BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9781

Length=1116
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CBI40077.3|  unnamed protein product                                204   3e-55   Vitis vinifera
ref|XP_010660803.1|  PREDICTED: transcription factor GTE8 isoform X2    203   5e-55   Vitis vinifera
ref|XP_010660801.1|  PREDICTED: transcription factor GTE8 isoform X1    203   5e-55   Vitis vinifera
ref|XP_006338672.1|  PREDICTED: transcription factor GTE8-like is...    202   1e-54   Solanum tuberosum [potatoes]
gb|KJB11627.1|  hypothetical protein B456_001G268800                    200   4e-54   Gossypium raimondii
gb|KJB11631.1|  hypothetical protein B456_001G268800                    200   4e-54   Gossypium raimondii
ref|XP_007031764.1|  Bromodomain-containing protein, putative iso...    198   2e-53   
gb|KHG23350.1|  Transcription factor GTE9 -like protein                 198   2e-53   Gossypium arboreum [tree cotton]
ref|XP_008341341.1|  PREDICTED: transcription factor GTE8-like          197   4e-53   
gb|KDO55686.1|  hypothetical protein CISIN_1g004592mg                   197   6e-53   Citrus sinensis [apfelsine]
ref|XP_006447148.1|  hypothetical protein CICLE_v10014390mg             197   8e-53   Citrus clementina [clementine]
ref|XP_007031761.1|  Bromodomain-containing protein, putative iso...    197   8e-53   
ref|XP_009370288.1|  PREDICTED: transcription factor GTE8-like is...    196   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_009370286.1|  PREDICTED: transcription factor GTE8-like is...    196   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_009371694.1|  PREDICTED: transcription factor GTE8-like is...    194   6e-52   Pyrus x bretschneideri [bai li]
ref|XP_009371695.1|  PREDICTED: transcription factor GTE8-like is...    194   7e-52   Pyrus x bretschneideri [bai li]
ref|XP_003548539.1|  PREDICTED: transcription factor GTE8-like is...    194   1e-51   Glycine max [soybeans]
ref|XP_012071037.1|  PREDICTED: transcription factor GTE8-like          192   4e-51   Jatropha curcas
emb|CDP16664.1|  unnamed protein product                                192   4e-51   Coffea canephora [robusta coffee]
ref|XP_004231798.1|  PREDICTED: transcription factor GTE8-like          191   8e-51   Solanum lycopersicum
ref|XP_003555161.2|  PREDICTED: transcription factor GTE8-like is...    191   1e-50   Glycine max [soybeans]
ref|XP_010033385.1|  PREDICTED: transcription factor GTE8-like          190   2e-50   Eucalyptus grandis [rose gum]
ref|XP_007140890.1|  hypothetical protein PHAVU_008G150100g             189   6e-50   Phaseolus vulgaris [French bean]
ref|XP_008231170.1|  PREDICTED: transcription factor GTE8               188   1e-49   Prunus mume [ume]
ref|XP_010248882.1|  PREDICTED: transcription factor GTE10-like         188   1e-49   
ref|XP_006604121.1|  PREDICTED: transcription factor GTE8-like is...    188   1e-49   Glycine max [soybeans]
ref|XP_002509565.1|  bromodomain-containing protein, putative           187   2e-49   
gb|KJB33937.1|  hypothetical protein B456_006G039400                    186   4e-49   Gossypium raimondii
ref|XP_007215507.1|  hypothetical protein PRUPE_ppa003659mg             185   4e-49   
ref|XP_011098835.1|  PREDICTED: transcription factor GTE8               186   5e-49   Sesamum indicum [beniseed]
gb|KHG21057.1|  Transcription factor GTE8 -like protein                 185   2e-48   Gossypium arboreum [tree cotton]
ref|XP_008379142.1|  PREDICTED: transcription factor GTE8-like is...    184   2e-48   
ref|XP_008379143.1|  PREDICTED: transcription factor GTE8-like is...    184   3e-48   
ref|XP_009627906.1|  PREDICTED: transcription factor GTE8-like          181   3e-47   Nicotiana tomentosiformis
ref|XP_006376891.1|  hypothetical protein POPTR_0012s09590g             171   6e-47   
ref|XP_004514963.1|  PREDICTED: transcription factor GTE8-like          179   1e-46   Cicer arietinum [garbanzo]
ref|XP_006599055.1|  PREDICTED: transcription factor GTE8-like is...    179   2e-46   Glycine max [soybeans]
ref|XP_004516282.1|  PREDICTED: transcription factor GTE8-like is...    177   6e-46   Cicer arietinum [garbanzo]
ref|XP_004516284.1|  PREDICTED: transcription factor GTE8-like is...    177   7e-46   Cicer arietinum [garbanzo]
ref|XP_009802944.1|  PREDICTED: transcription factor GTE8-like          177   7e-46   Nicotiana sylvestris
ref|XP_006599052.1|  PREDICTED: transcription factor GTE8-like is...    177   1e-45   Glycine max [soybeans]
ref|XP_006599054.1|  PREDICTED: transcription factor GTE8-like is...    177   1e-45   Glycine max [soybeans]
ref|XP_010528182.1|  PREDICTED: transcription factor GTE8               173   1e-44   
ref|XP_008792223.1|  PREDICTED: transcription factor GTE8-like          164   2e-43   Phoenix dactylifera
ref|XP_006374557.1|  hypothetical protein POPTR_0015s10370g             161   5e-43   
emb|CDY20057.1|  BnaA09g01940D                                          168   6e-43   Brassica napus [oilseed rape]
ref|XP_011040406.1|  PREDICTED: transcription factor GTE10-like         169   7e-43   Populus euphratica
ref|XP_009111562.1|  PREDICTED: transcription factor GTE8-like          166   3e-42   Brassica rapa
ref|XP_010250832.1|  PREDICTED: transcription factor GTE9               167   4e-42   
ref|XP_008450071.1|  PREDICTED: transcription factor GTE8 isoform X2    165   1e-41   Cucumis melo [Oriental melon]
ref|XP_008450066.1|  PREDICTED: transcription factor GTE8 isoform X1    165   1e-41   
ref|XP_011045187.1|  PREDICTED: transcription factor GTE8-like          165   1e-41   Populus euphratica
ref|XP_008450073.1|  PREDICTED: transcription factor GTE8 isoform X4    165   1e-41   
ref|XP_008450072.1|  PREDICTED: transcription factor GTE8 isoform X3    165   1e-41   Cucumis melo [Oriental melon]
ref|XP_006395464.1|  hypothetical protein EUTSA_v10003722mg             165   1e-41   Eutrema salsugineum [saltwater cress]
ref|XP_004145677.1|  PREDICTED: transcription factor GTE8 isoform X1    165   1e-41   Cucumis sativus [cucumbers]
ref|XP_011651572.1|  PREDICTED: transcription factor GTE8 isoform X2    165   2e-41   Cucumis sativus [cucumbers]
ref|XP_004304004.1|  PREDICTED: transcription factor GTE9               164   2e-41   Fragaria vesca subsp. vesca
ref|XP_002300086.2|  hypothetical protein POPTR_0001s36360g             163   3e-41   
ref|XP_008799966.1|  PREDICTED: transcription factor GTE9-like is...    161   2e-40   Phoenix dactylifera
ref|XP_011024071.1|  PREDICTED: transcription factor GTE8 isoform X3    162   2e-40   Populus euphratica
ref|XP_011024069.1|  PREDICTED: transcription factor GTE10 isofor...    161   4e-40   Populus euphratica
ref|XP_011024068.1|  PREDICTED: transcription factor GTE10 isofor...    161   5e-40   Populus euphratica
ref|XP_007037911.1|  Nuclear protein X1 isoform 2                       160   7e-40   
ref|XP_007037910.1|  Nuclear protein X1 isoform 1                       160   8e-40   
ref|XP_006440056.1|  hypothetical protein CICLE_v10018939mg             160   1e-39   Citrus clementina [clementine]
ref|XP_006476989.1|  PREDICTED: transcription factor GTE10-like         159   2e-39   Citrus sinensis [apfelsine]
gb|KDO69314.1|  hypothetical protein CISIN_1g004033mg                   159   2e-39   Citrus sinensis [apfelsine]
gb|KDO69315.1|  hypothetical protein CISIN_1g004033mg                   159   2e-39   Citrus sinensis [apfelsine]
ref|XP_002875368.1|  hypothetical protein ARALYDRAFT_484508             159   3e-39   
ref|XP_010425469.1|  PREDICTED: transcription factor GTE8               158   5e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010514420.1|  PREDICTED: transcription factor GTE8-like          157   9e-39   Camelina sativa [gold-of-pleasure]
ref|XP_002511228.1|  bromodomain-containing protein, putative           156   3e-38   
ref|XP_010502690.1|  PREDICTED: transcription factor GTE8-like is...    156   3e-38   
gb|KEH17395.1|  global transcription factor group protein               155   5e-38   Medicago truncatula
ref|NP_001189985.1|  global transcription factor group E8               155   6e-38   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189362.1|  global transcription factor group E8                  155   7e-38   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02121.1|  unnamed protein product                                155   9e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799968.1|  PREDICTED: transcription factor GTE9-like is...    154   1e-37   
ref|XP_010930070.1|  PREDICTED: transcription factor GTE9-like is...    151   8e-37   
ref|XP_010930064.1|  PREDICTED: transcription factor GTE9-like is...    151   8e-37   
ref|XP_010105169.1|  Transcription factor GTE10                         151   1e-36   Morus notabilis
emb|CBI15622.3|  unnamed protein product                                149   3e-36   Vitis vinifera
ref|XP_010663721.1|  PREDICTED: transcription factor GTE10              150   3e-36   Vitis vinifera
ref|XP_006290601.1|  hypothetical protein CARUB_v10016691mg             149   7e-36   Capsella rubella
ref|XP_010927644.1|  PREDICTED: transcription factor GTE9-like          146   4e-35   Elaeis guineensis
ref|XP_006845132.1|  PREDICTED: transcription factor GTE9               147   6e-35   Amborella trichopoda
ref|XP_004138062.1|  PREDICTED: transcription factor GTE10 isofor...    145   1e-34   Cucumis sativus [cucumbers]
ref|XP_011652479.1|  PREDICTED: transcription factor GTE10 isofor...    145   1e-34   Cucumis sativus [cucumbers]
ref|XP_011652554.1|  PREDICTED: transcription factor GTE10 isofor...    145   1e-34   Cucumis sativus [cucumbers]
ref|XP_011652591.1|  PREDICTED: transcription factor GTE10 isofor...    145   1e-34   Cucumis sativus [cucumbers]
ref|XP_002871611.1|  ATBET9                                             144   2e-34   
ref|XP_007037913.1|  Bromodomain-containing protein, putative iso...    145   2e-34   
ref|XP_008464458.1|  PREDICTED: transcription factor GTE10 isofor...    144   3e-34   Cucumis melo [Oriental melon]
ref|XP_008464456.1|  PREDICTED: transcription factor GTE10 isofor...    144   3e-34   Cucumis melo [Oriental melon]
ref|XP_008464457.1|  PREDICTED: transcription factor GTE10 isofor...    144   3e-34   Cucumis melo [Oriental melon]
ref|XP_006289128.1|  hypothetical protein CARUB_v10002549mg             143   5e-34   
ref|XP_008392845.1|  PREDICTED: transcription factor GTE10              144   7e-34   
ref|XP_010932309.1|  PREDICTED: transcription factor GTE9-like          139   1e-32   Elaeis guineensis
ref|XP_004500665.1|  PREDICTED: transcription factor GTE10-like i...    139   1e-32   
ref|XP_010319067.1|  PREDICTED: transcription factor GTE10              139   3e-32   Solanum lycopersicum
ref|XP_009359473.1|  PREDICTED: transcription factor GTE10-like         139   3e-32   
ref|XP_009609469.1|  PREDICTED: transcription factor GTE10-like i...    138   4e-32   Nicotiana tomentosiformis
ref|XP_009609471.1|  PREDICTED: transcription factor GTE10-like i...    138   5e-32   Nicotiana tomentosiformis
ref|XP_009609473.1|  PREDICTED: transcription factor GTE10-like i...    138   5e-32   Nicotiana tomentosiformis
ref|XP_009609468.1|  PREDICTED: transcription factor GTE10-like i...    138   5e-32   Nicotiana tomentosiformis
ref|XP_009609470.1|  PREDICTED: transcription factor GTE10-like i...    138   5e-32   Nicotiana tomentosiformis
ref|XP_009609466.1|  PREDICTED: transcription factor GTE10-like i...    138   5e-32   
ref|XP_009609472.1|  PREDICTED: transcription factor GTE10-like i...    138   5e-32   Nicotiana tomentosiformis
ref|NP_568297.1|  bromodomain and extraterminal domain protein 9        137   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190308.1|  bromodomain and extraterminal domain protein 9     137   6e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006581882.1|  PREDICTED: transcription factor GTE10-like i...    137   7e-32   
gb|KHN23270.1|  Transcription factor GTE10                              137   7e-32   Glycine soja [wild soybean]
ref|XP_006581880.1|  PREDICTED: transcription factor GTE10-like i...    137   8e-32   
gb|KHN34396.1|  Transcription factor GTE10                              137   1e-31   Glycine soja [wild soybean]
ref|XP_010677929.1|  PREDICTED: transcription factor GTE10-like i...    137   1e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010677932.1|  PREDICTED: transcription factor GTE10-like i...    136   1e-31   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB38771.1|  hypothetical protein B456_006G271100                    135   1e-31   Gossypium raimondii
ref|XP_008374310.1|  PREDICTED: transcription factor GTE10-like         137   2e-31   
ref|XP_003525531.2|  PREDICTED: transcription factor GTE10-like         136   2e-31   
ref|XP_010492232.1|  PREDICTED: transcription factor GTE9-like is...    135   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010492231.1|  PREDICTED: transcription factor GTE9-like is...    135   2e-31   Camelina sativa [gold-of-pleasure]
emb|CDP15018.1|  unnamed protein product                                129   2e-31   Coffea canephora [robusta coffee]
ref|XP_010453546.1|  PREDICTED: transcription factor GTE9 isoform X1    135   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010453548.1|  PREDICTED: transcription factor GTE9 isoform X2    135   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010420059.1|  PREDICTED: transcription factor GTE9 isoform X2    135   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010420058.1|  PREDICTED: transcription factor GTE9 isoform X1    135   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006578695.1|  PREDICTED: transcription factor GTE10-like         135   6e-31   Glycine max [soybeans]
ref|XP_009616063.1|  PREDICTED: transcription factor GTE10-like i...    134   7e-31   Nicotiana tomentosiformis
ref|XP_009616061.1|  PREDICTED: transcription factor GTE10-like i...    134   8e-31   Nicotiana tomentosiformis
ref|XP_009616062.1|  PREDICTED: transcription factor GTE10-like i...    134   8e-31   Nicotiana tomentosiformis
gb|KHN31912.1|  Transcription factor GTE10                              134   9e-31   Glycine soja [wild soybean]
ref|XP_006351489.1|  PREDICTED: transcription factor GTE10-like         134   1e-30   Solanum tuberosum [potatoes]
ref|XP_009758935.1|  PREDICTED: transcription factor GTE10-like i...    134   2e-30   Nicotiana sylvestris
ref|XP_009758933.1|  PREDICTED: transcription factor GTE10-like i...    133   2e-30   Nicotiana sylvestris
ref|XP_009758932.1|  PREDICTED: transcription factor GTE10-like i...    133   2e-30   Nicotiana sylvestris
ref|XP_007210895.1|  hypothetical protein PRUPE_ppa001621mg             132   3e-30   
ref|XP_008239430.1|  PREDICTED: transcription factor GTE10 isofor...    132   4e-30   Prunus mume [ume]
ref|XP_008239431.1|  PREDICTED: transcription factor GTE10 isofor...    132   5e-30   Prunus mume [ume]
ref|XP_012079886.1|  PREDICTED: transcription factor GTE10 isofor...    130   2e-29   Jatropha curcas
ref|XP_010519520.1|  PREDICTED: transcription factor GTE10 isofor...    130   3e-29   Tarenaya hassleriana [spider flower]
ref|XP_009390112.1|  PREDICTED: transcription factor GTE9-like is...    129   3e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010484059.1|  PREDICTED: transcription factor GTE10-like i...    130   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_009390111.1|  PREDICTED: transcription factor GTE9-like is...    129   4e-29   
ref|XP_009390110.1|  PREDICTED: transcription factor GTE11-like i...    129   4e-29   
ref|XP_009379940.1|  PREDICTED: transcription factor GTE9 isoform X2    129   5e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009379937.1|  PREDICTED: transcription factor GTE9 isoform X1    129   5e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009783526.1|  PREDICTED: transcription factor GTE10-like i...    127   6e-29   Nicotiana sylvestris
gb|AAF01563.1|AC009325_33  hypothetical protein                         127   6e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CAB87766.1|  kinase-like protein                                    128   7e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566151.1|  bromodomain and extraterminal domain protein 10       127   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484061.1|  PREDICTED: transcription factor GTE10-like i...    129   8e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010460135.1|  PREDICTED: transcription factor GTE10-like i...    129   1e-28   
ref|XP_010460112.1|  PREDICTED: transcription factor GTE10-like i...    129   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010460128.1|  PREDICTED: transcription factor GTE10-like i...    128   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010435667.1|  PREDICTED: transcription factor GTE11-like i...    127   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010435669.1|  PREDICTED: transcription factor GTE11-like i...    127   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_009783521.1|  PREDICTED: transcription factor GTE10-like i...    127   2e-28   Nicotiana sylvestris
ref|XP_009783523.1|  PREDICTED: transcription factor GTE10-like i...    127   2e-28   Nicotiana sylvestris
ref|XP_009783520.1|  PREDICTED: transcription factor GTE10-like i...    127   2e-28   Nicotiana sylvestris
ref|XP_009783525.1|  PREDICTED: transcription factor GTE10-like i...    127   2e-28   Nicotiana sylvestris
ref|XP_009783524.1|  PREDICTED: transcription factor GTE10-like i...    127   2e-28   Nicotiana sylvestris
ref|XP_009783522.1|  PREDICTED: transcription factor GTE10-like i...    127   2e-28   Nicotiana sylvestris
ref|XP_009783518.1|  PREDICTED: transcription factor GTE10-like i...    127   2e-28   Nicotiana sylvestris
ref|XP_012079887.1|  PREDICTED: transcription factor GTE10 isofor...    127   3e-28   Jatropha curcas
ref|XP_010435668.1|  PREDICTED: transcription factor GTE11-like i...    126   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_007137938.1|  hypothetical protein PHAVU_009G168100g             126   4e-28   Phaseolus vulgaris [French bean]
ref|XP_009411833.1|  PREDICTED: transcription factor GTE10-like         125   6e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006394288.1|  hypothetical protein EUTSA_v10003590mg             125   9e-28   
ref|XP_006394289.1|  hypothetical protein EUTSA_v10003590mg             125   1e-27   
ref|XP_006408544.1|  hypothetical protein EUTSA_v10020201mg             124   1e-27   Eutrema salsugineum [saltwater cress]
ref|XP_006408545.1|  hypothetical protein EUTSA_v10020201mg             124   1e-27   Eutrema salsugineum [saltwater cress]
ref|XP_006282318.1|  hypothetical protein CARUB_v10028607mg             125   1e-27   Capsella rubella
ref|XP_002882167.1|  ATBET10                                            124   1e-27   
emb|CDY48139.1|  BnaCnng15810D                                          122   2e-26   Brassica napus [oilseed rape]
emb|CDY16729.1|  BnaA09g06530D                                          121   4e-26   Brassica napus [oilseed rape]
ref|XP_009112075.1|  PREDICTED: transcription factor GTE10-like i...    120   7e-26   Brassica rapa
dbj|BAB10736.1|  unnamed protein product                                118   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011073015.1|  PREDICTED: transcription factor GTE8 isoform X2    117   3e-25   
ref|XP_011073012.1|  PREDICTED: transcription factor GTE8 isoform X1    117   4e-25   Sesamum indicum [beniseed]
ref|XP_007031763.1|  Bromodomain and extraterminal domain protein...    117   4e-25   
gb|KEH34972.1|  global transcription factor group protein               117   5e-25   Medicago truncatula
ref|XP_009336552.1|  PREDICTED: transcription factor GTE10-like         117   5e-25   
ref|NP_201137.5|  nuclear protein X1                                    117   5e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011083946.1|  PREDICTED: transcription factor GTE10-like         116   1e-24   Sesamum indicum [beniseed]
gb|KHG26101.1|  Transcription factor GTE10 -like protein                111   1e-24   Gossypium arboreum [tree cotton]
ref|XP_010026732.1|  PREDICTED: transcription factor GTE10-like         115   2e-24   Eucalyptus grandis [rose gum]
emb|CDY00163.1|  BnaC09g01380D                                          109   2e-24   
ref|XP_006297359.1|  hypothetical protein CARUB_v10013379mg             113   4e-24   
emb|CDX84396.1|  BnaC03g51040D                                          113   5e-24   
gb|EYU43070.1|  hypothetical protein MIMGU_mgv1a001604mg                114   6e-24   Erythranthe guttata [common monkey flower]
gb|KJB11630.1|  hypothetical protein B456_001G268800                    111   2e-23   Gossypium raimondii
ref|XP_011463705.1|  PREDICTED: transcription factor GTE10-like         112   2e-23   Fragaria vesca subsp. vesca
gb|KJB33939.1|  hypothetical protein B456_006G039400                    111   3e-23   Gossypium raimondii
gb|KJB33940.1|  hypothetical protein B456_006G039400                    111   4e-23   Gossypium raimondii
gb|KJB11632.1|  hypothetical protein B456_001G268800                    110   4e-23   Gossypium raimondii
ref|XP_010550188.1|  PREDICTED: transcription factor GTE9-like          110   7e-23   
gb|KJB11628.1|  hypothetical protein B456_001G268800                    110   9e-23   Gossypium raimondii
gb|KJB19581.1|  hypothetical protein B456_003G109400                    110   1e-22   Gossypium raimondii
emb|CDY13699.1|  BnaA06g32240D                                          106   3e-22   Brassica napus [oilseed rape]
emb|CDX83673.1|  BnaC07g24130D                                          106   6e-22   
gb|KJB19582.1|  hypothetical protein B456_003G109400                    107   1e-21   Gossypium raimondii
ref|XP_009151978.1|  PREDICTED: transcription factor GTE8               106   2e-21   Brassica rapa
ref|XP_007140891.1|  hypothetical protein PHAVU_008G150100g             104   7e-21   Phaseolus vulgaris [French bean]
gb|KDO55691.1|  hypothetical protein CISIN_1g004592mg                   102   2e-20   Citrus sinensis [apfelsine]
gb|KDO55690.1|  hypothetical protein CISIN_1g004592mg                   102   3e-20   Citrus sinensis [apfelsine]
ref|XP_009391145.1|  PREDICTED: transcription factor GTE9-like          100   8e-20   
ref|XP_006659082.1|  PREDICTED: transcription factor GTE9-like          100   9e-20   Oryza brachyantha
ref|XP_002965804.1|  hypothetical protein SELMODRAFT_406866           97.8    9e-19   
dbj|BAD08859.1|  putative bromodomain-containing protein              97.8    1e-18   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002993220.1|  hypothetical protein SELMODRAFT_431331           97.1    2e-18   
gb|EPS70275.1|  hypothetical protein M569_04485                       96.3    2e-18   Genlisea aurea
ref|XP_009391147.1|  PREDICTED: transcription factor GTE9-like        95.1    8e-18   
ref|XP_007037912.1|  Nuclear protein X1 isoform 3                     94.4    1e-17   
ref|XP_008800952.1|  PREDICTED: transcription factor GTE10-like i...  91.3    1e-16   Phoenix dactylifera
gb|KDO69316.1|  hypothetical protein CISIN_1g004033mg                 90.5    2e-16   Citrus sinensis [apfelsine]
ref|XP_006440055.1|  hypothetical protein CICLE_v10018939mg           90.5    3e-16   
dbj|BAH19453.1|  AT5G14270                                            90.1    3e-16   Arabidopsis thaliana [mouse-ear cress]
gb|KDO69317.1|  hypothetical protein CISIN_1g004033mg                 90.1    3e-16   Citrus sinensis [apfelsine]
ref|XP_006440054.1|  hypothetical protein CICLE_v10018939mg           90.1    3e-16   
gb|EAZ05455.1|  hypothetical protein OsI_27669                        89.7    5e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_009412706.1|  PREDICTED: transcription factor GTE9-like        86.7    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010930071.1|  PREDICTED: transcription factor GTE10-like i...  86.3    6e-15   
gb|AFK46997.1|  unknown                                               76.3    1e-13   Lotus japonicus
gb|KDO77998.1|  hypothetical protein CISIN_1g007584mg                 80.5    5e-13   Citrus sinensis [apfelsine]
ref|XP_010485369.1|  PREDICTED: transcription factor GTE9-like is...  80.1    6e-13   
ref|XP_006467562.1|  PREDICTED: transcription factor GTE9-like        80.1    6e-13   Citrus sinensis [apfelsine]
ref|XP_006449595.1|  hypothetical protein CICLE_v10014673mg           79.3    1e-12   Citrus clementina [clementine]
ref|XP_010485365.1|  PREDICTED: transcription factor GTE9-like is...  79.3    1e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010485368.1|  PREDICTED: transcription factor GTE9-like is...  79.3    1e-12   Camelina sativa [gold-of-pleasure]
gb|KDO69319.1|  hypothetical protein CISIN_1g004033mg                 78.6    2e-12   Citrus sinensis [apfelsine]
ref|XP_010273394.1|  PREDICTED: transcription factor GTE10            77.4    5e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010485366.1|  PREDICTED: transcription factor GTE9-like is...  77.4    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010039682.1|  PREDICTED: transcription factor GTE9-like        70.9    1e-11   Eucalyptus grandis [rose gum]
ref|XP_010095124.1|  Transcription factor GTE12                       75.5    2e-11   Morus notabilis
gb|KEH17396.1|  global transcription factor group protein             74.3    5e-11   Medicago truncatula
gb|EYU23138.1|  hypothetical protein MIMGU_mgv1a019799mg              73.6    9e-11   Erythranthe guttata [common monkey flower]
gb|AFW74428.1|  hypothetical protein ZEAMMB73_413666                  73.6    1e-10   
ref|XP_008648432.1|  PREDICTED: transcription factor GTE9-like        73.2    1e-10   Zea mays [maize]
ref|XP_009397772.1|  PREDICTED: transcription factor GTE9-like is...  72.0    3e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009397773.1|  PREDICTED: transcription factor GTE9-like is...  72.0    3e-10   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001047353.1|  Os02g0601800                                     72.0    3e-10   
gb|EEC73546.1|  hypothetical protein OsI_07959                        72.0    3e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_010929323.1|  PREDICTED: transcription factor GTE9-like is...  71.6    5e-10   Elaeis guineensis
ref|XP_010929315.1|  PREDICTED: transcription factor GTE9-like is...  71.2    5e-10   Elaeis guineensis
ref|XP_006647467.1|  PREDICTED: transcription factor GTE10-like       71.2    5e-10   Oryza brachyantha
ref|XP_006647466.1|  PREDICTED: transcription factor GTE10-like       71.2    5e-10   Oryza brachyantha
dbj|BAB41205.1|  kinase-like protein                                  70.5    9e-10   Oryza sativa Japonica Group [Japonica rice]
emb|CDY48349.1|  BnaCnng16110D                                        64.3    2e-09   Brassica napus [oilseed rape]
ref|XP_010234272.1|  PREDICTED: transcription factor GTE9-like is...  69.7    2e-09   Brachypodium distachyon [annual false brome]
ref|XP_010234273.1|  PREDICTED: transcription factor GTE9-like is...  69.7    2e-09   Brachypodium distachyon [annual false brome]
ref|XP_004953007.1|  PREDICTED: transcription factor GTE8-like is...  67.4    8e-09   Setaria italica
ref|XP_004953006.1|  PREDICTED: transcription factor GTE8-like is...  67.4    1e-08   
ref|XP_008225390.1|  PREDICTED: transcription factor GTE12 isofor...  66.6    1e-08   Prunus mume [ume]
ref|XP_010943966.1|  PREDICTED: transcription factor GTE9-like is...  67.0    1e-08   Elaeis guineensis
ref|XP_008225392.1|  PREDICTED: transcription factor GTE12 isofor...  66.6    1e-08   Prunus mume [ume]
ref|XP_010943965.1|  PREDICTED: transcription factor GTE9-like is...  66.6    2e-08   Elaeis guineensis
gb|EMS62647.1|  Transcription factor GTE9                             66.2    2e-08   Triticum urartu
gb|KHN47363.1|  Transcription factor GTE12                            65.9    2e-08   Glycine soja [wild soybean]
ref|XP_003542960.1|  PREDICTED: transcription factor GTE12-like i...  65.9    3e-08   Glycine max [soybeans]
ref|XP_008657741.1|  PREDICTED: transcription factor GTE9-like        62.4    7e-08   
ref|XP_003547190.1|  PREDICTED: transcription factor GTE12-like       64.3    8e-08   Glycine max [soybeans]
gb|KHN06936.1|  Transcription factor GTE12                            64.3    9e-08   Glycine soja [wild soybean]
ref|XP_010655612.1|  PREDICTED: transcription factor GTE9 isoform X7  63.9    1e-07   
ref|XP_002269681.2|  PREDICTED: transcription factor GTE9 isoform X5  63.9    1e-07   Vitis vinifera
ref|XP_010655605.1|  PREDICTED: transcription factor GTE9 isoform X1  63.9    1e-07   Vitis vinifera
emb|CAN72911.1|  hypothetical protein VITISV_007433                   63.5    1e-07   Vitis vinifera
ref|XP_010655611.1|  PREDICTED: transcription factor GTE9 isoform X6  63.5    1e-07   Vitis vinifera
ref|XP_007212375.1|  hypothetical protein PRUPE_ppa003707mg           63.5    1e-07   
gb|KDO78000.1|  hypothetical protein CISIN_1g007584mg                 63.5    1e-07   Citrus sinensis [apfelsine]
gb|KDO78001.1|  hypothetical protein CISIN_1g007584mg                 63.2    1e-07   Citrus sinensis [apfelsine]
gb|KEH34973.1|  global transcription factor group protein             63.5    1e-07   Medicago truncatula
ref|XP_009130282.1|  PREDICTED: uncharacterized protein LOC103855073  60.5    2e-07   
ref|XP_011096458.1|  PREDICTED: transcription factor GTE9-like is...  62.4    4e-07   Sesamum indicum [beniseed]
ref|XP_010655609.1|  PREDICTED: transcription factor GTE9 isoform X3  62.4    4e-07   Vitis vinifera
ref|XP_011096462.1|  PREDICTED: transcription factor GTE9-like is...  62.4    4e-07   Sesamum indicum [beniseed]
ref|XP_002519772.1|  bromodomain-containing protein, putative         61.6    6e-07   Ricinus communis
ref|XP_002454132.1|  hypothetical protein SORBIDRAFT_04g025160        61.6    6e-07   Sorghum bicolor [broomcorn]
ref|XP_011096463.1|  PREDICTED: transcription factor GTE9-like is...  61.6    7e-07   Sesamum indicum [beniseed]
ref|XP_004972962.1|  PREDICTED: transcription factor GTE10-like i...  61.6    7e-07   
ref|XP_004972961.1|  PREDICTED: transcription factor GTE10-like i...  61.6    7e-07   
ref|XP_012091871.1|  PREDICTED: transcription factor GTE12            61.2    8e-07   
ref|XP_004485967.1|  PREDICTED: transcription factor GTE10-like i...  60.8    9e-07   
ref|XP_004485965.1|  PREDICTED: transcription factor GTE10-like i...  60.8    1e-06   
gb|AAL06480.1|AF411790_1  AT3g27260/K17E12_8                          58.2    1e-06   
ref|XP_010052121.1|  PREDICTED: transcription factor GTE12            60.5    1e-06   
ref|XP_003575300.1|  PREDICTED: transcription factor GTE10-like       60.1    2e-06   
ref|XP_010655610.1|  PREDICTED: transcription factor GTE8 isoform X4  59.3    4e-06   
ref|XP_010655608.1|  PREDICTED: transcription factor GTE8 isoform X2  59.3    4e-06   
ref|XP_008371551.1|  PREDICTED: transcription factor GTE12            58.5    6e-06   
ref|XP_009757183.1|  PREDICTED: transcription factor GTE12            58.5    6e-06   
gb|KJB57315.1|  hypothetical protein B456_009G158600                  58.2    8e-06   
gb|AFW72199.1|  hypothetical protein ZEAMMB73_903470                  58.2    8e-06   
gb|KJB57316.1|  hypothetical protein B456_009G158600                  58.2    8e-06   
ref|XP_010559280.1|  PREDICTED: transcription factor GTE12-like i...  58.2    8e-06   
gb|KJB57318.1|  hypothetical protein B456_009G158600                  57.8    9e-06   
ref|XP_011464380.1|  PREDICTED: transcription factor GTE9-like        54.7    9e-06   
ref|XP_007025229.1|  DNA-binding bromodomain-containing protein, ...  57.8    1e-05   
ref|NP_001105214.2|  LOC542112                                        57.4    1e-05   
gb|AAO84020.1|  global transcription factor group E                   57.4    1e-05   
ref|XP_009352061.1|  PREDICTED: transcription factor GTE12-like       57.0    2e-05   
gb|AFW72198.1|  global transcription factor group E                   57.4    2e-05   
gb|EMT04068.1|  hypothetical protein F775_08594                       56.2    3e-05   
ref|XP_002444978.1|  hypothetical protein SORBIDRAFT_07g002270        55.5    3e-05   
ref|NP_001059741.1|  Os07g0507700                                     56.2    3e-05   
gb|EEE67240.1|  hypothetical protein OsJ_24385                        55.8    4e-05   
gb|EEC82117.1|  hypothetical protein OsI_26141                        55.8    4e-05   
gb|EMS62509.1|  Transcription factor GTE9                             55.5    6e-05   
gb|AFW81080.1|  hypothetical protein ZEAMMB73_211968                  54.3    7e-05   
ref|XP_002524829.1|  bromodomain-containing protein, putative         55.1    7e-05   
gb|AFW81081.1|  hypothetical protein ZEAMMB73_211968                  54.3    8e-05   
gb|EMS68384.1|  Transcription factor GTE11                            54.7    9e-05   
ref|XP_009610867.1|  PREDICTED: transcription factor GTE12            54.7    1e-04   
tpg|DAA62327.1|  TPA: hypothetical protein ZEAMMB73_683634            54.7    1e-04   
gb|AFW82738.1|  hypothetical protein ZEAMMB73_647475                  53.9    1e-04   
ref|XP_011460385.1|  PREDICTED: transcription factor GTE12            54.3    1e-04   
ref|XP_002530855.1|  bromodomain-containing protein, putative         54.3    1e-04   
ref|XP_002523731.1|  bromodomain-containing protein, putative         53.9    2e-04   
ref|XP_002300324.2|  DNA-binding bromodomain-containing family pr...  53.9    2e-04   
ref|XP_008678300.1|  PREDICTED: transcription factor GTE9-like is...  53.9    2e-04   
ref|XP_008678301.1|  PREDICTED: transcription factor GTE9-like is...  53.9    2e-04   
ref|XP_008678302.1|  PREDICTED: transcription factor GTE9-like is...  53.9    2e-04   
ref|XP_011046708.1|  PREDICTED: transcription factor GTE12-like       53.5    2e-04   
gb|ADN33877.1|  global transcription factor                           50.4    3e-04   
ref|XP_007147958.1|  hypothetical protein PHAVU_006G168500g           52.8    4e-04   
ref|XP_007147957.1|  hypothetical protein PHAVU_006G168500g           52.8    4e-04   
gb|KHG25071.1|  Transcription factor GTE12 -like protein              52.8    4e-04   
ref|XP_006657742.1|  PREDICTED: transcription factor GTE9-like is...  52.0    7e-04   
ref|XP_001754262.1|  predicted protein                                51.2    8e-04   
ref|XP_010231679.1|  PREDICTED: transcription factor GTE10 isofor...  51.2    0.001   



>emb|CBI40077.3| unnamed protein product [Vitis vinifera]
Length=714

 Score =   204 bits (518),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 178/221 (81%), Gaps = 4/221 (2%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             +S  DQ+EQ+SQQKPN  E D QQDGE S  DR  SPEKLYRAA+LKNRFADTI KAREK
Sbjct  497   VSGVDQLEQTSQQKPNYVESDSQQDGE-SLTDRQVSPEKLYRAAVLKNRFADTIFKAREK  555

Query  861   TLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe  682
             TL QGEKGDP++LRRERE LEMQR+KEKARLQAEAKAAE+AR+RAE EAAAEAK+KRE E
Sbjct  556   TLNQGEKGDPEKLRREREELEMQRRKEKARLQAEAKAAEDARRRAEAEAAAEAKKKRELE  615

Query  681   reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFT  505
             R AARQAL KME+TVEINENSRFLEDLE+LR  P E   SS++E+SP HS D L  F+F 
Sbjct  616   RAAARQALQKMEKTVEINENSRFLEDLELLRAAPAEHLPSSVDETSPDHSQDGLSGFRFV  675

Query  504   GSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GSNPLEQLGLYMK   D EE +  P S P    DVEEGEID
Sbjct  676   GSNPLEQLGLYMK--VDDEEEDGEPHSPPDVVNDVEEGEID  714



>ref|XP_010660803.1| PREDICTED: transcription factor GTE8 isoform X2 [Vitis vinifera]
Length=735

 Score =   203 bits (516),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 178/221 (81%), Gaps = 4/221 (2%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             +S  DQ+EQ+SQQKPN  E D QQDGE S  DR  SPEKLYRAA+LKNRFADTI KAREK
Sbjct  518   VSGVDQLEQTSQQKPNYVESDSQQDGE-SLTDRQVSPEKLYRAAVLKNRFADTIFKAREK  576

Query  861   TLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe  682
             TL QGEKGDP++LRRERE LEMQR+KEKARLQAEAKAAE+AR+RAE EAAAEAK+KRE E
Sbjct  577   TLNQGEKGDPEKLRREREELEMQRRKEKARLQAEAKAAEDARRRAEAEAAAEAKKKRELE  636

Query  681   reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFT  505
             R AARQAL KME+TVEINENSRFLEDLE+LR  P E   SS++E+SP HS D L  F+F 
Sbjct  637   RAAARQALQKMEKTVEINENSRFLEDLELLRAAPAEHLPSSVDETSPDHSQDGLSGFRFV  696

Query  504   GSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GSNPLEQLGLYMK   D EE +  P S P    DVEEGEID
Sbjct  697   GSNPLEQLGLYMK--VDDEEEDGEPHSPPDVVNDVEEGEID  735



>ref|XP_010660801.1| PREDICTED: transcription factor GTE8 isoform X1 [Vitis vinifera]
 ref|XP_010660802.1| PREDICTED: transcription factor GTE8 isoform X1 [Vitis vinifera]
Length=737

 Score =   203 bits (516),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 161/221 (73%), Positives = 178/221 (81%), Gaps = 4/221 (2%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             +S  DQ+EQ+SQQKPN  E D QQDGE S  DR  SPEKLYRAA+LKNRFADTI KAREK
Sbjct  520   VSGVDQLEQTSQQKPNYVESDSQQDGE-SLTDRQVSPEKLYRAAVLKNRFADTIFKAREK  578

Query  861   TLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe  682
             TL QGEKGDP++LRRERE LEMQR+KEKARLQAEAKAAE+AR+RAE EAAAEAK+KRE E
Sbjct  579   TLNQGEKGDPEKLRREREELEMQRRKEKARLQAEAKAAEDARRRAEAEAAAEAKKKRELE  638

Query  681   reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFT  505
             R AARQAL KME+TVEINENSRFLEDLE+LR  P E   SS++E+SP HS D L  F+F 
Sbjct  639   RAAARQALQKMEKTVEINENSRFLEDLELLRAAPAEHLPSSVDETSPDHSQDGLSGFRFV  698

Query  504   GSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GSNPLEQLGLYMK   D EE +  P S P    DVEEGEID
Sbjct  699   GSNPLEQLGLYMK--VDDEEEDGEPHSPPDVVNDVEEGEID  737



>ref|XP_006338672.1| PREDICTED: transcription factor GTE8-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006338673.1| PREDICTED: transcription factor GTE8-like isoform X2 [Solanum 
tuberosum]
Length=729

 Score =   202 bits (513),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 160/230 (70%), Positives = 185/230 (80%), Gaps = 8/230 (3%)
 Frame = -1

Query  1068  NDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFA  889
             N LA+G+  IS  DQ++QSSQQ P S E +  QDGE        SP KLYRAALLKNRFA
Sbjct  507   NSLAEGNHSISGVDQLDQSSQQMPFSVESEAYQDGESR-----VSPGKLYRAALLKNRFA  561

Query  888   DTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaa  709
             DTILKAREKTL + EKGDP++LRRERE LEMQR+K KA+LQAEAKAAEEA++RAE EAAA
Sbjct  562   DTILKAREKTLVEVEKGDPEKLRREREELEMQRRKAKAKLQAEAKAAEEAQRRAEVEAAA  621

Query  708   eakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSL  532
             EAKR+RE +REAARQALL+ME+TVEINENS+FLEDLEML   P+EQ HSS++E+SP HS 
Sbjct  622   EAKRRREVDREAARQALLQMEKTVEINENSKFLEDLEMLTAVPSEQLHSSVDETSPDHSQ  681

Query  531   DALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             D LGSFKF GSNPLEQLGLYMK   D +E E   +++P D  DVEEGEID
Sbjct  682   DGLGSFKFGGSNPLEQLGLYMK--VDDDEEECELATLPSDPIDVEEGEID  729



