLTGLW ++++GKVNGAVETC
Sbjct  504  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIVVQKDLTGLWSVNLNGKVNGAVETC  563

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NF++P I R FNP  C WAYGMN FDLD W+K+  T  YH WQ +NE+R
Sbjct  564  GESFHRFDKYLNFTNPHIARNFNPNDCGWAYGMNIFDLDEWKKQDITGIYHKWQNMNEDR  623

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y  T PL KSWHVLGLGYNPSI   EI NAAVVH+NGNMKPWL+I
Sbjct  624  VLWKLGTLPPGLITFYKLTHPLQKSWHVLGLGYNPSIDRKEIENAAVVHYNGNMKPWLEI  683

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++R  WTKY+ Y++ Y++ CN  
Sbjct  684  AMTKYRSYWTKYIKYDHPYLRNCNLS  709



>ref|XP_006290325.1| hypothetical protein CARUB_v10016785mg [Capsella rubella]
 gb|EOA23223.1| hypothetical protein CARUB_v10016785mg [Capsella rubella]
Length=673

 Score =   320 bits (820),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 139/205 (68%), Positives = 173/205 (84%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  467  KYRNPKYLSMLNHLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  526

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  527  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNMNENR  586

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+K WHVLGLGYNPSI   +I NAAVVH+NGNMKPWL++
Sbjct  587  TLWKLGTLPPGLITFYGLTHPLNKGWHVLGLGYNPSIDKKDIENAAVVHYNGNMKPWLEL  646

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  647  AMSKYRPYWTKYIKFDHPYLRRCNL  671



>ref|XP_011002080.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Populus euphratica]
Length=686

 Score =   320 bits (821),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLT LW +D+ GKVNGAVETC
Sbjct  480  KYRNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTKLWSVDLHGKVNGAVETC  539

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  540  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKVWKKKDITGIYHKWQNMNEDR  599

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y+ T PL+K+WHVLGLGYNPSI   EI +AAVVH+NGNMKPWL++
Sbjct  600  ELWKLGTLPPGLITFYNLTNPLEKTWHVLGLGYNPSIDRSEIESAAVVHYNGNMKPWLEL  659

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ Y++ Y+++CN  
Sbjct  660  AMTKYRPYWTKYIKYDHPYLRSCNLS  685



>ref|XP_011002081.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Populus euphratica]
Length=683

 Score =   320 bits (821),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLT LW +D+ GKVNGAVETC
Sbjct  477  KYRNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTKLWSVDLHGKVNGAVETC  536

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  537  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKVWKKKDITGIYHKWQNMNEDR  596

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y+ T PL+K+WHVLGLGYNPSI   EI +AAVVH+NGNMKPWL++
Sbjct  597  ELWKLGTLPPGLITFYNLTNPLEKTWHVLGLGYNPSIDRSEIESAAVVHYNGNMKPWLEL  656

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ Y++ Y+++CN  
Sbjct  657  AMTKYRPYWTKYIKYDHPYLRSCNLS  682



>gb|KJB41168.1| hypothetical protein B456_007G093500 [Gossypium raimondii]
Length=676

 Score =   320 bits (820),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC
Sbjct  470  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWSVDLHGKVNGAVETC  529

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+  I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  530  GQSFHRFDKYLNFSNHHISRNFDPNACGWAYGMNMFDLRVWKKKDITGIYHKWQNMNEDR  589

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPS+   EI +AAV+H+NGNMKPWLD+
Sbjct  590  ALWKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVHKKEIEHAAVIHYNGNMKPWLDL  649

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKYV Y++ Y+++CN  
Sbjct  650  AMTKYRPYWTKYVKYDHYYLRSCNLS  675



>ref|XP_004153994.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Cucumis sativus]
 gb|KGN46221.1| hypothetical protein Csa_6G075210 [Cucumis sativus]
Length=679

 Score =   320 bits (820),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC
Sbjct  473  KYRNPKYLSMLNHLRFYLPQVYPKLEKILFLDDDIVVQKDLTGLWDVDLHGKVNGAVETC  532