>gb|KJB11627.1| hypothetical protein B456_001G268800 [Gossypium raimondii]
 gb|KJB11629.1| hypothetical protein B456_001G268800 [Gossypium raimondii]
Length=669

 Score =   200 bits (508),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 180/219 (82%), Gaps = 4/219 (2%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL-  856
             FDQ+EQ+SQ K +S E D  QDG+ + N+RP SPEK YRAA+LKNRFADTILKAREK L 
Sbjct  453   FDQLEQTSQAKSSSVESDCHQDGDSAPNERPVSPEKRYRAAILKNRFADTILKAREKALT  512

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefere  676
              QGEKGDP++LRRERE LE QRKKEKARLQAEAKAAE+A+++AE EAAAEA+RKRE ER+
Sbjct  513   TQGEKGDPEKLRREREELEHQRKKEKARLQAEAKAAEDAQRQAEAEAAAEARRKRELERD  572

Query  675   aarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGS  499
             AARQALLKME+TVEINENSRFLEDLEMLR  P E   SS++E+SP HS D LGSFKF  +
Sbjct  573   AARQALLKMEKTVEINENSRFLEDLEMLRAAPAEHLPSSVDETSPDHSQDGLGSFKFGSN  632

Query  498   NPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             NPLEQLGLYMK  +D EE E  PS+VP    D EEGEID
Sbjct  633   NPLEQLGLYMK--EDEEEEEGEPSNVPNPVNDPEEGEID  669



>gb|KJB11631.1| hypothetical protein B456_001G268800 [Gossypium raimondii]
Length=664

 Score =   200 bits (508),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 180/219 (82%), Gaps = 4/219 (2%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL-  856
             FDQ+EQ+SQ K +S E D  QDG+ + N+RP SPEK YRAA+LKNRFADTILKAREK L 
Sbjct  448   FDQLEQTSQAKSSSVESDCHQDGDSAPNERPVSPEKRYRAAILKNRFADTILKAREKALT  507

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefere  676
              QGEKGDP++LRRERE LE QRKKEKARLQAEAKAAE+A+++AE EAAAEA+RKRE ER+
Sbjct  508   TQGEKGDPEKLRREREELEHQRKKEKARLQAEAKAAEDAQRQAEAEAAAEARRKRELERD  567

Query  675   aarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGS  499
             AARQALLKME+TVEINENSRFLEDLEMLR  P E   SS++E+SP HS D LGSFKF  +
Sbjct  568   AARQALLKMEKTVEINENSRFLEDLEMLRAAPAEHLPSSVDETSPDHSQDGLGSFKFGSN  627

Query  498   NPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             NPLEQLGLYMK  +D EE E  PS+VP    D EEGEID
Sbjct  628   NPLEQLGLYMK--EDEEEEEGEPSNVPNPVNDPEEGEID  664



>ref|XP_007031764.1| Bromodomain-containing protein, putative isoform 4 [Theobroma 
cacao]
 gb|EOY02690.1| Bromodomain-containing protein, putative isoform 4 [Theobroma 
cacao]
Length=739

 Score =   198 bits (504),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 164/241 (68%), Positives = 189/241 (78%), Gaps = 4/241 (2%)
 Frame = -1

Query  1098  AASIIDRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLY  919
              A + ++  V++  D +  +S  DQ+EQ+SQ KP+S E D  QDG+ +  +R  SPEKLY
Sbjct  501   GAQLDEKTSVDNPLDRNQCVSGLDQLEQTSQPKPSSVESDSCQDGDSAPTERQISPEKLY  560

Query  918   RAALLKNRFADTILKAREKTLG-QGEKGDPDQLRREREVLEMQrkkekarlqaeakaaee  742
             RAALLKNRFADTILKAREKTL  QG+KGDP++LRRERE LE QRKKEKARLQAEAKAAE+
Sbjct  561   RAALLKNRFADTILKAREKTLTQQGDKGDPEKLRREREELEQQRKKEKARLQAEAKAAED  620

Query  741   arkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HS  565
             AR+RAE EAAAEA+RKRE EREAARQALLKME+TVEINENSRFLEDL+MLR  P E   S
Sbjct  621   ARRRAEAEAAAEARRKRELEREAARQALLKMEKTVEINENSRFLEDLDMLRAAPVEHLPS  680

Query  564   SLNESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEI  385
             S++E+SP HS D LGSFKF  SNPLEQLGLYMK   D EE E  P S+     DVEEGEI
Sbjct  681   SVDETSPDHSQDGLGSFKFGSSNPLEQLGLYMK--QDEEEEEGEPPSIQNPVNDVEEGEI  738

Query  384   D  382
             D
Sbjct  739   D  739



>gb|KHG23350.1| Transcription factor GTE9 -like protein [Gossypium arboreum]
Length=686

 Score =   198 bits (503),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 157/219 (72%), Positives = 179/219 (82%), Gaps = 4/219 (2%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL-  856
             FDQ+EQ+SQ K +S E D  QDG+ + N+RP SPEK YRAA+LKNRFADTILKAREK L 
Sbjct  470   FDQLEQTSQAKSSSVESDCHQDGDSAPNERPVSPEKRYRAAILKNRFADTILKAREKALT  529

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefere  676
              QGEKGDP++LRRERE LE QRKKEKARLQAEAKAAE+A+++AE EAAAEA+RKRE ER+
Sbjct  530   TQGEKGDPEKLRREREELEYQRKKEKARLQAEAKAAEDAQRQAEAEAAAEARRKRELERD  589

Query  675   aarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGS  499
             AARQALLKME+TVEINENSRFLEDLEMLR  P E   SS++E+SP HS D  GSFKF  +
Sbjct  590   AARQALLKMEKTVEINENSRFLEDLEMLRAAPAEHLPSSVDETSPDHSQDGFGSFKFGSN  649

Query  498   NPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             NPLEQLGLYMK  +D EE E  PS+VP    D EEGEID
Sbjct  650   NPLEQLGLYMK--EDEEEEEGEPSNVPNPLNDPEEGEID  686



>ref|XP_008341341.1| PREDICTED: transcription factor GTE8-like [Malus domestica]
 ref|XP_008341342.1| PREDICTED: transcription factor GTE8-like [Malus domestica]
Length=734

 Score =   197 bits (502),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 160/237 (68%), Positives = 189/237 (80%), Gaps = 7/237 (3%)
 Frame = -1

Query  1071  VNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRF  892
             +++  +G+   S  DQVEQSSQQKP+  E D  Q G+ +  +RP SPEK YRAALLKNRF
Sbjct  498   IDNPLEGNQSDSGLDQVEQSSQQKPSPVESDCCQHGDSAPQERPVSPEKQYRAALLKNRF  557

Query  891   ADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaa  712
             ADTIL+AREKTL QG+KGDP++LRR+RE LE+QRKKEKARLQAEAKAAE+AR+RAE EAA
Sbjct  558   ADTILRAREKTLNQGDKGDPEKLRRQREELELQRKKEKARLQAEAKAAEDARRRAEAEAA  617

Query  711   aeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHS  535
             AEAKRKRE EREAARQALL+ME+TVEINENSRFL+DLEMLR  P EQ  SS++E+SP HS
Sbjct  618   AEAKRKRELEREAARQALLQMEKTVEINENSRFLKDLEMLRTAPAEQLPSSVDETSPDHS  677

Query  534   LDALGSFKFTGSNPLEQLGLYMKedddfeecep------pPSSVPKDAKDVEEGEID  382
              D LG F F GSNPLEQLGLYMK+DD+ E+ EP        ++ P    D+EEGEID
Sbjct  678   QDGLGGFNFGGSNPLEQLGLYMKDDDEEEDAEPVSVPPGTVNASPSPVNDIEEGEID  734



>gb|KDO55686.1| hypothetical protein CISIN_1g004592mg [Citrus sinensis]
 gb|KDO55687.1| hypothetical protein CISIN_1g004592mg [Citrus sinensis]
 gb|KDO55688.1| hypothetical protein CISIN_1g004592mg [Citrus sinensis]
 gb|KDO55689.1| hypothetical protein CISIN_1g004592mg [Citrus sinensis]
Length=743

 Score =   197 bits (501),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 191/235 (81%), Gaps = 3/235 (1%)
 Frame = -1

Query  1083  DRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALL  904
             ++ G  D  D +  +S  DQ+E +SQQKP+S E D +QDGE + N+R  SP+KLYRA LL
Sbjct  511   EKTGSGDPLDVNQSVSGLDQLEHTSQQKPSSVESDFRQDGESAPNERQVSPDKLYRATLL  570

Query  903   KNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkrae  724
             KNRFADTILKA+EKTL QG+KGDP++LRRERE LE+Q++KEKARLQAEAKAAEEAR++AE
Sbjct  571   KNRFADTILKAKEKTLSQGDKGDPEKLRREREELELQKRKEKARLQAEAKAAEEARRQAE  630

Query  723   eeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESS  547
              +AA EA+RKRE EREAARQALLKME+TVEINENSRFLEDLEMLR  P EQ  SS++E+S
Sbjct  631   ADAAVEARRKREVEREAARQALLKMEKTVEINENSRFLEDLEMLRTAPAEQLPSSVDETS  690

Query  546   PQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             P HS D LGSFKF GSNPLEQLGLYMK  +D EE +  P SVP    DVEEGEID
Sbjct  691   PDHSQDGLGSFKFGGSNPLEQLGLYMK--EDDEEEDAEPPSVPNPLNDVEEGEID  743



>ref|XP_006447148.1| hypothetical protein CICLE_v10014390mg [Citrus clementina]
 ref|XP_006447149.1| hypothetical protein CICLE_v10014390mg [Citrus clementina]
 ref|XP_006469987.1| PREDICTED: transcription factor GTE8-like isoform X1 [Citrus 
sinensis]
 ref|XP_006469988.1| PREDICTED: transcription factor GTE8-like isoform X2 [Citrus 
sinensis]
 gb|ESR60388.1| hypothetical protein CICLE_v10014390mg [Citrus clementina]
 gb|ESR60389.1| hypothetical protein CICLE_v10014390mg [Citrus clementina]
Length=743

 Score =   197 bits (501),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 163/235 (69%), Positives = 191/235 (81%), Gaps = 3/235 (1%)
 Frame = -1

Query  1083  DRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALL  904
             ++ G  D  D +  +S  DQ+E +SQQKP+S E D +QDGE + N+R  SP+KLYRA LL
Sbjct  511   EKTGSGDPLDVNQSVSGLDQLEHTSQQKPSSVESDFRQDGESAPNERQVSPDKLYRATLL  570

Query  903   KNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkrae  724
             KNRFADTILKA+EKTL QG+KGDP++LRRERE LE+Q++KEKARLQAEAKAAEEAR++AE
Sbjct  571   KNRFADTILKAKEKTLSQGDKGDPEKLRREREELELQKRKEKARLQAEAKAAEEARRQAE  630

Query  723   eeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESS  547
              +AA EA+RKRE EREAARQALLKME+TVEINENSRFLEDLEMLR  P EQ  SS++E+S
Sbjct  631   ADAAVEARRKREVEREAARQALLKMEKTVEINENSRFLEDLEMLRTAPAEQLPSSVDETS  690

Query  546   PQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             P HS D LGSFKF GSNPLEQLGLYMK  +D EE +  P SVP    DVEEGEID
Sbjct  691   PDHSQDGLGSFKFGGSNPLEQLGLYMK--EDDEEEDAEPPSVPNPLNDVEEGEID  743



>ref|XP_007031761.1| Bromodomain-containing protein, putative isoform 1 [Theobroma 
cacao]
 ref|XP_007031762.1| Bromodomain and extraterminal domain protein 10, putative isoform 
1 [Theobroma cacao]
 gb|EOY02687.1| Bromodomain-containing protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY02688.1| Bromodomain and extraterminal domain protein 10, putative isoform 
1 [Theobroma cacao]
Length=725

 Score =   197 bits (500),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 150/212 (71%), Positives = 174/212 (82%), Gaps = 1/212 (0%)
 Frame = -1

Query  1098  AASIIDRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLY  919
              A + ++  V++  D +  +S  DQ+EQ+SQ KP+S E D  QDG+ +  +R  SPEKLY
Sbjct  501   GAQLDEKTSVDNPLDRNQCVSGLDQLEQTSQPKPSSVESDSCQDGDSAPTERQISPEKLY  560

Query  918   RAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeea  739
             RAALLKNRFADTILKAREKTL QG+KGDP++LRRERE LE QRKKEKARLQAEAKAAE+A
Sbjct  561   RAALLKNRFADTILKAREKTLTQGDKGDPEKLRREREELEQQRKKEKARLQAEAKAAEDA  620

Query  738   rkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSS  562
             R+RAE EAAAEA+RKRE EREAARQALLKME+TVEINENSRFLEDL+MLR  P E   SS
Sbjct  621   RRRAEAEAAAEARRKRELEREAARQALLKMEKTVEINENSRFLEDLDMLRAAPVEHLPSS  680

Query  561   LNESSPQHSLDALGSFKFTGSNPLEQLGLYMK  466
             ++E+SP HS D LGSFKF  SNPLEQLGLYMK
Sbjct  681   VDETSPDHSQDGLGSFKFGSSNPLEQLGLYMK  712



>ref|XP_009370288.1| PREDICTED: transcription factor GTE8-like isoform X2 [Pyrus x 
bretschneideri]
Length=725

 Score =   196 bits (498),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 185/237 (78%), Gaps = 7/237 (3%)
 Frame = -1

Query  1071  VNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRF  892
             +++  +G+   S  DQVEQSSQQKP+  E D  Q G+ +  +RP SPEK YRAA+LKNRF
Sbjct  489   IDNPLEGNQSDSGLDQVEQSSQQKPSPVESDCCQHGDSATQERPVSPEKQYRAAVLKNRF  548

Query  891   ADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaa  712
             ADTIL+AREKTL QG+KGDP++LRR+RE LE+QRKKEKARLQAEAKAAE+AR+RAE EAA
Sbjct  549   ADTILRAREKTLNQGDKGDPEKLRRQREELELQRKKEKARLQAEAKAAEDARRRAEAEAA  608

Query  711   aeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHS  535
             AEAKRKRE EREAARQALL++E+TVEINENSRFL+DLEMLR  P EQ  SS++E+SP HS
Sbjct  609   AEAKRKRELEREAARQALLQIEKTVEINENSRFLKDLEMLRTAPAEQLPSSVDETSPDHS  668

Query  534   LDALGSFKFTGSNPLEQLGLYMKeddd------feeceppPSSVPKDAKDVEEGEID  382
              D LG F F GSNPLEQLGLYMK+DD+              ++ P    D+EEGEID
Sbjct  669   QDGLGGFNFGGSNPLEQLGLYMKDDDEEEDAEPVSVPPSTVNASPSPVNDIEEGEID  725



>ref|XP_009370286.1| PREDICTED: transcription factor GTE8-like isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009370287.1| PREDICTED: transcription factor GTE8-like isoform X1 [Pyrus x 
bretschneideri]
Length=734

 Score =   196 bits (498),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 155/237 (65%), Positives = 185/237 (78%), Gaps = 7/237 (3%)
 Frame = -1

Query  1071  VNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRF  892
             +++  +G+   S  DQVEQSSQQKP+  E D  Q G+ +  +RP SPEK YRAA+LKNRF
Sbjct  498   IDNPLEGNQSDSGLDQVEQSSQQKPSPVESDCCQHGDSATQERPVSPEKQYRAAVLKNRF  557

Query  891   ADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaa  712
             ADTIL+AREKTL QG+KGDP++LRR+RE LE+QRKKEKARLQAEAKAAE+AR+RAE EAA
Sbjct  558   ADTILRAREKTLNQGDKGDPEKLRRQREELELQRKKEKARLQAEAKAAEDARRRAEAEAA  617

Query  711   aeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHS  535
             AEAKRKRE EREAARQALL++E+TVEINENSRFL+DLEMLR  P EQ  SS++E+SP HS
Sbjct  618   AEAKRKRELEREAARQALLQIEKTVEINENSRFLKDLEMLRTAPAEQLPSSVDETSPDHS  677

Query  534   LDALGSFKFTGSNPLEQLGLYMKeddd------feeceppPSSVPKDAKDVEEGEID  382
              D LG F F GSNPLEQLGLYMK+DD+              ++ P    D+EEGEID
Sbjct  678   QDGLGGFNFGGSNPLEQLGLYMKDDDEEEDAEPVSVPPSTVNASPSPVNDIEEGEID  734



>ref|XP_009371694.1| PREDICTED: transcription factor GTE8-like isoform X1 [Pyrus x 
bretschneideri]
Length=734

 Score =   194 bits (494),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 154/237 (65%), Positives = 184/237 (78%), Gaps = 7/237 (3%)
 Frame = -1

Query  1071  VNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRF  892
             +++  +G+   S  DQVEQSSQQKP+  E D  Q G+ +  +RP SPEK YRAA+LKNRF
Sbjct  498   IDNPLEGNQSDSGLDQVEQSSQQKPSPVESDCCQHGDSATQERPVSPEKQYRAAVLKNRF  557

Query  891   ADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaa  712
             ADTIL+AREKTL QG+KGDP++LRR+RE LE+QRKKEKARLQAEAKAAE+AR+RAE EAA
Sbjct  558   ADTILRAREKTLNQGDKGDPEKLRRQREELELQRKKEKARLQAEAKAAEDARRRAEAEAA  617

Query  711   aeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHS  535
             AEAKRKRE EREAARQALL++E+TVEINENSRFL+DLEMLR  P EQ  SS++E+SP HS
Sbjct  618   AEAKRKRELEREAARQALLQIEKTVEINENSRFLKDLEMLRTAPAEQLPSSVDETSPDHS  677

Query  534   LDALGSFKFTGSNPLEQLGLYMKeddd------feeceppPSSVPKDAKDVEEGEID  382
              D LG F F G NPLEQLGLYMK+DD+              ++ P    D+EEGEID
Sbjct  678   QDGLGGFNFGGCNPLEQLGLYMKDDDEEEDAEPVSVPPSTVNASPSPVNDIEEGEID  734



>ref|XP_009371695.1| PREDICTED: transcription factor GTE8-like isoform X2 [Pyrus x 
bretschneideri]
Length=725

 Score =   194 bits (493),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 154/237 (65%), Positives = 184/237 (78%), Gaps = 7/237 (3%)
 Frame = -1

Query  1071  VNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRF  892
             +++  +G+   S  DQVEQSSQQKP+  E D  Q G+ +  +RP SPEK YRAA+LKNRF
Sbjct  489   IDNPLEGNQSDSGLDQVEQSSQQKPSPVESDCCQHGDSATQERPVSPEKQYRAAVLKNRF  548

Query  891   ADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaa  712
             ADTIL+AREKTL QG+KGDP++LRR+RE LE+QRKKEKARLQAEAKAAE+AR+RAE EAA
Sbjct  549   ADTILRAREKTLNQGDKGDPEKLRRQREELELQRKKEKARLQAEAKAAEDARRRAEAEAA  608

Query  711   aeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHS  535
             AEAKRKRE EREAARQALL++E+TVEINENSRFL+DLEMLR  P EQ  SS++E+SP HS
Sbjct  609   AEAKRKRELEREAARQALLQIEKTVEINENSRFLKDLEMLRTAPAEQLPSSVDETSPDHS  668

Query  534   LDALGSFKFTGSNPLEQLGLYMKeddd------feeceppPSSVPKDAKDVEEGEID  382
              D LG F F G NPLEQLGLYMK+DD+              ++ P    D+EEGEID
Sbjct  669   QDGLGGFNFGGCNPLEQLGLYMKDDDEEEDAEPVSVPPSTVNASPSPVNDIEEGEID  725



>ref|XP_003548539.1| PREDICTED: transcription factor GTE8-like isoform X1 [Glycine 
max]
 ref|XP_006599051.1| PREDICTED: transcription factor GTE8-like isoform X2 [Glycine 
max]
 gb|KHN10846.1| Transcription factor GTE8 [Glycine soja]
Length=744

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 160/245 (65%), Positives = 190/245 (78%), Gaps = 12/245 (5%)
 Frame = -1

Query  1113  DQACLAASIIDRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPAS  934
             D+  +AA+ ++R         +  +S  DQ+E +SQ KP+S + D QQDG+ +  +R  S
Sbjct  511   DEMTMAAATLER---------NQSVSGLDQLEDNSQHKPSSFDSDCQQDGDSAPTERQVS  561

Query  933   PEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeak  754
             P+KLYRAA+LK RF DTILKAREKTL QGEKGDP++LR+ERE LEM++KKEKARLQAEAK
Sbjct  562   PDKLYRAAVLKKRFLDTILKAREKTLTQGEKGDPEKLRQEREKLEMEQKKEKARLQAEAK  621

Query  753   aaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTE  574
             AAE+ARKRAEEEAAAEA+RKRE EREAARQALL+ME+TVEINENSR LEDLEMLR  P E
Sbjct  622   AAEDARKRAEEEAAAEARRKRELEREAARQALLQMEKTVEINENSRILEDLEMLRAVPAE  681

Query  573   Q-HSSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVE  397
             Q  SS++E+SP HS D LGSFKF  SNPLEQLGLY+K   D EE E  P  +P    DVE
Sbjct  682   QLPSSVDETSPAHSQDGLGSFKFGSSNPLEQLGLYIK--ADDEEEEGEPPCIPNPVNDVE  739

Query  396   EGEID  382
             EGEID
Sbjct  740   EGEID  744



>ref|XP_012071037.1| PREDICTED: transcription factor GTE8-like [Jatropha curcas]
 gb|KDP46330.1| hypothetical protein JCGZ_10170 [Jatropha curcas]
Length=742

 Score =   192 bits (488),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 154/221 (70%), Positives = 182/221 (82%), Gaps = 3/221 (1%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             +S  DQ+EQSSQQKP+S E D +QDG+ + ++R  SPEKL RAA+LKNRFADTILKAREK
Sbjct  524   VSGLDQLEQSSQQKPSSVESDCRQDGDSAPSERQVSPEKLIRAAILKNRFADTILKAREK  583

Query  861   TLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe  682
             TL Q +KGDP++L+RE E LEMQ+KKEKARLQAEAKAAE+AR++AE  AAAEA+RKRE E
Sbjct  584   TLSQVDKGDPEKLKREMEELEMQKKKEKARLQAEAKAAEDARRQAEAAAAAEARRKRELE  643

Query  681   reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFT  505
             REAARQALL+ME+TVEINEN+R LEDLEMLR  P E   SS++E+SP HS D LG F+F 
Sbjct  644   REAARQALLQMERTVEINENARLLEDLEMLRSAPAEHLPSSVDETSPDHSQDGLGGFRFG  703

Query  504   GSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GSNPLEQLGL+MK+DD+ EE EP    VP    DVEEGEID
Sbjct  704   GSNPLEQLGLFMKQDDEEEEGEPL--DVPNPVNDVEEGEID  742



>emb|CDP16664.1| unnamed protein product [Coffea canephora]
Length=735

 Score =   192 bits (488),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 165/236 (70%), Positives = 198/236 (84%), Gaps = 3/236 (1%)
 Frame = -1

Query  1083  DRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALL  904
             +++G  DL +G+  +S  DQ+EQSSQ+KPNS E D +QDGE +   RP SPEKLYRAALL
Sbjct  501   EKEGGEDLTEGNQSVSGLDQLEQSSQEKPNSDESDSRQDGESAPARRPVSPEKLYRAALL  560

Query  903   KNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkrae  724
             KNRFADTILKAREKTLGQGEKG+P++LRRERE LE+Q+K+EKARLQAEAKAAE+AR+RAE
Sbjct  561   KNRFADTILKAREKTLGQGEKGNPEKLRREREELELQKKREKARLQAEAKAAEDARRRAE  620

Query  723   eeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESS  547
             EEAAAEA++KRE EREAARQALL+ME+TVEINENSRFLEDLEMLR GP EQ  SS++E+S
Sbjct  621   EEAAAEARKKRELEREAARQALLQMEKTVEINENSRFLEDLEMLRSGPLEQLPSSVDETS  680

Query  546   PQHSLDALGS-FKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             P H  + +GS FKF G+NPLEQLGLYMK  D+ +E   PP+++     DVEEGEID
Sbjct  681   PDHLQEGIGSCFKFGGNNPLEQLGLYMK-VDEEDEEGEPPNALGSVNDDVEEGEID  735



>ref|XP_004231798.1| PREDICTED: transcription factor GTE8-like [Solanum lycopersicum]
 ref|XP_010315934.1| PREDICTED: transcription factor GTE8-like [Solanum lycopersicum]
 ref|XP_010315935.1| PREDICTED: transcription factor GTE8-like [Solanum lycopersicum]
Length=725

 Score =   191 bits (485),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 180/231 (78%), Gaps = 8/231 (3%)
 Frame = -1

Query  1068  NDLADGDGVISLFDQVEQSSQQKPNSSEFDGQ-QDGEISQNDRPASPEKLYRAALLKNRF  892
             N LADG+  I   DQ+EQSSQQ P S + +   QDGE        SP KLYRAALLKNRF
Sbjct  501   NSLADGNHSIDSLDQLEQSSQQMPFSVDSEAAYQDGESR-----VSPGKLYRAALLKNRF  555

Query  891   ADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaa  712
             ADTILKAREKTL + EKGDP++LRRERE LEMQR+K KA+LQAEAKAAEEA++RAE EAA
Sbjct  556   ADTILKAREKTLVEVEKGDPEKLRREREELEMQRRKAKAKLQAEAKAAEEAQRRAEVEAA  615

Query  711   aeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHS  535
             AE KR+RE +REAARQALL+ME+TVEINENS+FLEDLEML   P+EQ HSS++E+SP HS
Sbjct  616   AEVKRRRELDREAARQALLQMEKTVEINENSKFLEDLEMLTAVPSEQLHSSVDETSPDHS  675

Query  534   LDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              D LG+FKF GSNPLEQLGLYMK  DD EE     +    D  DVEEGEID
Sbjct  676   QDGLGTFKFGGSNPLEQLGLYMK-MDDDEEECELATLQSDDPIDVEEGEID  725



>ref|XP_003555161.2| PREDICTED: transcription factor GTE8-like isoform X1 [Glycine 
max]
 gb|KHN01919.1| Transcription factor GTE8 [Glycine soja]
Length=745

 Score =   191 bits (485),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 158/245 (64%), Positives = 191/245 (78%), Gaps = 12/245 (5%)
 Frame = -1

Query  1113  DQACLAASIIDRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPAS  934
             D+  +AA+ ++R         +  +S  DQ++ +SQ KP+S + D QQDG+ +  +R  S
Sbjct  512   DEMTMAAASLER---------NQSVSGLDQLDDNSQHKPSSFDSDCQQDGDSAATERQFS  562

Query  933   PEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeak  754
             P+KLYRAA+LK RF DTILKAREKTL QGEKGDP++LR+ERE LEM++KKEKARLQAEAK
Sbjct  563   PDKLYRAAVLKKRFLDTILKAREKTLTQGEKGDPEKLRQEREKLEMEQKKEKARLQAEAK  622

Query  753   aaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTE  574
             AAE+ARK+AEEEAAAEA+RKRE EREAARQALL+ME+TVEINENSR LEDLE+LR  PTE
Sbjct  623   AAEDARKQAEEEAAAEARRKRELEREAARQALLQMEKTVEINENSRILEDLELLRAVPTE  682

Query  573   Q-HSSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVE  397
             Q  SS++E+SP HS D LGSFKF  SNPLEQLGLY+K   D EE E  P  +P    DVE
Sbjct  683   QLPSSVDETSPAHSQDGLGSFKFGSSNPLEQLGLYIK--ADDEEEEGEPPCIPNPVNDVE  740

Query  396   EGEID  382
             EGEID
Sbjct  741   EGEID  745



>ref|XP_010033385.1| PREDICTED: transcription factor GTE8-like [Eucalyptus grandis]
 ref|XP_010033386.1| PREDICTED: transcription factor GTE8-like [Eucalyptus grandis]
 gb|KCW53010.1| hypothetical protein EUGRSUZ_J02307 [Eucalyptus grandis]
 gb|KCW53011.1| hypothetical protein EUGRSUZ_J02307 [Eucalyptus grandis]
 gb|KCW53012.1| hypothetical protein EUGRSUZ_J02307 [Eucalyptus grandis]
Length=723

 Score =   190 bits (483),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 185/230 (80%), Gaps = 4/230 (2%)
 Frame = -1

Query  1068  NDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFA  889
             ++L D +  +S+ DQ EQ+S  K  S + D  QDGE +  +R  SPEKLYRAALLKNRFA
Sbjct  497   SELIDINRSLSVLDQPEQTSMLKAGSVDSDSFQDGESAPIERQVSPEKLYRAALLKNRFA  556

Query  888   DTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaa  709
             DTILKAREKTL QG+KGDP++LRRERE LE+QR+KEKARLQAEAKAAEEAR+RAE EA A
Sbjct  557   DTILKAREKTLTQGDKGDPEKLRREREELEVQRRKEKARLQAEAKAAEEARRRAEAEALA  616

Query  708   eakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSL  532
             EAKRKRE EREAARQALLKME+TVEINENSRFLEDLEMLR  P E   SS +E SP H+L
Sbjct  617   EAKRKRELEREAARQALLKMEKTVEINENSRFLEDLEMLRTAPGEHLPSSADEMSPDHNL  676

Query  531   DALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             + LGSFK  GSNPLEQLGL+MK D++ EE EPP  S   + +DVEEGEID
Sbjct  677   EPLGSFKLGGSNPLEQLGLFMKADEEEEEAEPPAFS---NHEDVEEGEID  723



>ref|XP_007140890.1| hypothetical protein PHAVU_008G150100g [Phaseolus vulgaris]
 gb|ESW12884.1| hypothetical protein PHAVU_008G150100g [Phaseolus vulgaris]
Length=744

 Score =   189 bits (479),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 152/221 (69%), Positives = 178/221 (81%), Gaps = 3/221 (1%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             +S  DQ+E +SQ KP+S + D  QDG+ +  +R  SP+KLYRAA+LKNRF DTILKAREK
Sbjct  526   LSGLDQLEDNSQFKPSSFDSDCHQDGDSAPTERQVSPDKLYRAAVLKNRFLDTILKAREK  585

Query  861   TLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe  682
             TL QGEKGDP++LR ERE LEM+++KEKARLQAEAKAAE+ARK+AE EAAAEA+RKRE E
Sbjct  586   TLTQGEKGDPEKLRLEREKLEMEQRKEKARLQAEAKAAEDARKQAEAEAAAEARRKRELE  645

Query  681   reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFT  505
             REAARQALL+ME+TVEINENSR LEDLEMLR  P EQ  SS++E+SP HS D LGSFKF 
Sbjct  646   REAARQALLQMEKTVEINENSRLLEDLEMLRAVPAEQLPSSVDETSPDHSQDGLGSFKFG  705

Query  504   GSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              SNPLEQLGLY+K   D E+ E  P  +P    DVEEGEID
Sbjct  706   SSNPLEQLGLYIK--ADDEDEEGEPPCIPNPVHDVEEGEID  744



>ref|XP_008231170.1| PREDICTED: transcription factor GTE8 [Prunus mume]
 ref|XP_008231171.1| PREDICTED: transcription factor GTE8 [Prunus mume]
Length=735

 Score =   188 bits (477),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 193/236 (82%), Gaps = 2/236 (1%)
 Frame = -1

Query  1086  IDRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAAL  907
             +D K +++  +G+   S  DQVEQSSQ+KP+  E D  QDG+ +  +RP SPEK YRAAL
Sbjct  501   LDEKTIDNRLEGNQSDSGLDQVEQSSQRKPSPVESDCCQDGDSAPTERPVSPEKQYRAAL  560

Query  906   LKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkra  727
             LKNRFADTIL+AREKTL QG+KGDP++LRRERE LE+Q+KKEKARLQAEAKAAE+AR++A
Sbjct  561   LKNRFADTILRAREKTLNQGDKGDPEKLRREREELELQQKKEKARLQAEAKAAEDARRQA  620

Query  726   eeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNES  550
             E EAAAEAKRKRE EREAARQALL++E+TVEINENS+FL+DLEMLR  P EQ  SS++E+
Sbjct  621   EAEAAAEAKRKRELEREAARQALLQIEKTVEINENSQFLQDLEMLRTAPVEQLPSSVDET  680

Query  549   SPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             SP HS D LG F+F GSNPLEQLGLY+K DD+ EE   P +SVP    D+EEGEID
Sbjct  681   SPDHSQDGLGGFRFGGSNPLEQLGLYIK-DDEEEEEIEPAASVPSPVNDIEEGEID  735



>ref|XP_010248882.1| PREDICTED: transcription factor GTE10-like [Nelumbo nucifera]
 ref|XP_010248883.1| PREDICTED: transcription factor GTE10-like [Nelumbo nucifera]
 ref|XP_010248884.1| PREDICTED: transcription factor GTE10-like [Nelumbo nucifera]
Length=784

 Score =   188 bits (478),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 154/230 (67%), Positives = 180/230 (78%), Gaps = 3/230 (1%)
 Frame = -1

Query  1065  DLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFAD  886
             D  DG+  +S  DQ+EQ++  KP S E +   +G+   ++R  SPEKLYRAALL++RFAD
Sbjct  556   DSHDGNQSVSGLDQLEQNAPAKPVSVETNEHHEGDSVASERHVSPEKLYRAALLRSRFAD  615

Query  885   TILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaae  706
             TILKAREK L QGEKGDP++LRRERE LE Q+++EKARLQAEAKAAE+AR++AE EAAAE
Sbjct  616   TILKAREKALDQGEKGDPEKLRREREELEKQQREEKARLQAEAKAAEDARRQAEAEAAAE  675

Query  705   akrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLD  529
             AKRKRE EREAARQAL KME+TVEINEN  FLEDLEMLR  P E   SS++E+SP HS D
Sbjct  676   AKRKRELEREAARQALQKMEKTVEINENCHFLEDLEMLRAAPAEHLPSSVDETSPDHSQD  735

Query  528   ALGSFKFTG-SNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              +G FKF G SNPLEQLGLYMK  DD EE +  PSSVP    DVEEGEID
Sbjct  736   GMGGFKFRGSSNPLEQLGLYMK-MDDEEEEDVEPSSVPDPVNDVEEGEID  784



>ref|XP_006604121.1| PREDICTED: transcription factor GTE8-like isoform X2 [Glycine 
max]
Length=746

 Score =   188 bits (477),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 158/246 (64%), Positives = 190/246 (77%), Gaps = 13/246 (5%)
 Frame = -1

Query  1113  DQACLAASIIDRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPAS  934
             D+  +AA+ ++R         +  +S  DQ++ +SQ KP+S + D QQDG+ +  +R  S
Sbjct  512   DEMTMAAASLER---------NQSVSGLDQLDDNSQHKPSSFDSDCQQDGDSAATERQFS  562

Query  933   PEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEM-Qrkkekarlqaea  757
             P+KLYRAA+LK RF DTILKAREKTL QGEKGDP++LR+ERE LEM Q+K EKARLQAEA
Sbjct  563   PDKLYRAAVLKKRFLDTILKAREKTLTQGEKGDPEKLRQEREKLEMEQKKAEKARLQAEA  622

Query  756   kaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPT  577
             KAAE+ARK+AEEEAAAEA+RKRE EREAARQALL+ME+TVEINENSR LEDLE+LR  PT
Sbjct  623   KAAEDARKQAEEEAAAEARRKRELEREAARQALLQMEKTVEINENSRILEDLELLRAVPT  682

Query  576   EQ-HSSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDV  400
             EQ  SS++E+SP HS D LGSFKF  SNPLEQLGLY+K   D EE E  P  +P    DV
Sbjct  683   EQLPSSVDETSPAHSQDGLGSFKFGSSNPLEQLGLYIK--ADDEEEEGEPPCIPNPVNDV  740

Query  399   EEGEID  382
             EEGEID
Sbjct  741   EEGEID  746



>ref|XP_002509565.1| bromodomain-containing protein, putative [Ricinus communis]
 gb|EEF50952.1| bromodomain-containing protein, putative [Ricinus communis]
Length=718

 Score =   187 bits (475),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 183/228 (80%), Gaps = 3/228 (1%)
 Frame = -1

Query  1062  LADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADT  883
             + D    +S  DQ+EQ+SQQKP+S E D  QDG+ + N+R  SP+KL+RAA+LKNRFA+T
Sbjct  493   MCDDPESVSGLDQLEQTSQQKPSSVESDCCQDGDSAPNERQVSPDKLFRAAMLKNRFAET  552

Query  882   ILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaea  703
             ILKAREKTL Q +KGDP++LRRE+  LE+Q+KKEKARLQAEAKAAE+ARK+AE  AAAEA
Sbjct  553   ILKAREKTLSQVDKGDPEKLRREKVELELQKKKEKARLQAEAKAAEDARKQAEAAAAAEA  612

Query  702   krkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDA  526
             +RKRE EREAARQALLKME+TVEINENS+ LEDLEMLR  P E   SS++E+SP HS D 
Sbjct  613   RRKRELEREAARQALLKMEKTVEINENSQLLEDLEMLRAAPVEHLPSSVDETSPVHSQDG  672

Query  525   LGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             LG FKF GSNPLEQLGL+MK+D++ EE EP     P    D+EEGEID
Sbjct  673   LGGFKFGGSNPLEQLGLFMKQDEEEEEGEPLNILNP--VNDMEEGEID  718



>gb|KJB33937.1| hypothetical protein B456_006G039400 [Gossypium raimondii]
 gb|KJB33938.1| hypothetical protein B456_006G039400 [Gossypium raimondii]
Length=737

 Score =   186 bits (473),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 152/217 (70%), Positives = 176/217 (81%), Gaps = 3/217 (1%)
 Frame = -1

Query  1029  DQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQ  850
             DQ+EQ+SQ+KP+S E D  QDG+ +  +R  SPEKLYRAAL+KNRFADTILKAREKTL Q
Sbjct  523   DQLEQTSQRKPSSVESDSCQDGDNAPTERQISPEKLYRAALIKNRFADTILKAREKTLIQ  582

Query  849   GEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaa  670
             G+KGDP++LRRERE LE QRKKEKARLQAEAKAAE+AR+RAE EAAAEA+RKRE EREAA
Sbjct  583   GDKGDPEKLRREREELEQQRKKEKARLQAEAKAAEDARRRAEAEAAAEARRKRELEREAA  642

Query  669   rqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSNP  493
             R+ALL+ME+T+EINENS FLEDLEMLR  P +   SS+  +   HS+D LGSFKF  SNP
Sbjct  643   RKALLEMEKTIEINENSGFLEDLEMLRAAPVDNLPSSVEGTCTDHSVDGLGSFKFGSSNP  702

Query  492   LEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             LEQLGLYMK  +D EE E  P S+P    D EEGEID
Sbjct  703   LEQLGLYMK--EDEEEEEGEPPSIPNPMNDAEEGEID  737



>ref|XP_007215507.1| hypothetical protein PRUPE_ppa003659mg [Prunus persica]
 gb|EMJ16706.1| hypothetical protein PRUPE_ppa003659mg [Prunus persica]
Length=558

 Score =   185 bits (469),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 160/236 (68%), Positives = 192/236 (81%), Gaps = 2/236 (1%)
 Frame = -1

Query  1086  IDRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAAL  907
             +D K +++  +G+   S  DQVEQSSQQKP+  E D  QDG+ +  +RP SPEK YRAA+
Sbjct  324   LDEKTIDNRLEGNQSDSGLDQVEQSSQQKPSPVESDCCQDGDSAPTERPVSPEKQYRAAI  383

Query  906   LKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkra  727
             LK RFADTIL+AREKTL QG+KGDP++LRRERE LE+Q+KKEKARLQAEAKAAE+AR+RA
Sbjct  384   LKERFADTILRAREKTLNQGDKGDPEKLRREREELELQQKKEKARLQAEAKAAEDARRRA  443

Query  726   eeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNES  550
             E EAAAEAKRKRE EREAARQALL++E+TVEINENS+FL+DLEMLR  P EQ  SS++E+
Sbjct  444   EAEAAAEAKRKRELEREAARQALLQIEKTVEINENSQFLQDLEMLRTAPVEQLPSSVDET  503

Query  549   SPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             SP HS D LG F+F GSNPLEQLGLY+K DD+ EE   P +SVP    D+EEGEID
Sbjct  504   SPDHSQDGLGGFRFGGSNPLEQLGLYIK-DDEEEEEIEPAASVPIPVNDIEEGEID  558



>ref|XP_011098835.1| PREDICTED: transcription factor GTE8 [Sesamum indicum]
Length=720

 Score =   186 bits (472),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 162/236 (69%), Positives = 188/236 (80%), Gaps = 4/236 (2%)
 Frame = -1

Query  1083  DRKG-VNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAAL  907
             ++KG   +L DG   +S  DQ+EQ SQ +P SS+ DGQ DGE +Q +R  SP+KLYRAAL
Sbjct  487   EKKGDAEELVDGHASVSGLDQLEQGSQLRPYSSDSDGQLDGESAQAERQVSPDKLYRAAL  546

Query  906   LKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkra  727
             LKNRFADTILKAREKTL Q +K DP++LRRERE LEM +++EKARLQAEA+AAE+ARKRA
Sbjct  547   LKNRFADTILKAREKTLNQDDKADPERLRREREELEMHKRREKARLQAEARAAEDARKRA  606

Query  726   eeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLR-VGPTEQHSSLNES  550
             E EAAAEAKR+RE EREAAR+ALLKME+TVEINENSRFLEDLEMLR V P +  SS++E+
Sbjct  607   EAEAAAEAKRRRELEREAAREALLKMEKTVEINENSRFLEDLEMLRAVAPEQLPSSVDET  666

Query  549   SPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             SP  S D  GSFKF GSNPLEQLGLYMK   D EE E  P S+P    DVEEGEID
Sbjct  667   SPDRSPDGFGSFKFGGSNPLEQLGLYMK--VDDEEEEADPPSIPNAVDDVEEGEID  720



>gb|KHG21057.1| Transcription factor GTE8 -like protein [Gossypium arboreum]
Length=737

 Score =   185 bits (469),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 153/217 (71%), Positives = 174/217 (80%), Gaps = 3/217 (1%)
 Frame = -1

Query  1029  DQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQ  850
             DQ+EQ+SQ+KP+S E D  QDG+ +  +R  SPEKLYRAAL+KNRFADTILKAREKTL Q
Sbjct  523   DQLEQTSQRKPSSVESDSCQDGDNAPTERQISPEKLYRAALIKNRFADTILKAREKTLIQ  582

Query  849   GEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaa  670
             G+KGDP++LRRERE LE QRKKEKARLQAEAKAAE+AR+RAE EAAAEA+RKRE EREAA
Sbjct  583   GDKGDPEKLRREREELEQQRKKEKARLQAEAKAAEDARRRAEAEAAAEARRKRELEREAA  642

Query  669   rqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSNP  493
             R ALL+ME+T+EINENSRFLEDLEMLR  P +   SS+  +    S+D LGSFKF  SNP
Sbjct  643   RNALLEMEKTIEINENSRFLEDLEMLRAAPDDNLPSSVEGTCTDLSVDGLGSFKFGSSNP  702

Query  492   LEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             LEQLGLYMK   D EE E  P SVP    D EEGEID
Sbjct  703   LEQLGLYMK--KDEEEEEGEPPSVPNPMNDAEEGEID  737



>ref|XP_008379142.1| PREDICTED: transcription factor GTE8-like isoform X1 [Malus domestica]
Length=734

 Score =   184 bits (467),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 151/243 (62%), Positives = 184/243 (76%), Gaps = 10/243 (4%)
 Frame = -1

Query  1083  DRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALL  904
             ++  +++  +G+   S  DQVEQSSQQKP+  E D  Q G+ +  +R  SPEK YRAALL
Sbjct  493   EKTTIDNPLEGNHSDSGLDQVEQSSQQKPSPVESDCCQHGDSAPPERSVSPEKQYRAALL  552

Query  903   KNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkrae  724
             KNRFADTIL+AREKTL QG+K DP++LRR+RE LE+Q+KKEKARLQAEAKAAE+AR+RAE
Sbjct  553   KNRFADTILRAREKTLNQGDKEDPEKLRRQREELELQQKKEKARLQAEAKAAEDARRRAE  612

Query  723   eeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESS  547
              EAAAEAKRKRE EREAARQAL+++E+TVEINENSRFL+DLEMLR  P EQ  SS++E+S
Sbjct  613   AEAAAEAKRKRELEREAARQALMQIEKTVEINENSRFLKDLEMLRTAPAEQLPSSVDETS  672

Query  546   PQHSLDALGSFKFTGSNPLEQLGLYMK--------edddfeeceppPSSVPKDAKDVEEG  391
             P HS + LG FKF GSNPLEQLGLYMK        +        P  +S+     D+EEG
Sbjct  673   PDHSQECLGGFKFGGSNPLEQLGLYMKDDEEEEDADPVSSVPPSPVSASI-SPVNDIEEG  731

Query  390   EID  382
             EID
Sbjct  732   EID  734



>ref|XP_008379143.1| PREDICTED: transcription factor GTE8-like isoform X2 [Malus domestica]
Length=725

 Score =   184 bits (466),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 151/243 (62%), Positives = 184/243 (76%), Gaps = 10/243 (4%)
 Frame = -1

Query  1083  DRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALL  904
             ++  +++  +G+   S  DQVEQSSQQKP+  E D  Q G+ +  +R  SPEK YRAALL
Sbjct  484   EKTTIDNPLEGNHSDSGLDQVEQSSQQKPSPVESDCCQHGDSAPPERSVSPEKQYRAALL  543

Query  903   KNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkrae  724
             KNRFADTIL+AREKTL QG+K DP++LRR+RE LE+Q+KKEKARLQAEAKAAE+AR+RAE
Sbjct  544   KNRFADTILRAREKTLNQGDKEDPEKLRRQREELELQQKKEKARLQAEAKAAEDARRRAE  603

Query  723   eeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESS  547
              EAAAEAKRKRE EREAARQAL+++E+TVEINENSRFL+DLEMLR  P EQ  SS++E+S
Sbjct  604   AEAAAEAKRKRELEREAARQALMQIEKTVEINENSRFLKDLEMLRTAPAEQLPSSVDETS  663

Query  546   PQHSLDALGSFKFTGSNPLEQLGLYMK--------edddfeeceppPSSVPKDAKDVEEG  391
             P HS + LG FKF GSNPLEQLGLYMK        +        P  +S+     D+EEG
Sbjct  664   PDHSQECLGGFKFGGSNPLEQLGLYMKDDEEEEDADPVSSVPPSPVSASI-SPVNDIEEG  722

Query  390   EID  382
             EID
Sbjct  723   EID  725



>ref|XP_009627906.1| PREDICTED: transcription factor GTE8-like [Nicotiana tomentosiformis]
 ref|XP_009627907.1| PREDICTED: transcription factor GTE8-like [Nicotiana tomentosiformis]
Length=725

 Score =   181 bits (459),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 168/241 (70%), Positives = 192/241 (80%), Gaps = 6/241 (2%)
 Frame = -1

Query  1095  ASIIDRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYR  916
             A +  ++  N LADGD  IS  DQ+EQSSQQ P S E +  QDGE S  DR  SPEKLYR
Sbjct  488   AKVDGKEAGNSLADGDQSISGMDQLEQSSQQMPISVESEAYQDGE-SVPDRRVSPEKLYR  546

Query  915   AALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeear  736
             AALLKNRFADTILKAREKTL + EKGDP++LRRERE LEM+R+KEKA+LQAEAKAAEEA+
Sbjct  547   AALLKNRFADTILKAREKTLVEVEKGDPEKLRREREELEMRRRKEKAKLQAEAKAAEEAQ  606

Query  735   kraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSL  559
             +RAE EAAAEAKR+RE +REAARQALL+ME+TVEINENS+FLEDLEML   P EQ  SS+
Sbjct  607   RRAEAEAAAEAKRRRELDREAARQALLQMEKTVEINENSKFLEDLEMLTAVPPEQLPSSV  666

Query  558   NESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDV--EEGEI  385
             +E+SP HS D LG FKF GSN LEQLGLYMK   D +E E  P++VP D KDV  EEGEI
Sbjct  667   DETSPDHSQDGLGGFKFGGSNALEQLGLYMK--MDDDEEECEPATVPSDPKDVEPEEGEI  724

Query  384   D  382
             D
Sbjct  725   D  725



>ref|XP_006376891.1| hypothetical protein POPTR_0012s09590g [Populus trichocarpa]
 gb|ERP54688.1| hypothetical protein POPTR_0012s09590g [Populus trichocarpa]
Length=246

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 182/236 (77%), Gaps = 3/236 (1%)
 Frame = -1

Query  1080  RKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLK  901
             R  + D A  +  +    QVE  ++ KP ++E DG Q+GE +  +R  SPEKLYRAALL+
Sbjct  11    RSHLGDPAVRNQSVDGLAQVELDTEGKPVAAEADGHQEGESAPPERQVSPEKLYRAALLR  70

Query  900   NRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraee  721
             NRFADTILKAREK L +GEK DP++LR+E+E  E ++K+EKARLQAEAKAAEEAR++AE 
Sbjct  71    NRFADTILKAREKALEKGEKRDPEKLRKEKEEFERRQKEEKARLQAEAKAAEEARRKAEA  130

Query  720   eaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQH--SSLNESS  547
             EAAAEAKR+RE EREAARQAL++ME+TV+INEN +F+EDLEMLR+   ++   S + E+S
Sbjct  131   EAAAEAKRQRELEREAARQALIQMEKTVDINENCQFMEDLEMLRIAHHDEQLPSFIEETS  190

Query  546   PQHSLDALGSFKFTGSNPLEQLGLYMKedddfeecepp-PSSVPKDAKDVEEGEID  382
             P HS + LGSFK  GSNPLEQLGLYMKEDD+ EE     PSSVP   KDVEEGEID
Sbjct  191   PDHSQNGLGSFKLQGSNPLEQLGLYMKEDDEDEEEVVEPPSSVPDLTKDVEEGEID  246



>ref|XP_004514963.1| PREDICTED: transcription factor GTE8-like [Cicer arietinum]
Length=768

 Score =   179 bits (455),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 175/221 (79%), Gaps = 3/221 (1%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             ++  D+ E  SQ KP S + +  QDGE    +R  SP+KLYRAALLKNRFADTILKAREK
Sbjct  550   VNGLDKHEDKSQPKPISRDSNFYQDGECGPTERQVSPDKLYRAALLKNRFADTILKAREK  609

Query  861   TLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe  682
             TL QG KGDP++LRR++E LEM+R++EKARLQAEAKAAEEA+KRAE EAAAE KRKRE E
Sbjct  610   TLTQGVKGDPEKLRRDKEKLEMERRQEKARLQAEAKAAEEAKKRAEAEAAAEVKRKRELE  669

Query  681   reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFT  505
             REAARQALLKME+TVEI+ENS+FLEDLE+LR  P E   SS++E+SP HS D +GSF+F 
Sbjct  670   REAARQALLKMEKTVEIDENSQFLEDLELLRAVPAEPLPSSVDETSPDHSQDGMGSFRFG  729

Query  504   GSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             G NPLEQLGLY+K DD+ E+ +     VP    DVEEGEID
Sbjct  730   GCNPLEQLGLYIKVDDEEEDGDLV--CVPNPVNDVEEGEID  768



>ref|XP_006599055.1| PREDICTED: transcription factor GTE8-like isoform X4 [Glycine 
max]
 gb|KHN10847.1| Transcription factor GTE8 [Glycine soja]
Length=759

 Score =   179 bits (453),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 146/240 (61%), Positives = 186/240 (78%), Gaps = 2/240 (1%)
 Frame = -1

Query  1098  AASIIDRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLY  919
              A +++    +D ++ +  +   D++E +SQQKP+S   D  QDGE    +R  SP+KLY
Sbjct  521   GAQMVENSRADDTSERNQSVGGLDKLEDNSQQKPSSFSSDCHQDGECGPTERKVSPDKLY  580

Query  918   RAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeea  739
             RAALLKNRFADTILKAREKTL +GEKGDP++LR++RE LE++R+KE+ARLQAEAKAAE+A
Sbjct  581   RAALLKNRFADTILKAREKTLTKGEKGDPEKLRQQREKLEIERQKERARLQAEAKAAEDA  640

Query  738   rkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSS  562
             RKRA+ EAAAEA+RKRE EREAARQ LL+ME++VEINENS+FLED E+L   P EQ  SS
Sbjct  641   RKRADAEAAAEARRKRELEREAARQVLLQMEKSVEINENSQFLEDFELLSAVPAEQLPSS  700

Query  561   LNESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             ++E+SP  S D +GSFKF G NPLEQLGLY+K+DD+ EE +P     P    D+EEGEID
Sbjct  701   VDETSPDISQDGMGSFKFGGGNPLEQLGLYIKDDDEEEEGDPLCVPNPP-VNDIEEGEID  759



>ref|XP_004516282.1| PREDICTED: transcription factor GTE8-like isoform X1 [Cicer arietinum]
 ref|XP_004516283.1| PREDICTED: transcription factor GTE8-like isoform X2 [Cicer arietinum]
Length=797

 Score =   177 bits (450),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 170/221 (77%), Gaps = 3/221 (1%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             ++  DQVE +SQ K +S +   QQDG+    +R  SP+KLYR ALLKNRF DTILKAREK
Sbjct  579   VTDLDQVEDNSQDKRSSFDSYFQQDGDSGPTERQVSPDKLYRVALLKNRFVDTILKAREK  638

Query  861   TLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe  682
             TL QGEKGDP +LR ERE LEM+++KEKARL AEAKAAE+ARK+AE EAAAEA+RK E E
Sbjct  639   TLTQGEKGDPVKLRLEREKLEMEQRKEKARLLAEAKAAEDARKQAEAEAAAEARRKIELE  698

Query  681   reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFT  505
             REAARQAL +ME+TVEI+EN RFLEDLE LR  P EQ  S ++E+SP HS D LGSFKF 
Sbjct  699   REAARQALTQMEKTVEIHENPRFLEDLERLRAVPAEQLPSYVDETSPDHSQDGLGSFKFD  758

Query  504   GSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              SNPLEQLGLYMK   D E+ E  P SVP    DVEEGEID
Sbjct  759   SSNPLEQLGLYMK--IDDEDEEGEPPSVPNPVNDVEEGEID  797



>ref|XP_004516284.1| PREDICTED: transcription factor GTE8-like isoform X3 [Cicer arietinum]
Length=790

 Score =   177 bits (450),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 148/221 (67%), Positives = 170/221 (77%), Gaps = 3/221 (1%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             ++  DQVE +SQ K +S +   QQDG+    +R  SP+KLYR ALLKNRF DTILKAREK
Sbjct  572   VTDLDQVEDNSQDKRSSFDSYFQQDGDSGPTERQVSPDKLYRVALLKNRFVDTILKAREK  631

Query  861   TLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe  682
             TL QGEKGDP +LR ERE LEM+++KEKARL AEAKAAE+ARK+AE EAAAEA+RK E E
Sbjct  632   TLTQGEKGDPVKLRLEREKLEMEQRKEKARLLAEAKAAEDARKQAEAEAAAEARRKIELE  691

Query  681   reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFT  505
             REAARQAL +ME+TVEI+EN RFLEDLE LR  P EQ  S ++E+SP HS D LGSFKF 
Sbjct  692   REAARQALTQMEKTVEIHENPRFLEDLERLRAVPAEQLPSYVDETSPDHSQDGLGSFKFD  751

Query  504   GSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              SNPLEQLGLYMK   D E+ E  P SVP    DVEEGEID
Sbjct  752   SSNPLEQLGLYMK--IDDEDEEGEPPSVPNPVNDVEEGEID  790



>ref|XP_009802944.1| PREDICTED: transcription factor GTE8-like [Nicotiana sylvestris]
 ref|XP_009802946.1| PREDICTED: transcription factor GTE8-like [Nicotiana sylvestris]
Length=725

 Score =   177 bits (448),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 166/241 (69%), Positives = 192/241 (80%), Gaps = 6/241 (2%)
 Frame = -1

Query  1095  ASIIDRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYR  916
             A +  ++  + LADGD  IS  DQ+EQSSQQ P S E +  QDGE S  DR  SPEKLYR
Sbjct  488   AKVDGKEAGSSLADGDQSISGMDQLEQSSQQMPISVESEAYQDGE-SVPDRRVSPEKLYR  546

Query  915   AALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeear  736
             AALLKNRFADTILKAREKTL + EKGDP++LRRERE LEM+R+KEKA+LQAEAKAAEEA+
Sbjct  547   AALLKNRFADTILKAREKTLVEVEKGDPEKLRREREELEMRRRKEKAKLQAEAKAAEEAQ  606

Query  735   kraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSL  559
             +RAE EAAAEAKR+RE +REAARQALL+ME+TVEINENS+FLEDLEML   P EQ  SS+
Sbjct  607   RRAEAEAAAEAKRRRELDREAARQALLQMEKTVEINENSKFLEDLEMLTAVPPEQLPSSV  666

Query  558   NESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDV--EEGEI  385
             +E+SP HS D LG FKF GSN LEQLGLYMK   D +E E  P+++P D KDV  EEGEI
Sbjct  667   DETSPDHSQDGLGGFKFGGSNALEQLGLYMK--MDDDEEECEPATLPSDPKDVEPEEGEI  724

Query  384   D  382
             D
Sbjct  725   D  725



>ref|XP_006599052.1| PREDICTED: transcription factor GTE8-like isoform X1 [Glycine 
max]
 ref|XP_006599053.1| PREDICTED: transcription factor GTE8-like isoform X2 [Glycine 
max]
Length=786

 Score =   177 bits (448),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 176/218 (81%), Gaps = 2/218 (1%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLG  853
              D++E +SQQKP+S   D  QDGE    +R  SP+KLYRAALLKNRFADTILKAREKTL 
Sbjct  570   LDKLEDNSQQKPSSFSSDCHQDGECGPTERKVSPDKLYRAALLKNRFADTILKAREKTLT  629

Query  852   QGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkreferea  673
             +GEKGDP++LR++RE LE++R+KE+ARLQAEAKAAE+ARKRA+ EAAAEA+RKRE EREA
Sbjct  630   KGEKGDPEKLRQQREKLEIERQKERARLQAEAKAAEDARKRADAEAAAEARRKRELEREA  689

Query  672   arqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSN  496
             ARQ LL+ME++VEINENS+FLED E+L   P EQ  SS++E+SP  S D +GSFKF G N
Sbjct  690   ARQVLLQMEKSVEINENSQFLEDFELLSAVPAEQLPSSVDETSPDISQDGMGSFKFGGGN  749

Query  495   PLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             PLEQLGLY+K+DD+ EE +P     P    D+EEGEID
Sbjct  750   PLEQLGLYIKDDDEEEEGDPLCVPNPP-VNDIEEGEID  786



>ref|XP_006599054.1| PREDICTED: transcription factor GTE8-like isoform X3 [Glycine 
max]
Length=782

 Score =   177 bits (448),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 144/218 (66%), Positives = 176/218 (81%), Gaps = 2/218 (1%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLG  853
              D++E +SQQKP+S   D  QDGE    +R  SP+KLYRAALLKNRFADTILKAREKTL 
Sbjct  566   LDKLEDNSQQKPSSFSSDCHQDGECGPTERKVSPDKLYRAALLKNRFADTILKAREKTLT  625

Query  852   QGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkreferea  673
             +GEKGDP++LR++RE LE++R+KE+ARLQAEAKAAE+ARKRA+ EAAAEA+RKRE EREA
Sbjct  626   KGEKGDPEKLRQQREKLEIERQKERARLQAEAKAAEDARKRADAEAAAEARRKRELEREA  685

Query  672   arqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSN  496
             ARQ LL+ME++VEINENS+FLED E+L   P EQ  SS++E+SP  S D +GSFKF G N
Sbjct  686   ARQVLLQMEKSVEINENSQFLEDFELLSAVPAEQLPSSVDETSPDISQDGMGSFKFGGGN  745

Query  495   PLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             PLEQLGLY+K+DD+ EE +P     P    D+EEGEID
Sbjct  746   PLEQLGLYIKDDDEEEEGDPLCVPNPP-VNDIEEGEID  782



>ref|XP_010528182.1| PREDICTED: transcription factor GTE8 [Tarenaya hassleriana]
 ref|XP_010528183.1| PREDICTED: transcription factor GTE8 [Tarenaya hassleriana]
 ref|XP_010528185.1| PREDICTED: transcription factor GTE8 [Tarenaya hassleriana]
Length=716

 Score =   173 bits (439),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 151/237 (64%), Positives = 185/237 (78%), Gaps = 5/237 (2%)
 Frame = -1

Query  1083  DRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALL  904
             ++ G++   +     S  DQ++ SS QKP+S + +  +DG + +  R  S EKLYRAALL
Sbjct  482   EKTGIDGAVERSQSPSGMDQLDSSSHQKPSSDDSECHRDGNVLE--RQLSSEKLYRAALL  539

Query  903   KNRFADTILKAREKTLGQGE-KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkra  727
             KNRFAD ILKAREKTL Q + KGDP++LR+ERE  E+Q+KKEKARLQAEAKAAE+AR++A
Sbjct  540   KNRFADIILKAREKTLPQNDVKGDPERLRKEREEFELQKKKEKARLQAEAKAAEDARRQA  599

Query  726   eeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNES  550
             E  A AEAKRKRE EREAARQALL ME+TVEINENSRFLEDLEML  GP EQ  SS +E+
Sbjct  600   EAAATAEAKRKRELEREAARQALLMMEKTVEINENSRFLEDLEMLSSGPPEQIPSSADET  659

Query  549   SPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKD-AKDVEEGEID  382
             SP+ +L+ LGSFK +GSNPLEQLGLYMK+DD+ +E +PPP +     AKDVEEGEID
Sbjct  660   SPERTLEGLGSFKLSGSNPLEQLGLYMKQDDEEDEPDPPPPAPLPSLAKDVEEGEID  716



>ref|XP_008792223.1| PREDICTED: transcription factor GTE8-like [Phoenix dactylifera]
Length=290

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 149/221 (67%), Positives = 173/221 (78%), Gaps = 5/221 (2%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             +S  D  EQ ++ K    E DG Q+GE + ++R  SPEKLYRAALL++RFADTILKAREK
Sbjct  74    VSGMDHPEQDARPK-VPVEADGHQEGENAPSERQVSPEKLYRAALLRSRFADTILKAREK  132

Query  861   TLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe  682
             TLGQGEKGDP++L+RE+E LE QR++EKARLQAEAKAAEEAR+RAE EAAAEAKRKRE E
Sbjct  133   TLGQGEKGDPEKLQREKEELEKQRREEKARLQAEAKAAEEARRRAEAEAAAEAKRKRELE  192

Query  681   reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFT  505
             REAARQALLKME+TVEI+ + R L+DLEMLR  P E   SS++E+SP  S D +G F   
Sbjct  193   REAARQALLKMEKTVEISNDCRILKDLEMLRTVPAEHVPSSVDETSPDLSPDGMGGFTLG  252

Query  504   GSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GSNPLEQLGLYMK  DD EE E  PS VP    DVEEGEID
Sbjct  253   GSNPLEQLGLYMK-KDDEEEEEGEPSGVP--VNDVEEGEID  290



>ref|XP_006374557.1| hypothetical protein POPTR_0015s10370g [Populus trichocarpa]
 gb|ERP52354.1| hypothetical protein POPTR_0015s10370g [Populus trichocarpa]
Length=251

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 172/221 (78%), Gaps = 4/221 (2%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLG  853
              DQVE  ++ KP ++E DG Q+GE + + R  SPEKLYRAALL+NRFADTILKAREK L 
Sbjct  31    LDQVELDTEGKPVAAEVDGHQEGESAPSKRQVSPEKLYRAALLRNRFADTILKAREKALE  90

Query  852   QGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkreferea  673
             +GEK DP++LR+E+E  E ++K+EKARLQAEAKAAEEAR++AE EAAAEAKRKRE EREA
Sbjct  91    KGEKCDPEKLRKEKEEFERRQKEEKARLQAEAKAAEEARRKAEAEAAAEAKRKRELEREA  150

Query  672   arqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDALGSFKFTG-S  499
             ARQALL+ME+TV+INENS F+EDLEMLR    EQ  S + E+SP  S + LGSFK  G S
Sbjct  151   ARQALLEMEKTVDINENSHFMEDLEMLRTVHDEQLPSFIEETSPDLSQNCLGSFKLQGSS  210

Query  498   NPLEQLGLYMKedddfeeceppPSSVPKD--AKDVEEGEID  382
             NPLEQLGLYMKEDDD EE    P        AKDVEEGEID
Sbjct  211   NPLEQLGLYMKEDDDEEEEVVEPPPPSVPERAKDVEEGEID  251



>emb|CDY20057.1| BnaA09g01940D [Brassica napus]
Length=645

 Score =   168 bits (426),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 146/215 (68%), Positives = 168/215 (78%), Gaps = 9/215 (4%)
 Frame = -1

Query  1008  QQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE-KGDP  832
             QQKP+S E D Q DG I +   PA  EK YRAALLKN+FAD ILKAREKTL Q   KGDP
Sbjct  434   QQKPSSDESDSQPDGNILET--PAPSEKQYRAALLKNKFADIILKAREKTLPQNSNKGDP  491

Query  831   DQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefere----aarq  664
             ++LR+ERE LE+Q KKE+ARLQAEA+AAE+AR++AE EAAAEA  + + +RE    AARQ
Sbjct  492   EKLRKEREELELQMKKERARLQAEAEAAEDARRQAEAEAAAEAAAESKRKRELEREAARQ  551

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSNPLE  487
             ALLKMEQTVEINENSRFLEDLEML     EQ  SS++E+SP+  LDALGSF F G NPLE
Sbjct  552   ALLKMEQTVEINENSRFLEDLEMLSSSAPEQLPSSVDETSPERGLDALGSFNFRGINPLE  611

Query  486   QLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             QLGLYMK+D+D EE E P  +VPK A DVEEGEID
Sbjct  612   QLGLYMKQDEDEEEPEAPR-AVPKLATDVEEGEID  645



>ref|XP_011040406.1| PREDICTED: transcription factor GTE10-like [Populus euphratica]
Length=787

 Score =   169 bits (428),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 146/236 (62%), Positives = 182/236 (77%), Gaps = 3/236 (1%)
 Frame = -1

Query  1080  RKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLK  901
             R  + D A  +  +    QVE  ++ K  ++E DG Q+GE +  +R  SPEKLYRAALL+
Sbjct  552   RSHLGDPAVRNQSVDGLAQVELDTEGKLVAAEADGHQEGESAPPERQVSPEKLYRAALLR  611

Query  900   NRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraee  721
             NRFADTILKAREK L +GEK DP++LR+E+E  E ++K+EKARLQAEAKAAEEA+++AE 
Sbjct  612   NRFADTILKAREKALEKGEKRDPEKLRKEKEEFERRQKEEKARLQAEAKAAEEAQRKAEA  671

Query  720   eaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQH--SSLNESS  547
             EAAAEAKR+RE EREAARQAL++ME+TV+INEN +F+EDLEMLR+   ++   SS+ E+S
Sbjct  672   EAAAEAKRQRELEREAARQALIQMEKTVDINENCQFMEDLEMLRIAHHDEQLPSSVEETS  731

Query  546   PQHSLDALGSFKFTGSNPLEQLGLYMKedddfeecepp-PSSVPKDAKDVEEGEID  382
             P HS + LGSFK  GSNPLEQLGLYMKEDD+ EE     PSSVP   KDVEEGEID
Sbjct  732   PDHSQNGLGSFKLQGSNPLEQLGLYMKEDDEDEEEVVEPPSSVPDLTKDVEEGEID  787



>ref|XP_009111562.1| PREDICTED: transcription factor GTE8-like [Brassica rapa]
Length=651

 Score =   166 bits (420),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 146/217 (67%), Positives = 169/217 (78%), Gaps = 9/217 (4%)
 Frame = -1

Query  1014  SSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE-KG  838
             + QQKP+S E D Q DG + +   PA  EK YRAALLKN+FAD ILKAREKTL Q   KG
Sbjct  438   AEQQKPSSDESDSQPDGNMLET--PAPSEKQYRAALLKNKFADIILKAREKTLPQNSNKG  495

Query  837   DPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefere----aa  670
             DP++LR+ERE LE+Q KKE+ARLQAEA+AAE+AR++AE EAAAEA  + + +RE    AA
Sbjct  496   DPEKLRKEREELELQMKKERARLQAEAEAAEDARRQAEAEAAAEAAAESKRKRELEREAA  555

Query  669   rqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSNP  493
             RQALLKMEQTVEINENSRFLEDLEML     EQ  SS++E+SP+  LDALGSF F G NP
Sbjct  556   RQALLKMEQTVEINENSRFLEDLEMLSSSAPEQLPSSVDETSPERGLDALGSFNFRGINP  615

Query  492   LEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             LEQLGLYMK+DDD EE E P  +VPK A DVEEGEID
Sbjct  616   LEQLGLYMKQDDDEEEPEAPR-AVPKLATDVEEGEID  651



>ref|XP_010250832.1| PREDICTED: transcription factor GTE9 [Nelumbo nucifera]
 ref|XP_010250834.1| PREDICTED: transcription factor GTE9 [Nelumbo nucifera]
Length=774

 Score =   167 bits (422),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 159/230 (69%), Positives = 182/230 (79%), Gaps = 4/230 (2%)
 Frame = -1

Query  1065  DLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQ-NDRPASPEKLYRAALLKNRFA  889
             D  DG+  IS  DQ+EQS+  KP S E  G+Q+GE +  ++R  SPEKLYRAALL++RFA
Sbjct  547   DSHDGNQSISGLDQLEQSALPKPVSHEA-GRQEGESAPPSERQVSPEKLYRAALLRSRFA  605

Query  888   DTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaa  709
             DTILKAREK L QGEKGDP++LRRERE LE Q+++EKARLQAEAKAAE AR++AE EAAA
Sbjct  606   DTILKAREKALDQGEKGDPEKLRREREELERQQREEKARLQAEAKAAEAARRQAEAEAAA  665

Query  708   eakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSL  532
             EAKRKRE EREAARQAL  ME+TVEINEN +FLEDLEMLR  P E   SS++E+SP HS 
Sbjct  666   EAKRKRELEREAARQALQMMEKTVEINENCQFLEDLEMLRSAPAEPLPSSVDETSPDHSQ  725

Query  531   DALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             D LGSFKF GSNPLEQLGLYMK  DD EE E  P+ VP    DVEEGEID
Sbjct  726   DGLGSFKFRGSNPLEQLGLYMK-MDDEEEEEVEPTGVPDPGNDVEEGEID  774



>ref|XP_008450071.1| PREDICTED: transcription factor GTE8 isoform X2 [Cucumis melo]
Length=750

 Score =   165 bits (418),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 182/218 (83%), Gaps = 4/218 (2%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLG  853
             ++Q EQ+S  KP+S+E D  QDG  + +++P SPE+LYRAALLKNRFADTIL+A+EKT+ 
Sbjct  536   YEQPEQTSS-KPSSTESDCNQDGNYTASEKPVSPERLYRAALLKNRFADTILRAKEKTMT  594

Query  852   QGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkreferea  673
             QG+KGDP++LRRERE LE++++KEKARLQAEAKAA++A++RAE EAAAEAKRKRE +REA
Sbjct  595   QGDKGDPEKLRREREELELEQRKEKARLQAEAKAAQDAQRRAEAEAAAEAKRKRELDREA  654

Query  672   arqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSN  496
             ARQALL++E+TV I+ENS+FLEDLEMLR  P EQ  SS +E+SP HS D LGSFKF GSN
Sbjct  655   ARQALLQIEKTVIIDENSQFLEDLEMLRTAPAEQLPSSGDETSPDHSQDGLGSFKFVGSN  714

Query  495   PLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             PLEQLGL++K D++ EE EP    V    KDVEEGEID
Sbjct  715   PLEQLGLFIKADEEDEEIEPNF--VSNSIKDVEEGEID  750



>ref|XP_008450066.1| PREDICTED: transcription factor GTE8 isoform X1 [Cucumis melo]
 ref|XP_008450067.1| PREDICTED: transcription factor GTE8 isoform X1 [Cucumis melo]
 ref|XP_008450068.1| PREDICTED: transcription factor GTE8 isoform X1 [Cucumis melo]
 ref|XP_008450069.1| PREDICTED: transcription factor GTE8 isoform X1 [Cucumis melo]
 ref|XP_008450070.1| PREDICTED: transcription factor GTE8 isoform X1 [Cucumis melo]
Length=751

 Score =   165 bits (418),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 182/218 (83%), Gaps = 4/218 (2%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLG  853
             ++Q EQ+S  KP+S+E D  QDG  + +++P SPE+LYRAALLKNRFADTIL+A+EKT+ 
Sbjct  537   YEQPEQTSS-KPSSTESDCNQDGNYTASEKPVSPERLYRAALLKNRFADTILRAKEKTMT  595

Query  852   QGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkreferea  673
             QG+KGDP++LRRERE LE++++KEKARLQAEAKAA++A++RAE EAAAEAKRKRE +REA
Sbjct  596   QGDKGDPEKLRREREELELEQRKEKARLQAEAKAAQDAQRRAEAEAAAEAKRKRELDREA  655

Query  672   arqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSN  496
             ARQALL++E+TV I+ENS+FLEDLEMLR  P EQ  SS +E+SP HS D LGSFKF GSN
Sbjct  656   ARQALLQIEKTVIIDENSQFLEDLEMLRTAPAEQLPSSGDETSPDHSQDGLGSFKFVGSN  715

Query  495   PLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             PLEQLGL++K D++ EE EP    V    KDVEEGEID
Sbjct  716   PLEQLGLFIKADEEDEEIEPNF--VSNSIKDVEEGEID  751



>ref|XP_011045187.1| PREDICTED: transcription factor GTE8-like [Populus euphratica]
Length=743

 Score =   165 bits (418),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 142/221 (64%), Positives = 173/221 (78%), Gaps = 3/221 (1%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             +S  DQ+EQ+SQ+K +S E D QQDGE + +D   S EK  R AL+KNRFADTILKA+EK
Sbjct  525   VSGLDQLEQTSQEKLSSVESDCQQDGESAPSDSQVSLEKRIRHALIKNRFADTILKAKEK  584

Query  861   TLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe  682
             TL Q +KGDP +L+RERE LE+ +KKEKARL AEAKAAE+A+++AE  AAAEA++KRE E
Sbjct  585   TLSQVDKGDPQKLQREREELELHKKKEKARLLAEAKAAEDAQRQAEAAAAAEARQKRELE  644

Query  681   reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFT  505
             REAARQALLKME+TVEINENS+FLEDLEMLR  P E   SS++E+SP  S D LG FKF 
Sbjct  645   REAARQALLKMEKTVEINENSQFLEDLEMLRAVPAEHVPSSVDETSPDRSQDGLGGFKFG  704

Query  504   GSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
               NPLEQLGL+MK+D++ EE EP     P +  +VEEGEID
Sbjct  705   ACNPLEQLGLFMKDDEEEEEGEPLNVLNPLN--EVEEGEID  743



>ref|XP_008450073.1| PREDICTED: transcription factor GTE8 isoform X4 [Cucumis melo]
Length=748

 Score =   165 bits (418),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 182/218 (83%), Gaps = 4/218 (2%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLG  853
             ++Q EQ+S  KP+S+E D  QDG  + +++P SPE+LYRAALLKNRFADTIL+A+EKT+ 
Sbjct  534   YEQPEQTSS-KPSSTESDCNQDGNYTASEKPVSPERLYRAALLKNRFADTILRAKEKTMT  592

Query  852   QGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkreferea  673
             QG+KGDP++LRRERE LE++++KEKARLQAEAKAA++A++RAE EAAAEAKRKRE +REA
Sbjct  593   QGDKGDPEKLRREREELELEQRKEKARLQAEAKAAQDAQRRAEAEAAAEAKRKRELDREA  652

Query  672   arqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSN  496
             ARQALL++E+TV I+ENS+FLEDLEMLR  P EQ  SS +E+SP HS D LGSFKF GSN
Sbjct  653   ARQALLQIEKTVIIDENSQFLEDLEMLRTAPAEQLPSSGDETSPDHSQDGLGSFKFVGSN  712

Query  495   PLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             PLEQLGL++K D++ EE EP    V    KDVEEGEID
Sbjct  713   PLEQLGLFIKADEEDEEIEPNF--VSNSIKDVEEGEID  748



>ref|XP_008450072.1| PREDICTED: transcription factor GTE8 isoform X3 [Cucumis melo]
Length=749

 Score =   165 bits (418),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 182/218 (83%), Gaps = 4/218 (2%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLG  853
             ++Q EQ+S  KP+S+E D  QDG  + +++P SPE+LYRAALLKNRFADTIL+A+EKT+ 
Sbjct  535   YEQPEQTSS-KPSSTESDCNQDGNYTASEKPVSPERLYRAALLKNRFADTILRAKEKTMT  593

Query  852   QGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkreferea  673
             QG+KGDP++LRRERE LE++++KEKARLQAEAKAA++A++RAE EAAAEAKRKRE +REA
Sbjct  594   QGDKGDPEKLRREREELELEQRKEKARLQAEAKAAQDAQRRAEAEAAAEAKRKRELDREA  653

Query  672   arqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSN  496
             ARQALL++E+TV I+ENS+FLEDLEMLR  P EQ  SS +E+SP HS D LGSFKF GSN
Sbjct  654   ARQALLQIEKTVIIDENSQFLEDLEMLRTAPAEQLPSSGDETSPDHSQDGLGSFKFVGSN  713

Query  495   PLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             PLEQLGL++K D++ EE EP    V    KDVEEGEID
Sbjct  714   PLEQLGLFIKADEEDEEIEPNF--VSNSIKDVEEGEID  749



>ref|XP_006395464.1| hypothetical protein EUTSA_v10003722mg [Eutrema salsugineum]
 gb|ESQ32750.1| hypothetical protein EUTSA_v10003722mg [Eutrema salsugineum]
Length=718

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 172/235 (73%), Gaps = 10/235 (4%)
 Frame = -1

Query  1068  NDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFA  889
             +DL DG       +Q++  +QQK +  E DGQ DG I +    AS EK YRAALLKNRFA
Sbjct  488   DDLFDGSQSTGAPEQMDICAQQKRSYDESDGQNDGNILKTQ--ASSEKRYRAALLKNRFA  545

Query  888   DTILKAREKTLGQ-GEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaa  712
             D ILKAREKTL Q   KGDP++LR+ERE LE+Q+KKE+ARLQAEA+AAE+AR++AE EAA
Sbjct  546   DIILKAREKTLPQISNKGDPERLRKEREELELQKKKERARLQAEAEAAEDARRQAEAEAA  605

Query  711   aeakrkrefere----aarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESS  547
             AEA  + + +RE    AARQALLKME+TVEINENSRFLEDLEML     EQ  SS +E S
Sbjct  606   AEAAAESKRKRELEREAARQALLKMEKTVEINENSRFLEDLEMLSSSAPEQLPSSADEIS  665

Query  546   PQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             P+  LDALGSF   GSNPLEQLGLYMK   D +E EP   +VP  A DVEEGEID
Sbjct  666   PERPLDALGSFNLRGSNPLEQLGLYMK--QDDDEEEPEAPAVPSLATDVEEGEID  718



>ref|XP_004145677.1| PREDICTED: transcription factor GTE8 isoform X1 [Cucumis sativus]
 ref|XP_011651571.1| PREDICTED: transcription factor GTE8 isoform X1 [Cucumis sativus]
 gb|KGN58199.1| hypothetical protein Csa_3G589570 [Cucumis sativus]
Length=750

 Score =   165 bits (417),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 181/219 (83%), Gaps = 4/219 (2%)
 Frame = -1

Query  1035  LFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
              ++Q EQ+S  KP+S+E D  QDG  + +++P SPE+LYRAALLKNRFADTIL+A+EKT+
Sbjct  535   CYEQPEQTSS-KPSSTESDCNQDGNYTASEKPVSPERLYRAALLKNRFADTILRAKEKTM  593

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefere  676
              QG+KGDP++LRRERE LE++++KEKARLQAEAKAA++A++RAE EAAAEAKRKRE +RE
Sbjct  594   TQGDKGDPEKLRREREELELEQRKEKARLQAEAKAAQDAQRRAEAEAAAEAKRKRELDRE  653

Query  675   aarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGS  499
             AARQALL++E+TV I+ENS+FLEDLEMLR  P EQ  SS +E+SP HS D LGSFKF GS
Sbjct  654   AARQALLQIEKTVIIDENSQFLEDLEMLRAAPAEQLPSSGDETSPDHSQDGLGSFKFVGS  713

Query  498   NPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             NPLEQLGL++K   D E+ E  P+ V    KDVEEGEID
Sbjct  714   NPLEQLGLFIK--ADEEDEEIEPNFVSNSIKDVEEGEID  750



>ref|XP_011651572.1| PREDICTED: transcription factor GTE8 isoform X2 [Cucumis sativus]
Length=748

 Score =   165 bits (417),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 145/219 (66%), Positives = 181/219 (83%), Gaps = 4/219 (2%)
 Frame = -1

Query  1035  LFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
              ++Q EQ+S  KP+S+E D  QDG  + +++P SPE+LYRAALLKNRFADTIL+A+EKT+
Sbjct  533   CYEQPEQTSS-KPSSTESDCNQDGNYTASEKPVSPERLYRAALLKNRFADTILRAKEKTM  591

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefere  676
              QG+KGDP++LRRERE LE++++KEKARLQAEAKAA++A++RAE EAAAEAKRKRE +RE
Sbjct  592   TQGDKGDPEKLRREREELELEQRKEKARLQAEAKAAQDAQRRAEAEAAAEAKRKRELDRE  651

Query  675   aarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGS  499
             AARQALL++E+TV I+ENS+FLEDLEMLR  P EQ  SS +E+SP HS D LGSFKF GS
Sbjct  652   AARQALLQIEKTVIIDENSQFLEDLEMLRAAPAEQLPSSGDETSPDHSQDGLGSFKFVGS  711

Query  498   NPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             NPLEQLGL++K   D E+ E  P+ V    KDVEEGEID
Sbjct  712   NPLEQLGLFIK--ADEEDEEIEPNFVSNSIKDVEEGEID  748



>ref|XP_004304004.1| PREDICTED: transcription factor GTE9 [Fragaria vesca subsp. vesca]
Length=740

 Score =   164 bits (416),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 144/237 (61%), Positives = 180/237 (76%), Gaps = 4/237 (2%)
 Frame = -1

Query  1083  DRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALL  904
             ++  V +  +G    S  DQVE++SQ KP+S E D +QDG+ +  +R  SP+K +RAA+L
Sbjct  503   EKTTVGNPLEGTQSDSGLDQVEETSQPKPSSVESDSRQDGDSAPTERSVSPDKQHRAAML  562

Query  903   KNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkrae  724
             K+RFADTIL+A+ KT  QG+KGDP++LRR+RE LE+Q+KKEKARLQAEAKAAEEAR++ E
Sbjct  563   KHRFADTILRAQAKTFDQGDKGDPEKLRRQREKLELQQKKEKARLQAEAKAAEEARRKKE  622