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I RKF+P AC WAYGMN FDL  W+K   T  YH WQ LNE R
Sbjct  533  GESFHRFDKYLNFSNPHIARKFDPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNLNEER  592

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI   EI+NAAV+H+NGNMKPWL++
Sbjct  593  LLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIDKSEIDNAAVIHYNGNMKPWLEL  652

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A+ ++R  WTKY+ Y + Y++ C  
Sbjct  653  AMTKYRGYWTKYIKYNHPYLRQCKL  677



>ref|XP_010910637.1| PREDICTED: probable galacturonosyltransferase 4 isoform X3 [Elaeis 
guineensis]
Length=549

 Score =   316 bits (810),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 171/207 (83%), Gaps = 0/207 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPEM+PKL++++FLDDDIVVQ+DLTGLW I++ GKVNGAVETC
Sbjct  343  KFRNPKYLSILNHLRFYLPEMFPKLNKVVFLDDDIVVQKDLTGLWTINLKGKVNGAVETC  402

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+PLI + F+P AC WAYGMN FDL  WRK+  TE YH WQ LN +R
Sbjct  403  RESFHRFDRYLNFSNPLIAKNFDPHACGWAYGMNVFDLAEWRKQNITELYHSWQKLNHDR  462

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+++ T PLD+SWHVLGLGYNP +   EI  AAV+H+NGNMKPWL+I
Sbjct  463  LLWKLGTLPPGLITFWNRTFPLDRSWHVLGLGYNPHVVQKEIEQAAVIHYNGNMKPWLEI  522

Query  419  AIAQFRPLWTKYVDYENEYIQACNFGL  339
             + ++R  W+KY++Y+  ++Q CN  L
Sbjct  523  GMPKYRNHWSKYINYDQVFLQDCNINL  549



>ref|XP_008670346.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Zea mays]
 tpg|DAA40616.1| TPA: hypothetical protein ZEAMMB73_629807 [Zea mays]
Length=684

 Score =   320 bits (819),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPK+ +ILFLDDDIVVQ+DLTGLW ++++GKVNGAVETC
Sbjct  478  KYRNPKYLSMLNHLRFYLPEVYPKVDKILFLDDDIVVQKDLTGLWDVNLNGKVNGAVETC  537

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE R
Sbjct  538  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEGR  597

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPS+   EI++AAVVH+NGNMKPWL++
Sbjct  598  VLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSVDRSEIDSAAVVHYNGNMKPWLEL  657

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A+ ++RP WT+Y+ Y++ YI+ CN 
Sbjct  658  AMTKYRPYWTRYIKYDHPYIRGCNL  682



>ref|XP_008232829.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
isoform X2 [Prunus mume]
Length=674

 Score =   319 bits (818),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC
Sbjct  468  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWAVDLHGKVNGAVETC  527

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  528  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKKDITGIYHKWQNMNEDR  587

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL KSWHVLGLGYNPS+   EI+NAAVVH+NGNMKPWL++
Sbjct  588  TLWKLGTLPPGLITFYGLTHPLHKSWHVLGLGYNPSLDRSEIDNAAVVHYNGNMKPWLEL  647

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++R  WTKY+ Y++ YI++C   
Sbjct  648  AMTKYRGYWTKYIKYDHPYIRSCKIS  673



>ref|XP_008232828.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
isoform X1 [Prunus mume]
Length=675

 Score =   319 bits (818),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC
Sbjct  469  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWAVDLHGKVNGAVETC  528

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  529  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKKDITGIYHKWQNMNEDR  588

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL KSWHVLGLGYNPS+   EI+NAAVVH+NGNMKPWL++
Sbjct  589  TLWKLGTLPPGLITFYGLTHPLHKSWHVLGLGYNPSLDRSEIDNAAVVHYNGNMKPWLEL  648

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++R  WTKY+ Y++ YI++C   
Sbjct  649  AMTKYRGYWTKYIKYDHPYIRSCKIS  674



>ref|XP_012083520.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Jatropha curcas]
 ref|XP_012083521.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Jatropha curcas]
 ref|XP_012083522.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Jatropha curcas]
 ref|XP_012083523.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Jatropha curcas]
 ref|XP_012083524.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Jatropha curcas]
 gb|KDP28715.1| hypothetical protein JCGZ_14486 [Jatropha curcas]
Length=686