Query  723   eeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEM-LRVGPTEQHS-SLNE-  553
              EA AEAKRKRE EREAARQALL+ME+TVEIN +SRFL+DLEM +   P EQ    ++E 
Sbjct  623   AEALAEAKRKRELEREAARQALLQMEKTVEIN-DSRFLQDLEMQMLTAPMEQLPIKVDET  681

Query  552   SSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             +SP HS D LG FKF GSNPLEQLGL+MK+D D EE E      PK   D+EEGEID
Sbjct  682   TSPDHSDDGLGGFKFHGSNPLEQLGLFMKKDQDDEEEEAADLVAPKPVDDIEEGEID  738



>ref|XP_002300086.2| hypothetical protein POPTR_0001s36360g [Populus trichocarpa]
 gb|EEE84891.2| hypothetical protein POPTR_0001s36360g [Populus trichocarpa]
Length=630

 Score =   163 bits (412),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 141/218 (65%), Positives = 172/218 (79%), Gaps = 3/218 (1%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLG  853
              DQ+EQ+SQ+K +S E D QQDGE + +D   S EK  R AL+KNRFADTILKA+EK+L 
Sbjct  415   LDQLEQTSQEKLSSVESDCQQDGESAPSDSQVSLEKRIRHALIKNRFADTILKAKEKSLS  474

Query  852   QGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkreferea  673
             QG+KGDP +L+RERE LE+ +KKEKARL AEA+AAE+A+++AE  AAAEA+RKRE EREA
Sbjct  475   QGDKGDPQKLQREREELELHKKKEKARLLAEAQAAEDAQRQAEAAAAAEARRKRELEREA  534

Query  672   arqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHS-SLNESSPQHSLDALGSFKFTGSN  496
             ARQALLKME+TVEINENS+FLEDLEMLRV P E    S++E+SP  S D LG FKF   N
Sbjct  535   ARQALLKMEKTVEINENSQFLEDLEMLRVVPAEHVPISVDETSPDPSQDGLGGFKFGACN  594

Query  495   PLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             PLEQLGL+MK+D++ EE EP     P +  +VEEGEID
Sbjct  595   PLEQLGLFMKDDEEEEEGEPLNVLNPLN--EVEEGEID  630



>ref|XP_008799966.1| PREDICTED: transcription factor GTE9-like isoform X1 [Phoenix 
dactylifera]
Length=719

 Score =   161 bits (408),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 144/229 (63%), Positives = 170/229 (74%), Gaps = 4/229 (2%)
 Frame = -1

Query  1065  DLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFAD  886
             DL D +   +   Q+EQ     P S E + QQ+GE + + R  SPEKLYRAALL+NRFAD
Sbjct  494   DLLDANRSSNRLHQLEQDVHAVPASGEVNSQQEGENAPSQRQVSPEKLYRAALLRNRFAD  553

Query  885   TILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaae  706
             TILKAREKTL QGEK DP+ +R ERE LE Q+++EKARLQAEAKAAEEARK+AE EAAAE
Sbjct  554   TILKAREKTLDQGEKRDPEMVRLEREELERQKREEKARLQAEAKAAEEARKQAEAEAAAE  613

Query  705   akrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLD  529
             AKRKRE EREAARQALL+ME+T EI+EN+ FL+DLEMLR  P E   SS+ E+SP H+ +
Sbjct  614   AKRKRELEREAARQALLQMEKTAEIDENNLFLKDLEMLRTVPAEHVPSSVGETSPTHTQE  673

Query  528   ALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              LG  K  G+N LEQLGLYMK DD+ EE      S+P    DVEEGEID
Sbjct  674   GLGCIKLGGTNALEQLGLYMKVDDEEEEDGESR-SIP--VNDVEEGEID  719



>ref|XP_011024071.1| PREDICTED: transcription factor GTE8 isoform X3 [Populus euphratica]
Length=744

 Score =   162 bits (409),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 175/228 (77%), Gaps = 4/228 (2%)
 Frame = -1

Query  1053  GDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILK  874
             G+  +   DQVE  ++ KP ++E DG Q+GE + + R  SPEKLYRAALL+NRFADTILK
Sbjct  517   GNKSVDGLDQVELDTEGKPVAAEVDGHQEGESAPSKRQVSPEKLYRAALLRNRFADTILK  576

Query  873   AREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrk  694
             AREK L +GEK DP++LR+E+E  E ++K+EKARLQAEAKAAEEAR++AE EAAAEA+RK
Sbjct  577   AREKALEKGEKCDPEKLRKEKEEFERRQKEEKARLQAEAKAAEEARRKAEAEAAAEARRK  636

Query  693   refereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDALGS  517
             RE EREAARQALL+ME+TV+INENS F+EDLEMLR    EQ  S + E+SP  S + L S
Sbjct  637   RELEREAARQALLEMEKTVDINENSHFMEDLEMLRTVHDEQLPSFIEETSPDLSQNCLDS  696

Query  516   FKFTG-SNPLEQLGLYMKedddfeeceppPSSVPKD--AKDVEEGEID  382
             FKF G SNPLEQLGLYMKED+D EE    P        A+DVEEGEID
Sbjct  697   FKFQGSSNPLEQLGLYMKEDEDEEEEVVEPPPPIVPERARDVEEGEID  744



>ref|XP_011024069.1| PREDICTED: transcription factor GTE10 isoform X2 [Populus euphratica]
Length=797

 Score =   161 bits (408),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 175/228 (77%), Gaps = 4/228 (2%)
 Frame = -1

Query  1053  GDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILK  874
             G+  +   DQVE  ++ KP ++E DG Q+GE + + R  SPEKLYRAALL+NRFADTILK
Sbjct  570   GNKSVDGLDQVELDTEGKPVAAEVDGHQEGESAPSKRQVSPEKLYRAALLRNRFADTILK  629

Query  873   AREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrk  694
             AREK L +GEK DP++LR+E+E  E ++K+EKARLQAEAKAAEEAR++AE EAAAEA+RK
Sbjct  630   AREKALEKGEKCDPEKLRKEKEEFERRQKEEKARLQAEAKAAEEARRKAEAEAAAEARRK  689

Query  693   refereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDALGS  517
             RE EREAARQALL+ME+TV+INENS F+EDLEMLR    EQ  S + E+SP  S + L S
Sbjct  690   RELEREAARQALLEMEKTVDINENSHFMEDLEMLRTVHDEQLPSFIEETSPDLSQNCLDS  749

Query  516   FKFTG-SNPLEQLGLYMKedddfeeceppPSSVPKD--AKDVEEGEID  382
             FKF G SNPLEQLGLYMKED+D EE    P        A+DVEEGEID
Sbjct  750   FKFQGSSNPLEQLGLYMKEDEDEEEEVVEPPPPIVPERARDVEEGEID  797



>ref|XP_011024068.1| PREDICTED: transcription factor GTE10 isoform X1 [Populus euphratica]
Length=797

 Score =   161 bits (407),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 175/228 (77%), Gaps = 4/228 (2%)
 Frame = -1

Query  1053  GDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILK  874
             G+  +   DQVE  ++ KP ++E DG Q+GE + + R  SPEKLYRAALL+NRFADTILK
Sbjct  570   GNKSVDGLDQVELDTEGKPVAAEVDGHQEGESAPSKRQVSPEKLYRAALLRNRFADTILK  629

Query  873   AREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrk  694
             AREK L +GEK DP++LR+E+E  E ++K+EKARLQAEAKAAEEAR++AE EAAAEA+RK
Sbjct  630   AREKALEKGEKCDPEKLRKEKEEFERRQKEEKARLQAEAKAAEEARRKAEAEAAAEARRK  689

Query  693   refereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDALGS  517
             RE EREAARQALL+ME+TV+INENS F+EDLEMLR    EQ  S + E+SP  S + L S
Sbjct  690   RELEREAARQALLEMEKTVDINENSHFMEDLEMLRTVHDEQLPSFIEETSPDLSQNCLDS  749

Query  516   FKFTG-SNPLEQLGLYMKedddfeeceppPSSVPKD--AKDVEEGEID  382
             FKF G SNPLEQLGLYMKED+D EE    P        A+DVEEGEID
Sbjct  750   FKFQGSSNPLEQLGLYMKEDEDEEEEVVEPPPPIVPERARDVEEGEID  797



>ref|XP_007037911.1| Nuclear protein X1 isoform 2 [Theobroma cacao]
 gb|EOY22412.1| Nuclear protein X1 isoform 2 [Theobroma cacao]
Length=776

 Score =   160 bits (405),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 172/227 (76%), Gaps = 3/227 (1%)
 Frame = -1

Query  1056  DGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTIL  877
             DG+  ++   QVE     KP++ E +G QD E +  +R  SPEKLYRAA+L+ RFADTIL
Sbjct  551   DGNQSLNELGQVELKFHDKPSAIEAEGHQDEESAPAERQVSPEKLYRAAVLRKRFADTIL  610

Query  876   KAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakr  697
             KAREK L +GEKGDP++LR ERE LE  +++EKARLQ EAKAAEEAR +AE EAAAEAKR
Sbjct  611   KAREKALEKGEKGDPEKLRMEREELERWQREEKARLQVEAKAAEEARIKAEAEAAAEAKR  670

Query  696   krefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDALG  520
             KRE EREAARQALLKME+TV+IN NS+F+ED EMLR    E   + + E+SP HS + LG
Sbjct  671   KRELEREAARQALLKMEKTVDINGNSQFMEDFEMLRTSNDEHLPNFMEETSPSHSQNGLG  730

Query  519   SFKFTG-SNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             SFK  G SNPLEQLGLYMK DD+ EE EPP S+ P+   DVEEGEID
Sbjct  731   SFKLQGRSNPLEQLGLYMKADDEDEEDEPPQSA-PEPVNDVEEGEID  776



>ref|XP_007037910.1| Nuclear protein X1 isoform 1 [Theobroma cacao]
 gb|EOY22411.1| Nuclear protein X1 isoform 1 [Theobroma cacao]
Length=781

 Score =   160 bits (405),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 144/227 (63%), Positives = 172/227 (76%), Gaps = 3/227 (1%)
 Frame = -1

Query  1056  DGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTIL  877
             DG+  ++   QVE     KP++ E +G QD E +  +R  SPEKLYRAA+L+ RFADTIL
Sbjct  556   DGNQSLNELGQVELKFHDKPSAIEAEGHQDEESAPAERQVSPEKLYRAAVLRKRFADTIL  615

Query  876   KAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakr  697
             KAREK L +GEKGDP++LR ERE LE  +++EKARLQ EAKAAEEAR +AE EAAAEAKR
Sbjct  616   KAREKALEKGEKGDPEKLRMEREELERWQREEKARLQVEAKAAEEARIKAEAEAAAEAKR  675

Query  696   krefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDALG  520
             KRE EREAARQALLKME+TV+IN NS+F+ED EMLR    E   + + E+SP HS + LG
Sbjct  676   KRELEREAARQALLKMEKTVDINGNSQFMEDFEMLRTSNDEHLPNFMEETSPSHSQNGLG  735

Query  519   SFKFTG-SNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             SFK  G SNPLEQLGLYMK DD+ EE EPP S+ P+   DVEEGEID
Sbjct  736   SFKLQGRSNPLEQLGLYMKADDEDEEDEPPQSA-PEPVNDVEEGEID  781



>ref|XP_006440056.1| hypothetical protein CICLE_v10018939mg [Citrus clementina]
 gb|ESR53296.1| hypothetical protein CICLE_v10018939mg [Citrus clementina]
Length=778

 Score =   160 bits (404),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 179/233 (77%), Gaps = 4/233 (2%)
 Frame = -1

Query  1074  GVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNR  895
             GV D+  G+  ++  DQVE +SQ KP +   DG  +GE + ++R  SP+KLYRAALL+NR
Sbjct  548   GVPDI--GNSSVNSLDQVELNSQGKPVAIVADGHHEGESAPSERQVSPDKLYRAALLRNR  605

Query  894   FADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeea  715
             FADTILKAREK L +GEK DP++LR ERE LE + ++EKARLQAEAKAAEEAR++AE EA
Sbjct  606   FADTILKAREKALEKGEKRDPEKLRIEREELERRHREEKARLQAEAKAAEEARRKAEAEA  665

Query  714   aaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQH  538
             AAEAKRKRE EREAARQAL  ME+TV+INENSRF+EDLEMLR+   EQ  S   E+SP H
Sbjct  666   AAEAKRKRELEREAARQALQMMEKTVDINENSRFMEDLEMLRIAQDEQLPSFTAETSPDH  725

Query  537   SLDALGSFKFTGS-NPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
               D LGSFKF GS NPLEQLGLYMK DDD EE   PP +  +  KDVEEGEID
Sbjct  726   LQDRLGSFKFQGSTNPLEQLGLYMKMDDDDEEEVEPPLTAKEPVKDVEEGEID  778



>ref|XP_006476989.1| PREDICTED: transcription factor GTE10-like [Citrus sinensis]
Length=778

 Score =   159 bits (403),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 179/233 (77%), Gaps = 4/233 (2%)
 Frame = -1

Query  1074  GVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNR  895
             GV D+  G+  ++  DQVE +SQ KP +   DG  +GE + ++R  SP+KLYRAALL+NR
Sbjct  548   GVPDI--GNSSVNSLDQVELNSQGKPVAIVADGHHEGESAPSERQVSPDKLYRAALLRNR  605

Query  894   FADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeea  715
             FADTILKAREK L +GEK DP++LR ERE LE + ++EKARLQAEAKAAEEAR++AE EA
Sbjct  606   FADTILKAREKALEKGEKRDPEKLRIEREELERRHREEKARLQAEAKAAEEARRKAEAEA  665

Query  714   aaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQH  538
             AAEAKRKRE EREAARQAL  ME+TV+INENSRF+EDLEMLR+   EQ  S   E+SP H
Sbjct  666   AAEAKRKRELEREAARQALQMMEKTVDINENSRFMEDLEMLRIAQDEQLPSFTAEASPDH  725

Query  537   SLDALGSFKFTGS-NPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
               D LGSFKF GS NPLEQLGLYMK DDD EE   PP +  +  KDVEEGEID
Sbjct  726   LQDRLGSFKFQGSTNPLEQLGLYMKMDDDDEEEVEPPLTAKEPIKDVEEGEID  778



>gb|KDO69314.1| hypothetical protein CISIN_1g004033mg [Citrus sinensis]
Length=778

 Score =   159 bits (403),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 179/233 (77%), Gaps = 4/233 (2%)
 Frame = -1

Query  1074  GVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNR  895
             GV D+  G+  ++  DQVE +SQ KP +   DG  +GE + ++R  SP+KLYRAALL+NR
Sbjct  548   GVPDI--GNSSVNSLDQVELNSQGKPVAIVADGHHEGESAPSERQVSPDKLYRAALLRNR  605

Query  894   FADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeea  715
             FADTILKAREK L +GEK DP++LR ERE LE + ++EKARLQAEAKAAEEAR++AE EA
Sbjct  606   FADTILKAREKALEKGEKRDPEKLRIEREELERRHREEKARLQAEAKAAEEARRKAEAEA  665

Query  714   aaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQH  538
             AAEAKRKRE EREAARQAL  ME+TV+INENSRF+EDLEMLR+   EQ  S   E+SP H
Sbjct  666   AAEAKRKRELEREAARQALQMMEKTVDINENSRFMEDLEMLRIAQDEQLPSFTAEASPDH  725

Query  537   SLDALGSFKFTGS-NPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
               D LGSFKF GS NPLEQLGLYMK DDD EE   PP +  +  KDVEEGEID
Sbjct  726   LQDRLGSFKFQGSTNPLEQLGLYMKMDDDDEEEVEPPLTAKEPIKDVEEGEID  778



>gb|KDO69315.1| hypothetical protein CISIN_1g004033mg [Citrus sinensis]
Length=776

 Score =   159 bits (403),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 152/233 (65%), Positives = 179/233 (77%), Gaps = 4/233 (2%)
 Frame = -1

Query  1074  GVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNR  895
             GV D+  G+  ++  DQVE +SQ KP +   DG  +GE + ++R  SP+KLYRAALL+NR
Sbjct  546   GVPDI--GNSSVNSLDQVELNSQGKPVAIVADGHHEGESAPSERQVSPDKLYRAALLRNR  603

Query  894   FADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeea  715
             FADTILKAREK L +GEK DP++LR ERE LE + ++EKARLQAEAKAAEEAR++AE EA
Sbjct  604   FADTILKAREKALEKGEKRDPEKLRIEREELERRHREEKARLQAEAKAAEEARRKAEAEA  663

Query  714   aaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQH  538
             AAEAKRKRE EREAARQAL  ME+TV+INENSRF+EDLEMLR+   EQ  S   E+SP H
Sbjct  664   AAEAKRKRELEREAARQALQMMEKTVDINENSRFMEDLEMLRIAQDEQLPSFTAEASPDH  723

Query  537   SLDALGSFKFTGS-NPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
               D LGSFKF GS NPLEQLGLYMK DDD EE   PP +  +  KDVEEGEID
Sbjct  724   LQDRLGSFKFQGSTNPLEQLGLYMKMDDDDEEEVEPPLTAKEPIKDVEEGEID  776



>ref|XP_002875368.1| hypothetical protein ARALYDRAFT_484508 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51627.1| hypothetical protein ARALYDRAFT_484508 [Arabidopsis lyrata subsp. 
lyrata]
Length=814

 Score =   159 bits (401),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 135/208 (65%), Positives = 157/208 (75%), Gaps = 8/208 (4%)
 Frame = -1

Query  1071  VNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRF  892
             ++DL  G       +Q++  SQQKP+S E D Q +G I +   P S EK YRAALLKNRF
Sbjct  487   IDDLFGGSQSTGALEQMDICSQQKPSSDESDIQHEGNILET--PVSSEKRYRAALLKNRF  544

Query  891   ADTILKAREKTLGQ-GEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeea  715
             AD ILKAREK L Q G KGDP++LR+ERE LE+Q+KKEKARLQAEAKAAE+AR++AE EA
Sbjct  545   ADIILKAREKPLPQNGIKGDPERLRKEREELELQKKKEKARLQAEAKAAEDARRQAEAEA  604

Query  714   aaeakrkref----ereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNES  550
             AAEA  + +     EREAARQALLKME+TVEINENSRFLEDLEML     EQ  SS +E+
Sbjct  605   AAEAAAEAKRKRELEREAARQALLKMEKTVEINENSRFLEDLEMLSSSAPEQLPSSADET  664

Query  549   SPQHSLDALGSFKFTGSNPLEQLGLYMK  466
             SP+  LDALGSF   GSNPLEQLGLYMK
Sbjct  665   SPEKPLDALGSFNLRGSNPLEQLGLYMK  692


 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 42/60 (70%), Gaps = 3/60 (5%)
 Frame = -1

Query  558  NESSPQHSLDALGSFKFTGS-NPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            +E+SP+  LDA GSF   GS NPLEQLGLYMK   D +E EP   +VP  A DVEEGEID
Sbjct  757  DETSPERPLDAFGSFNLKGSSNPLEQLGLYMK--QDDDEEEPEAPAVPNLANDVEEGEID  814



>ref|XP_010425469.1| PREDICTED: transcription factor GTE8 [Camelina sativa]
 ref|XP_010425470.1| PREDICTED: transcription factor GTE8 [Camelina sativa]
Length=815

 Score =   158 bits (400),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 136/203 (67%), Positives = 154/203 (76%), Gaps = 8/203 (4%)
 Frame = -1

Query  1056  DGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTIL  877
             +G       +Q++  SQQKP + E DGQ +G + +   PAS EK YRAALLKNRFAD IL
Sbjct  490   EGSQSTGALEQMDICSQQKPGTDESDGQHEGNMLET--PASSEKRYRAALLKNRFADIIL  547

Query  876   KAREKTLGQ-GEKGDPDQLRREREVLEMQrkkekarlqaeakaae----earkraeeeaa  712
             KAREK L Q G KGDP++LR+ERE LE+Q+KKEKARLQAEAKAAE    +A   A  EAA
Sbjct  548   KAREKPLPQNGIKGDPERLRKEREELELQKKKEKARLQAEAKAAEDARRQAEAEAAAEAA  607

Query  711   aeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHS  535
             AEAKRKRE EREAARQALLKME+TVEINENSRFLEDLEML     EQ  SS +E+SP+  
Sbjct  608   AEAKRKREVEREAARQALLKMEKTVEINENSRFLEDLEMLSSSAPEQLPSSADETSPERP  667

Query  534   LDALGSFKFTGSNPLEQLGLYMK  466
             LDALGSF   GSNPLEQLGLYMK
Sbjct  668   LDALGSFNLRGSNPLEQLGLYMK  690


 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 2/61 (3%)
 Frame = -1

Query  558  NESSPQHSLDALGSFKFTGSNPLEQLGLYMK--edddfeeceppPSSVPKDAKDVEEGEI  385
            +E+SP+  LDALGSF    SNPLE+LGLYMK  +DDD EE E    +VPK   DVEEGEI
Sbjct  755  DETSPERPLDALGSFNLKESNPLEKLGLYMKQDDDDDVEEPEAQAPAVPKLGNDVEEGEI  814

Query  384  D  382
            D
Sbjct  815  D  815



>ref|XP_010514420.1| PREDICTED: transcription factor GTE8-like [Camelina sativa]
 ref|XP_010514421.1| PREDICTED: transcription factor GTE8-like [Camelina sativa]
Length=815

 Score =   157 bits (398),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 155/203 (76%), Gaps = 8/203 (4%)
 Frame = -1

Query  1056  DGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTIL  877
             +G    S  +Q++  SQQKP + E DGQ +G + +   P S EK YRAALLKNRFAD IL
Sbjct  490   EGCQSTSALEQMDICSQQKPGTDESDGQHEGNMLET--PVSSEKRYRAALLKNRFADIIL  547

Query  876   KAREKTLGQ-GEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeak  700
             KAREK L Q G KGDP++LR+ERE LE+Q+KKEKARLQAEAKAAE+AR++AE EAAAEA 
Sbjct  548   KAREKPLPQNGIKGDPERLRKEREELELQKKKEKARLQAEAKAAEDARRQAEAEAAAEAA  607

Query  699   rkref----ereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHS  535
              + +     EREAARQALLKME+TVEINENSRFLEDLEML     EQ  SS +E+SP+  
Sbjct  608   AEAKRKRELEREAARQALLKMEKTVEINENSRFLEDLEMLSSSAPEQLTSSADETSPERP  667

Query  534   LDALGSFKFTGSNPLEQLGLYMK  466
             LDALGSF   GSNPLEQLGLYMK
Sbjct  668   LDALGSFNLRGSNPLEQLGLYMK  690


 Score = 58.2 bits (139),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 37/60 (62%), Positives = 44/60 (73%), Gaps = 2/60 (3%)
 Frame = -1

Query  558  NESSPQHSLDALGSFKFTGSNPLEQLGLYMKe--dddfeeceppPSSVPKDAKDVEEGEI  385
            +E+SP+  LDALGSF    SNPLE+LGLYMK+  +DD EE E    +VPK A DVEEGEI
Sbjct  755  DETSPERPLDALGSFNLKESNPLEKLGLYMKQDDNDDVEEPEAQAPAVPKLANDVEEGEI  814



>ref|XP_002511228.1| bromodomain-containing protein, putative [Ricinus communis]
 gb|EEF51830.1| bromodomain-containing protein, putative [Ricinus communis]
Length=759

 Score =   156 bits (394),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 138/216 (64%), Positives = 169/216 (78%), Gaps = 9/216 (4%)
 Frame = -1

Query  1026  QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             ++E +SQ +P + E DG Q+GE +  DR  SP+KLYRAA+L+NRFADTILKAREK L +G
Sbjct  552   KIESNSQGEPLNVETDGHQEGENAPPDRQVSPDKLYRAAILRNRFADTILKAREKALEKG  611

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             EK DP++LR+ERE LE Q+K+EKARLQAEAKAAEEA+++A  EAAAEAKR+RE EREAAR
Sbjct  612   EKRDPEKLRKEREELERQQKEEKARLQAEAKAAEEAQRKAAAEAAAEAKRQRELEREAAR  671

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDALGSFKFTGSNPL  490
             QAL +ME+TVEINENS+F+EDLEMLR    E+  S + E+SP+        F   GSNPL
Sbjct  672   QALQQMEKTVEINENSQFMEDLEMLRTAHDEELPSFMEETSPE--------FVLQGSNPL  723

Query  489   EQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             EQLGLYMK+DD+ EE   PP SV +  KDVEEGEID
Sbjct  724   EQLGLYMKKDDEEEEDVEPPQSVSESIKDVEEGEID  759



>ref|XP_010502690.1| PREDICTED: transcription factor GTE8-like isoform X1 [Camelina 
sativa]
 ref|XP_010502691.1| PREDICTED: transcription factor GTE8-like isoform X2 [Camelina 
sativa]
 ref|XP_010502693.1| PREDICTED: transcription factor GTE8-like isoform X1 [Camelina 
sativa]
Length=813

 Score =   156 bits (394),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 155/203 (76%), Gaps = 8/203 (4%)
 Frame = -1

Query  1056  DGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTIL  877
             +G       +Q++  SQQKP++ E DGQ +G + +   PAS EK YRAALLKNRFAD IL
Sbjct  490   EGSQSTGALEQMDICSQQKPSTDESDGQHEGNMLET--PASSEKRYRAALLKNRFADIIL  547

Query  876   KAREKTLGQ-GEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeak  700
             KAREK L Q G KGDP++LR+ERE LE+Q+KKEKARLQAEAKAAE+AR++AE EAAAEA 
Sbjct  548   KAREKPLSQNGIKGDPERLRKEREELELQKKKEKARLQAEAKAAEDARRQAEAEAAAEAA  607

Query  699   rkref----ereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHS  535
              + +     EREAARQALLKME+TVEINENSRFLEDLEML     EQ  SS +E+SP+  
Sbjct  608   AEAKRKRELEREAARQALLKMEKTVEINENSRFLEDLEMLSSSAPEQLTSSADETSPERP  667

Query  534   LDALGSFKFTGSNPLEQLGLYMK  466
             LDAL SF   GSNPLEQLGLYMK
Sbjct  668   LDALESFNLRGSNPLEQLGLYMK  690


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -1

Query  558  NESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            +E+SP+  LDALGSF    SNPLE+LGLYMK+DDD EE E    +VPK A DVEEGEID
Sbjct  755  DETSPERPLDALGSFNLKESNPLEKLGLYMKQDDDVEEPEAQAPAVPKLANDVEEGEID  813



>gb|KEH17395.1| global transcription factor group protein [Medicago truncatula]
Length=751

 Score =   155 bits (391),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 161/195 (83%), Gaps = 3/195 (2%)
 Frame = -1

Query  963  EISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkk  784
            E   ++R  SP+KL RAAL+KNRF DTIL AREKTL QG KGDP+++R ++E LEM+R+K
Sbjct  559  ECGASERQISPDKLIRAALIKNRFVDTILNAREKTLTQGVKGDPEKMRLDKEKLEMERRK  618

Query  783  ekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLED  604
            EKARLQAEAKAAEEARKRAEEEAAAE++RKRE ER+AARQALL+ME+TVEINENS+FLED
Sbjct  619  EKARLQAEAKAAEEARKRAEEEAAAESRRKRELERQAARQALLQMEKTVEINENSQFLED  678

Query  603  LEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPS  427
            LEMLRV P EQ   S++E+SP  S + +GSFKF GSNPLEQLGLY+K +D+ EE +P   
Sbjct  679  LEMLRVVPAEQLPCSVDETSPDDSQNGMGSFKFGGSNPLEQLGLYIKVEDEEEEGDPL--  736

Query  426  SVPKDAKDVEEGEID  382
             VP    DVEEGEID
Sbjct  737  CVPNPVNDVEEGEID  751



>ref|NP_001189985.1| global transcription factor group E8 [Arabidopsis thaliana]
 gb|AEE77285.1| global transcription factor group E8 [Arabidopsis thaliana]
Length=764

 Score =   155 bits (391),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 156/208 (75%), Gaps = 8/208 (4%)
 Frame = -1

Query  1071  VNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRF  892
             ++DL  G       +Q++  SQQK +S E DGQ +G I +   PAS EK YRAALLKNRF
Sbjct  438   IDDLFVGSQSTGALEQMDICSQQKLSSDESDGQHEGNILET--PASSEKRYRAALLKNRF  495

Query  891   ADTILKAREKTLGQ-GEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeea  715
             AD ILKAREK L Q G KGDP++LR+ERE L +Q+KKEKARLQAEA+AAE+AR++AE EA
Sbjct  496   ADIILKAREKPLPQNGIKGDPERLRKEREELVLQKKKEKARLQAEAEAAEDARRQAEAEA  555

Query  714   aaeakrkref----ereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNES  550
             AAEA  + +     EREAARQALLKME+TVEINENSRFLEDLEML     EQ  SS  E+
Sbjct  556   AAEAAAEAKRKRELEREAARQALLKMEKTVEINENSRFLEDLEMLSSSAPEQLPSSAEET  615

Query  549   SPQHSLDALGSFKFTGSNPLEQLGLYMK  466
             SP+  LDALGSF   GSNPLEQLGLYMK
Sbjct  616   SPERPLDALGSFNLRGSNPLEQLGLYMK  643


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = -1

Query  558  NESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            NE+S +  +DA GSF   GSNPLEQLGLYMK   D +E EP   +VP  A DVEEGEID
Sbjct  708  NETSLERPVDAFGSFNLKGSNPLEQLGLYMK--QDDDEEEPEAPAVPNLANDVEEGEID  764



>ref|NP_189362.1| global transcription factor group E8 [Arabidopsis thaliana]
 sp|Q9LK27.2|GTE8_ARATH RecName: Full=Transcription factor GTE8; AltName: Full=Bromodomain-containing 
protein GTE8; AltName: Full=Protein GLOBAL 
TRANSCRIPTION FACTOR GROUP E8 [Arabidopsis thaliana]
 gb|AEE77284.1| global transcription factor group E8 [Arabidopsis thaliana]
Length=813

 Score =   155 bits (392),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 156/208 (75%), Gaps = 8/208 (4%)
 Frame = -1

Query  1071  VNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRF  892
             ++DL  G       +Q++  SQQK +S E DGQ +G I +   PAS EK YRAALLKNRF
Sbjct  487   IDDLFVGSQSTGALEQMDICSQQKLSSDESDGQHEGNILET--PASSEKRYRAALLKNRF  544

Query  891   ADTILKAREKTLGQ-GEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeea  715
             AD ILKAREK L Q G KGDP++LR+ERE L +Q+KKEKARLQAEA+AAE+AR++AE EA
Sbjct  545   ADIILKAREKPLPQNGIKGDPERLRKEREELVLQKKKEKARLQAEAEAAEDARRQAEAEA  604

Query  714   aaeakrkref----ereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNES  550
             AAEA  + +     EREAARQALLKME+TVEINENSRFLEDLEML     EQ  SS  E+
Sbjct  605   AAEAAAEAKRKRELEREAARQALLKMEKTVEINENSRFLEDLEMLSSSAPEQLPSSAEET  664

Query  549   SPQHSLDALGSFKFTGSNPLEQLGLYMK  466
             SP+  LDALGSF   GSNPLEQLGLYMK
Sbjct  665   SPERPLDALGSFNLRGSNPLEQLGLYMK  692


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = -1

Query  558  NESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            NE+S +  +DA GSF   GSNPLEQLGLYMK   D +E EP   +VP  A DVEEGEID
Sbjct  757  NETSLERPVDAFGSFNLKGSNPLEQLGLYMK--QDDDEEEPEAPAVPNLANDVEEGEID  813



>dbj|BAB02121.1| unnamed protein product [Arabidopsis thaliana]
Length=818

 Score =   155 bits (391),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 156/208 (75%), Gaps = 8/208 (4%)
 Frame = -1

Query  1071  VNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRF  892
             ++DL  G       +Q++  SQQK +S E DGQ +G I +   PAS EK YRAALLKNRF
Sbjct  492   IDDLFVGSQSTGALEQMDICSQQKLSSDESDGQHEGNILET--PASSEKRYRAALLKNRF  549

Query  891   ADTILKAREKTLGQ-GEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeea  715
             AD ILKAREK L Q G KGDP++LR+ERE L +Q+KKEKARLQAEA+AAE+AR++AE EA
Sbjct  550   ADIILKAREKPLPQNGIKGDPERLRKEREELVLQKKKEKARLQAEAEAAEDARRQAEAEA  609

Query  714   aaeakrkref----ereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNES  550
             AAEA  + +     EREAARQALLKME+TVEINENSRFLEDLEML     EQ  SS  E+
Sbjct  610   AAEAAAEAKRKRELEREAARQALLKMEKTVEINENSRFLEDLEMLSSSAPEQLPSSAEET  669

Query  549   SPQHSLDALGSFKFTGSNPLEQLGLYMK  466
             SP+  LDALGSF   GSNPLEQLGLYMK
Sbjct  670   SPERPLDALGSFNLRGSNPLEQLGLYMK  697


 Score = 58.5 bits (140),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 41/59 (69%), Gaps = 2/59 (3%)
 Frame = -1

Query  558  NESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            NE+S +  +DA GSF   GSNPLEQLGLYMK   D +E EP   +VP  A DVEEGEID
Sbjct  762  NETSLERPVDAFGSFNLKGSNPLEQLGLYMK--QDDDEEEPEAPAVPNLANDVEEGEID  818



>ref|XP_008799968.1| PREDICTED: transcription factor GTE9-like isoform X2 [Phoenix 
dactylifera]
Length=716

 Score =   154 bits (388),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 167/229 (73%), Gaps = 7/229 (3%)
 Frame = -1

Query  1065  DLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFAD  886
             DL D +   +   Q+EQ     P S E + QQ+GE + + R  SPEKLYRAALL+NRFAD
Sbjct  494   DLLDANRSSNRLHQLEQDVHAVPASGEVNSQQEGENAPSQRQVSPEKLYRAALLRNRFAD  553

Query  885   TILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaae  706
             TILKAREKTL QGEK DP+ +R ERE LE Q+++EKARLQAEAKAAEEARK+AE EAAAE
Sbjct  554   TILKAREKTLDQGEKRDPEMVRLEREELERQKREEKARLQAEAKAAEEARKQAEAEAAAE  613

Query  705   akrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLD  529
             AKRKRE EREAARQALL   QT EI+EN+ FL+DLEMLR  P E   SS+ E+SP H+ +
Sbjct  614   AKRKRELEREAARQALL---QTAEIDENNLFLKDLEMLRTVPAEHVPSSVGETSPTHTQE  670

Query  528   ALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              LG  K  G+N LEQLGLYMK DD+ EE      S+P    DVEEGEID
Sbjct  671   GLGCIKLGGTNALEQLGLYMKVDDEEEEDGESR-SIP--VNDVEEGEID  716



>ref|XP_010930070.1| PREDICTED: transcription factor GTE9-like isoform X2 [Elaeis 
guineensis]
Length=738

 Score =   151 bits (382),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 169/205 (82%), Gaps = 4/205 (2%)
 Frame = -1

Query  993  SSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRRE  814
            S E DG Q+GE + ++R  SPEKLYRAALL++RFADTILKAREKTLGQGEKGDP++LRRE
Sbjct  537  SVEVDGNQEGENAPSERQVSPEKLYRAALLRSRFADTILKAREKTLGQGEKGDPEKLRRE  596

Query  813  REVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVE  634
            RE LE Q+++EKARLQAEAKAAEEAR+RAE EAAAEAKRKRE EREAARQALLKME+TVE
Sbjct  597  REELERQQREEKARLQAEAKAAEEARRRAEAEAAAEAKRKRELEREAARQALLKMEKTVE  656

Query  633  INENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMKedd  457
            I+ + R L+DLEMLR  P E   SS++E+SP  S D +G FK  GSNPLEQLGLYMK +D
Sbjct  657  ISNDCRILKDLEMLRTVPAEHVPSSVDETSPDLSPDGMGGFKLGGSNPLEQLGLYMK-ED  715

Query  456  dfeeceppPSSVPKDAKDVEEGEID  382
            D EE E  PSSVP    DVEEGEID
Sbjct  716  DEEEEEGEPSSVP--VNDVEEGEID  738



>ref|XP_010930064.1| PREDICTED: transcription factor GTE9-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010930065.1| PREDICTED: transcription factor GTE9-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010930066.1| PREDICTED: transcription factor GTE9-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010930067.1| PREDICTED: transcription factor GTE9-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010930068.1| PREDICTED: transcription factor GTE9-like isoform X1 [Elaeis 
guineensis]
Length=748

 Score =   151 bits (382),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 169/205 (82%), Gaps = 4/205 (2%)
 Frame = -1

Query  993  SSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRRE  814
            S E DG Q+GE + ++R  SPEKLYRAALL++RFADTILKAREKTLGQGEKGDP++LRRE
Sbjct  547  SVEVDGNQEGENAPSERQVSPEKLYRAALLRSRFADTILKAREKTLGQGEKGDPEKLRRE  606

Query  813  REVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVE  634
            RE LE Q+++EKARLQAEAKAAEEAR+RAE EAAAEAKRKRE EREAARQALLKME+TVE
Sbjct  607  REELERQQREEKARLQAEAKAAEEARRRAEAEAAAEAKRKRELEREAARQALLKMEKTVE  666

Query  633  INENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMKedd  457
            I+ + R L+DLEMLR  P E   SS++E+SP  S D +G FK  GSNPLEQLGLYMK +D
Sbjct  667  ISNDCRILKDLEMLRTVPAEHVPSSVDETSPDLSPDGMGGFKLGGSNPLEQLGLYMK-ED  725

Query  456  dfeeceppPSSVPKDAKDVEEGEID  382
            D EE E  PSSVP    DVEEGEID
Sbjct  726  DEEEEEGEPSSVP--VNDVEEGEID  748



>ref|XP_010105169.1| Transcription factor GTE10 [Morus notabilis]
 gb|EXC04015.1| Transcription factor GTE10 [Morus notabilis]
Length=782

 Score =   151 bits (381),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 140/218 (64%), Positives = 170/218 (78%), Gaps = 4/218 (2%)
 Frame = -1

Query  1026  QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             Q EQ SQ KP S   D +QDGE + ++R  SPEK YRAALL++RFADTILKAREK L +G
Sbjct  566   QAEQDSQSKPVSVGVDDRQDGESAPSERQVSPEKRYRAALLRSRFADTILKAREKALEKG  625

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             EK DP++LR E+E LE ++K+EKARLQAEA AAEEAR++AE+EAAAEAKRKRE EREAAR
Sbjct  626   EKRDPEKLRLEKEELERRQKEEKARLQAEATAAEEARRKAEQEAAAEAKRKRELEREAAR  685

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS--LNESSPQHSLDALGSFKFTGSNP  493
             QAL  ME+TV+INENSRF+EDLEMLR    ++       E+SP+ S + LGSFK  G NP
Sbjct  686   QALQMMEKTVDINENSRFMEDLEMLRTAAHDEEVPNFEEEASPELSQNGLGSFKLEG-NP  744

Query  492   LEQLGLYMKedddfeeceppPS-SVPKDAKDVEEGEID  382
             LE+LGLYMK DD++EE E  P  S+P+ + DVEEGEID
Sbjct  745   LEKLGLYMKVDDEYEEEEVEPPQSIPEQSNDVEEGEID  782



>emb|CBI15622.3| unnamed protein product [Vitis vinifera]
Length=700

 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 175/224 (78%), Gaps = 2/224 (1%)
 Frame = -1

Query  1053  GDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILK  874
             G+  +++   V+ + + KP S+E DG Q+GE + ++R  SPEKLYRAALL++RFADTILK
Sbjct  479   GNEALNIPCNVDPNLESKPISAEADGHQEGESAPSERQVSPEKLYRAALLRSRFADTILK  538

Query  873   AREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrk  694
             AREKTL +GEKGDP++LR ERE LE ++K+EKARLQAEAKAAEEARK+AE EAAAEAKRK
Sbjct  539   AREKTLEKGEKGDPEKLRLEREELERRQKEEKARLQAEAKAAEEARKKAEAEAAAEAKRK  598

Query  693   refereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSF  514
             RE +REAARQAL +M++TV+INEN  FL+DLEMLR  P E   SL+E SP  S + LGSF
Sbjct  599   RELDREAARQALQQMQKTVDINENCLFLKDLEMLRAAP-EPLPSLDERSPDQSPNCLGSF  657

Query  513   KFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             K  GSNPLEQLGLYMK DD+ EE   P   +P    DVEEGEID
Sbjct  658   KLQGSNPLEQLGLYMKMDDEEEEEVEPQ-CIPGPGNDVEEGEID  700



>ref|XP_010663721.1| PREDICTED: transcription factor GTE10 [Vitis vinifera]
Length=781

 Score =   150 bits (379),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 144/224 (64%), Positives = 175/224 (78%), Gaps = 2/224 (1%)
 Frame = -1

Query  1053  GDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILK  874
             G+  +++   V+ + + KP S+E DG Q+GE + ++R  SPEKLYRAALL++RFADTILK
Sbjct  560   GNEALNIPCNVDPNLESKPISAEADGHQEGESAPSERQVSPEKLYRAALLRSRFADTILK  619

Query  873   AREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrk  694
             AREKTL +GEKGDP++LR ERE LE ++K+EKARLQAEAKAAEEARK+AE EAAAEAKRK
Sbjct  620   AREKTLEKGEKGDPEKLRLEREELERRQKEEKARLQAEAKAAEEARKKAEAEAAAEAKRK  679

Query  693   refereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSF  514
             RE +REAARQAL +M++TV+INEN  FL+DLEMLR  P E   SL+E SP  S + LGSF
Sbjct  680   RELDREAARQALQQMQKTVDINENCLFLKDLEMLRAAP-EPLPSLDERSPDQSPNCLGSF  738

Query  513   KFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             K  GSNPLEQLGLYMK DD+ EE   P   +P    DVEEGEID
Sbjct  739   KLQGSNPLEQLGLYMKMDDEEEEEVEPQ-CIPGPGNDVEEGEID  781



>ref|XP_006290601.1| hypothetical protein CARUB_v10016691mg [Capsella rubella]
 gb|EOA23499.1| hypothetical protein CARUB_v10016691mg [Capsella rubella]
Length=825

 Score =   149 bits (377),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 134/216 (62%), Positives = 154/216 (71%), Gaps = 21/216 (10%)
 Frame = -1

Query  1056  DGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTIL  877
             +G       +Q++  SQQKP S E DGQ +G I +   P S EK YRAALLKNRFAD IL
Sbjct  490   EGSQSTGALEQMDICSQQKPGSDESDGQHEGNILET--PVSSEKRYRAALLKNRFADIIL  547

Query  876   KAREKTLGQ-GEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeak  700
             KAREK L Q G KGDP++LR+ERE LE+Q+KKEKARLQAEAKAAE+AR++AE EAAAEA 
Sbjct  548   KAREKPLPQNGIKGDPERLRKEREELELQKKKEKARLQAEAKAAEDARRQAEAEAAAEAA  607

Query  699   rkref----ereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHS  535
              + +     EREAARQALLKME+TVEINENSRFLEDLEML     EQ  SS +E+SP+  
Sbjct  608   AEAKRKRELEREAARQALLKMEKTVEINENSRFLEDLEMLSSSAPEQLPSSADETSPERP  667

Query  534   LDALGSFK-------------FTGSNPLEQLGLYMK  466
             LDALGSF                GSNPLEQLGLYMK
Sbjct  668   LDALGSFNLRGRPLDALGSFSLRGSNPLEQLGLYMK  703


 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  558  NESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            +E+SP+  LDALG F   G+N LEQLGLYMK DDD EE E    +VPK A DVEEGEID
Sbjct  767  DETSPERPLDALGGFNLKGNNALEQLGLYMKRDDDEEEPEAQAPAVPKIANDVEEGEID  825


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -1

Query  558  NESSPQHSLDALGSFKFTGSNPLEQLGLYMK  466
            +E+SP+  LDALGSF   GSNPLEQLGLYMK
Sbjct  720  DETSPERPLDALGSFNLGGSNPLEQLGLYMK  750



>ref|XP_010927644.1| PREDICTED: transcription factor GTE9-like [Elaeis guineensis]
Length=720

 Score =   146 bits (369),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 140/226 (62%), Positives = 173/226 (77%), Gaps = 4/226 (2%)
 Frame = -1

Query  1056  DGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTIL  877
             DG+G  +  DQ E+ +   P S E +  Q+G  + ++R   P+KLYRAALL++RFADTIL
Sbjct  498   DGNGSTNGLDQPERDAYAIPASVEANSHQEGGNAPSERQVFPQKLYRAALLRSRFADTIL  557

Query  876   KAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakr  697
             KAR+KT  QGEK DP+ LR ERE LE ++++EKARLQAEAKAAEEARK+A  EAAAEAK 
Sbjct  558   KARDKTFDQGEKRDPEILRLEREELERKKREEKARLQAEAKAAEEARKQAAAEAAAEAKH  617

Query  696   krefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALG  520
             KRE EREAARQALL++E+TVEINE+S+FL+DLEMLR  P E   SS+ E+SP HS + +G
Sbjct  618   KRELEREAARQALLQIERTVEINESSQFLKDLEMLRTVPAEHVPSSVGETSPVHSQEDIG  677

Query  519   SFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              FKF GSNPLEQLGLYMK DD+ EE   P +++   A DVEEGEID
Sbjct  678   CFKFGGSNPLEQLGLYMKADDEEEEDGEPSTAL---ANDVEEGEID  720



>ref|XP_006845132.1| PREDICTED: transcription factor GTE9 [Amborella trichopoda]
 gb|ERN06807.1| hypothetical protein AMTR_s00005p00204230 [Amborella trichopoda]
Length=827

 Score =   147 bits (370),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 145/226 (64%), Positives = 177/226 (78%), Gaps = 3/226 (1%)
 Frame = -1

Query  1056  DGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTIL  877
             DG+  +S  D++EQ + +KP S E DG+++GE + ++R  SPEKL RAALL++RFADTIL
Sbjct  604   DGNRSVSELDELEQITNRKPASVESDGRREGENAPSERQVSPEKLLRAALLRSRFADTIL  663

Query  876   KAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakr  697
             KAREKT  Q EKGDP++LRRERE LE Q+++E+ARLQAEAKAA+EARK AE EA AEAKR
Sbjct  664   KAREKTRDQ-EKGDPEKLRREREELERQQREERARLQAEAKAAQEARKHAEAEAEAEAKR  722

Query  696   krefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALG  520
             KR+ EREAAR AL KME+TVEI+E+ +FL+DLEMLR  P E   SS++E+SP HS D LG
Sbjct  723   KRQLEREAARLALQKMEKTVEIDESCQFLKDLEMLRSAPPEHIPSSVDETSPDHSQDGLG  782

Query  519   SFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             SFK  G NPLE+LGLYMK DDD EE  PPP  +     DVEEGEID
Sbjct  783   SFKLRGMNPLERLGLYMKVDDDEEEEAPPPIPM-PAPTDVEEGEID  827



>ref|XP_004138062.1| PREDICTED: transcription factor GTE10 isoform X2 [Cucumis sativus]
 gb|KGN63499.1| hypothetical protein Csa_1G002680 [Cucumis sativus]
Length=781

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 172/217 (79%), Gaps = 3/217 (1%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDG-QQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             V+Q+++   N+ E D  Q++GE + + R  SP++LYRAALL+NRFADTILKAREK L +G
Sbjct  565   VDQTAEANTNTIEPDSYQEEGESAPSKRQVSPDRLYRAALLRNRFADTILKAREKALEKG  624

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             +K DP+++R ERE LE Q+++EKARLQAEAKAAE+AR++AE EAAAEAK+KRE +REAAR
Sbjct  625   DKRDPEKVRMEREELERQQREEKARLQAEAKAAEDARRKAEAEAAAEAKKKRELDREAAR  684

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNE-SSPQHSLDALGSFKFTGSNPL  490
             QALLKME+TV+INENS+F+EDLEMLR    E   +  E SSP+HS +  GSFK  GSNPL
Sbjct  685   QALLKMEKTVDINENSQFMEDLEMLRASNDELLPNFTEESSPEHSQNGFGSFKLQGSNPL  744

Query  489   EQLGLYMKedddfeeceppPS-SVPKDAKDVEEGEID  382
             EQLGLYMK D++ EE E  P  SV K A DVEEGEID
Sbjct  745   EQLGLYMKVDEEDEEEESEPPQSVNKAANDVEEGEID  781



>ref|XP_011652479.1| PREDICTED: transcription factor GTE10 isoform X1 [Cucumis sativus]
Length=782

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 172/217 (79%), Gaps = 3/217 (1%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDG-QQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             V+Q+++   N+ E D  Q++GE + + R  SP++LYRAALL+NRFADTILKAREK L +G
Sbjct  566   VDQTAEANTNTIEPDSYQEEGESAPSKRQVSPDRLYRAALLRNRFADTILKAREKALEKG  625

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             +K DP+++R ERE LE Q+++EKARLQAEAKAAE+AR++AE EAAAEAK+KRE +REAAR
Sbjct  626   DKRDPEKVRMEREELERQQREEKARLQAEAKAAEDARRKAEAEAAAEAKKKRELDREAAR  685

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNE-SSPQHSLDALGSFKFTGSNPL  490
             QALLKME+TV+INENS+F+EDLEMLR    E   +  E SSP+HS +  GSFK  GSNPL
Sbjct  686   QALLKMEKTVDINENSQFMEDLEMLRASNDELLPNFTEESSPEHSQNGFGSFKLQGSNPL  745

Query  489   EQLGLYMKedddfeeceppPS-SVPKDAKDVEEGEID  382
             EQLGLYMK D++ EE E  P  SV K A DVEEGEID
Sbjct  746   EQLGLYMKVDEEDEEEESEPPQSVNKAANDVEEGEID  782



>ref|XP_011652554.1| PREDICTED: transcription factor GTE10 isoform X3 [Cucumis sativus]
Length=777

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 172/217 (79%), Gaps = 3/217 (1%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDG-QQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             V+Q+++   N+ E D  Q++GE + + R  SP++LYRAALL+NRFADTILKAREK L +G
Sbjct  561   VDQTAEANTNTIEPDSYQEEGESAPSKRQVSPDRLYRAALLRNRFADTILKAREKALEKG  620

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             +K DP+++R ERE LE Q+++EKARLQAEAKAAE+AR++AE EAAAEAK+KRE +REAAR
Sbjct  621   DKRDPEKVRMEREELERQQREEKARLQAEAKAAEDARRKAEAEAAAEAKKKRELDREAAR  680

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNE-SSPQHSLDALGSFKFTGSNPL  490
             QALLKME+TV+INENS+F+EDLEMLR    E   +  E SSP+HS +  GSFK  GSNPL
Sbjct  681   QALLKMEKTVDINENSQFMEDLEMLRASNDELLPNFTEESSPEHSQNGFGSFKLQGSNPL  740

Query  489   EQLGLYMKedddfeeceppPS-SVPKDAKDVEEGEID  382
             EQLGLYMK D++ EE E  P  SV K A DVEEGEID
Sbjct  741   EQLGLYMKVDEEDEEEESEPPQSVNKAANDVEEGEID  777



>ref|XP_011652591.1| PREDICTED: transcription factor GTE10 isoform X4 [Cucumis sativus]
Length=776

 Score =   145 bits (367),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 172/217 (79%), Gaps = 3/217 (1%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDG-QQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             V+Q+++   N+ E D  Q++GE + + R  SP++LYRAALL+NRFADTILKAREK L +G
Sbjct  560   VDQTAEANTNTIEPDSYQEEGESAPSKRQVSPDRLYRAALLRNRFADTILKAREKALEKG  619

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             +K DP+++R ERE LE Q+++EKARLQAEAKAAE+AR++AE EAAAEAK+KRE +REAAR
Sbjct  620   DKRDPEKVRMEREELERQQREEKARLQAEAKAAEDARRKAEAEAAAEAKKKRELDREAAR  679

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNE-SSPQHSLDALGSFKFTGSNPL  490
             QALLKME+TV+INENS+F+EDLEMLR    E   +  E SSP+HS +  GSFK  GSNPL
Sbjct  680   QALLKMEKTVDINENSQFMEDLEMLRASNDELLPNFTEESSPEHSQNGFGSFKLQGSNPL  739

Query  489   EQLGLYMKedddfeeceppPS-SVPKDAKDVEEGEID  382
             EQLGLYMK D++ EE E  P  SV K A DVEEGEID
Sbjct  740   EQLGLYMKVDEEDEEEESEPPQSVNKAANDVEEGEID  776



>ref|XP_002871611.1| ATBET9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47870.1| ATBET9 [Arabidopsis lyrata subsp. lyrata]
Length=690

 Score =   144 bits (364),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 168/225 (75%), Gaps = 7/225 (3%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             + + DQ+E +S +K +S E D QQDG  +Q ++   PEK+YRAA LKNRFAD ILKAREK
Sbjct  468   VGVLDQLESASPEKISSVEADCQQDGNSAQTEKQLPPEKIYRAAFLKNRFADIILKAREK  527

Query  861   TLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe  682
              L Q +  DP++L+RERE LE+Q+KKEKARLQAEAKAAEEAR++AE +AAAEA  + + +
Sbjct  528   PLNQNDLRDPEKLQREREELELQKKKEKARLQAEAKAAEEARRKAEAQAAAEAAAEAKRK  587

Query  681   ----reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHS-SLNESSPQHSLDALGS  517
                 REAARQAL++MEQ+VE+NEN++FL+DLE+L+   T+  + ++ E  P  S D L S
Sbjct  588   LELEREAARQALMEMEQSVELNENAKFLKDLELLKTVDTDHLTDAIEEDGPDVSHDGLRS  647

Query  516   FKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             F F GSNPLEQLGL+MK+D+D EE +P  S  P    D+EEGEID
Sbjct  648   FSFGGSNPLEQLGLFMKQDEDDEEADPLTSPAP--GIDIEEGEID  690



>ref|XP_007037913.1| Bromodomain-containing protein, putative isoform 4 [Theobroma 
cacao]
 gb|EOY22414.1| Bromodomain-containing protein, putative isoform 4 [Theobroma 
cacao]
Length=749

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 158/202 (78%), Gaps = 5/202 (2%)
 Frame = -1

Query  981  DGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVL  802
            DG Q  E +  +R  SPEKLYRAA+L+ RFADTILKAREK L +GEKGDP++LR ERE L
Sbjct  551  DGNQ--ESAPAERQVSPEKLYRAAVLRKRFADTILKAREKALEKGEKGDPEKLRMEREEL  608

Query  801  EMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINEN  622
            E  +++EKARLQ EAKAAEEAR +AE EAAAEAKRKRE EREAARQALLKME+TV+IN N
Sbjct  609  ERWQREEKARLQVEAKAAEEARIKAEAEAAAEAKRKRELEREAARQALLKMEKTVDINGN  668

Query  621  SRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDALGSFKFTG-SNPLEQLGLYMKedddfe  448
            S+F+ED EMLR    E   + + E+SP HS + LGSFK  G SNPLEQLGLYMK DD+ E
Sbjct  669  SQFMEDFEMLRTSNDEHLPNFMEETSPSHSQNGLGSFKLQGRSNPLEQLGLYMKADDEDE  728

Query  447  eceppPSSVPKDAKDVEEGEID  382
            E EPP S+ P+   DVEEGEID
Sbjct  729  EDEPPQSA-PEPVNDVEEGEID  749



>ref|XP_008464458.1| PREDICTED: transcription factor GTE10 isoform X3 [Cucumis melo]
Length=775

 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 171/217 (79%), Gaps = 3/217 (1%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDG-QQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             V+ +++   N+ E D  Q++GE + + R  SP++LYRAALL+NRFADTILKAREK L +G
Sbjct  559   VDHTTEANTNTIEPDSYQEEGESAPSKRQVSPDRLYRAALLRNRFADTILKAREKALEKG  618

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             +K DP+++R ERE LE Q+++EKARLQAEAKAAE+AR++AE EAAAEAK+KRE +REAAR
Sbjct  619   DKRDPEKVRMEREELERQQREEKARLQAEAKAAEDARRKAEAEAAAEAKKKRELDREAAR  678

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNE-SSPQHSLDALGSFKFTGSNPL  490
             QALLKME+TV+INENS+F+EDLEMLR    E   +  E SSP+HS +  GSFK  GSNPL
Sbjct  679   QALLKMEKTVDINENSQFMEDLEMLRASNDELLPNFTEESSPEHSQNGFGSFKLQGSNPL  738

Query  489   EQLGLYMKedddfeeceppPS-SVPKDAKDVEEGEID  382
             EQLGLYMK D++ EE E  P  SV K A DVEEGEID
Sbjct  739   EQLGLYMKVDEEDEEEESEPPQSVNKAANDVEEGEID  775



>ref|XP_008464456.1| PREDICTED: transcription factor GTE10 isoform X1 [Cucumis melo]
Length=781

 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 171/217 (79%), Gaps = 3/217 (1%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDG-QQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             V+ +++   N+ E D  Q++GE + + R  SP++LYRAALL+NRFADTILKAREK L +G
Sbjct  565   VDHTTEANTNTIEPDSYQEEGESAPSKRQVSPDRLYRAALLRNRFADTILKAREKALEKG  624

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             +K DP+++R ERE LE Q+++EKARLQAEAKAAE+AR++AE EAAAEAK+KRE +REAAR
Sbjct  625   DKRDPEKVRMEREELERQQREEKARLQAEAKAAEDARRKAEAEAAAEAKKKRELDREAAR  684

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNE-SSPQHSLDALGSFKFTGSNPL  490
             QALLKME+TV+INENS+F+EDLEMLR    E   +  E SSP+HS +  GSFK  GSNPL
Sbjct  685   QALLKMEKTVDINENSQFMEDLEMLRASNDELLPNFTEESSPEHSQNGFGSFKLQGSNPL  744

Query  489   EQLGLYMKedddfeeceppPS-SVPKDAKDVEEGEID  382
             EQLGLYMK D++ EE E  P  SV K A DVEEGEID
Sbjct  745   EQLGLYMKVDEEDEEEESEPPQSVNKAANDVEEGEID  781



>ref|XP_008464457.1| PREDICTED: transcription factor GTE10 isoform X2 [Cucumis melo]
Length=780

 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 171/217 (79%), Gaps = 3/217 (1%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDG-QQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             V+ +++   N+ E D  Q++GE + + R  SP++LYRAALL+NRFADTILKAREK L +G
Sbjct  564   VDHTTEANTNTIEPDSYQEEGESAPSKRQVSPDRLYRAALLRNRFADTILKAREKALEKG  623

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             +K DP+++R ERE LE Q+++EKARLQAEAKAAE+AR++AE EAAAEAK+KRE +REAAR
Sbjct  624   DKRDPEKVRMEREELERQQREEKARLQAEAKAAEDARRKAEAEAAAEAKKKRELDREAAR  683

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNE-SSPQHSLDALGSFKFTGSNPL  490
             QALLKME+TV+INENS+F+EDLEMLR    E   +  E SSP+HS +  GSFK  GSNPL
Sbjct  684   QALLKMEKTVDINENSQFMEDLEMLRASNDELLPNFTEESSPEHSQNGFGSFKLQGSNPL  743

Query  489   EQLGLYMKedddfeeceppPS-SVPKDAKDVEEGEID  382
             EQLGLYMK D++ EE E  P  SV K A DVEEGEID
Sbjct  744   EQLGLYMKVDEEDEEEESEPPQSVNKAANDVEEGEID  780



>ref|XP_006289128.1| hypothetical protein CARUB_v10002549mg [Capsella rubella]
 gb|EOA22026.1| hypothetical protein CARUB_v10002549mg [Capsella rubella]
Length=701

 Score =   143 bits (361),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 165/223 (74%), Gaps = 8/223 (4%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNS-SEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
              DQ+E +SQ+K +S  E D QQDG   QN++   PEK+YRAA LKNRFAD ILK+REK L
Sbjct  481   LDQLESASQEKISSVEEVDCQQDGNSGQNEKQLPPEKIYRAAFLKNRFADLILKSREKPL  540

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe--  682
              Q +  DP++L+RERE LE+Q+KKEKARLQAEAKAAEEAR++ E +AAAEA  + + +  
Sbjct  541   NQNDTRDPEKLQREREELELQKKKEKARLQAEAKAAEEARRKVEAQAAAEAAAEAKRKLE  600

Query  681   --reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFK  511
               REAARQAL++MEQ+VE+NEN++FL+DLE+L+   T+   +S+ E  P  S D L SF 
Sbjct  601   LEREAARQALMEMEQSVELNENAKFLKDLELLKTVNTDHLTNSIEEDGPDVSHDGLRSFS  660

Query  510   FTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             F GSNPLEQLGL+MK+D+D EE +   S  P    D+EEGEID
Sbjct  661   FGGSNPLEQLGLFMKQDEDEEEADLLTSPAP--GIDIEEGEID  701



>ref|XP_008392845.1| PREDICTED: transcription factor GTE10 [Malus domestica]
 ref|XP_008392846.1| PREDICTED: transcription factor GTE10 [Malus domestica]
Length=817

 Score =   144 bits (362),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 154/210 (73%), Gaps = 6/210 (3%)
 Frame = -1

Query  1080  RKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLK  901
             R  + D   G+  I+    +EQ +  KPN  E  G ++GE +  +R  SP+KLYRAALL+
Sbjct  548   RSDIGDSEIGNNSINWVAPLEQDAXSKPNPVEEAGHREGESAPTERQVSPDKLYRAALLR  607

Query  900   NRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraee  721
             NRFADTILKAREK L +GEK DP++LR ERE LE ++K+EKARLQAEAKAAEEARK+AE 
Sbjct  608   NRFADTILKAREKALEKGEKLDPEKLRIEREELEKRQKEEKARLQAEAKAAEEARKKAEA  667

Query  720   eaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSL--NESS  547
             E AA AKR+RE EREAARQAL  ME+TVEINENS+ LEDLEM R    ++H  +   E++
Sbjct  668   EVAAXAKRQRELEREAARQALQMMERTVEINENSQVLEDLEMFRAV-VDEHVPIFTEETT  726

Query  546   PQH---SLDALGSFKFTGSNPLEQLGLYMK  466
             P+H    L  LGSFK  GSNPLEQLGL+MK
Sbjct  727   PEHIQDELARLGSFKLQGSNPLEQLGLFMK  756



>ref|XP_010932309.1| PREDICTED: transcription factor GTE9-like [Elaeis guineensis]
Length=722

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 141/226 (62%), Positives = 165/226 (73%), Gaps = 4/226 (2%)
 Frame = -1

Query  1056  DGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTIL  877
             D  G      Q+EQ     P S E +  Q+GE +   R  SPEKLYRAALL++RFADTIL
Sbjct  500   DASGSSDRLHQLEQDVHSVPASVEANSHQEGENAPCQRQVSPEKLYRAALLRSRFADTIL  559

Query  876   KAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakr  697
             KAREKTL QGEK DP++LR ERE LE Q+++EKARLQAEAKAAEEARK+AE EAAAEAKR
Sbjct  560   KAREKTLDQGEKRDPEKLRLEREELERQKREEKARLQAEAKAAEEARKQAEAEAAAEAKR  619

Query  696   krefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALG  520
             KRE EREAARQALL+ME+T EINEN+ FL+DLEML   P E   SS+ ESSP  S + +G
Sbjct  620   KRELEREAARQALLQMEKTAEINENNLFLKDLEMLSTVPAEHVPSSVGESSPTLSQEGMG  679

Query  519   SFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
               K  G+NPLEQLGLY+K DD+ EE      ++P    DVEEGEID
Sbjct  680   CIKLGGTNPLEQLGLYIKVDDEEEEDGEAR-TIP--VNDVEEGEID  722



>ref|XP_004500665.1| PREDICTED: transcription factor GTE10-like isoform X1 [Cicer 
arietinum]
 ref|XP_004500666.1| PREDICTED: transcription factor GTE10-like isoform X2 [Cicer 
arietinum]
Length=779

 Score =   139 bits (351),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 137/224 (61%), Positives = 162/224 (72%), Gaps = 2/224 (1%)
 Frame = -1

Query  1053  GDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILK  874
             G     L  QV+QS + K  + E +  QDGE + + R  SPEKLYRAALL++RFADTILK
Sbjct  558   GKDSTDLGTQVDQSLETKAVTIESESHQDGESAASKRQVSPEKLYRAALLRSRFADTILK  617

Query  873   AREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrk  694
             A+EK L + EK DP++LR ERE LE ++K+EKARLQAEAKAAEEAR++AE EAAAE KRK
Sbjct  618   AQEKALEKDEKRDPEKLRIEREGLERRQKEEKARLQAEAKAAEEARRKAEAEAAAETKRK  677

Query  693   refereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSF  514
             RE EREAARQAL KME+TVEINE+ +FLEDLEML     E      E+SP H  +  G  
Sbjct  678   REEEREAARQALQKMEKTVEINESCQFLEDLEMLSAVHDENAPIFKEASPDHHQNGFGGI  737

Query  513   KFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             K  G NPLEQLGLYMK DD+ EE E P S+    +KDVEEGEID
Sbjct  738   KLQG-NPLEQLGLYMKVDDEDEEEELPQSAA-GPSKDVEEGEID  779



>ref|XP_010319067.1| PREDICTED: transcription factor GTE10 [Solanum lycopersicum]
Length=781

 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 140/222 (63%), Positives = 169/222 (76%), Gaps = 4/222 (2%)
 Frame = -1

Query  1035  LFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
             L  Q   +SQQ  N +E D  ++ E ++ +R  SPEKLYRAALL+ RFAD ILKA+EK++
Sbjct  560   LAGQTVLTSQQNSNFAELDDHREEESAEPERQVSPEKLYRAALLRGRFADIILKAQEKSI  619

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefere  676
              +GE  DP++L+ ERE  E +R++EKARLQAEAKAAEEARKRAE EAAAEAKRKRE ERE
Sbjct  620   EKGEVRDPEKLKLEREEFERRRREEKARLQAEAKAAEEARKRAEAEAAAEAKRKRELERE  679

Query  675   aarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKF-TG  502
             AARQAL KME+TVEINENSRF+EDLE+ R  P EQ  S ++E+SP HS + LGSFKF   
Sbjct  680   AARQALQKMEKTVEINENSRFMEDLELFRAAPDEQLESFIDETSPGHSENILGSFKFKAS  739

Query  501   SNPLEQLGLYMKedddfeeceppPS--SVPKDAKDVEEGEID  382
             SNPLEQLGLYMKE+D+ EE E      S+P  + D EEGEID
Sbjct  740   SNPLEQLGLYMKEEDEDEEEEEEAEPHSIPDISNDPEEGEID  781



>ref|XP_009359473.1| PREDICTED: transcription factor GTE10-like [Pyrus x bretschneideri]
 ref|XP_009359474.1| PREDICTED: transcription factor GTE10-like [Pyrus x bretschneideri]
Length=802

 Score =   139 bits (349),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 138/238 (58%), Positives = 167/238 (70%), Gaps = 25/238 (11%)
 Frame = -1

Query  1026  QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             Q+EQ +  K N  E  G ++GE +  +RP SP+KLYRAALL+NRFADTILKAREK L +G
Sbjct  567   QLEQDTPSKLNPVEEAGHREGESAPTERPVSPDKLYRAALLRNRFADTILKAREKALEKG  626

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             EK DP++LR ERE LE ++K+EKARLQAEAKAAEEARK+AE EAAAEAKR+RE EREAAR
Sbjct  627   EKLDPEKLRIEREELEKRQKEEKARLQAEAKAAEEARKKAEAEAAAEAKRQRELEREAAR  686

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSL--NESSPQH---SLDALGSFKFTG  502
             QAL  ME+TVEINENS+FLEDLEM R    ++H  +   E++P+H    L  LGSFK  G
Sbjct  687   QALQMMERTVEINENSQFLEDLEMFRA--VDEHVPIFTEETTPEHIQDELARLGSFKLQG  744

Query  501   -SNPLEQLGLYMKe-----------------dddfeeceppPSSVPKDAKDVEEGEID  382
              SNPLEQLGL+MK                  + + E    P  S   +AKDVEEG+ID
Sbjct  745   SSNPLEQLGLFMKTDDDIEEEIEPPQSAPEPEPEPEREPEPEPSNDVEAKDVEEGQID  802



>ref|XP_009609469.1| PREDICTED: transcription factor GTE10-like isoform X3 [Nicotiana 
tomentosiformis]
Length=785

 Score =   138 bits (348),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 164/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAALL++RFADTILKA+EKTL +GE
Sbjct  564   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAALLRSRFADTILKAQEKTLEKGE  623

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+  +E LE +R++EKARLQAEAKAA EAR+ AE EAAAEAK+KRE EREAARQ
Sbjct  624   VWDPEKLKLGKEELERRRREEKARLQAEAKAAGEARREAEAEAAAEAKKKRELEREAARQ  683

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  684   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPGHSQNGLGSFKFKASSNPL  743

Query  489   EQLGLYMKedddfeeceppP-----SSVPKD-AKDVEEGEID  382
             EQLGLYMK D + EE          S+ P+D +KD EEGEID
Sbjct  744   EQLGLYMKGDGEDEEENESHSIPDLSNCPEDISKDPEEGEID  785



>ref|XP_009609471.1| PREDICTED: transcription factor GTE10-like isoform X5 [Nicotiana 
tomentosiformis]
Length=784

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 164/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAALL++RFADTILKA+EKTL +GE
Sbjct  563   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAALLRSRFADTILKAQEKTLEKGE  622

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+  +E LE +R++EKARLQAEAKAA EAR+ AE EAAAEAK+KRE EREAARQ
Sbjct  623   VWDPEKLKLGKEELERRRREEKARLQAEAKAAGEARREAEAEAAAEAKKKRELEREAARQ  682

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  683   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPGHSQNGLGSFKFKASSNPL  742

Query  489   EQLGLYMKedddfeeceppP-----SSVPKD-AKDVEEGEID  382
             EQLGLYMK D + EE          S+ P+D +KD EEGEID
Sbjct  743   EQLGLYMKGDGEDEEENESHSIPDLSNCPEDISKDPEEGEID  784



>ref|XP_009609473.1| PREDICTED: transcription factor GTE10-like isoform X7 [Nicotiana 
tomentosiformis]
Length=780

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 164/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAALL++RFADTILKA+EKTL +GE
Sbjct  559   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAALLRSRFADTILKAQEKTLEKGE  618

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+  +E LE +R++EKARLQAEAKAA EAR+ AE EAAAEAK+KRE EREAARQ
Sbjct  619   VWDPEKLKLGKEELERRRREEKARLQAEAKAAGEARREAEAEAAAEAKKKRELEREAARQ  678

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  679   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPGHSQNGLGSFKFKASSNPL  738

Query  489   EQLGLYMKedddfeeceppP-----SSVPKD-AKDVEEGEID  382
             EQLGLYMK D + EE          S+ P+D +KD EEGEID
Sbjct  739   EQLGLYMKGDGEDEEENESHSIPDLSNCPEDISKDPEEGEID  780



>ref|XP_009609468.1| PREDICTED: transcription factor GTE10-like isoform X2 [Nicotiana 
tomentosiformis]
Length=786

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 164/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAALL++RFADTILKA+EKTL +GE
Sbjct  565   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAALLRSRFADTILKAQEKTLEKGE  624

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+  +E LE +R++EKARLQAEAKAA EAR+ AE EAAAEAK+KRE EREAARQ
Sbjct  625   VWDPEKLKLGKEELERRRREEKARLQAEAKAAGEARREAEAEAAAEAKKKRELEREAARQ  684

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  685   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPGHSQNGLGSFKFKASSNPL  744

Query  489   EQLGLYMKedddfeeceppP-----SSVPKD-AKDVEEGEID  382
             EQLGLYMK D + EE          S+ P+D +KD EEGEID
Sbjct  745   EQLGLYMKGDGEDEEENESHSIPDLSNCPEDISKDPEEGEID  786



>ref|XP_009609470.1| PREDICTED: transcription factor GTE10-like isoform X4 [Nicotiana 
tomentosiformis]
Length=785

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 164/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAALL++RFADTILKA+EKTL +GE
Sbjct  564   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAALLRSRFADTILKAQEKTLEKGE  623

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+  +E LE +R++EKARLQAEAKAA EAR+ AE EAAAEAK+KRE EREAARQ
Sbjct  624   VWDPEKLKLGKEELERRRREEKARLQAEAKAAGEARREAEAEAAAEAKKKRELEREAARQ  683

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  684   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPGHSQNGLGSFKFKASSNPL  743

Query  489   EQLGLYMKedddfeeceppP-----SSVPKD-AKDVEEGEID  382
             EQLGLYMK D + EE          S+ P+D +KD EEGEID
Sbjct  744   EQLGLYMKGDGEDEEENESHSIPDLSNCPEDISKDPEEGEID  785



>ref|XP_009609466.1| PREDICTED: transcription factor GTE10-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009609467.1| PREDICTED: transcription factor GTE10-like isoform X1 [Nicotiana 
tomentosiformis]
Length=787

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 164/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAALL++RFADTILKA+EKTL +GE
Sbjct  566   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAALLRSRFADTILKAQEKTLEKGE  625

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+  +E LE +R++EKARLQAEAKAA EAR+ AE EAAAEAK+KRE EREAARQ
Sbjct  626   VWDPEKLKLGKEELERRRREEKARLQAEAKAAGEARREAEAEAAAEAKKKRELEREAARQ  685

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  686   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPGHSQNGLGSFKFKASSNPL  745

Query  489   EQLGLYMKedddfeeceppP-----SSVPKD-AKDVEEGEID  382
             EQLGLYMK D + EE          S+ P+D +KD EEGEID
Sbjct  746   EQLGLYMKGDGEDEEENESHSIPDLSNCPEDISKDPEEGEID  787



>ref|XP_009609472.1| PREDICTED: transcription factor GTE10-like isoform X6 [Nicotiana 
tomentosiformis]
Length=782

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 164/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAALL++RFADTILKA+EKTL +GE
Sbjct  561   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAALLRSRFADTILKAQEKTLEKGE  620

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+  +E LE +R++EKARLQAEAKAA EAR+ AE EAAAEAK+KRE EREAARQ
Sbjct  621   VWDPEKLKLGKEELERRRREEKARLQAEAKAAGEARREAEAEAAAEAKKKRELEREAARQ  680

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  681   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPGHSQNGLGSFKFKASSNPL  740

Query  489   EQLGLYMKedddfeeceppP-----SSVPKD-AKDVEEGEID  382
             EQLGLYMK D + EE          S+ P+D +KD EEGEID
Sbjct  741   EQLGLYMKGDGEDEEENESHSIPDLSNCPEDISKDPEEGEID  782



>ref|NP_568297.1| bromodomain and extraterminal domain protein 9 [Arabidopsis thaliana]
 sp|Q93YS6.1|GTE9_ARATH RecName: Full=Transcription factor GTE9; AltName: Full=BROMODOMAIN 
AND EXTRATERMINAL DOMAIN PROTEIN 9; Short=AtBET9; AltName: 
Full=Bromodomain-containing protein GTE9; AltName: Full=Protein 
GLOBAL TRANSCRIPTION FACTOR GROUP E9 [Arabidopsis thaliana]
 gb|AAL24133.1| putative kinase [Arabidopsis thaliana]
 gb|AED92010.1| bromodomain and extraterminal domain protein 9 [Arabidopsis thaliana]
Length=688

 Score =   137 bits (345),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 165/221 (75%), Gaps = 7/221 (3%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLG  853
              DQ+E +S +K +S E D QQDG  +QN++   PEK YRAA+LKNRFAD ILKAREK L 
Sbjct  471   LDQLESASPEKISSVEADCQQDGNSAQNEKQLPPEKSYRAAILKNRFADIILKAREKPLN  530

Query  852   QGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkref----  685
             Q +  DP++L+RERE LE+Q+KKEKARLQAEAKAAEEAR++AE +AAAEA  + +     
Sbjct  531   QNDTRDPEKLQREREELELQKKKEKARLQAEAKAAEEARRKAEAQAAAEAAAEAKRKLEL  590

Query  684   ereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFT  505
             EREAARQAL++MEQ+VE+NEN++FLEDLE+L+   T+  ++  E      +  L SF F 
Sbjct  591   EREAARQALMEMEQSVELNENAKFLEDLELLKTVDTDHLTNTIEEEDGPDV-GLRSFSFG  649

Query  504   GSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GSNPLEQLGL+MK+D+D EE +P  S  P+   D+EEGEID
Sbjct  650   GSNPLEQLGLFMKQDEDEEEADPLTSPAPE--IDIEEGEID  688



>ref|NP_001190308.1| bromodomain and extraterminal domain protein 9 [Arabidopsis thaliana]
 gb|AED92011.1| bromodomain and extraterminal domain protein 9 [Arabidopsis thaliana]
Length=689

 Score =   137 bits (345),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 165/221 (75%), Gaps = 7/221 (3%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLG  853
              DQ+E +S +K +S E D QQDG  +QN++   PEK YRAA+LKNRFAD ILKAREK L 
Sbjct  472   LDQLESASPEKISSVEADCQQDGNSAQNEKQLPPEKSYRAAILKNRFADIILKAREKPLN  531

Query  852   QGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkref----  685
             Q +  DP++L+RERE LE+Q+KKEKARLQAEAKAAEEAR++AE +AAAEA  + +     
Sbjct  532   QNDTRDPEKLQREREELELQKKKEKARLQAEAKAAEEARRKAEAQAAAEAAAEAKRKLEL  591

Query  684   ereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFT  505
             EREAARQAL++MEQ+VE+NEN++FLEDLE+L+   T+  ++  E      +  L SF F 
Sbjct  592   EREAARQALMEMEQSVELNENAKFLEDLELLKTVDTDHLTNTIEEEDGPDV-GLRSFSFG  650

Query  504   GSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GSNPLEQLGL+MK+D+D EE +P  S  P+   D+EEGEID
Sbjct  651   GSNPLEQLGLFMKQDEDEEEADPLTSPAPE--IDIEEGEID  689



>ref|XP_006581882.1| PREDICTED: transcription factor GTE10-like isoform X3 [Glycine 
max]
Length=788

 Score =   137 bits (346),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 163/220 (74%), Gaps = 6/220 (3%)
 Frame = -1

Query  1026  QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             QVE+SSQ +P ++E +  Q+GE + + R  SPEKLYRAALL++RFADTILKA+EK L + 
Sbjct  570   QVEESSQSRPVATEPESHQEGESAASKRQVSPEKLYRAALLRSRFADTILKAQEKALEKD  629

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             EK DP++LR ERE LE ++K+EKARLQAEAKAAEEA+++AE EAAAEAKRKRE EREAAR
Sbjct  630   EKRDPEKLRIEREDLERRQKEEKARLQAEAKAAEEAQRKAEAEAAAEAKRKRELEREAAR  689

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKFTGSNPL  490
             QAL KME+TV+INENS+FLEDLEML     E   S   E+S     D LG  K  G NPL
Sbjct  690   QALQKMEKTVDINENSQFLEDLEMLSAVHDEHLPSFKEETSTDQPQDGLGGIKLQG-NPL  748

Query  489   EQLGLYMKedddfeeceppPSSVPKDA----KDVEEGEID  382
             EQLGLYMK++D+ E+ E      P  A     DVEEGEID
Sbjct  749   EQLGLYMKDEDEEEDEEEEDELPPSGAVGPSNDVEEGEID  788



>gb|KHN23270.1| Transcription factor GTE10 [Glycine soja]
Length=788

 Score =   137 bits (346),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 163/220 (74%), Gaps = 6/220 (3%)
 Frame = -1

Query  1026  QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             QVE+SSQ +P ++E +  Q+GE + + R  SPEKLYRAALL++RFADTILKA+EK L + 
Sbjct  570   QVEESSQSRPVATEPESHQEGESAASKRQVSPEKLYRAALLRSRFADTILKAQEKALEKD  629

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             EK DP++LR ERE LE ++K+EKARLQAEAKAAEEA+++AE EAAAEAKRKRE EREAAR
Sbjct  630   EKRDPEKLRIEREDLERRQKEEKARLQAEAKAAEEAQRKAEAEAAAEAKRKRELEREAAR  689

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKFTGSNPL  490
             QAL KME+TV+INENS+FLEDLEML     E   S   E+S     D LG  K  G NPL
Sbjct  690   QALQKMEKTVDINENSQFLEDLEMLSAVHDEHLPSFKEETSTDQPQDGLGGIKLQG-NPL  748

Query  489   EQLGLYMKedddfeeceppPSSVPKDA----KDVEEGEID  382
             EQLGLYMK++D+ E+ E      P  A     DVEEGEID
Sbjct  749   EQLGLYMKDEDEEEDEEEEDELPPSGAVGPSNDVEEGEID  788



>ref|XP_006581880.1| PREDICTED: transcription factor GTE10-like isoform X1 [Glycine 
max]
 ref|XP_006581881.1| PREDICTED: transcription factor GTE10-like isoform X2 [Glycine 
max]
Length=790

 Score =   137 bits (345),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 163/220 (74%), Gaps = 6/220 (3%)
 Frame = -1

Query  1026  QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             QVE+SSQ +P ++E +  Q+GE + + R  SPEKLYRAALL++RFADTILKA+EK L + 
Sbjct  572   QVEESSQSRPVATEPESHQEGESAASKRQVSPEKLYRAALLRSRFADTILKAQEKALEKD  631

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             EK DP++LR ERE LE ++K+EKARLQAEAKAAEEA+++AE EAAAEAKRKRE EREAAR
Sbjct  632   EKRDPEKLRIEREDLERRQKEEKARLQAEAKAAEEAQRKAEAEAAAEAKRKRELEREAAR  691

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKFTGSNPL  490
             QAL KME+TV+INENS+FLEDLEML     E   S   E+S     D LG  K  G NPL
Sbjct  692   QALQKMEKTVDINENSQFLEDLEMLSAVHDEHLPSFKEETSTDQPQDGLGGIKLQG-NPL  750

Query  489   EQLGLYMKedddfeeceppPSSVPKDA----KDVEEGEID  382
             EQLGLYMK++D+ E+ E      P  A     DVEEGEID
Sbjct  751   EQLGLYMKDEDEEEDEEEEDELPPSGAVGPSNDVEEGEID  790



>gb|KHN34396.1| Transcription factor GTE10 [Glycine soja]
Length=739

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 167/218 (77%), Gaps = 5/218 (2%)
 Frame = -1

Query  1026  QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
              VEQSSQ    S E +  Q+GE + + +  SP+KLYRAALL++RFADTILKA+EKTL +G
Sbjct  524   HVEQSSQTDSVSDEPENHQEGENAPSKKQVSPDKLYRAALLRSRFADTILKAQEKTLEKG  583

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             +K DP++LR ER+ LE ++K+EKARLQAEAKAAEE R++AE EAA EAKRKRE EREAAR
Sbjct  584   DKWDPEKLRMERKELERRQKEEKARLQAEAKAAEEVRRKAEAEAATEAKRKRELEREAAR  643

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQH--SSLNESSPQHSLDALGSFKFTGS-N  496
             QAL KME+T+ I+E+S+FLEDLEML  G  ++H  +   E SP H  + LGSFK  GS N
Sbjct  644   QALQKMEKTIGISESSQFLEDLEMLS-GLLDEHLPNFTEERSPDHLENGLGSFKLQGSCN  702