 Score =   320 bits (819),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 170/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +++ GKVNGAVETC
Sbjct  480  KYRNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWSVNLGGKVNGAVETC  539

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NF++P I R F+P AC WAYGMN FDL  W+K   T  YH WQ +NE+R
Sbjct  540  GESFHRFDKYLNFTNPHIARNFDPNACGWAYGMNIFDLKEWKKRDITGIYHKWQKMNEDR  599

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPS+   EI+NAAV+H+NGNMKPWL+I
Sbjct  600  VLWKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVDRSEIDNAAVIHYNGNMKPWLEI  659

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++R  WTKY+ Y++ Y+ +CN  
Sbjct  660  AMTKYRTYWTKYIKYDHPYLHSCNLS  685



>ref|XP_011469111.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Fragaria vesca subsp. vesca]
 ref|XP_011469112.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase 
[Fragaria vesca subsp. vesca]
Length=671

 Score =   319 bits (818),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL++ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC
Sbjct  465  KYRNPKYLSMLNHLRFYLPQVYPKLNKILFLDDDIVVQKDLTGLWAVDLHGKVNGAVETC  524

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE R
Sbjct  525  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKKDITGIYHKWQNMNEER  584

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL KSWHVLGLGYNPS+  +EI NAAVVH+NGNMKPWL++
Sbjct  585  TLWKLGTLPPGLITFYGLTHPLQKSWHVLGLGYNPSLDRNEIENAAVVHYNGNMKPWLEL  644

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++R  WTKY+ Y++ Y+++C   
Sbjct  645  AMTKYRAYWTKYIKYDHPYLRSCKLS  670



>dbj|BAJ53137.1| JHL05D22.8 [Jatropha curcas]
Length=693

 Score =   320 bits (819),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 170/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLTGLW +++ GKVNGAVETC
Sbjct  487  KYRNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTGLWSVNLGGKVNGAVETC  546

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NF++P I R F+P AC WAYGMN FDL  W+K   T  YH WQ +NE+R
Sbjct  547  GESFHRFDKYLNFTNPHIARNFDPNACGWAYGMNIFDLKEWKKRDITGIYHKWQKMNEDR  606

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y  T PL+KSWHVLGLGYNPS+   EI+NAAV+H+NGNMKPWL+I
Sbjct  607  VLWKLGTLPPGLITFYGLTHPLEKSWHVLGLGYNPSVDRSEIDNAAVIHYNGNMKPWLEI  666

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++R  WTKY+ Y++ Y+ +CN  
Sbjct  667  AMTKYRTYWTKYIKYDHPYLHSCNLS  692



>ref|XP_010647084.1| PREDICTED: probable galacturonosyltransferase 4 [Vitis vinifera]
Length=638

 Score =   318 bits (815),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPE++PKL+++LFLDDDIVVQ+DLTGLW ID+ G VNGAVETC
Sbjct  432  KFRNPKYLSILNHLRFYLPEIFPKLNKVLFLDDDIVVQKDLTGLWSIDLKGNVNGAVETC  491

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+PLI + F+  AC WAYGMN FDLD W+K+  TE YH WQ LN +R
Sbjct  492  GESFHRFDRYLNFSNPLISKNFDSHACGWAYGMNIFDLDQWKKQHITEVYHTWQKLNHDR  551

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT++  T P+D+SWHVLGLGYNPS++  EI  AAV+H+NGN+KPWL+I
Sbjct  552  QLWKLGTLPPGLITFWKRTLPIDRSWHVLGLGYNPSVNRREIERAAVIHYNGNLKPWLEI  611

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
             + +FR  W K+ D++NEY++ CN 
Sbjct  612  GMPKFRNYWAKFADFDNEYLRDCNI  636



>gb|KJB67441.1| hypothetical protein B456_010G190800 [Gossypium raimondii]
Length=395

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/205 (67%), Positives = 169/205 (82%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPE++PKL+++LFLDDDIVVQ+DLTGLW +D+ G VNGAVETC
Sbjct  189  KFRNPKYLSILNHLRFYLPEIFPKLNKVLFLDDDIVVQKDLTGLWSLDLKGNVNGAVETC  248