Query  495   PLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             PLEQLGLYMK D++ EE E P S+  ++  DVEEGEI+
Sbjct  703   PLEQLGLYMKADEEEEEEEMPQSTT-RETNDVEEGEIN  739



>ref|XP_010677929.1| PREDICTED: transcription factor GTE10-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010677930.1| PREDICTED: transcription factor GTE10-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010677931.1| PREDICTED: transcription factor GTE10-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=784

 Score =   137 bits (344),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 174/224 (78%), Gaps = 5/224 (2%)
 Frame = -1

Query  1038  SLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKT  859
             S   QVEQSSQ K  S E DG ++GE + ++R  SP+KLYRAALL++RFADTILKA+EKT
Sbjct  561   SSLSQVEQSSQIKDPSIEVDGLKEGESAPSERQVSPDKLYRAALLRSRFADTILKAQEKT  620

Query  858   LGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefer  679
             L +GEK DP++LR ERE LE ++++EKARLQAEA+AAEEAR++AE EAAAEAKRKRE ER
Sbjct  621   LEKGEKRDPEKLRLEREELERRQREEKARLQAEARAAEEARRKAEAEAAAEAKRKRELER  680

Query  678   eaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLD--ALGSFKF  508
             EAAR AL KME+TV+INEN +F+EDLEML   P +  SS +  +SP  S +   LGSF+F
Sbjct  681   EAARLALQKMEKTVDINENCQFMEDLEMLSTAPADNLSSFIGNTSPNDSENGGGLGSFRF  740

Query  507   TG-SNPLEQLGLYMKedddfeeceppPSSVPKDA-KDVEEGEID  382
              G SNPLEQLGLY K+DD+ EE    P +VP+ A  DVEEGEID
Sbjct  741   RGNSNPLEQLGLYRKDDDEEEEEVEAPHNVPEAAPNDVEEGEID  784



>ref|XP_010677932.1| PREDICTED: transcription factor GTE10-like isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=779

 Score =   136 bits (343),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 174/224 (78%), Gaps = 5/224 (2%)
 Frame = -1

Query  1038  SLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKT  859
             S   QVEQSSQ K  S E DG ++GE + ++R  SP+KLYRAALL++RFADTILKA+EKT
Sbjct  556   SSLSQVEQSSQIKDPSIEVDGLKEGESAPSERQVSPDKLYRAALLRSRFADTILKAQEKT  615

Query  858   LGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefer  679
             L +GEK DP++LR ERE LE ++++EKARLQAEA+AAEEAR++AE EAAAEAKRKRE ER
Sbjct  616   LEKGEKRDPEKLRLEREELERRQREEKARLQAEARAAEEARRKAEAEAAAEAKRKRELER  675

Query  678   eaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLD--ALGSFKF  508
             EAAR AL KME+TV+INEN +F+EDLEML   P +  SS +  +SP  S +   LGSF+F
Sbjct  676   EAARLALQKMEKTVDINENCQFMEDLEMLSTAPADNLSSFIGNTSPNDSENGGGLGSFRF  735

Query  507   TG-SNPLEQLGLYMKedddfeeceppPSSVPKDA-KDVEEGEID  382
              G SNPLEQLGLY K+DD+ EE    P +VP+ A  DVEEGEID
Sbjct  736   RGNSNPLEQLGLYRKDDDEEEEEVEAPHNVPEAAPNDVEEGEID  779



>gb|KJB38771.1| hypothetical protein B456_006G271100 [Gossypium raimondii]
Length=668

 Score =   135 bits (341),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 166/219 (76%), Gaps = 12/219 (5%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLG  853
             F QVE  S  KP++ E       E + ++R  SPEKLYRAALL+NRFADT+LKAREK L 
Sbjct  460   FGQVE-FSDDKPSAVE-------ESAPSERQVSPEKLYRAALLRNRFADTVLKAREKALE  511

Query  852   QGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkreferea  673
             +GEKGDP +LR ERE LE Q+++EKARLQAEAKAAEEAR++AE EAA EAKRKRE EREA
Sbjct  512   KGEKGDPVKLRMEREELERQQREEKARLQAEAKAAEEARRKAEAEAAVEAKRKRELEREA  571

Query  672   arqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDALGSFKFTG-S  499
             ARQALLKME+TV+INENS+F+EDLEML     E   + + E+SP HS + LGSFK  G S
Sbjct  572   ARQALLKMEKTVDINENSQFMEDLEMLTTTNDETLPNFMEETSPSHSQNELGSFKLRGVS  631

Query  498   NPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             NPLEQLGLYMK DD+ E+  P   S P+   DVEEGEID
Sbjct  632   NPLEQLGLYMKPDDNDEDEPPQ--SAPEPVNDVEEGEID  668



>ref|XP_008374310.1| PREDICTED: transcription factor GTE10-like [Malus domestica]
Length=835

 Score =   137 bits (344),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 153/209 (73%), Gaps = 4/209 (2%)
 Frame = -1

Query  1080  RKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLK  901
             R  + D   G+  I+    +EQ    KP   E  G ++GE + ++R  SP+KLYRAA+L+
Sbjct  549   RSDIGDSEIGNQSINRVAPLEQDPPSKPIPVEEGGHREGESAPSERQVSPDKLYRAAVLR  608

Query  900   NRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraee  721
             NRFADTILKAREK L +GEK DP++LR ERE LE ++K+EKARLQAEAKAAEEARK+AE 
Sbjct  609   NRFADTILKAREKALEKGEKLDPEKLRIEREELEKRQKEEKARLQAEAKAAEEARKKAEA  668

Query  720   eaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQ  541
             EAAAEAKR+RE EREAARQAL  +E+TVEINENSRFLEDLEM R       +   E+SP+
Sbjct  669   EAAAEAKRQRELEREAARQALQMIEKTVEINENSRFLEDLEMFRAVDEHVTNFTEETSPE  728

Query  540   H---SLDALGSFKFTG-SNPLEQLGLYMK  466
             H    L  LGSFK  G SNPLEQLGL+MK
Sbjct  729   HIEDELARLGSFKLQGSSNPLEQLGLFMK  757



>ref|XP_003525531.2| PREDICTED: transcription factor GTE10-like, partial [Glycine 
max]
Length=792

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 167/218 (77%), Gaps = 5/218 (2%)
 Frame = -1

Query  1026  QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
              VEQSSQ    S E +  Q+GE + + +  SP+KLYRAALL++RFADTILKA+EKTL +G
Sbjct  577   HVEQSSQTDSVSDEPENHQEGENAPSKKQVSPDKLYRAALLRSRFADTILKAQEKTLEKG  636

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             +K DP++LR ER+ LE ++K+EKARLQAEAKAAEE R++AE EAA EAKRKRE EREAAR
Sbjct  637   DKWDPEKLRMERKELERRQKEEKARLQAEAKAAEEVRRKAEAEAATEAKRKRELEREAAR  696

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQH--SSLNESSPQHSLDALGSFKFTGS-N  496
             QAL KME+T+ I+E+S+FLEDLEML  G  ++H  +   E SP H  + LGSFK  GS N
Sbjct  697   QALQKMEKTIGISESSQFLEDLEMLS-GLLDEHLPNFTEERSPDHLENGLGSFKLQGSCN  755

Query  495   PLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             PLEQLGLYMK D++ EE E P S+  ++  DVEEGEI+
Sbjct  756   PLEQLGLYMKADEEEEEEEMPQSTT-RETNDVEEGEIN  792



>ref|XP_010492232.1| PREDICTED: transcription factor GTE9-like isoform X2 [Camelina 
sativa]
Length=697

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 169/224 (75%), Gaps = 12/224 (5%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNS-SEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
              DQ+E +SQ+K +S  E D QQDG  +QN++   PEK+YRAALLKNRFAD ILK+REK L
Sbjct  479   LDQLESASQEKISSIEEVDCQQDGNSAQNEKQLPPEKVYRAALLKNRFADLILKSREKPL  538

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkref---  685
              Q    DP++L+RERE LE+Q+KKEKARLQAEAKAAEEAR++AE +AAAEA  + +    
Sbjct  539   NQNVTRDPEKLQREREELELQKKKEKARLQAEAKAAEEARRKAEAQAAAEAAAEAKRKLE  598

Query  684   -ereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDA-LGSF  514
              EREAARQAL++MEQ+VE+NEN++FL+DLE+L+   T+Q ++ + E  P  S D  L SF
Sbjct  599   LEREAARQALMEMEQSVELNENAKFLKDLELLK---TDQLTNEIEEDGPDVSHDGLLRSF  655

Query  513   KFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              F GSNPLEQLGL+MK+D+D EE +P  S  P    D+EEGEID
Sbjct  656   SFGGSNPLEQLGLFMKQDEDEEEADPLTSPAP--GIDIEEGEID  697



>ref|XP_010492231.1| PREDICTED: transcription factor GTE9-like isoform X1 [Camelina 
sativa]
Length=698

 Score =   135 bits (341),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 169/224 (75%), Gaps = 12/224 (5%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNS-SEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
              DQ+E +SQ+K +S  E D QQDG  +QN++   PEK+YRAALLKNRFAD ILK+REK L
Sbjct  480   LDQLESASQEKISSIEEVDCQQDGNSAQNEKQLPPEKVYRAALLKNRFADLILKSREKPL  539

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkref---  685
              Q    DP++L+RERE LE+Q+KKEKARLQAEAKAAEEAR++AE +AAAEA  + +    
Sbjct  540   NQNVTRDPEKLQREREELELQKKKEKARLQAEAKAAEEARRKAEAQAAAEAAAEAKRKLE  599

Query  684   -ereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDA-LGSF  514
              EREAARQAL++MEQ+VE+NEN++FL+DLE+L+   T+Q ++ + E  P  S D  L SF
Sbjct  600   LEREAARQALMEMEQSVELNENAKFLKDLELLK---TDQLTNEIEEDGPDVSHDGLLRSF  656

Query  513   KFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              F GSNPLEQLGL+MK+D+D EE +P  S  P    D+EEGEID
Sbjct  657   SFGGSNPLEQLGLFMKQDEDEEEADPLTSPAP--GIDIEEGEID  698



>emb|CDP15018.1| unnamed protein product [Coffea canephora]
Length=242

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 133/200 (67%), Positives = 159/200 (80%), Gaps = 3/200 (2%)
 Frame = -1

Query  975  QQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEM  796
             Q+ E +  +R  SPEK YRAALL++RFADTI+KA+EK L +GEK DP++LRRERE LE 
Sbjct  44   HQEAESAPQERQVSPEKQYRAALLRSRFADTIIKAQEKALEKGEKLDPEKLRREREDLER  103

Query  795  QrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSR  616
            +RK+EKARLQAEAKAAE+AR++AEEEAAAE +RKRE EREAARQAL +ME+TV+INENS+
Sbjct  104  RRKEEKARLQAEAKAAEDARRKAEEEAAAEVRRKRELEREAARQALQQMEKTVDINENSQ  163

Query  615  FLEDLEMLRVGPTEQHSS-LNESSPQHSLDALGSFKFTG-SNPLEQLGLYMKedddfeec  442
            F+EDLEM R  P EQ  + + E+SP+HS   LGSFKF G SNPLEQLGLYMK  DD EE 
Sbjct  164  FMEDLEMFRSAPDEQLVNFIEETSPEHSQTGLGSFKFQGSSNPLEQLGLYMK-KDDEEEE  222

Query  441  eppPSSVPKDAKDVEEGEID  382
            E    SVP  + D EEGEID
Sbjct  223  ETDVHSVPDASDDPEEGEID  242



>ref|XP_010453546.1| PREDICTED: transcription factor GTE9 isoform X1 [Camelina sativa]
Length=699

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 169/224 (75%), Gaps = 12/224 (5%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNS-SEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
              DQ+E +SQ+K +S  E D QQDG  +QN++   PEK+YRAALLKNRFAD ILK+REK L
Sbjct  481   LDQLESASQEKISSVEEADCQQDGNSAQNEKQLPPEKVYRAALLKNRFADLILKSREKPL  540

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkref---  685
              Q    DP++L+RERE LE+Q+KKEKARLQAEAKAAEEAR++AE +AAAEA  + +    
Sbjct  541   NQNVTRDPEKLQREREELELQKKKEKARLQAEAKAAEEARRKAEAQAAAEAAAEAKRKLE  600

Query  684   -ereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDA-LGSF  514
              EREAARQAL++MEQ+VE+NEN++FL+DLE+L+   T+Q ++ + E  P  S D  L SF
Sbjct  601   LEREAARQALMEMEQSVELNENAKFLKDLELLK---TDQLTNEIEEDGPDVSHDGLLRSF  657

Query  513   KFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              F GSNPLEQLGL+MK+D+D EE +P  S  P    DVEEGEID
Sbjct  658   SFGGSNPLEQLGLFMKQDEDEEEADPLTSPAP--GLDVEEGEID  699



>ref|XP_010453548.1| PREDICTED: transcription factor GTE9 isoform X2 [Camelina sativa]
Length=698

 Score =   135 bits (340),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 133/224 (59%), Positives = 169/224 (75%), Gaps = 12/224 (5%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNS-SEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
              DQ+E +SQ+K +S  E D QQDG  +QN++   PEK+YRAALLKNRFAD ILK+REK L
Sbjct  480   LDQLESASQEKISSVEEADCQQDGNSAQNEKQLPPEKVYRAALLKNRFADLILKSREKPL  539

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkref---  685
              Q    DP++L+RERE LE+Q+KKEKARLQAEAKAAEEAR++AE +AAAEA  + +    
Sbjct  540   NQNVTRDPEKLQREREELELQKKKEKARLQAEAKAAEEARRKAEAQAAAEAAAEAKRKLE  599

Query  684   -ereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDA-LGSF  514
              EREAARQAL++MEQ+VE+NEN++FL+DLE+L+   T+Q ++ + E  P  S D  L SF
Sbjct  600   LEREAARQALMEMEQSVELNENAKFLKDLELLK---TDQLTNEIEEDGPDVSHDGLLRSF  656

Query  513   KFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              F GSNPLEQLGL+MK+D+D EE +P  S  P    DVEEGEID
Sbjct  657   SFGGSNPLEQLGLFMKQDEDEEEADPLTSPAP--GLDVEEGEID  698



>ref|XP_010420059.1| PREDICTED: transcription factor GTE9 isoform X2 [Camelina sativa]
Length=699

 Score =   135 bits (339),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 168/224 (75%), Gaps = 12/224 (5%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNS-SEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
              DQ+E +SQ+K +S  E D QQDG  +QN++   PEK+YRAALLKNRFAD ILK+REK L
Sbjct  481   LDQLESASQEKISSVEEADCQQDGNSAQNEKQLPPEKVYRAALLKNRFADLILKSREKPL  540

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe--  682
              Q    DP++L+RERE LE+Q+KKEKARLQAEAKAAEEAR++AE +AA EA  + + +  
Sbjct  541   NQNVTRDPEKLQREREELELQKKKEKARLQAEAKAAEEARRKAEAQAAGEAAAEAKRKLE  600

Query  681   --reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDA-LGSF  514
               REAARQAL++MEQ+VE+NEN++FL+DLE+L+   T+Q ++ + E  P  S D  L SF
Sbjct  601   LEREAARQALMEMEQSVELNENAKFLKDLELLK---TDQLTNEIEEDGPDVSHDGLLRSF  657

Query  513   KFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              F GSNPLEQLGL+MK+D+D EE +P  S  P    D+EEGEID
Sbjct  658   SFGGSNPLEQLGLFMKQDEDEEEADPLTSPAP--GLDIEEGEID  699



>ref|XP_010420058.1| PREDICTED: transcription factor GTE9 isoform X1 [Camelina sativa]
Length=700

 Score =   135 bits (339),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 130/224 (58%), Positives = 168/224 (75%), Gaps = 12/224 (5%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNS-SEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
              DQ+E +SQ+K +S  E D QQDG  +QN++   PEK+YRAALLKNRFAD ILK+REK L
Sbjct  482   LDQLESASQEKISSVEEADCQQDGNSAQNEKQLPPEKVYRAALLKNRFADLILKSREKPL  541

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe--  682
              Q    DP++L+RERE LE+Q+KKEKARLQAEAKAAEEAR++AE +AA EA  + + +  
Sbjct  542   NQNVTRDPEKLQREREELELQKKKEKARLQAEAKAAEEARRKAEAQAAGEAAAEAKRKLE  601

Query  681   --reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSS-LNESSPQHSLDA-LGSF  514
               REAARQAL++MEQ+VE+NEN++FL+DLE+L+   T+Q ++ + E  P  S D  L SF
Sbjct  602   LEREAARQALMEMEQSVELNENAKFLKDLELLK---TDQLTNEIEEDGPDVSHDGLLRSF  658

Query  513   KFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              F GSNPLEQLGL+MK+D+D EE +P  S  P    D+EEGEID
Sbjct  659   SFGGSNPLEQLGLFMKQDEDEEEADPLTSPAP--GLDIEEGEID  700



>ref|XP_006578695.1| PREDICTED: transcription factor GTE10-like [Glycine max]
Length=783

 Score =   135 bits (339),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 139/217 (64%), Positives = 163/217 (75%), Gaps = 3/217 (1%)
 Frame = -1

Query  1026  QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             QVEQSSQ    ++E +  QDGE + + R  SPEKLYRAALL++RFADTILKA+EK L + 
Sbjct  568   QVEQSSQSGHVATEPESHQDGESAASKRQVSPEKLYRAALLRSRFADTILKAQEKALEKD  627

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             EK DP++LR ERE LE ++K+EKARLQAEAKAAEEA+++AE EAAAEAKRKRE EREAAR
Sbjct  628   EKRDPEKLRIEREDLERRQKEEKARLQAEAKAAEEAQRKAEAEAAAEAKRKRELEREAAR  687

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKFTGSNPL  490
             QAL KME+TV+INENS FLEDLEML     E   S   E+S     D LG  K  G NPL
Sbjct  688   QALQKMEKTVDINENSHFLEDLEMLSAVHDEHLPSFKEETSADQPQDGLGGIKLQG-NPL  746

Query  489   EQLGLYMK-edddfeeceppPSSVPKDAKDVEEGEID  382
             EQLGLYMK E+++ EE EPPPS     + DVEEGEID
Sbjct  747   EQLGLYMKEEEEEEEEEEPPPSGAAGPSNDVEEGEID  783



>ref|XP_009616063.1| PREDICTED: transcription factor GTE10-like isoform X3 [Nicotiana 
tomentosiformis]
Length=770

 Score =   134 bits (338),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 165/213 (77%), Gaps = 4/213 (2%)
 Frame = -1

Query  1014  SSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGD  835
             +S++K  S+E D  ++ E ++ +R  SPEKLYRAALL+ RFAD ILKA+EK+L +GE  D
Sbjct  560   TSEKKSISAEPDDHREEESAEPERQVSPEKLYRAALLRGRFADIILKAQEKSLEKGEVRD  619

Query  834   PDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALL  655
             P++L+ ERE  E +R++EKARLQAEAKAAEEAR+RA+ EAAAEAKRKRE EREAARQAL 
Sbjct  620   PERLKLEREEFERRRREEKARLQAEAKAAEEARRRADAEAAAEAKRKRELEREAARQALQ  679

Query  654   KMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKF-TGSNPLEQL  481
             KME+TVEINENSRFLEDLE+ +  P EQ  S + E+SP HS + LGSFKF   SNPLEQL
Sbjct  680   KMEKTVEINENSRFLEDLELFKAAPDEQLESFIEETSPGHSENVLGSFKFKANSNPLEQL  739

Query  480   GLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GLY+K  DD  E E  P SVP  + D EEGEID
Sbjct  740   GLYIK--DDEGEEETEPHSVPAVSNDPEEGEID  770



>ref|XP_009616061.1| PREDICTED: transcription factor GTE10-like isoform X1 [Nicotiana 
tomentosiformis]
Length=779

 Score =   134 bits (338),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 165/213 (77%), Gaps = 4/213 (2%)
 Frame = -1

Query  1014  SSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGD  835
             +S++K  S+E D  ++ E ++ +R  SPEKLYRAALL+ RFAD ILKA+EK+L +GE  D
Sbjct  569   TSEKKSISAEPDDHREEESAEPERQVSPEKLYRAALLRGRFADIILKAQEKSLEKGEVRD  628

Query  834   PDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALL  655
             P++L+ ERE  E +R++EKARLQAEAKAAEEAR+RA+ EAAAEAKRKRE EREAARQAL 
Sbjct  629   PERLKLEREEFERRRREEKARLQAEAKAAEEARRRADAEAAAEAKRKRELEREAARQALQ  688

Query  654   KMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKF-TGSNPLEQL  481
             KME+TVEINENSRFLEDLE+ +  P EQ  S + E+SP HS + LGSFKF   SNPLEQL
Sbjct  689   KMEKTVEINENSRFLEDLELFKAAPDEQLESFIEETSPGHSENVLGSFKFKANSNPLEQL  748

Query  480   GLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GLY+K  DD  E E  P SVP  + D EEGEID
Sbjct  749   GLYIK--DDEGEEETEPHSVPAVSNDPEEGEID  779



>ref|XP_009616062.1| PREDICTED: transcription factor GTE10-like isoform X2 [Nicotiana 
tomentosiformis]
Length=776

 Score =   134 bits (338),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 165/213 (77%), Gaps = 4/213 (2%)
 Frame = -1

Query  1014  SSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGD  835
             +S++K  S+E D  ++ E ++ +R  SPEKLYRAALL+ RFAD ILKA+EK+L +GE  D
Sbjct  566   TSEKKSISAEPDDHREEESAEPERQVSPEKLYRAALLRGRFADIILKAQEKSLEKGEVRD  625

Query  834   PDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALL  655
             P++L+ ERE  E +R++EKARLQAEAKAAEEAR+RA+ EAAAEAKRKRE EREAARQAL 
Sbjct  626   PERLKLEREEFERRRREEKARLQAEAKAAEEARRRADAEAAAEAKRKRELEREAARQALQ  685

Query  654   KMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKF-TGSNPLEQL  481
             KME+TVEINENSRFLEDLE+ +  P EQ  S + E+SP HS + LGSFKF   SNPLEQL
Sbjct  686   KMEKTVEINENSRFLEDLELFKAAPDEQLESFIEETSPGHSENVLGSFKFKANSNPLEQL  745

Query  480   GLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GLY+K  DD  E E  P SVP  + D EEGEID
Sbjct  746   GLYIK--DDEGEEETEPHSVPAVSNDPEEGEID  776



>gb|KHN31912.1| Transcription factor GTE10 [Glycine soja]
Length=783

 Score =   134 bits (337),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 138/217 (64%), Positives = 162/217 (75%), Gaps = 3/217 (1%)
 Frame = -1

Query  1026  QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             QVEQSSQ    ++E +  QDGE + + R  SPEKLYRAALL++RFADTILKA+EK L + 
Sbjct  568   QVEQSSQSGHVATEPESHQDGESAASKRQVSPEKLYRAALLRSRFADTILKAQEKALEKD  627

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             EK DP++LR ERE LE ++K+EKARLQAEAKAAEEA+++AE EAAAEAKRKRE EREAAR
Sbjct  628   EKRDPEKLRIEREDLERRQKEEKARLQAEAKAAEEAQRKAEAEAAAEAKRKRELEREAAR  687

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKFTGSNPL  490
             QAL KME+TV+INENS FLEDLEML     E   S   E+S     D LG  K  G NPL
Sbjct  688   QALQKMEKTVDINENSHFLEDLEMLSAVHDEHLPSFKEETSADQPQDGLGGIKLQG-NPL  746

Query  489   EQLGLYMKedddfeeceppP-SSVPKDAKDVEEGEID  382
             EQLGLYMKE+++ EE E PP S     + DVEEGEID
Sbjct  747   EQLGLYMKEEEEEEEEEEPPLSGAAGPSNDVEEGEID  783



>ref|XP_006351489.1| PREDICTED: transcription factor GTE10-like [Solanum tuberosum]
Length=786

 Score =   134 bits (337),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 138/224 (62%), Positives = 168/224 (75%), Gaps = 6/224 (3%)
 Frame = -1

Query  1035  LFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
             L  Q   +SQQ  N +E D  ++ E ++ +R  SPEKLYRAALL+ RFAD ILKA+EK++
Sbjct  563   LAGQTVLTSQQNSNFAEPDDHREEESAEPERQVSPEKLYRAALLRGRFADIILKAQEKSI  622

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefere  676
              +GE  DP++L+ ERE  E +R++EKARLQAEAKAAEEARKRAE EAAAEAKRKRE ERE
Sbjct  623   EKGEVRDPEKLKLEREEFERRRREEKARLQAEAKAAEEARKRAEAEAAAEAKRKRELERE  682

Query  675   aarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTG-  502
             AARQAL KME+TVEINENS+F+EDLE+ R  P EQ  S + E+SP HS + LGSFKF   
Sbjct  683   AARQALQKMEKTVEINENSQFMEDLELFRAAPDEQLESFIEETSPGHSENVLGSFKFKAT  742

Query  501   SNPLEQLGLYMKedddfeeceppPSSVPKDAKDV----EEGEID  382
             SNPLEQLGLYMKE+D+ E+ E    + P+   DV    EEGEID
Sbjct  743   SNPLEQLGLYMKEEDEDEDEEEEEEAEPQSIPDVSNDPEEGEID  786



>ref|XP_009758935.1| PREDICTED: transcription factor GTE10-like isoform X3 [Nicotiana 
sylvestris]
Length=770

 Score =   134 bits (336),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 166/213 (78%), Gaps = 4/213 (2%)
 Frame = -1

Query  1014  SSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGD  835
             +S++K  S+E D  ++ E ++ +R  SPEKLYRAALL+ RFAD ILKA+EK+L +GE  D
Sbjct  560   NSEKKSISAEPDDHREEESAEPERQVSPEKLYRAALLRGRFADIILKAQEKSLEKGEVRD  619

Query  834   PDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALL  655
             P++L+ E+E  E +R++EKARLQAEAKAAEEAR+RA+ EAAAEAKRKRE EREAARQAL 
Sbjct  620   PERLKLEKEEFERRRREEKARLQAEAKAAEEARRRADAEAAAEAKRKRELEREAARQALQ  679

Query  654   KMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKF-TGSNPLEQL  481
             KME+TVEINENSRFLEDLE+ +  P EQ  S + E+SP HS + LGSFKF   SNPLEQL
Sbjct  680   KMEKTVEINENSRFLEDLELFKAAPDEQLESFIEETSPGHSENVLGSFKFKASSNPLEQL  739

Query  480   GLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GLY+K  DD EE E  P SVP  + D EEGEID
Sbjct  740   GLYIK--DDEEEEETEPHSVPAVSNDPEEGEID  770



>ref|XP_009758933.1| PREDICTED: transcription factor GTE10-like isoform X2 [Nicotiana 
sylvestris]
Length=776

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 166/213 (78%), Gaps = 4/213 (2%)
 Frame = -1

Query  1014  SSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGD  835
             +S++K  S+E D  ++ E ++ +R  SPEKLYRAALL+ RFAD ILKA+EK+L +GE  D
Sbjct  566   NSEKKSISAEPDDHREEESAEPERQVSPEKLYRAALLRGRFADIILKAQEKSLEKGEVRD  625

Query  834   PDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALL  655
             P++L+ E+E  E +R++EKARLQAEAKAAEEAR+RA+ EAAAEAKRKRE EREAARQAL 
Sbjct  626   PERLKLEKEEFERRRREEKARLQAEAKAAEEARRRADAEAAAEAKRKRELEREAARQALQ  685

Query  654   KMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKF-TGSNPLEQL  481
             KME+TVEINENSRFLEDLE+ +  P EQ  S + E+SP HS + LGSFKF   SNPLEQL
Sbjct  686   KMEKTVEINENSRFLEDLELFKAAPDEQLESFIEETSPGHSENVLGSFKFKASSNPLEQL  745

Query  480   GLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GLY+K  DD EE E  P SVP  + D EEGEID
Sbjct  746   GLYIK--DDEEEEETEPHSVPAVSNDPEEGEID  776



>ref|XP_009758932.1| PREDICTED: transcription factor GTE10-like isoform X1 [Nicotiana 
sylvestris]
Length=779

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 166/213 (78%), Gaps = 4/213 (2%)
 Frame = -1

Query  1014  SSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGD  835
             +S++K  S+E D  ++ E ++ +R  SPEKLYRAALL+ RFAD ILKA+EK+L +GE  D
Sbjct  569   NSEKKSISAEPDDHREEESAEPERQVSPEKLYRAALLRGRFADIILKAQEKSLEKGEVRD  628

Query  834   PDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALL  655
             P++L+ E+E  E +R++EKARLQAEAKAAEEAR+RA+ EAAAEAKRKRE EREAARQAL 
Sbjct  629   PERLKLEKEEFERRRREEKARLQAEAKAAEEARRRADAEAAAEAKRKRELEREAARQALQ  688

Query  654   KMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKF-TGSNPLEQL  481
             KME+TVEINENSRFLEDLE+ +  P EQ  S + E+SP HS + LGSFKF   SNPLEQL
Sbjct  689   KMEKTVEINENSRFLEDLELFKAAPDEQLESFIEETSPGHSENVLGSFKFKASSNPLEQL  748

Query  480   GLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GLY+K  DD EE E  P SVP  + D EEGEID
Sbjct  749   GLYIK--DDEEEEETEPHSVPAVSNDPEEGEID  779



>ref|XP_007210895.1| hypothetical protein PRUPE_ppa001621mg [Prunus persica]
 gb|EMJ12094.1| hypothetical protein PRUPE_ppa001621mg [Prunus persica]
Length=791

 Score =   132 bits (333),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 157/209 (75%), Gaps = 9/209 (4%)
 Frame = -1

Query  1068  NDLAD---GDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKN  898
             ND+ D   G+  I+    ++Q S  KP S E  G ++GE + ++R  SP+KLYRAALL+N
Sbjct  527   NDIGDSEIGNDSINGVAPLDQDSGSKPISVEEGGHREGESAPSERQVSPDKLYRAALLRN  586

Query  897   RFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeee  718
             RFADTILKAREK L +GEK DP++LR ERE LE ++K+EKARLQAEAKAAEEARK+AE E
Sbjct  587   RFADTILKAREKALEKGEKLDPEKLRIEREELEKRQKEEKARLQAEAKAAEEARKKAEAE  646

Query  717   aaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQ  541
             AAAEAKR+RE EREAARQAL  ME+TVEI ENS+F+EDLEM R    E   +   E+SP+
Sbjct  647   AAAEAKRQRELEREAARQALQMMEKTVEI-ENSQFMEDLEMFRAVDDEHVPNFTEETSPE  705

Query  540   HS---LDALGSFKFTG-SNPLEQLGLYMK  466
             HS   L  LGSFK  G SNPLEQLGL+MK
Sbjct  706   HSQNELARLGSFKLQGSSNPLEQLGLFMK  734



>ref|XP_008239430.1| PREDICTED: transcription factor GTE10 isoform X1 [Prunus mume]
Length=814

 Score =   132 bits (333),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 158/210 (75%), Gaps = 9/210 (4%)
 Frame = -1

Query  1071  VNDLAD---GDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLK  901
             +ND+ D   G+  I+    ++Q S  KP S E  G ++GE + ++R  SP+KLYRAALL+
Sbjct  549   INDIGDSEIGNDSINGVAPLDQDSGSKPISVEEGGHREGESAPSERQVSPDKLYRAALLR  608

Query  900   NRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraee  721
             NRFADTILKAREK L +GEK DP++LR ERE LE ++K+EKARLQAEAKAAEEARK+AE 
Sbjct  609   NRFADTILKAREKALEKGEKLDPEKLRIEREELEKRQKEEKARLQAEAKAAEEARKKAEA  668

Query  720   eaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSP  544
             +AAAEAKR+RE EREAARQAL  ME+TVEI ENS+F+EDLEM R    E   +   E+SP
Sbjct  669   DAAAEAKRQRELEREAARQALQMMEKTVEI-ENSQFMEDLEMFRAVDDEHLPNFTEETSP  727

Query  543   QHS---LDALGSFKFTG-SNPLEQLGLYMK  466
             +HS   L  LGS+K  G SNPLEQLGL+MK
Sbjct  728   EHSQNELVRLGSYKLQGSSNPLEQLGLFMK  757



>ref|XP_008239431.1| PREDICTED: transcription factor GTE10 isoform X2 [Prunus mume]
Length=812

 Score =   132 bits (332),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 158/210 (75%), Gaps = 9/210 (4%)
 Frame = -1

Query  1071  VNDLAD---GDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLK  901
             +ND+ D   G+  I+    ++Q S  KP S E  G ++GE + ++R  SP+KLYRAALL+
Sbjct  547   INDIGDSEIGNDSINGVAPLDQDSGSKPISVEEGGHREGESAPSERQVSPDKLYRAALLR  606

Query  900   NRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraee  721
             NRFADTILKAREK L +GEK DP++LR ERE LE ++K+EKARLQAEAKAAEEARK+AE 
Sbjct  607   NRFADTILKAREKALEKGEKLDPEKLRIEREELEKRQKEEKARLQAEAKAAEEARKKAEA  666

Query  720   eaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSP  544
             +AAAEAKR+RE EREAARQAL  ME+TVEI ENS+F+EDLEM R    E   +   E+SP
Sbjct  667   DAAAEAKRQRELEREAARQALQMMEKTVEI-ENSQFMEDLEMFRAVDDEHLPNFTEETSP  725

Query  543   QHS---LDALGSFKFTG-SNPLEQLGLYMK  466
             +HS   L  LGS+K  G SNPLEQLGL+MK
Sbjct  726   EHSQNELVRLGSYKLQGSSNPLEQLGLFMK  755



>ref|XP_012079886.1| PREDICTED: transcription factor GTE10 isoform X1 [Jatropha curcas]
 gb|KDP30957.1| hypothetical protein JCGZ_11333 [Jatropha curcas]
Length=774

 Score =   130 bits (327),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 140/235 (60%), Positives = 169/235 (72%), Gaps = 10/235 (4%)
 Frame = -1

Query  1080  RKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLK  901
             + G+ D   G+   +   ++E +S  KP  +E D  Q+GE + ++R  SP+KLYRAALL+
Sbjct  548   KSGLGDPGVGNQCTNGLAKIESNSLGKPIIAETDSCQEGESAPSERQVSPDKLYRAALLR  607

Query  900   NRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraee  721
             NRFADTILKAREK L +GEK DP+QLR ERE  E ++K+EKARLQAEAKAAEEA+++A  
Sbjct  608   NRFADTILKAREKALEKGEKVDPEQLRLEREEFERRQKEEKARLQAEAKAAEEAQRKAAA  667

Query  720   eaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNE-SSP  544
             EAAAEAKRKRE EREAARQAL +ME+TVEINEN +FLEDLEM R    E+  S  E SSP
Sbjct  668   EAAAEAKRKRELEREAARQALQQMEKTVEINENGQFLEDLEMFRTVHDEELPSFMEVSSP  727

Query  543   QHSLDALGSFKFTG-SNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
                      FK  G SNPLE+LGLYMK DDD E+   PP SV +  KDVEEGEID
Sbjct  728   D--------FKLQGSSNPLEKLGLYMKRDDDEEDEVEPPKSVLELVKDVEEGEID  774



>ref|XP_010519520.1| PREDICTED: transcription factor GTE10 isoform X1 [Tarenaya hassleriana]
 ref|XP_010519521.1| PREDICTED: transcription factor GTE10 isoform X1 [Tarenaya hassleriana]
Length=927

 Score =   130 bits (327),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 150/190 (79%), Gaps = 3/190 (2%)
 Frame = -1

Query  1026  QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             QVEQ    KP + + DG +D E + ++R  SPE+LYRAALLKNRFADTILKAREK L +G
Sbjct  535   QVEQELDDKPTAIDADGPRDEETAPSERQISPERLYRAALLKNRFADTILKAREKALDKG  594

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             EKGDP++LR ERE  E + ++EKARLQAEAKAAEEA+++A+ EAAA A+RKRE EREAAR
Sbjct  595   EKGDPEKLRIEREEFERRLREEKARLQAEAKAAEEAKRKADAEAAATARRKREQEREAAR  654

Query  666   qALLKMEQTVEINENSRFLEDLEMLR-VGPTEQHSS-LNESSPQHSLDALGSFKFTG-SN  496
             QAL  ME+TV+INENS+FLEDLEMLR V   ++    + E+SP+ S + LGSFK  G +N
Sbjct  655   QALQNMEKTVDINENSQFLEDLEMLRAVAEGDKLPCFMEETSPEFSENMLGSFKMQGNNN  714

Query  495   PLEQLGLYMK  466
             PLEQLGLYMK
Sbjct  715   PLEQLGLYMK  724



>ref|XP_009390112.1| PREDICTED: transcription factor GTE9-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   129 bits (325),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 160/213 (75%), Gaps = 8/213 (4%)
 Frame = -1

Query  1020  EQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEK  841
             E+ +  KP     D  Q+G+ + ++R  SPEKLYRAALL++RFADTI+KAREKTLGQ +K
Sbjct  527   EKDADPKPLLVGSDECQEGDHTPSERKVSPEKLYRAALLRSRFADTIVKAREKTLGQCDK  586

Query  840   GDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqA  661
             GDP++L+RERE +E Q+++EKARLQAEAKAAE+ARKRAE  AAAEAKRK E EREAARQA
Sbjct  587   GDPEKLQREREEIERQQREEKARLQAEAKAAEDARKRAEAAAAAEAKRKIELEREAARQA  646

Query  660   LLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFTGSNPLEQL  481
             LLK+E+TV+INE+ R L+DLEML   P E     NE    +SLD +G F+  GSNPLE+L
Sbjct  647   LLKIEKTVDINEDCRILKDLEMLGTVPAE-----NEKHTGYSLDGIGGFRLGGSNPLERL  701

Query  480   GLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GL+MK DD+ EE     S+      DVEEGEID
Sbjct  702   GLFMKVDDEEEEEVEHKSA---PVNDVEEGEID  731



>ref|XP_010484059.1| PREDICTED: transcription factor GTE10-like isoform X1 [Camelina 
sativa]
 ref|XP_010484060.1| PREDICTED: transcription factor GTE10-like isoform X1 [Camelina 
sativa]
Length=1083

 Score =   130 bits (327),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 130/171 (76%), Gaps = 3/171 (2%)
 Frame = -1

Query  969  DGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQr  790
            D E +  +R  SP+K YR ALLKNRFADTI+KAREK L +GEKGDP++LR ERE  E + 
Sbjct  547  DEETAPPERQISPDKRYRQALLKNRFADTIMKAREKALTKGEKGDPEKLRIEREKFEKRL  606

Query  789  kkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFL  610
            ++EK RLQAEAKAAEE R++A+ EAA + +R+RE EREAARQAL KME+TVEINE  RF+
Sbjct  607  REEKVRLQAEAKAAEEVRRKAKAEAAEKVRREREQEREAARQALQKMEKTVEINEGIRFM  666

Query  609  EDLEMLRVGPTEQH---SSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMK  466
            EDL+M R   +E     +S++E SP+ S D LGSFK  GSNPL  LGLYMK
Sbjct  667  EDLQMFRATGSEGDQLPTSMDEMSPKCSEDMLGSFKIEGSNPLAHLGLYMK  717



>ref|XP_009390111.1| PREDICTED: transcription factor GTE9-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=762

 Score =   129 bits (325),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 160/213 (75%), Gaps = 8/213 (4%)
 Frame = -1

Query  1020  EQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEK  841
             E+ +  KP     D  Q+G+ + ++R  SPEKLYRAALL++RFADTI+KAREKTLGQ +K
Sbjct  558   EKDADPKPLLVGSDECQEGDHTPSERKVSPEKLYRAALLRSRFADTIVKAREKTLGQCDK  617

Query  840   GDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqA  661
             GDP++L+RERE +E Q+++EKARLQAEAKAAE+ARKRAE  AAAEAKRK E EREAARQA
Sbjct  618   GDPEKLQREREEIERQQREEKARLQAEAKAAEDARKRAEAAAAAEAKRKIELEREAARQA  677

Query  660   LLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFTGSNPLEQL  481
             LLK+E+TV+INE+ R L+DLEML   P E     NE    +SLD +G F+  GSNPLE+L
Sbjct  678   LLKIEKTVDINEDCRILKDLEMLGTVPAE-----NEKHTGYSLDGIGGFRLGGSNPLERL  732

Query  480   GLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GL+MK DD+ EE     S+      DVEEGEID
Sbjct  733   GLFMKVDDEEEEEVEHKSA---PVNDVEEGEID  762



>ref|XP_009390110.1| PREDICTED: transcription factor GTE11-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=766

 Score =   129 bits (325),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 160/213 (75%), Gaps = 8/213 (4%)
 Frame = -1

Query  1020  EQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEK  841
             E+ +  KP     D  Q+G+ + ++R  SPEKLYRAALL++RFADTI+KAREKTLGQ +K
Sbjct  562   EKDADPKPLLVGSDECQEGDHTPSERKVSPEKLYRAALLRSRFADTIVKAREKTLGQCDK  621

Query  840   GDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqA  661
             GDP++L+RERE +E Q+++EKARLQAEAKAAE+ARKRAE  AAAEAKRK E EREAARQA
Sbjct  622   GDPEKLQREREEIERQQREEKARLQAEAKAAEDARKRAEAAAAAEAKRKIELEREAARQA  681

Query  660   LLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFTGSNPLEQL  481
             LLK+E+TV+INE+ R L+DLEML   P E     NE    +SLD +G F+  GSNPLE+L
Sbjct  682   LLKIEKTVDINEDCRILKDLEMLGTVPAE-----NEKHTGYSLDGIGGFRLGGSNPLERL  736

Query  480   GLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             GL+MK DD+ EE     S+      DVEEGEID
Sbjct  737   GLFMKVDDEEEEEVEHKSA---PVNDVEEGEID  766