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+PLI + F+P AC WAYGMN FDL  WR++  TE YH WQ LN +R
Sbjct  249  GESFHRFDRYLNFSNPLISKNFDPHACGWAYGMNIFDLAEWRRQSITEVYHRWQRLNRDR  308

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT++  T  LDKSWHVLGLGYNP+++  EI+ AAV+H+NGN+KPWL+I
Sbjct  309  QLWKLGTLPPGLITFWKRTYSLDKSWHVLGLGYNPNVNQREIDRAAVIHYNGNLKPWLEI  368

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
             I +++  W KYVDYE  Y++ CN 
Sbjct  369  GIPKYKIYWAKYVDYETVYLRECNI  393



>ref|XP_006398488.1| hypothetical protein EUTSA_v10000819mg [Eutrema salsugineum]
 gb|ESQ39941.1| hypothetical protein EUTSA_v10000819mg [Eutrema salsugineum]
Length=631

 Score =   318 bits (814),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPE++PKL+++LFLDDDIVVQ+DL+GLW +D+ G VNGAVETC
Sbjct  425  KFRNPKYLSILNHLRFYLPEIFPKLNKVLFLDDDIVVQKDLSGLWSVDLKGNVNGAVETC  484

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+PLI + F+P+AC WAYGMN FDLD W+K+  TE YH WQ LNE R
Sbjct  485  GESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNIFDLDEWKKQNITEVYHRWQTLNEGR  544

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT++  T PLD+ WH+LGLGYNPS++  +I   AV+H+NGN+KPWL+I
Sbjct  545  ELWKLGTLPPGLITFWRRTYPLDRKWHILGLGYNPSVNQRDIERGAVIHYNGNLKPWLEI  604

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
             I ++R  W K+VDYE+ Y++ CN 
Sbjct  605  GIPRYRGFWAKHVDYEHVYLRECNI  629



>ref|XP_008460145.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Cucumis melo]
Length=679

 Score =   319 bits (818),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 167/205 (81%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC
Sbjct  473  KYRNPKYLSMLNHLRFYLPQVYPKLEKILFLDDDIVVQKDLTGLWDVDLHGKVNGAVETC  532

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I RKF+P AC WAYGMN FDL  W+K   T  YH WQ LNE R
Sbjct  533  GESFHRFDKYLNFSNPHIARKFDPNACGWAYGMNMFDLKEWKKRDITGIYHKWQNLNEER  592

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT+Y  T PLDKSWHVLGLGYNPSI   EI NAAV+H+NGNMKPWL++
Sbjct  593  LLWKLGTLPPGLITFYGLTHPLDKSWHVLGLGYNPSIDKSEIENAAVIHYNGNMKPWLEL  652

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A+ ++R  WTKY+ Y + Y++ C  
Sbjct  653  AMTKYRGYWTKYIKYNHPYLRQCKL  677



>ref|XP_010934420.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Elaeis guineensis]
Length=716

 Score =   320 bits (820),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 168/206 (82%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ G VNGAVETC
Sbjct  510  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWSVDLKGNVNGAVETC  569

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  570  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKQWKKKDITGIYHKWQNMNEDR  629

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PL KSWHVLGLGYNP I   EI NAAVVH+NGNMKPWL++
Sbjct  630  VLWKLGTLPPGLLTFYKLTYPLGKSWHVLGLGYNPGIDRSEIENAAVVHYNGNMKPWLEL  689

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ Y++ Y++ CN  
Sbjct  690  AMTKYRPYWTKYIKYDDRYVRGCNVS  715



>ref|XP_007220901.1| hypothetical protein PRUPE_ppa002418mg [Prunus persica]
 gb|EMJ22100.1| hypothetical protein PRUPE_ppa002418mg [Prunus persica]
Length=674

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/206 (67%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLP++YPKL +ILFLDDDIVVQ+DLTGLW +D+ GKVNGAVETC
Sbjct  468  KYRNPKYLSMLNHLRFYLPQVYPKLDKILFLDDDIVVQKDLTGLWAVDLHGKVNGAVETC  527