>ref|XP_009379940.1| PREDICTED: transcription factor GTE9 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=738

 Score =   129 bits (324),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 134/242 (55%), Positives = 173/242 (71%), Gaps = 9/242 (4%)
 Frame = -1

Query  1098  AASIIDRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLY  919
             A+S  ++  V +  D +   S   Q E+ +  +    E D  Q+GE + ++R  SP+KLY
Sbjct  503   ASSDQEKSDVMNPLDFNRTWSGLSQSEKDAHPRSLLVEADECQEGEHAPSERQVSPQKLY  562

Query  918   RAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeea  739
             RAALL++RFADTILKAREKTL QG+KGDP++LRRERE +E Q+++E+ARLQAEAKAAE+A
Sbjct  563   RAALLRSRFADTILKAREKTLHQGDKGDPEKLRREREEIERQQREERARLQAEAKAAEDA  622

Query  738   rkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSS  562
             R++AE EAAAEAKRKRE EREAARQALLK+E+TV+INE+ R L+DLEMLR  P E+   S
Sbjct  623   RRQAEAEAAAEAKRKRELEREAARQALLKVEKTVDINEDCRILKDLEMLRTAPAEEIPMS  682

Query  561   LNESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAK--DVEEGE  388
             L+E    + L+ +G FK  G NPLEQLGL++K      + E      PK A   DVEEGE
Sbjct  683   LDEKCSDYYLNGIGGFKL-GGNPLEQLGLFIK-----VDDEEEEEGEPKGAPEIDVEEGE  736

Query  387   ID  382
             ID
Sbjct  737   ID  738



>ref|XP_009379937.1| PREDICTED: transcription factor GTE9 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009379938.1| PREDICTED: transcription factor GTE9 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=748

 Score =   129 bits (323),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 134/242 (55%), Positives = 173/242 (71%), Gaps = 9/242 (4%)
 Frame = -1

Query  1098  AASIIDRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLY  919
             A+S  ++  V +  D +   S   Q E+ +  +    E D  Q+GE + ++R  SP+KLY
Sbjct  513   ASSDQEKSDVMNPLDFNRTWSGLSQSEKDAHPRSLLVEADECQEGEHAPSERQVSPQKLY  572

Query  918   RAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeea  739
             RAALL++RFADTILKAREKTL QG+KGDP++LRRERE +E Q+++E+ARLQAEAKAAE+A
Sbjct  573   RAALLRSRFADTILKAREKTLHQGDKGDPEKLRREREEIERQQREERARLQAEAKAAEDA  632

Query  738   rkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSS  562
             R++AE EAAAEAKRKRE EREAARQALLK+E+TV+INE+ R L+DLEMLR  P E+   S
Sbjct  633   RRQAEAEAAAEAKRKRELEREAARQALLKVEKTVDINEDCRILKDLEMLRTAPAEEIPMS  692

Query  561   LNESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAK--DVEEGE  388
             L+E    + L+ +G FK  G NPLEQLGL++K      + E      PK A   DVEEGE
Sbjct  693   LDEKCSDYYLNGIGGFKL-GGNPLEQLGLFIK-----VDDEEEEEGEPKGAPEIDVEEGE  746

Query  387   ID  382
             ID
Sbjct  747   ID  748



>ref|XP_009783526.1| PREDICTED: transcription factor GTE10-like isoform X8 [Nicotiana 
sylvestris]
Length=505

 Score =   127 bits (318),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 165/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAA L++ FADTILKA+EKTL +GE
Sbjct  284   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAASLRSCFADTILKAQEKTLEKGE  343

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+ E+E LE ++++EKARLQAEAKAA EAR++AE EAAAEAK+KRE EREAARQ
Sbjct  344   VWDPEKLKLEKEELERRKREEKARLQAEAKAAGEARRKAEAEAAAEAKKKRELEREAARQ  403

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  404   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPDHSQNGLGSFKFKASSNPL  463

Query  489   EQLGLYMK-----edddfeeceppPSSVPKD-AKDVEEGEID  382
             EQLGLYMK     E+++     P  S+ P+D +KD E+GEID
Sbjct  464   EQLGLYMKGDDEDEEENESHSIPDLSNCPEDISKDPEKGEID  505



>gb|AAF01563.1|AC009325_33 hypothetical protein [Arabidopsis thaliana]
 gb|AAF03453.1|AC010797_29 hypothetical protein [Arabidopsis thaliana]
Length=601

 Score =   127 bits (320),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 144/218 (66%), Gaps = 8/218 (4%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSE-FDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
              +Q+E +S+ K +  E  DG QDG  +  ++   PEK YRAALLKNRFAD ILKA+E TL
Sbjct  391   LNQMEDASRGKLSLIEGADGHQDGNSAPKEKELPPEKRYRAALLKNRFADIILKAQEITL  450

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefere  676
              Q EK DP+ L+RE+E LE+Q   +K         A+EA +   +  A EAKRK E ERE
Sbjct  451   NQNEKRDPETLQREKEELELQ---KKKEKARLQAEAKEAEEARRKAEAQEAKRKLELERE  507

Query  675   aarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFTGSN  496
             AARQALL+ME++VEINEN+RFL+DLE+L+   T+Q  +L +   +   D L  F F GSN
Sbjct  508   AARQALLEMEKSVEINENTRFLKDLELLKTVNTDQLRNLRDVGSES--DGLAVFGFGGSN  565

Query  495   PLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             PLEQLGL+MK ++D +E +    + P    +VEEGEID
Sbjct  566   PLEQLGLFMKHEEDEDESDML--AFPDPGNEVEEGEID  601



>emb|CAB87766.1| kinase-like protein [Arabidopsis thaliana]
Length=703

 Score =   128 bits (322),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 119/218 (55%), Positives = 159/218 (73%), Gaps = 4/218 (2%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLG  853
              DQ+E +S +K +S E D QQDG  +QN++   PEK YRAA+LKNRFAD ILKAREK L 
Sbjct  489   LDQLESASPEKISSVEADCQQDGNSAQNEKQLPPEKSYRAAILKNRFADIILKAREKPLN  548

Query  852   QGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkreferea  673
             Q +  DP++L+RERE LE+Q+KKEKARLQAEAKAAEEAR++AE +AAAEA  + + + E 
Sbjct  549   QNDTRDPEKLQREREELELQKKKEKARLQAEAKAAEEARRKAEAQAAAEAAAEAKRKLEL  608

Query  672   arqALLK-MEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFTGSN  496
              R+A  + + ++VE+NEN++FLEDLE+L+   T+  ++  E      +  L SF F GSN
Sbjct  609   EREAARQALMESVELNENAKFLEDLELLKTVDTDHLTNTIEEEDGPDV-GLRSFSFGGSN  667

Query  495   PLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             PLEQLGL+MK+D+D EE +P  S  P+   D+EEGEID
Sbjct  668   PLEQLGLFMKQDEDEEEADPLTSPAPE--IDIEEGEID  703



>ref|NP_566151.1| bromodomain and extraterminal domain protein 10 [Arabidopsis 
thaliana]
 sp|Q93ZB7.1|GTE11_ARATH RecName: Full=Transcription factor GTE11; AltName: Full=BROMODOMAIN 
AND EXTRATERMINAL DOMAIN PROTEIN 10; Short=AtBET10; AltName: 
Full=Bromodomain-containing protein GTE11; AltName: 
Full=Protein GLOBAL TRANSCRIPTION FACTOR GROUP E11 [Arabidopsis 
thaliana]
 gb|AAL15293.1| AT3g01770/F28J7_10 [Arabidopsis thaliana]
 gb|AAM20580.1| unknown protein [Arabidopsis thaliana]
 gb|AAM91306.1| unknown protein [Arabidopsis thaliana]
 gb|AEE73712.1| bromodomain and extraterminal domain protein 10 [Arabidopsis 
thaliana]
Length=620

 Score =   127 bits (320),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 109/218 (50%), Positives = 144/218 (66%), Gaps = 8/218 (4%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSE-FDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
              +Q+E +S+ K +  E  DG QDG  +  ++   PEK YRAALLKNRFAD ILKA+E TL
Sbjct  410   LNQMEDASRGKLSLIEGADGHQDGNSAPKEKELPPEKRYRAALLKNRFADIILKAQEITL  469

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefere  676
              Q EK DP+ L+RE+E LE+Q   +K         A+EA +   +  A EAKRK E ERE
Sbjct  470   NQNEKRDPETLQREKEELELQ---KKKEKARLQAEAKEAEEARRKAEAQEAKRKLELERE  526

Query  675   aarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFTGSN  496
             AARQALL+ME++VEINEN+RFL+DLE+L+   T+Q  +L +   +   D L  F F GSN
Sbjct  527   AARQALLEMEKSVEINENTRFLKDLELLKTVNTDQLRNLRDVGSES--DGLAVFGFGGSN  584

Query  495   PLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             PLEQLGL+MK ++D +E +    + P    +VEEGEID
Sbjct  585   PLEQLGLFMKHEEDEDESDML--AFPDPGNEVEEGEID  620



>ref|XP_010484061.1| PREDICTED: transcription factor GTE10-like isoform X2 [Camelina 
sativa]
Length=1056

 Score =   129 bits (324),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 129/169 (76%), Gaps = 3/169 (2%)
 Frame = -1

Query  963  EISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkk  784
            E +  +R  SP+K YR ALLKNRFADTI+KAREK L +GEKGDP++LR ERE  E + ++
Sbjct  522  ETAPPERQISPDKRYRQALLKNRFADTIMKAREKALTKGEKGDPEKLRIEREKFEKRLRE  581

Query  783  ekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLED  604
            EK RLQAEAKAAEE R++A+ EAA + +R+RE EREAARQAL KME+TVEINE  RF+ED
Sbjct  582  EKVRLQAEAKAAEEVRRKAKAEAAEKVRREREQEREAARQALQKMEKTVEINEGIRFMED  641

Query  603  LEMLRVGPTEQH---SSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMK  466
            L+M R   +E     +S++E SP+ S D LGSFK  GSNPL  LGLYMK
Sbjct  642  LQMFRATGSEGDQLPTSMDEMSPKCSEDMLGSFKIEGSNPLAHLGLYMK  690



>ref|XP_010460135.1| PREDICTED: transcription factor GTE10-like isoform X3 [Camelina 
sativa]
Length=1041

 Score =   129 bits (323),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 129/171 (75%), Gaps = 3/171 (2%)
 Frame = -1

Query  969  DGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQr  790
            D E +   R  SP+K YR ALLKNRFADTI+KAREK L +GEKGDP++LR ERE  E + 
Sbjct  506  DEETAPPGRQISPDKRYRQALLKNRFADTIMKAREKALTKGEKGDPEKLRIEREEFEKRL  565

Query  789  kkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFL  610
            ++EK RLQAEAKAAEE R++A+ EAA + +R+RE EREAARQAL KME+TVEINE  RF+
Sbjct  566  REEKVRLQAEAKAAEEDRRKAKAEAAEKVRREREQEREAARQALQKMEKTVEINEGIRFM  625

Query  609  EDLEMLRVGPTEQH---SSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMK  466
            EDL+M R   +E     +S++E SP+ S D LGSFK  GSNPL  LGLYMK
Sbjct  626  EDLQMFRATGSEGDQLPTSMDEMSPKCSEDMLGSFKMEGSNPLAHLGLYMK  676



>ref|XP_010460112.1| PREDICTED: transcription factor GTE10-like isoform X1 [Camelina 
sativa]
 ref|XP_010460120.1| PREDICTED: transcription factor GTE10-like isoform X1 [Camelina 
sativa]
Length=1080

 Score =   129 bits (323),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 129/171 (75%), Gaps = 3/171 (2%)
 Frame = -1

Query  969  DGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQr  790
            D E +   R  SP+K YR ALLKNRFADTI+KAREK L +GEKGDP++LR ERE  E + 
Sbjct  545  DEETAPPGRQISPDKRYRQALLKNRFADTIMKAREKALTKGEKGDPEKLRIEREEFEKRL  604

Query  789  kkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFL  610
            ++EK RLQAEAKAAEE R++A+ EAA + +R+RE EREAARQAL KME+TVEINE  RF+
Sbjct  605  REEKVRLQAEAKAAEEDRRKAKAEAAEKVRREREQEREAARQALQKMEKTVEINEGIRFM  664

Query  609  EDLEMLRVGPTEQH---SSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMK  466
            EDL+M R   +E     +S++E SP+ S D LGSFK  GSNPL  LGLYMK
Sbjct  665  EDLQMFRATGSEGDQLPTSMDEMSPKCSEDMLGSFKMEGSNPLAHLGLYMK  715



>ref|XP_010460128.1| PREDICTED: transcription factor GTE10-like isoform X2 [Camelina 
sativa]
Length=1053

 Score =   128 bits (322),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 126/163 (77%), Gaps = 3/163 (2%)
 Frame = -1

Query  945  RPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlq  766
            R  SP+K YR ALLKNRFADTI+KAREK L +GEKGDP++LR ERE  E + ++EK RLQ
Sbjct  526  RQISPDKRYRQALLKNRFADTIMKAREKALTKGEKGDPEKLRIEREEFEKRLREEKVRLQ  585

Query  765  aeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRV  586
            AEAKAAEE R++A+ EAA + +R+RE EREAARQAL KME+TVEINE  RF+EDL+M R 
Sbjct  586  AEAKAAEEDRRKAKAEAAEKVRREREQEREAARQALQKMEKTVEINEGIRFMEDLQMFRA  645

Query  585  GPTEQH---SSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMK  466
              +E     +S++E SP+ S D LGSFK  GSNPL  LGLYMK
Sbjct  646  TGSEGDQLPTSMDEMSPKCSEDMLGSFKMEGSNPLAHLGLYMK  688



>ref|XP_010435667.1| PREDICTED: transcription factor GTE11-like isoform X1 [Camelina 
sativa]
Length=659

 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 162/222 (73%), Gaps = 9/222 (4%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSE-FDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
              +Q+E +S+ K +  E  +  +DG  +QN++   PEK YRAALLK+++AD ILKAREKTL
Sbjct  442   LNQLENASKGKLSPVEGVNSHKDGNSAQNEKQLPPEKRYRAALLKSQYADLILKAREKTL  501

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe--  682
              Q EK +P++LR E++ LE+Q+KKEKARLQAEAK AEEAR++A+ +AAAEA  + + +  
Sbjct  502   NQNEKRNPEKLRLEKDELELQKKKEKARLQAEAKEAEEARRKAKAQAAAEAAAEAKRKLG  561

Query  681   --reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKF  508
               REAARQALL+ME++VEINENSRFL+DLE+L+   T+  ++L E    H  D LG F F
Sbjct  562   LEREAARQALLEMEKSVEINENSRFLKDLELLKTVNTDHLTNLREVG--HDSDGLGVFGF  619

Query  507   TGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              GSNPLEQLGL+MK D+D +E +      P  + +VEEGEID
Sbjct  620   GGSNPLEQLGLFMKHDEDEDEADLLCFQDP--SNEVEEGEID  659



>ref|XP_010435669.1| PREDICTED: transcription factor GTE11-like isoform X3 [Camelina 
sativa]
Length=658

 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 162/222 (73%), Gaps = 9/222 (4%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSE-FDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
              +Q+E +S+ K +  E  +  +DG  +QN++   PEK YRAALLK+++AD ILKAREKTL
Sbjct  441   LNQLENASKGKLSPVEGVNSHKDGNSAQNEKQLPPEKRYRAALLKSQYADLILKAREKTL  500

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe--  682
              Q EK +P++LR E++ LE+Q+KKEKARLQAEAK AEEAR++A+ +AAAEA  + + +  
Sbjct  501   NQNEKRNPEKLRLEKDELELQKKKEKARLQAEAKEAEEARRKAKAQAAAEAAAEAKRKLG  560

Query  681   --reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKF  508
               REAARQALL+ME++VEINENSRFL+DLE+L+   T+  ++L E    H  D LG F F
Sbjct  561   LEREAARQALLEMEKSVEINENSRFLKDLELLKTVNTDHLTNLREVG--HDSDGLGVFGF  618

Query  507   TGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              GSNPLEQLGL+MK D+D +E +      P  + +VEEGEID
Sbjct  619   GGSNPLEQLGLFMKHDEDEDEADLLCFQDP--SNEVEEGEID  658



>ref|XP_009783521.1| PREDICTED: transcription factor GTE10-like isoform X3 [Nicotiana 
sylvestris]
Length=760

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 165/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAA L++ FADTILKA+EKTL +GE
Sbjct  539   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAASLRSCFADTILKAQEKTLEKGE  598

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+ E+E LE ++++EKARLQAEAKAA EAR++AE EAAAEAK+KRE EREAARQ
Sbjct  599   VWDPEKLKLEKEELERRKREEKARLQAEAKAAGEARRKAEAEAAAEAKKKRELEREAARQ  658

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  659   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPDHSQNGLGSFKFKASSNPL  718

Query  489   EQLGLYMKedddfeeceppP-----SSVPKD-AKDVEEGEID  382
             EQLGLYMK DD+ EE          S+ P+D +KD E+GEID
Sbjct  719   EQLGLYMKGDDEDEEENESHSIPDLSNCPEDISKDPEKGEID  760



>ref|XP_009783523.1| PREDICTED: transcription factor GTE10-like isoform X5 [Nicotiana 
sylvestris]
Length=759

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 165/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAA L++ FADTILKA+EKTL +GE
Sbjct  538   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAASLRSCFADTILKAQEKTLEKGE  597

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+ E+E LE ++++EKARLQAEAKAA EAR++AE EAAAEAK+KRE EREAARQ
Sbjct  598   VWDPEKLKLEKEELERRKREEKARLQAEAKAAGEARRKAEAEAAAEAKKKRELEREAARQ  657

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  658   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPDHSQNGLGSFKFKASSNPL  717

Query  489   EQLGLYMKedddfeeceppP-----SSVPKD-AKDVEEGEID  382
             EQLGLYMK DD+ EE          S+ P+D +KD E+GEID
Sbjct  718   EQLGLYMKGDDEDEEENESHSIPDLSNCPEDISKDPEKGEID  759



>ref|XP_009783520.1| PREDICTED: transcription factor GTE10-like isoform X2 [Nicotiana 
sylvestris]
Length=761

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 165/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAA L++ FADTILKA+EKTL +GE
Sbjct  540   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAASLRSCFADTILKAQEKTLEKGE  599

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+ E+E LE ++++EKARLQAEAKAA EAR++AE EAAAEAK+KRE EREAARQ
Sbjct  600   VWDPEKLKLEKEELERRKREEKARLQAEAKAAGEARRKAEAEAAAEAKKKRELEREAARQ  659

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  660   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPDHSQNGLGSFKFKASSNPL  719

Query  489   EQLGLYMKedddfeeceppP-----SSVPKD-AKDVEEGEID  382
             EQLGLYMK DD+ EE          S+ P+D +KD E+GEID
Sbjct  720   EQLGLYMKGDDEDEEENESHSIPDLSNCPEDISKDPEKGEID  761



>ref|XP_009783525.1| PREDICTED: transcription factor GTE10-like isoform X7 [Nicotiana 
sylvestris]
Length=755

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 165/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAA L++ FADTILKA+EKTL +GE
Sbjct  534   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAASLRSCFADTILKAQEKTLEKGE  593

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+ E+E LE ++++EKARLQAEAKAA EAR++AE EAAAEAK+KRE EREAARQ
Sbjct  594   VWDPEKLKLEKEELERRKREEKARLQAEAKAAGEARRKAEAEAAAEAKKKRELEREAARQ  653

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  654   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPDHSQNGLGSFKFKASSNPL  713

Query  489   EQLGLYMKedddfeeceppP-----SSVPKD-AKDVEEGEID  382
             EQLGLYMK DD+ EE          S+ P+D +KD E+GEID
Sbjct  714   EQLGLYMKGDDEDEEENESHSIPDLSNCPEDISKDPEKGEID  755



>ref|XP_009783524.1| PREDICTED: transcription factor GTE10-like isoform X6 [Nicotiana 
sylvestris]
Length=757

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 165/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAA L++ FADTILKA+EKTL +GE
Sbjct  536   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAASLRSCFADTILKAQEKTLEKGE  595

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+ E+E LE ++++EKARLQAEAKAA EAR++AE EAAAEAK+KRE EREAARQ
Sbjct  596   VWDPEKLKLEKEELERRKREEKARLQAEAKAAGEARRKAEAEAAAEAKKKRELEREAARQ  655

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  656   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPDHSQNGLGSFKFKASSNPL  715

Query  489   EQLGLYMKedddfeeceppP-----SSVPKD-AKDVEEGEID  382
             EQLGLYMK DD+ EE          S+ P+D +KD E+GEID
Sbjct  716   EQLGLYMKGDDEDEEENESHSIPDLSNCPEDISKDPEKGEID  757



>ref|XP_009783522.1| PREDICTED: transcription factor GTE10-like isoform X4 [Nicotiana 
sylvestris]
Length=760

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 165/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAA L++ FADTILKA+EKTL +GE
Sbjct  539   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAASLRSCFADTILKAQEKTLEKGE  598

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+ E+E LE ++++EKARLQAEAKAA EAR++AE EAAAEAK+KRE EREAARQ
Sbjct  599   VWDPEKLKLEKEELERRKREEKARLQAEAKAAGEARRKAEAEAAAEAKKKRELEREAARQ  658

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  659   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPDHSQNGLGSFKFKASSNPL  718

Query  489   EQLGLYMKedddfeeceppP-----SSVPKD-AKDVEEGEID  382
             EQLGLYMK DD+ EE          S+ P+D +KD E+GEID
Sbjct  719   EQLGLYMKGDDEDEEENESHSIPDLSNCPEDISKDPEKGEID  760



>ref|XP_009783518.1| PREDICTED: transcription factor GTE10-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009783519.1| PREDICTED: transcription factor GTE10-like isoform X1 [Nicotiana 
sylvestris]
Length=762

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 133/222 (60%), Positives = 165/222 (74%), Gaps = 8/222 (4%)
 Frame = -1

Query  1023  VEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGE  844
              E++SQ K    E +   +GE +  +R  SPEKLYRAA L++ FADTILKA+EKTL +GE
Sbjct  541   TERNSQPKSILGEPNDHHEGESAPPERQVSPEKLYRAASLRSCFADTILKAQEKTLEKGE  600

Query  843   KGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarq  664
               DP++L+ E+E LE ++++EKARLQAEAKAA EAR++AE EAAAEAK+KRE EREAARQ
Sbjct  601   VWDPEKLKLEKEELERRKREEKARLQAEAKAAGEARRKAEAEAAAEAKKKRELEREAARQ  660

Query  663   ALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKF-TGSNPL  490
             ALLKME+TVEINENS+F+EDLE+ R  P EQ      E+SP HS + LGSFKF   SNPL
Sbjct  661   ALLKMEKTVEINENSQFMEDLELFRAAPDEQLERFTEETSPDHSQNGLGSFKFKASSNPL  720

Query  489   EQLGLYMKedddfeeceppP-----SSVPKD-AKDVEEGEID  382
             EQLGLYMK DD+ EE          S+ P+D +KD E+GEID
Sbjct  721   EQLGLYMKGDDEDEEENESHSIPDLSNCPEDISKDPEKGEID  762



>ref|XP_012079887.1| PREDICTED: transcription factor GTE10 isoform X2 [Jatropha curcas]
Length=770

 Score =   127 bits (318),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 162/217 (75%), Gaps = 10/217 (5%)
 Frame = -1

Query  1026  QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             ++E +S  KP  +E D  Q+GE + ++R  SP+KLYRAALL+NRFADTILKAREK L +G
Sbjct  562   KIESNSLGKPIIAETDSCQEGESAPSERQVSPDKLYRAALLRNRFADTILKAREKALEKG  621

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             EK DP+QLR ERE  E ++K+EKARLQAEAKAAEEA+++A  EAAAEAKRKRE EREAAR
Sbjct  622   EKVDPEQLRLEREEFERRQKEEKARLQAEAKAAEEAQRKAAAEAAAEAKRKRELEREAAR  681

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNE-SSPQHSLDALGSFKFTG-SNP  493
             QAL +ME+TVEINEN +FLEDLEM R    E+  S  E SSP         FK  G SNP
Sbjct  682   QALQQMEKTVEINENGQFLEDLEMFRTVHDEELPSFMEVSSPD--------FKLQGSSNP  733

Query  492   LEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             LE+LGLYMK DDD E+   PP SV +  KDVEEGEID
Sbjct  734   LEKLGLYMKRDDDEEDEVEPPKSVLELVKDVEEGEID  770



>ref|XP_010435668.1| PREDICTED: transcription factor GTE11-like isoform X2 [Camelina 
sativa]
Length=658

 Score =   126 bits (316),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 120/222 (54%), Positives = 162/222 (73%), Gaps = 9/222 (4%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSE-FDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
              +Q+E +S+ K +  E  +  +DG  +QN++   PEK YRAALLK+++AD ILKAREKTL
Sbjct  441   LNQLEDASKGKLSPVEGVNSHKDGNRAQNEKQLPPEKRYRAALLKSQYADLILKAREKTL  500

Query  855   GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe--  682
              Q EK +P++LR E++ LE+Q+KKEKARLQAEAK AEEAR++A+ +AAAEA  + + +  
Sbjct  501   NQNEKRNPEKLRLEKDELELQKKKEKARLQAEAKEAEEARRKAKAQAAAEAAAEAKRKLG  560

Query  681   --reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKF  508
               REAARQALL+ME++VEINENSRFL+DLE+L+   T+  ++L E    H  D LG F F
Sbjct  561   LEREAARQALLEMEKSVEINENSRFLKDLELLKTVNTDHLTNLREVG--HDSDGLGVFGF  618

Query  507   TGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              GSNPLEQLGL+MK D+D +E +      P  + +VEEGEID
Sbjct  619   GGSNPLEQLGLFMKHDEDEDEADLLCFQDP--SNEVEEGEID  658



>ref|XP_007137938.1| hypothetical protein PHAVU_009G168100g [Phaseolus vulgaris]
 gb|ESW09932.1| hypothetical protein PHAVU_009G168100g [Phaseolus vulgaris]
Length=779

 Score =   126 bits (317),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 135/220 (61%), Positives = 161/220 (73%), Gaps = 6/220 (3%)
 Frame = -1

Query  1026  QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQG  847
             QV+ +SQ K  +SE +  Q+GE + + R  SPEKLYRAALL++RFADTILKA+EK L + 
Sbjct  561   QVDHTSQSKLVASEPESHQEGESAASKRQVSPEKLYRAALLRSRFADTILKAQEKALEKD  620

Query  846   EKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaar  667
             EK DP++LR ERE LE ++K+EKARLQAEAKAAEEAR++AE EAAAEAKRKRE EREAAR
Sbjct  621   EKRDPEKLRIEREDLERRQKEEKARLQAEAKAAEEARRKAEAEAAAEAKRKRELEREAAR  680

Query  666   qALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKFTGSNPL  490
             QAL KME+TV+INE+S+FLEDLEML     E   S   E+S     + LG  K  G NPL
Sbjct  681   QALQKMEKTVDINESSQFLEDLEMLSAVHDEPMPSFKEETSTDQPQNGLGRIKLQG-NPL  739

Query  489   EQLGLYMKedddfeecepp----PSSVPKDAKDVEEGEID  382
             EQLGLYMK+DDD EE E       S     + DVEEGEID
Sbjct  740   EQLGLYMKDDDDEEEEEEEEELPASGAAGPSNDVEEGEID  779



>ref|XP_009411833.1| PREDICTED: transcription factor GTE10-like [Musa acuminata subsp. 
malaccensis]
Length=725

 Score =   125 bits (315),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 165/220 (75%), Gaps = 5/220 (2%)
 Frame = -1

Query  1029  DQVEQSSQQKPNSSEFDGQQDGEISQN---DRPASPEKLYRAALLKNRFADTILKAREKT  859
             +Q E  +Q K  S + +  ++  +  N   +R  SPEKLYRAALL++RFADTILKAREKT
Sbjct  507   NQEEHVAQPKSESVDIERNREDLLRDNAPSERRFSPEKLYRAALLRSRFADTILKAREKT  566

Query  858   LGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefer  679
             L QGEK DP++LRRERE LE ++++EKARLQAEAKAAEEA++ AE EAAAEAKRKRE ER
Sbjct  567   LDQGEKRDPEKLRRERETLERRKREEKARLQAEAKAAEEAQRLAEAEAAAEAKRKRELER  626

Query  678   eaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTG  502
             EAARQALL+ME+TVEINE++ FL+DL+MLR  P E   +S+ E+SP HS + +  F+  G
Sbjct  627   EAARQALLQMEKTVEINESTLFLKDLDMLRTVPGEHLPNSVGETSPDHSPEGISGFELGG  686

Query  501   SNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             SNPLEQLGLYMK + D +E E    +    A D EEGEID
Sbjct  687   SNPLEQLGLYMKVEVDDDEDEDVEPNG-ATANDAEEGEID  725



>ref|XP_006394288.1| hypothetical protein EUTSA_v10003590mg [Eutrema salsugineum]
 gb|ESQ31574.1| hypothetical protein EUTSA_v10003590mg [Eutrema salsugineum]
Length=992

 Score =   125 bits (315),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 106/163 (65%), Gaps = 6/163 (4%)
 Frame = -1

Query  942  PASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqa  763
            P  PEK YRAALLKNRFADTI+KAREK L +GEKGDP++LR ERE  E +++  + +++ 
Sbjct  551  PPDPEKRYRAALLKNRFADTIMKAREKALTKGEKGDPEKLRIERE--EFEKRLRQEKVRL  608

Query  762  eakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVG  583
            +A+A      R + + +    R+   +R         ME+TVEINE  RF+EDLEMLR  
Sbjct  609  QAEAKAADEARRKAKQSCRKARREREQRGCCTTGFTNMEKTVEINEGRRFMEDLEMLRAT  668

Query  582  PTEQH---SSLNESSPQHSLDALGSFKFTG-SNPLEQLGLYMK  466
             T+     + + E SP+ S D LGSFK  G SNPLEQLGLYMK
Sbjct  669  VTDGDQLPTFMEEMSPKCSQDMLGSFKMEGNSNPLEQLGLYMK  711



>ref|XP_006394289.1| hypothetical protein EUTSA_v10003590mg [Eutrema salsugineum]
 gb|ESQ31575.1| hypothetical protein EUTSA_v10003590mg [Eutrema salsugineum]
Length=995

 Score =   125 bits (315),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 106/163 (65%), Gaps = 6/163 (4%)
 Frame = -1

Query  942  PASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqa  763
            P  PEK YRAALLKNRFADTI+KAREK L +GEKGDP++LR ERE  E +++  + +++ 
Sbjct  554  PPDPEKRYRAALLKNRFADTIMKAREKALTKGEKGDPEKLRIERE--EFEKRLRQEKVRL  611

Query  762  eakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVG  583
            +A+A      R + + +    R+   +R         ME+TVEINE  RF+EDLEMLR  
Sbjct  612  QAEAKAADEARRKAKQSCRKARREREQRGCCTTGFTNMEKTVEINEGRRFMEDLEMLRAT  671

Query  582  PTEQH---SSLNESSPQHSLDALGSFKFTG-SNPLEQLGLYMK  466
             T+     + + E SP+ S D LGSFK  G SNPLEQLGLYMK
Sbjct  672  VTDGDQLPTFMEEMSPKCSQDMLGSFKMEGNSNPLEQLGLYMK  714



>ref|XP_006408544.1| hypothetical protein EUTSA_v10020201mg [Eutrema salsugineum]
 gb|ESQ49997.1| hypothetical protein EUTSA_v10020201mg [Eutrema salsugineum]
Length=682

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 155/226 (69%), Gaps = 6/226 (3%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNS--SEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAR  868
             IS  DQ+E +S+ +  S     D +QDG   QN++   PEK YRAALLKNRFAD ILKAR
Sbjct  457   ISGLDQLEDASRDEKLSFVEGADCRQDGNSGQNEKQLPPEKRYRAALLKNRFADIILKAR  516

Query  867   EKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkre  688
             EKT  + EK DP++LRRERE  E Q+KKEKARLQAEAK AEEA+++AE EAAAEA  + +
Sbjct  517   EKTQNKTEKRDPEKLRREREEFEWQKKKEKARLQAEAKEAEEAKRKAEAEAAAEAASEAK  576

Query  687   fe----reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALG  520
              +    REAARQAL++ME++VEINE+SRF++DLE+L      +    N +  +   D LG
Sbjct  577   RKLELEREAARQALVEMEKSVEINEDSRFIKDLELLETRVYTEEHLRNITRGEEDADGLG  636

Query  519   SFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              F F GSNPLEQLGL+MK DD+ E+            ++VEEGEID
Sbjct  637   VFGFGGSNPLEQLGLFMKHDDEDEDEAAEHQLEFPGNEEVEEGEID  682



>ref|XP_006408545.1| hypothetical protein EUTSA_v10020201mg [Eutrema salsugineum]
 gb|ESQ49998.1| hypothetical protein EUTSA_v10020201mg [Eutrema salsugineum]
Length=683

 Score =   124 bits (312),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 122/226 (54%), Positives = 155/226 (69%), Gaps = 6/226 (3%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNS--SEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAR  868
             IS  DQ+E +S+ +  S     D +QDG   QN++   PEK YRAALLKNRFAD ILKAR
Sbjct  458   ISGLDQLEDASRDEKLSFVEGADCRQDGNSGQNEKQLPPEKRYRAALLKNRFADIILKAR  517

Query  867   EKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkre  688
             EKT  + EK DP++LRRERE  E Q+KKEKARLQAEAK AEEA+++AE EAAAEA  + +
Sbjct  518   EKTQNKTEKRDPEKLRREREEFEWQKKKEKARLQAEAKEAEEAKRKAEAEAAAEAASEAK  577

Query  687   fe----reaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALG  520
              +    REAARQAL++ME++VEINE+SRF++DLE+L      +    N +  +   D LG
Sbjct  578   RKLELEREAARQALVEMEKSVEINEDSRFIKDLELLETRVYTEEHLRNITRGEEDADGLG  637

Query  519   SFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              F F GSNPLEQLGL+MK DD+ E+            ++VEEGEID
Sbjct  638   VFGFGGSNPLEQLGLFMKHDDEDEDEAAEHQLEFPGNEEVEEGEID  683



>ref|XP_006282318.1| hypothetical protein CARUB_v10028607mg [Capsella rubella]
 gb|EOA15216.1| hypothetical protein CARUB_v10028607mg [Capsella rubella]
Length=1078

 Score =   125 bits (315),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 123/161 (76%), Gaps = 4/161 (2%)
 Frame = -1

Query  936  SPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaea  757
            SP+K YRAA LKNRFADTI+KAREK L +GEKGDP++LR ERE  E + K+EK RLQAEA
Sbjct  557  SPDKRYRAAFLKNRFADTIMKAREKALTKGEKGDPEKLRIEREEFEKRLKEEKVRLQAEA  616

Query  756  kaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPT  577
            K  EEAR++A+ EA  +A+++RE EREAARQAL KME+TVEINE  RF+EDL+MLR    
Sbjct  617  KTVEEARRKAKAEAVEKARKEREQEREAARQALQKMEKTVEINEGIRFMEDLQMLRSSGA  676

Query  576  EQH---SSLNESSPQHSLDALGSFKFTGS-NPLEQLGLYMK  466
            E +   +S+ E SP  S D LGSFK  GS NPL  LGLYMK
Sbjct  677  EGNQLPTSMEEKSPNCSEDMLGSFKMEGSNNPLAHLGLYMK  717



>ref|XP_002882167.1| ATBET10 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58426.1| ATBET10 [Arabidopsis lyrata subsp. lyrata]
Length=622

 Score =   124 bits (311),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 148/204 (73%), Gaps = 8/204 (4%)
 Frame = -1

Query  981  DGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVL  802
            DG  DG  + N++   PEK YRAALLK+RFAD ILKA+E TL Q EK DP++LRRE+E +
Sbjct  423  DGHLDGNSAPNEKQLPPEKRYRAALLKDRFADIILKAKEITLNQNEKRDPEKLRREKEEI  482

Query  801  EMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe----reaarqALLKMEQTVE  634
            E+Q+KKEKARLQAEAK AEEAR++AE +AA EA  + + +    R+AARQALL+ME++VE
Sbjct  483  ELQKKKEKARLQAEAKEAEEARRKAEAQAAVEAAAEAKRKLELERKAARQALLEMEKSVE  542

Query  633  INENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMKeddd  454
            INEN+RFL+DLE+L+   T+Q  +L +       D L  F F GSNPLEQLGL+MK D+D
Sbjct  543  INENTRFLKDLELLKTVKTDQLRNLRDVGSDS--DGLEVFGFGGSNPLEQLGLFMKHDED  600

Query  453  feeceppPSSVPKDAKDVEEGEID  382
             +E +    + P    +VEEGEID
Sbjct  601  EDEADLL--AFPDPGNEVEEGEID  622



>emb|CDY48139.1| BnaCnng15810D [Brassica napus]
Length=884

 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 129/170 (76%), Gaps = 4/170 (2%)
 Frame = -1

Query  963  EISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkk  784
            E +  +R  SP K  RAALLKNRFADTI+KAREKTL +GEKGDP++LR ERE  E + ++
Sbjct  373  ETAPCERQDSPGKRQRAALLKNRFADTIMKAREKTLTKGEKGDPEKLRIEREKFEKRLRE  432

Query  783  ekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLED  604
            E  RLQAEAKA EEAR++A+ EAA +A+R+RE EREAARQAL K+E+TVEI+E  RF+ED
Sbjct  433  ENLRLQAEAKAVEEARRKAKAEAAEKARREREQEREAARQALQKLEKTVEIDEGRRFMED  492

Query  603  LEMLRVGPTEQH---SSLNESSPQHSLDALGSFKFTG-SNPLEQLGLYMK  466
            LEMLR    E     + + E SP+ S D LGSFK  G SNPLEQLGLYMK
Sbjct  493  LEMLRATGAEGDQLPTFMEEMSPKRSPDMLGSFKMEGNSNPLEQLGLYMK  542



>emb|CDY16729.1| BnaA09g06530D [Brassica napus]
Length=1142

 Score =   121 bits (303),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 139/192 (72%), Gaps = 5/192 (3%)
 Frame = -1

Query  1026  QVEQSSQQKPNS-SEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQ  850
             QVE   ++K  S +  +   + E +  +R  SP K  RAALLKNRFADTI+KAREKTL +
Sbjct  351   QVEHDVREKSTSMAALNVLTEEETAPLERQDSPGKRQRAALLKNRFADTIMKAREKTLTK  410

Query  849   GEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaa  670
             GEKGDP++LR ERE  E + ++E  RLQAEAKA EEAR++A+ EAA +A+R+RE EREAA
Sbjct  411   GEKGDPEKLRIEREKFEKRLREENLRLQAEAKAVEEARRKAKAEAAEKARREREQEREAA  470

Query  669   rqALLKMEQTVEINENSRFLEDLEMLRVGPTEQH---SSLNESSPQHSLDALGSFKFTG-  502
             RQAL K+E+TVEI+E  RF+EDLEMLR    E     + + E SP+ S D LGSFK  G 
Sbjct  471   RQALQKLEKTVEIDEGRRFMEDLEMLRATGAEGDQLPTFMEEMSPKCSPDMLGSFKMEGN  530

Query  501   SNPLEQLGLYMK  466
             SNPLEQLGLYMK
Sbjct  531   SNPLEQLGLYMK  542



>ref|XP_009112075.1| PREDICTED: transcription factor GTE10-like isoform X1 [Brassica 
rapa]
Length=1105

 Score =   120 bits (301),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 127/165 (77%), Gaps = 4/165 (2%)
 Frame = -1

Query  948  DRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarl  769
            +R  SP K  RAALLKNRFADTI+KAREKTL +GEKGDP++LR ERE  E + ++E  RL
Sbjct  526  ERQDSPGKRQRAALLKNRFADTIMKAREKTLTKGEKGDPEKLRIEREKFEKRLREENLRL  585

Query  768  qaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLR  589
            QAEAKA EEAR++A+ EAA +A+R+RE EREAARQAL K+E+TVEI+E  RF+EDLEMLR
Sbjct  586  QAEAKAVEEARRKAKAEAAEKARREREQEREAARQALQKLEKTVEIDEGRRFMEDLEMLR  645

Query  588  VGPTEQH---SSLNESSPQHSLDALGSFKFTG-SNPLEQLGLYMK  466
                E     + + E SP+ S D LGSFK  G SNPLEQLGLYMK
Sbjct  646  ATGAEGDQLPTFMEEMSPKCSPDMLGSFKMEGNSNPLEQLGLYMK  690



>dbj|BAB10736.1| unnamed protein product [Arabidopsis thaliana]
Length=569

 Score =   118 bits (295),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 127/165 (77%), Gaps = 6/165 (4%)
 Frame = -1

Query  942  PASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqa  763
            P SP+K YRAA LKNRFADTI+KAREK   +GEKGDP++LR ERE  E + ++EK RLQA
Sbjct  60   PDSPDKRYRAAFLKNRFADTIMKAREKAFTKGEKGDPEKLRIEREEFEKRLREEKERLQA  119

Query  762  eakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVG  583
            EAKAAEEAR++A+ EAA +A+R+RE EREAARQAL KME+TVEINE  RF+EDL+MLR  
Sbjct  120  EAKAAEEARRKAKAEAAEKARREREQEREAARQALQKMEKTVEINEGIRFMEDLQMLRAT  179

Query  582  PTEQH---SSLNESSPQHSLD--ALGSFKF-TGSNPLEQLGLYMK  466
             TE     +S+   SP+ S D   LGSFK  + SNPLE LGLYMK
Sbjct  180  GTEGDQLPTSMEVMSPKFSEDMLGLGSFKMESNSNPLEHLGLYMK  224