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  528  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNMFDLKEWKKKDITGIYHKWQNMNEDR  587

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL KSWHVLGLGYNPS+   E++NAAVVH+NGNMKPWL++
Sbjct  588  TLWKLGTLPPGLITFYGLTHPLQKSWHVLGLGYNPSLDRSELDNAAVVHYNGNMKPWLEL  647

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++R  WTKY+ Y++ YI++C   
Sbjct  648  AMTKYRGYWTKYIKYDHPYIRSCKLS  673



>ref|XP_009418721.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=656

 Score =   318 bits (816),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/206 (67%), Positives = 168/206 (82%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPKL +ILFLDDDIVVQ+DLT LW +D+ G VNGAVETC
Sbjct  450  KYRNPKYLSMLNHLRFYLPEVYPKLDKILFLDDDIVVQKDLTALWSVDLKGNVNGAVETC  509

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P +C WAYGMN FDL  W+K+  T  YH WQ +NE+R
Sbjct  510  GESFHRFDKYLNFSNPHIARNFDPNSCGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEDR  569

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPSI   EI NAAVVH+NGNMKPWL++
Sbjct  570  VLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSIDHSEIQNAAVVHYNGNMKPWLEL  629

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
            A+ ++RP WTKY+ Y++ Y++ C   
Sbjct  630  AMTKYRPYWTKYIKYDHPYVRGCKLS  655



>ref|XP_008670345.1| PREDICTED: polygalacturonate 4-alpha-galacturonosyltransferase-like 
isoform X1 [Zea mays]
Length=693

 Score =   319 bits (818),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 172/205 (84%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LNHLRFYLPE+YPK+ +ILFLDDDIVVQ+DLTGLW ++++GKVNGAVETC
Sbjct  487  KYRNPKYLSMLNHLRFYLPEVYPKVDKILFLDDDIVVQKDLTGLWDVNLNGKVNGAVETC  546

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R F+P AC WAYGMN FDL  W+K+  T  YH WQ +NE R
Sbjct  547  GESFHRFDKYLNFSNPHIARNFDPNACGWAYGMNIFDLKEWKKKDITGIYHKWQNMNEGR  606

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGL+T+Y  T PLDKSWHVLGLGYNPS+   EI++AAVVH+NGNMKPWL++
Sbjct  607  VLWKLGTLPPGLLTFYKLTHPLDKSWHVLGLGYNPSVDRSEIDSAAVVHYNGNMKPWLEL  666

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A+ ++RP WT+Y+ Y++ YI+ CN 
Sbjct  667  AMTKYRPYWTRYIKYDHPYIRGCNL  691



>ref|XP_002882844.1| hypothetical protein ARALYDRAFT_478777 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59103.1| hypothetical protein ARALYDRAFT_478777 [Arabidopsis lyrata subsp. 
lyrata]
Length=601

 Score =   317 bits (811),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 170/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPE++PKL ++LFLDDDIVVQ+DL+GLW +D+ G VNGAVETC
Sbjct  395  KFRNPKYLSILNHLRFYLPEIFPKLSKVLFLDDDIVVQKDLSGLWSVDLKGNVNGAVETC  454

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+PLI + F+P+AC WAYGMN FDLD W+++  TE YH WQ LN +R
Sbjct  455  GESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITEVYHRWQDLNRDR  514

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT++  T PLD+ WH+LGLGYNPS++  +I  AAV+H+NGN+KPWL+I
Sbjct  515  ELWKLGTLPPGLITFWRRTYPLDRKWHILGLGYNPSVNQRDIERAAVIHYNGNLKPWLEI  574

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             I ++R  W+K+VDYE  Y++ CN  
Sbjct  575  GIPRYRSFWSKHVDYEQVYLRECNIN  600



>ref|XP_009138790.1| PREDICTED: LOW QUALITY PROTEIN: polygalacturonate 4-alpha-galacturonosyltransferase-like 
[Brassica rapa]
Length=674

 Score =   319 bits (817),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            K+RNPKYLS+LN LRFYLPE+YPKL++ILFLDDDI+VQ+DLT LW+++++GKVNGAVETC
Sbjct  468  KYRNPKYLSMLNRLRFYLPEVYPKLNKILFLDDDIIVQKDLTPLWEVNLNGKVNGAVETC  527

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+P I R FNP AC WAYGMN FDL  W+K   T  YH WQ +NENR
Sbjct  528  GESFHRFDKYLNFSNPHIARNFNPNACGWAYGMNMFDLXEWKKRDITGIYHKWQNMNENR  587

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            TLWKLGTLPPGLIT+Y  T PL+K+WHVLGLGYNPSI+  +I NAAVVH+NGNMKPWL++
Sbjct  588  TLWKLGTLPPGLITFYGLTHPLNKAWHVLGLGYNPSIAKKDIENAAVVHYNGNMKPWLEL  647

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
            A++++RP WTKY+ +++ Y++ CN 
Sbjct  648  AMSKYRPYWTKYIQFDHPYLRRCNL  672



>dbj|BAB11325.1| unnamed protein product [Arabidopsis thaliana]
Length=615

 Score =   317 bits (812),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 172/206 (83%), Gaps = 0/206 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPE++PKL ++LFLDDDIVVQ+DL+GLW +D+ G VNGAVETC
Sbjct  409  KFRNPKYLSILNHLRFYLPEIFPKLSKVLFLDDDIVVQKDLSGLWSVDLKGNVNGAVETC  468

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+PLI + F+P+AC WAYGMN FDLD W+++  TE YH WQ LN++R
Sbjct  469  GESFHRFDRYLNFSNPLISKNFDPRACGWAYGMNVFDLDEWKRQNITEVYHRWQDLNQDR  528

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
             LWKLGTLPPGLIT++  T PLD+ WH+LGLGYNPS++  +I  AAV+H+NGN+KPWL+I
Sbjct  529  ELWKLGTLPPGLITFWRRTYPLDRKWHILGLGYNPSVNQRDIERAAVIHYNGNLKPWLEI  588

Query  419  AIAQFRPLWTKYVDYENEYIQACNFG  342
             I ++R  W+K+VDYE+ Y++ CN  
Sbjct  589  GIPRYRGFWSKHVDYEHVYLRECNIN  614



>ref|XP_010538434.1| PREDICTED: probable galacturonosyltransferase 4 [Tarenaya hassleriana]
Length=649

 Score =   318 bits (815),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 136/205 (66%), Positives = 174/205 (85%), Gaps = 0/205 (0%)
 Frame = -2

Query  959  KFRNPKYLSILNHLRFYLPEMYPKLHRILFLDDDIVVQRDLTGLWKIDMDGKVNGAVETC  780
            KFRNPKYLSILNHLRFYLPE++PKL+++LFLDDDIVVQ+DL+GL+ +D+ G VNGAVETC
Sbjct  443  KFRNPKYLSILNHLRFYLPEIFPKLNKVLFLDDDIVVQKDLSGLFSLDLKGNVNGAVETC  502

Query  779  FGSFHRYAQYMNFSHPLIRRKFNPKACAWAYGMNFFDLDAWRKEKCTEEYHYWQALNENR  600
              SFHR+ +Y+NFS+PLI   F+P AC WAYGMN FDLD W+++  TE YH WQ LN++R
Sbjct  503  GQSFHRFDRYLNFSNPLIAENFDPHACGWAYGMNIFDLDEWKRQNITEVYHRWQNLNQDR  562

Query  599  TLWKLGTLPPGLITYYSTTKPLDKSWHVLGLGYNPSISTDEINNAAVVHFNGNMKPWLDI  420
            +LWKLGTLPPGLIT++  T PLD++WHVLGLGYNPS++  +I  AAV+H+NGN+KPWL+I
Sbjct  563  SLWKLGTLPPGLITFWKRTHPLDRNWHVLGLGYNPSVNPRDIGRAAVIHYNGNLKPWLEI  622

Query  419  AIAQFRPLWTKYVDYENEYIQACNF  345
             I ++R  W+KYVDYE+EY++ CN 
Sbjct  623  GITRYRGYWSKYVDYEHEYMRECNI  647



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2336926777002