>ref|XP_011073015.1| PREDICTED: transcription factor GTE8 isoform X2 [Sesamum indicum]
Length=721

 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 152/196 (78%), Gaps = 2/196 (1%)
 Frame = -1

Query  981  DGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVL  802
            D    GE    DR  SPEKLYRAALL+ RFAD I+KA+E T+G+GE  D ++L+ E+E L
Sbjct  523  DRNSGGESGLPDREVSPEKLYRAALLRGRFADIIIKAQENTIGKGESPDFEKLKLEKEEL  582

Query  801  EMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINEN  622
            E +R++EKARLQAEA+AAEE+R++AEEEAAAEAKRKRE EREAARQAL KME+TVEINEN
Sbjct  583  ERRRREEKARLQAEARAAEESRRKAEEEAAAEAKRKRELEREAARQALQKMEKTVEINEN  642

Query  621  SRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKF-TGSNPLEQLGLYMKedddfee  445
            ++F+EDLEM R  P E H  + E SP++S + LGSFKF   SNPLEQLGLYMK +++ EE
Sbjct  643  NQFMEDLEMFRGAPDE-HIFIEEGSPENSPNGLGSFKFPASSNPLEQLGLYMKNEEEEEE  701

Query  444  ceppPSSVPKDAKDVE  397
             E  P SVP  + D+E
Sbjct  702  EEVEPQSVPDASNDLE  717



>ref|XP_011073012.1| PREDICTED: transcription factor GTE8 isoform X1 [Sesamum indicum]
 ref|XP_011073013.1| PREDICTED: transcription factor GTE8 isoform X1 [Sesamum indicum]
 ref|XP_011073014.1| PREDICTED: transcription factor GTE8 isoform X1 [Sesamum indicum]
Length=749

 Score =   117 bits (294),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 152/196 (78%), Gaps = 2/196 (1%)
 Frame = -1

Query  981  DGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVL  802
            D    GE    DR  SPEKLYRAALL+ RFAD I+KA+E T+G+GE  D ++L+ E+E L
Sbjct  551  DRNSGGESGLPDREVSPEKLYRAALLRGRFADIIIKAQENTIGKGESPDFEKLKLEKEEL  610

Query  801  EMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINEN  622
            E +R++EKARLQAEA+AAEE+R++AEEEAAAEAKRKRE EREAARQAL KME+TVEINEN
Sbjct  611  ERRRREEKARLQAEARAAEESRRKAEEEAAAEAKRKRELEREAARQALQKMEKTVEINEN  670

Query  621  SRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKF-TGSNPLEQLGLYMKedddfee  445
            ++F+EDLEM R  P E H  + E SP++S + LGSFKF   SNPLEQLGLYMK +++ EE
Sbjct  671  NQFMEDLEMFRGAPDE-HIFIEEGSPENSPNGLGSFKFPASSNPLEQLGLYMKNEEEEEE  729

Query  444  ceppPSSVPKDAKDVE  397
             E  P SVP  + D+E
Sbjct  730  EEVEPQSVPDASNDLE  745



>ref|XP_007031763.1| Bromodomain and extraterminal domain protein 10, putative isoform 
3 [Theobroma cacao]
 gb|EOY02689.1| Bromodomain and extraterminal domain protein 10, putative isoform 
3 [Theobroma cacao]
Length=657

 Score =   117 bits (292),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = -1

Query  1098  AASIIDRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLY  919
              A + ++  V++  D +  +S  DQ+EQ+SQ KP+S E D  QDG+ +  +R  SPEKLY
Sbjct  501   GAQLDEKTSVDNPLDRNQCVSGLDQLEQTSQPKPSSVESDSCQDGDSAPTERQISPEKLY  560

Query  918   RAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQ  793
             RAALLKNRFADTILKAREKTL QG+KGDP++LRRERE LE Q
Sbjct  561   RAALLKNRFADTILKAREKTLTQGDKGDPEKLRREREELEQQ  602



>gb|KEH34972.1| global transcription factor group protein [Medicago truncatula]
Length=779

 Score =   117 bits (293),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 136/225 (60%), Positives = 164/225 (73%), Gaps = 3/225 (1%)
 Frame = -1

Query  1053  GDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILK  874
             G+   +L  Q +QS Q KP++ E +   DGE   + R  SPEKLYR ALL++RFADTILK
Sbjct  557   GNDSTNLGIQADQSLQTKPDTIESESHLDGEGVASKRQVSPEKLYRQALLRSRFADTILK  616

Query  873   AREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrk  694
             A+EK L + EK DP++LR ERE LE ++K+EKARLQAEAKAAEEAR++AE EAAAEAKRK
Sbjct  617   AQEKALEKDEKRDPEKLRIEREELERRQKEEKARLQAEAKAAEEARRKAEAEAAAEAKRK  676

Query  693   refereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGS  517
             RE EREAARQAL  ME+TVEINE+ +FLEDLEML     E+  S   E+SP    +  G 
Sbjct  677   RELEREAARQALQNMEKTVEINESCQFLEDLEMLSAVHDEKTPSFKEEASPDDHQNGFGG  736

Query  516   FKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
              K  G NPLEQLGLYMK DD+ EE E P S+  + +KDVEEGEID
Sbjct  737   IKLQG-NPLEQLGLYMKVDDEDEEEELPQSAA-EPSKDVEEGEID  779



>ref|XP_009336552.1| PREDICTED: transcription factor GTE10-like [Pyrus x bretschneideri]
 ref|XP_009336553.1| PREDICTED: transcription factor GTE10-like [Pyrus x bretschneideri]
Length=834

 Score =   117 bits (293),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 149/210 (71%), Gaps = 5/210 (2%)
 Frame = -1

Query  1080  RKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDG-QQDGEISQNDRPASPEKLYRAALL  904
             R  + D   G+  I+    +EQ    KP   E  G +++G+ + ++R  SP+K YR A+L
Sbjct  549   RSDIGDSEIGNQSINRVAPLEQDPLSKPIPVEEGGHREEGKSAPSERQVSPDKRYRQAVL  608

Query  903   KNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkrae  724
              NRFADTILKAREK L +GEK DP++LR ERE LE ++K+EKARLQAEAKAAEEA+K+A+
Sbjct  609   MNRFADTILKAREKALEKGEKLDPEKLRIEREELEKRQKEEKARLQAEAKAAEEAQKKAK  668

Query  723   eeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSP  544
              EAAAEAKR+RE EREAARQAL  +E+TVEINENSR LEDLEM R       +   E+S 
Sbjct  669   AEAAAEAKRQRELEREAARQALQMIEKTVEINENSRVLEDLEMFRAVDEHVTNFTEETSA  728

Query  543   QH---SLDALGSFKFTG-SNPLEQLGLYMK  466
             +H    L  LGSFK  G SNPLEQLGL+MK
Sbjct  729   EHIEDELARLGSFKLQGSSNPLEQLGLFMK  758



>ref|NP_201137.5| nuclear protein X1 [Arabidopsis thaliana]
 sp|Q9FGW9.2|GTE10_ARATH RecName: Full=Transcription factor GTE10; AltName: Full=Bromodomain-containing 
protein GTE10; AltName: Full=Nuclear protein 
X1; AltName: Full=Protein GLOBAL TRANSCRIPTION FACTOR GROUP 
E10 [Arabidopsis thaliana]
 gb|AED97732.1| nuclear protein X1 [Arabidopsis thaliana]
Length=1061

 Score =   117 bits (294),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 127/165 (77%), Gaps = 6/165 (4%)
 Frame = -1

Query  942  PASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqa  763
            P SP+K YRAA LKNRFADTI+KAREK   +GEKGDP++LR ERE  E + ++EK RLQA
Sbjct  552  PDSPDKRYRAAFLKNRFADTIMKAREKAFTKGEKGDPEKLRIEREEFEKRLREEKERLQA  611

Query  762  eakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVG  583
            EAKAAEEAR++A+ EAA +A+R+RE EREAARQAL KME+TVEINE  RF+EDL+MLR  
Sbjct  612  EAKAAEEARRKAKAEAAEKARREREQEREAARQALQKMEKTVEINEGIRFMEDLQMLRAT  671

Query  582  PTEQH---SSLNESSPQHSLD--ALGSFKF-TGSNPLEQLGLYMK  466
             TE     +S+   SP+ S D   LGSFK  + SNPLE LGLYMK
Sbjct  672  GTEGDQLPTSMEVMSPKFSEDMLGLGSFKMESNSNPLEHLGLYMK  716



>ref|XP_011083946.1| PREDICTED: transcription factor GTE10-like [Sesamum indicum]
Length=771

 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 161/212 (76%), Gaps = 8/212 (4%)
 Frame = -1

Query  1011  SQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDP  832
             S + PN      +Q+GE +  +R  SPEK YRAALL++RFAD I+KA+E T+ +G K D 
Sbjct  566   SMEPPNC-----RQEGESAPPERQVSPEKQYRAALLRSRFADIIIKAQENTIEKGGKPDS  620

Query  831   DQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLK  652
             ++L+ E+E LE +R++EKARLQAEAKAAEEARK+AE EAAAEA+RKRE EREAARQAL +
Sbjct  621   EKLKLEKEELERRRREEKARLQAEAKAAEEARKKAEVEAAAEARRKRELEREAARQALQQ  680

Query  651   MEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKF-TGSNPLEQLG  478
             ME+TV+INENS+F+EDLEM R  P E  HS + E+SP++SL  LGSFKF   SNPLEQLG
Sbjct  681   MEKTVDINENSQFMEDLEMFRSAPDEHLHSFIEEASPENSLKGLGSFKFRANSNPLEQLG  740

Query  477   LYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             LYMK D++ EE   P  S+   + D EEGEID
Sbjct  741   LYMKNDEEEEEEVEPQ-SILDTSNDPEEGEID  771



>gb|KHG26101.1| Transcription factor GTE10 -like protein [Gossypium arboreum]
Length=257

 Score =   111 bits (277),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 165/244 (68%), Gaps = 20/244 (8%)
 Frame = -1

Query  1053  GDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILK  874
             G+  ++   QVE +S  K ++ E    Q+ E + ++R  SPEKLYRAALL+NRFADTILK
Sbjct  14    GNQSLNELGQVELNSHDKSSAVEVQCHQEEESAPSERQVSPEKLYRAALLRNRFADTILK  73

Query  873   AREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrk  694
             AREK L +GEKGDP++LR ERE LE ++++EKARLQAEAKAAEEAR++AE EAAAEAKRK
Sbjct  74    AREKALEKGEKGDPEKLRMEREELERRQREEKARLQAEAKAAEEARRKAEAEAAAEAKRK  133

Query  693   refereaarqALLKMEQTVEINENSRFLEDLEM-------LRVGPTEQ------------  571
             RE EREAARQALL+ME+TV+INENS+F++DLEM        R  P EQ            
Sbjct  134   RELEREAARQALLQMEKTVDINENSQFIQDLEMRFADGEDCRSNPLEQLGLYMKEDDEDE  193

Query  570   HSSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKD-AKDVEE  394
                  +S+P+ + D      +  SNPLEQLGLY+K  DD +E         ++   DVE+
Sbjct  194   EDEPPQSAPEPANDIDEGNLWGRSNPLEQLGLYIKVKDDKDEEAEAAPQTAQEPVNDVED  253

Query  393   GEID  382
             GEID
Sbjct  254   GEID  257



>ref|XP_010026732.1| PREDICTED: transcription factor GTE10-like [Eucalyptus grandis]
 gb|KCW83192.1| hypothetical protein EUGRSUZ_B00141 [Eucalyptus grandis]
Length=780

 Score =   115 bits (288),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 140/236 (59%), Positives = 165/236 (70%), Gaps = 14/236 (6%)
 Frame = -1

Query  1065  DLADGDGVISLFDQVEQSSQQKPNSS--EFDGQQDGEISQNDRPASPEKLYRAALLKNRF  892
             D A  DG+    DQV ++SQ  PNS   E D Q + E +  +R  SPEK YRAALL+NRF
Sbjct  551   DTASVDGM----DQVVENSQ--PNSLPLEADVQGEEESTPPERQVSPEKRYRAALLRNRF  604

Query  891   ADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaa  712
             A+TI KAREK L + EK DP++LR ERE LE + K+EKA++QAEA AAEEARK+AE EAA
Sbjct  605   AETIFKAREKALEKVEKRDPEKLRIEREELERRAKEEKAKIQAEAMAAEEARKKAEAEAA  664

Query  711   aeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNE--SSPQH  538
             AEAKR+RE ERE ARQAL KME+TV+INENS+F+EDLEMLRV   E   +  E   SP  
Sbjct  665   AEAKRQRELERELARQALQKMEKTVDINENSQFMEDLEMLRVPHGEDLPNFLEEAKSPDC  724

Query  537   SLDALGSFKF-TGSNPLEQLGLYMKedddfeeceppPSS---VPKDAKDVEEGEID  382
             S D LGSFK    SNPLEQLGLYMK DD+ E+ E  P     V     DVE+GEID
Sbjct  725   SEDHLGSFKLQNNSNPLEQLGLYMKVDDEDEDEESEPPESHPVLPPPNDVEDGEID  780



>emb|CDY00163.1| BnaC09g01380D [Brassica napus]
Length=220

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 120/170 (71%), Gaps = 11/170 (6%)
 Frame = -1

Query  1083  DRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALL  904
             +R+ ++DL +G    S+    EQ   QKP+S E DGQ DG + +   PA  EK YRAALL
Sbjct  46    ERERMDDLLEGSREYSITGAPEQ---QKPSSDESDGQPDGNVLET--PAPSEKQYRAALL  100

Query  903   KNRFADTILKAREKTLGQ--GEKGDPDQLRREREVLEMQrkkek----arlqaeakaaee  742
             KN+FAD ILKAREKTL Q    KGDP++LR+ERE LE+Q KKE+    A  +A   A  +
Sbjct  101   KNKFADIILKAREKTLPQQNSNKGDPEKLRKEREELELQMKKERARLQAEAEAAEDARRQ  160

Query  741   arkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEML  592
             A   A  EAAAE+KRKRE EREAARQALLKMEQTVEINENSR LEDLEML
Sbjct  161   AEAEAAAEAAAESKRKRELEREAARQALLKMEQTVEINENSRLLEDLEML  210



>ref|XP_006297359.1| hypothetical protein CARUB_v10013379mg [Capsella rubella]
 gb|EOA30257.1| hypothetical protein CARUB_v10013379mg [Capsella rubella]
Length=552

 Score =   113 bits (283),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 129/191 (68%), Gaps = 17/191 (9%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSE-FDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILK-AREKT  859
              +Q+E +S+ K +  E   G +DG  +QN++   PEK YRAALLKNRFAD ILK A+EKT
Sbjct  350   LNQLEDASKGKLSHVEGVGGHKDGNSAQNEKQLPPEKRYRAALLKNRFADIILKAAQEKT  409

Query  858   LGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefer  679
             L Q EK  P++LR ER                  K AEEAR++A+ +AAAEAKRK E ER
Sbjct  410   LNQNEKRSPEKLRLER----------MNSNCKRRKEAEEARRKAKAQAAAEAKRKLEHER  459

Query  678   eaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFTGS  499
             EAARQALL+ME++VEIN+NSRFL+DLE++    T+  ++L E    H  D LG F F GS
Sbjct  460   EAARQALLEMEKSVEINDNSRFLKDLELVN---TDHLTNLREVG--HDSDGLGVFGFGGS  514

Query  498   NPLEQLGLYMK  466
             NPLEQLGLYMK
Sbjct  515   NPLEQLGLYMK  525



>emb|CDX84396.1| BnaC03g51040D [Brassica napus]
Length=613

 Score =   113 bits (283),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 125/164 (76%), Gaps = 8/164 (5%)
 Frame = -1

Query  945  RPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlq  766
            R  SP K  RAALLKNRFADTI+KAREKTL +GE GDP++LR ERE  E + ++E ARLQ
Sbjct  329  RQDSPGKRQRAALLKNRFADTIMKAREKTLTKGENGDPEKLRIEREKFERRLREENARLQ  388

Query  765  aeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRV  586
            AEAKAAEEAR++AE EAA +A+R+RE EREAARQAL KME+TVEINE  RF+EDLEMLR 
Sbjct  389  AEAKAAEEARRKAEAEAAEKARREREQEREAARQALQKMEKTVEINEGRRFMEDLEMLRA  448

Query  585  GPTEQH---SSLNESSPQHSLDALGSFKFTG-SNPLEQLGLYMK  466
               E     + + E SP    + LGSFK  G SNPLEQLGLYMK
Sbjct  449  TGAEADQLPTFMKEMSP----NMLGSFKMEGNSNPLEQLGLYMK  488



>gb|EYU43070.1| hypothetical protein MIMGU_mgv1a001604mg [Erythranthe guttata]
Length=786

 Score =   114 bits (284),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 154/203 (76%), Gaps = 7/203 (3%)
 Frame = -1

Query  1053  GDGVISLFDQVEQSSQQKPNSSEFDGQ--QDGEISQNDRPASPEKLYRAALLKNRFADTI  880
             GD  I  F   +       NSS  D    Q+GE + ++R  SPEK YRAALL++RFAD I
Sbjct  546   GDPNIGDFRNAKPEQNSVSNSSSIDPNCGQEGESAPSERQVSPEKQYRAALLRSRFADII  605

Query  879   LKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeak  700
             +KA+E T+ +GEK DP++L+ ERE +E +R++EKARLQAEAKAAEEARK+AE EAAAEAK
Sbjct  606   IKAQENTIEKGEKPDPEKLKLEREEIERRRREEKARLQAEAKAAEEARKKAEAEAAAEAK  665

Query  699   rkrefereaarqALLKMEQTVEINENSRFLEDLEMLR-VGPTE--QHSSLNESSPQHSLD  529
             RKRE EREAARQAL KME+TV+INENS+F+EDLE+ R  GP E  Q+  + ++SP++S +
Sbjct  666   RKRELEREAARQALQKMEKTVDINENSQFMEDLELFRSAGPDEHLQNLLIEQASPENSEN  725

Query  528   A-LGSFKF-TGSNPLEQLGLYMK  466
             A LGSFKF   SNPLEQLGLYMK
Sbjct  726   ALLGSFKFQASSNPLEQLGLYMK  748



>gb|KJB11630.1| hypothetical protein B456_001G268800 [Gossypium raimondii]
Length=541

 Score =   111 bits (277),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL-  856
             FDQ+EQ+SQ K +S E D  QDG+ + N+RP SPEK YRAA+LKNRFADTILKAREK L 
Sbjct  448   FDQLEQTSQAKSSSVESDCHQDGDSAPNERPVSPEKRYRAAILKNRFADTILKAREKALT  507

Query  855   GQGEKGDPDQLRREREVLEMQ  793
              QGEKGDP++LRRERE LE Q
Sbjct  508   TQGEKGDPEKLRREREELEHQ  528



>ref|XP_011463705.1| PREDICTED: transcription factor GTE10-like, partial [Fragaria 
vesca subsp. vesca]
Length=813

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 126/199 (63%), Positives = 152/199 (76%), Gaps = 3/199 (2%)
 Frame = -1

Query  1053  GDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILK  874
             G+  I+    VEQ S  KP S E   +Q+ E +  +R  SPEKLYRAALL+NRFADTI K
Sbjct  551   GNDPINGVVPVEQKSPSKPISVEEGERQEEESAPPERQVSPEKLYRAALLRNRFADTIFK  610

Query  873   AREKT-LGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakr  697
             A+EK  L +G+K DP++LR ERE LE +RK+EKARLQAEA+AAEEARK+AEEEAAAEA+R
Sbjct  611   AKEKALLEKGDKLDPEKLRIEREELERRRKEEKARLQAEARAAEEARKKAEEEAAAEARR  670

Query  696   krefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALG  520
             +RE EREAARQAL  ME+TVEINENSRF+EDLEM R G  +     + E+SP+HS +  G
Sbjct  671   QRELEREAARQALQMMEKTVEINENSRFMEDLEMFRAGDDDHLPHYIEETSPEHSHNEPG  730

Query  519   SFKFTG-SNPLEQLGLYMK  466
             SFK  G SNPLEQLGL+MK
Sbjct  731   SFKLQGSSNPLEQLGLFMK  749



>gb|KJB33939.1| hypothetical protein B456_006G039400 [Gossypium raimondii]
Length=614

 Score =   111 bits (277),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -1

Query  1029  DQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQ  850
             DQ+EQ+SQ+KP+S E D  QDG+ +  +R  SPEKLYRAAL+KNRFADTILKAREKTL Q
Sbjct  523   DQLEQTSQRKPSSVESDSCQDGDNAPTERQISPEKLYRAALIKNRFADTILKAREKTLIQ  582

Query  849   GEKGDPDQLRREREVLEMQ  793
             G+KGDP++LRRERE LE Q
Sbjct  583   GDKGDPEKLRREREELEQQ  601



>gb|KJB33940.1| hypothetical protein B456_006G039400 [Gossypium raimondii]
Length=686

 Score =   111 bits (277),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/79 (71%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = -1

Query  1029  DQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQ  850
             DQ+EQ+SQ+KP+S E D  QDG+ +  +R  SPEKLYRAAL+KNRFADTILKAREKTL Q
Sbjct  523   DQLEQTSQRKPSSVESDSCQDGDNAPTERQISPEKLYRAALIKNRFADTILKAREKTLIQ  582

Query  849   GEKGDPDQLRREREVLEMQ  793
             G+KGDP++LRRERE LE Q
Sbjct  583   GDKGDPEKLRREREELEQQ  601



>gb|KJB11632.1| hypothetical protein B456_001G268800 [Gossypium raimondii]
Length=614

 Score =   110 bits (276),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 1/81 (1%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL-  856
             FDQ+EQ+SQ K +S E D  QDG+ + N+RP SPEK YRAA+LKNRFADTILKAREK L 
Sbjct  448   FDQLEQTSQAKSSSVESDCHQDGDSAPNERPVSPEKRYRAAILKNRFADTILKAREKALT  507

Query  855   GQGEKGDPDQLRREREVLEMQ  793
              QGEKGDP++LRRERE LE Q
Sbjct  508   TQGEKGDPEKLRREREELEHQ  528



>ref|XP_010550188.1| PREDICTED: transcription factor GTE9-like [Tarenaya hassleriana]
 ref|XP_010550189.1| PREDICTED: transcription factor GTE9-like [Tarenaya hassleriana]
 ref|XP_010550190.1| PREDICTED: transcription factor GTE9-like [Tarenaya hassleriana]
Length=698

 Score =   110 bits (275),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 108/234 (46%), Positives = 145/234 (62%), Gaps = 23/234 (10%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSE-FDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKARE  865
             +S  +Q+E +S  K  S+E  D  QDG  ++N+R    +KLYRAALLKNRFAD ILKARE
Sbjct  474   VSGLNQLEDASHGKLCSAEEADCHQDGNSAENERQLPSDKLYRAALLKNRFADLILKARE  533

Query  864   KTLGQGEKGDPD-----------QLRREREVLEMQrkkekarlqaeakaaeearkraeee  718
             KTL Q ++ DP+           Q +RER  L+ +        +A  +A   A  +A  E
Sbjct  534   KTLSQNDRLDPEKLRREREELELQKKRERARLQAE-------AKAAEEARRRAEAQAAAE  586

Query  717   aaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQH  538
             A AEAKRK E EREAAR+ALL+MEQ+VEINEN+ +L+DLEML+     ++ +      + 
Sbjct  587   AVAEAKRKLELEREAARRALLEMEQSVEINENAEYLKDLEMLKTANGGENLTKAREEDEG  646

Query  537   SLDALGSFK--FTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
               D LG+F   F G NPLEQLGL+MK +++ +E  P P   P   K++EEGEID
Sbjct  647   CEDGLGNFDFGFGGCNPLEQLGLFMKHEEEEDEGLPDPD--PDPCKEIEEGEID  698



>gb|KJB11628.1| hypothetical protein B456_001G268800 [Gossypium raimondii]
Length=687

 Score =   110 bits (274),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 72/94 (77%), Gaps = 3/94 (3%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSNPLEQ  484
            LLKME+TVEINENSRFLEDLEMLR  P E   SS++E+SP HS D LGSFKF  +NPLEQ
Sbjct  596  LLKMEKTVEINENSRFLEDLEMLRAAPAEHLPSSVDETSPDHSQDGLGSFKFGSNNPLEQ  655

Query  483  LGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            LGLYMK  +D EE E  PS+VP    D EEGEID
Sbjct  656  LGLYMK--EDEEEEEGEPSNVPNPVNDPEEGEID  687


 Score = 84.7 bits (208),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTL  856
             FDQ+EQ+SQ K +S E D  QDG+ + N+RP SPEK YRAA+LKNRFADTILKAREK L
Sbjct  448   FDQLEQTSQAKSSSVESDCHQDGDSAPNERPVSPEKRYRAAILKNRFADTILKAREKAL  506



>gb|KJB19581.1| hypothetical protein B456_003G109400 [Gossypium raimondii]
Length=784

 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 129/244 (53%), Positives = 167/244 (68%), Gaps = 20/244 (8%)
 Frame = -1

Query  1053  GDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILK  874
             G+  ++   QVE +S  K ++ E +  Q+ E + ++R  SPEKLYRAALL+NRFADTILK
Sbjct  541   GNQSLNELGQVELNSHDKSSAIEVECHQEEESAPSERQVSPEKLYRAALLRNRFADTILK  600

Query  873   AREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrk  694
             AREK L +GEKGDP++LR ERE LE ++++EKARLQAEAKAAEEAR++AE EAAAEAKRK
Sbjct  601   AREKALEKGEKGDPEKLRMEREELERRQREEKARLQAEAKAAEEARRKAEAEAAAEAKRK  660

Query  693   refereaarqALLKMEQTVEINENSRFLEDLEM-------LRVGPTEQ------------  571
             RE EREAARQALL+ME+TV+INENS+F++DLEM        R  P EQ            
Sbjct  661   RELEREAARQALLQMEKTVDINENSQFIQDLEMRFADGEDCRNNPLEQLGLYMKEDDEDE  720

Query  570   HSSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKD-AKDVEE  394
                  +S+P+ + D      +  SNPLEQLGLY+K +DD +E         ++   DVE+
Sbjct  721   EDEPPQSAPEPANDIDEGNLWGRSNPLEQLGLYIKVEDDKDEEAEAAPQTAQEPVNDVED  780

Query  393   GEID  382
             GEID
Sbjct  781   GEID  784



>emb|CDY13699.1| BnaA06g32240D [Brassica napus]
Length=457

 Score =   106 bits (265),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQH-SSLNESSPQHSLDALGSFKFTGSNPLEQ  484
            LLKME+TVEINENSRFLEDLEMLR    EQ  SS++E SP+ +LDALGSF   G NPLEQ
Sbjct  365  LLKMEKTVEINENSRFLEDLEMLRSSVPEQLLSSVDEISPERTLDALGSFNLGGMNPLEQ  424

Query  483  LGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            LGLYMK  DD E+    P +VPK A DVEEGEID
Sbjct  425  LGLYMK-QDDDEDEPEAPPTVPKLATDVEEGEID  457


 Score = 79.0 bits (193),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 56/82 (68%), Gaps = 4/82 (5%)
 Frame = -1

Query  1071  VNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRF  892
             ++DL +G       +Q++ S+QQKP+S E DGQ DG   +N  P S EK YRAALLKN+F
Sbjct  224   IDDLLNGSESNGAPEQMDISTQQKPSSDETDGQPDGNTLEN--PVSSEKKYRAALLKNKF  281

Query  891   ADTILKAREKTLGQ--GEKGDP  832
             AD ILKAREKTL Q    KGDP
Sbjct  282   ADIILKAREKTLPQQNSNKGDP  303



>emb|CDX83673.1| BnaC07g24130D [Brassica napus]
Length=498

 Score =   106 bits (264),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQH-SSLNESSPQHSLDALGSFKFTGSNPLEQ  484
            LLKME+TVEINENSRFLEDLEMLR    EQ  SS++E SP+ +LDALGSF   G NPLEQ
Sbjct  406  LLKMEKTVEINENSRFLEDLEMLRSSVPEQLLSSVDEISPERTLDALGSFNLGGMNPLEQ  465

Query  483  LGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            LGLYMK  DD E+    P +VPK A DVEEGEID
Sbjct  466  LGLYMK-QDDDEDEPEAPPAVPKLATDVEEGEID  498


 Score = 77.0 bits (188),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 50/68 (74%), Gaps = 4/68 (6%)
 Frame = -1

Query  1029  DQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQ  850
             +Q++ S+QQKP+S E DGQ DG   +N  P S EK YRAALLKN+FAD ILKAREKTL Q
Sbjct  279   EQMDLSTQQKPSSDETDGQPDGNTLEN--PVSSEKKYRAALLKNKFADIILKAREKTLPQ  336

Query  849   --GEKGDP  832
                 KGDP
Sbjct  337   QNSSKGDP  344



>gb|KJB19582.1| hypothetical protein B456_003G109400 [Gossypium raimondii]
Length=787

 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 130/247 (53%), Positives = 167/247 (68%), Gaps = 23/247 (9%)
 Frame = -1

Query  1053  GDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILK  874
             G+  ++   QVE +S  K ++ E +  Q+ E + ++R  SPEKLYRAALL+NRFADTILK
Sbjct  541   GNQSLNELGQVELNSHDKSSAIEVECHQEEESAPSERQVSPEKLYRAALLRNRFADTILK  600

Query  873   AREKTL---GQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaea  703
             AREK L    QGEKGDP++LR ERE LE ++++EKARLQAEAKAAEEAR++AE EAAAEA
Sbjct  601   AREKALEKVTQGEKGDPEKLRMEREELERRQREEKARLQAEAKAAEEARRKAEAEAAAEA  660

Query  702   krkrefereaarqALLKMEQTVEINENSRFLEDLEM-------LRVGPTEQ---------  571
             KRKRE EREAARQALL+ME+TV+INENS+F++DLEM        R  P EQ         
Sbjct  661   KRKRELEREAARQALLQMEKTVDINENSQFIQDLEMRFADGEDCRNNPLEQLGLYMKEDD  720

Query  570   ---HSSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKD-AKD  403
                     +S+P+ + D      +  SNPLEQLGLY+K +DD +E         ++   D
Sbjct  721   EDEEDEPPQSAPEPANDIDEGNLWGRSNPLEQLGLYIKVEDDKDEEAEAAPQTAQEPVND  780

Query  402   VEEGEID  382
             VE+GEID
Sbjct  781   VEDGEID  787



>ref|XP_009151978.1| PREDICTED: transcription factor GTE8 [Brassica rapa]
Length=720

 Score =   106 bits (264),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQH-SSLNESSPQHSLDALGSFKFTGSNPLEQ  484
            LLKME+TVEINENSRFLEDLEMLR    EQ  SS++E SP+ +LDALGSF   G NPLEQ
Sbjct  628  LLKMEKTVEINENSRFLEDLEMLRSSVPEQLLSSVDEISPERTLDALGSFNLGGMNPLEQ  687

Query  483  LGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            LGLYMK  DD E+    P +VPK A DVEEGEID
Sbjct  688  LGLYMK-QDDDEDEPEAPPTVPKLATDVEEGEID  720


 Score = 79.7 bits (195),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/81 (57%), Positives = 56/81 (69%), Gaps = 3/81 (4%)
 Frame = -1

Query  1071  VNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRF  892
             ++DL +G       +Q++ S+QQKP+S E DGQ DG   +N  P S EK YRAALLKN+F
Sbjct  488   IDDLLNGSESNGAPEQMDISTQQKPSSDETDGQPDGNTLEN--PVSSEKKYRAALLKNKF  545

Query  891   ADTILKAREKTLGQ-GEKGDP  832
             AD ILKAREKTL Q   KGDP
Sbjct  546   ADIILKAREKTLPQNSNKGDP  566



>ref|XP_007140891.1| hypothetical protein PHAVU_008G150100g [Phaseolus vulgaris]
 gb|ESW12885.1| hypothetical protein PHAVU_008G150100g [Phaseolus vulgaris]
Length=619

 Score =   104 bits (259),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 66/83 (80%), Gaps = 0/83 (0%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             +S  DQ+E +SQ KP+S + D  QDG+ +  +R  SP+KLYRAA+LKNRF DTILKAREK
Sbjct  526   LSGLDQLEDNSQFKPSSFDSDCHQDGDSAPTERQVSPDKLYRAAVLKNRFLDTILKAREK  585

Query  861   TLGQGEKGDPDQLRREREVLEMQ  793
             TL QGEKGDP++LR ERE LEM+
Sbjct  586   TLTQGEKGDPEKLRLEREKLEME  608



>gb|KDO55691.1| hypothetical protein CISIN_1g004592mg [Citrus sinensis]
Length=624

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1083  DRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALL  904
             ++ G  D  D +  +S  DQ+E +SQQKP+S E D +QDGE + N+R  SP+KLYRA LL
Sbjct  511   EKTGSGDPLDVNQSVSGLDQLEHTSQQKPSSVESDFRQDGESAPNERQVSPDKLYRATLL  570

Query  903   KNRFADTILKAREKTLGQGEKGDPDQ  826
             KNRFADTILKA+EKTL QG+KGDP++
Sbjct  571   KNRFADTILKAKEKTLSQGDKGDPEK  596



>gb|KDO55690.1| hypothetical protein CISIN_1g004592mg [Citrus sinensis]
Length=688

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  1083  DRKGVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALL  904
             ++ G  D  D +  +S  DQ+E +SQQKP+S E D +QDGE + N+R  SP+KLYRA LL
Sbjct  511   EKTGSGDPLDVNQSVSGLDQLEHTSQQKPSSVESDFRQDGESAPNERQVSPDKLYRATLL  570

Query  903   KNRFADTILKAREKTLGQGEKGDPDQ  826
             KNRFADTILKA+EKTL QG+KGDP++
Sbjct  571   KNRFADTILKAKEKTLSQGDKGDPEK  596



>ref|XP_009391145.1| PREDICTED: transcription factor GTE9-like [Musa acuminata subsp. 
malaccensis]
Length=707

 Score =   100 bits (250),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 137/179 (77%), Gaps = 5/179 (3%)
 Frame = -1

Query  1002  KPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQL  823
             KP S + DG Q+GE + ++R  S EKLYRAA L +RFADTILKA +K+L Q ++ DP+ L
Sbjct  513   KPLSVDSDGCQEGEHASSERKVSSEKLYRAACLMSRFADTILKA-QKSLDQADRVDPETL  571

Query  822   RREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQ  643
             +RERE +E QR++E+ARLQAEAKAAE AR+RAE EAAAEAK +RE EREAARQALL+ME+
Sbjct  572   QREREEIERQRREERARLQAEAKAAEGARRRAEAEAAAEAKHRREREREAARQALLQMEK  631

Query  642   TVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMK  466
             TVEI++    L+DLE+L   P     S +E  P HSLD +  F+F GSNP+EQLGL++K
Sbjct  632   TVEIDDYHLVLKDLEILTRTPM----SFDEKCPGHSLDDVEDFRFGGSNPMEQLGLFLK  686



>ref|XP_006659082.1| PREDICTED: transcription factor GTE9-like, partial [Oryza brachyantha]
Length=738

 Score =   100 bits (250),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 148/219 (68%), Gaps = 16/219 (7%)
 Frame = -1

Query  1020  EQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEK  841
             EQSS   P S++ +G+   E     + A P K YRAA+L NRFADTI KAREKTL Q  K
Sbjct  530   EQSSDPVPISADDEGENVSE-----KQAPPAKNYRAAVLLNRFADTIFKAREKTLDQVAK  584

Query  840   GDPDQLRREREVLEMQrkkekarlqaeakaa----eearkraeeeaaaeakrkreferea  673
              DPD+L+ + E LE  R++E+ARLQAEAKAA    + A+  A  EAAAEAKR+RE EREA
Sbjct  585   KDPDKLQHDMEELERLRREERARLQAEAKAAEDARKRAQAAAAAEAAAEAKRQREREREA  644

Query  672   arqALLKMEQTVEINENSRFLEDLEMLRVGPTEQH--SSLNESSPQHSLDALGSFKFTGS  499
             AR+AL +ME+TV+INE + FL+DLEML    T +   SS+ E+SP H+ + LG F+  GS
Sbjct  645   ARKALQQMEKTVDINEGNLFLKDLEMLGTVTTGEQFPSSVGETSPSHTPEGLG-FQL-GS  702

Query  498   NPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             NPLEQLGLYMK DD+ +E             DVEEGEID
Sbjct  703   NPLEQLGLYMKNDDEEDEEGESADE---PTVDVEEGEID  738



>ref|XP_002965804.1| hypothetical protein SELMODRAFT_406866 [Selaginella moellendorffii]
 gb|EFJ33224.1| hypothetical protein SELMODRAFT_406866 [Selaginella moellendorffii]
Length=706

 Score = 97.8 bits (242),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 141/208 (68%), Gaps = 6/208 (3%)
 Frame = -1

Query  987  EFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKT--LGQGEKGDPDQLRRE  814
            E   ++  E  Q++RP SPEK  RAALLK RFADTILKAREKT  L  G+  DP++LR+E
Sbjct  499  ESQAEKSAEKLQSERPVSPEKSVRAALLKGRFADTILKAREKTFPLKSGDNVDPEKLRKE  558

Query  813  REVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVE  634
            RE LE + +++KARLQA+AKAAE ARK+AE EAA EA++KRE EREAAR+AL +ME+TV+
Sbjct  559  REELERKLREDKARLQADAKAAEVARKKAEAEAATEARKKREVEREAARKALQQMERTVD  618

Query  633  INENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFT--GSNPLEQLGLYMKe  463
            ++ +   L+D +++R    E   SS  E SP +S D L  F       N LEQLGL+MK 
Sbjct  619  LDAHCEILKDFDLMRTSSKEHFQSSAGEVSPPNSPDGLPGFTLPQGAGNALEQLGLFMKL  678

Query  462  dddfeeceppPSSVPKDAK-DVEEGEID  382
            D++ ++ +        D   +VEEGEID
Sbjct  679  DEEEDDKQGDGEVAYADENGEVEEGEID  706



>dbj|BAD08859.1| putative bromodomain-containing protein [Oryza sativa Japonica 
Group]
 gb|EAZ41383.1| hypothetical protein OsJ_25901 [Oryza sativa Japonica Group]
Length=791

 Score = 97.8 bits (242),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 119/219 (54%), Positives = 149/219 (68%), Gaps = 16/219 (7%)
 Frame = -1

Query  1020  EQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEK  841
             +QSS   P S+E +G+    +S+   P  P K YRAA+L NRFADTI KAREKTL Q  K
Sbjct  583   QQSSDPVPISAEDEGEN---VSEKQVP--PAKQYRAAVLLNRFADTIFKAREKTLDQVAK  637

Query  840   GDPDQLRREREVLEMQrkkekarlqaeakaa----eearkraeeeaaaeakrkreferea  673
              DP++L+ + E LE  R++E+AR+QAEAKAA    + A   A  EAAAEAKR+RE EREA
Sbjct  638   KDPEKLQHDMEELERLRREERARIQAEAKAAEDARKRAEAAAAAEAAAEAKRQREREREA  697

Query  672   arqALLKMEQTVEINENSRFLEDLEML-RVGPTEQH-SSLNESSPQHSLDALGSFKFTGS  499
             AR+AL +ME+TV+INE + FL+DLEML  V   EQ  SS+ E+SP H+ + LG F+  GS
Sbjct  698   ARKALQQMEKTVDINEGNLFLKDLEMLGTVTSGEQFPSSVGETSPTHTPEGLG-FQL-GS  755

Query  498   NPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             NPLEQLGLYMK DD+ +E             DVEEGEID
Sbjct  756   NPLEQLGLYMKNDDEEDEEGESADE---PTIDVEEGEID  791



>ref|XP_002993220.1| hypothetical protein SELMODRAFT_431331 [Selaginella moellendorffii]
 gb|EFJ05740.1| hypothetical protein SELMODRAFT_431331 [Selaginella moellendorffii]
Length=702

 Score = 97.1 bits (240),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 104/197 (53%), Positives = 137/197 (70%), Gaps = 6/197 (3%)
 Frame = -1

Query  954  QNDRPASPEKLYRAALLKNRFADTILKAREKT--LGQGEKGDPDQLRREREVLEMQrkke  781
            Q++RP SPEK  RAALLK RFADTILKAREKT  L  G+  DP++LR+ERE LE + +++
Sbjct  506  QSERPVSPEKSVRAALLKGRFADTILKAREKTFPLKSGDNVDPEKLRKEREELERKLRED  565

Query  780  karlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDL  601
            KARLQA+AKAAE ARK+AE EAA EA++KRE EREAAR+AL +ME+TV+++ +   L+D 
Sbjct  566  KARLQADAKAAEVARKKAEAEAATEARKKREVEREAARKALQQMERTVDLDAHCEILKDF  625

Query  600  EMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFT--GSNPLEQLGLYMKedddfeeceppP  430
            +++R    E   SS  E SP +S D L  F       N LEQLGL+MK D++ ++ +   
Sbjct  626  DLMRTSSKEHFQSSAGEVSPPNSPDGLPGFTLPQGAGNALEQLGLFMKLDEEEDDKQGDG  685

Query  429  SSVPKDAK-DVEEGEID  382
                 D   +VEEGEID
Sbjct  686  EVAYADENGEVEEGEID  702



>gb|EPS70275.1| hypothetical protein M569_04485, partial [Genlisea aurea]
Length=543

 Score = 96.3 bits (238),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 149/199 (75%), Gaps = 4/199 (2%)
 Frame = -1

Query  966  GEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrk  787
            GE +  +R  SPEKLYRAALL+ RFAD I+KA+E ++ +G + DP++L+ ERE LE +RK
Sbjct  345  GENAPPERQVSPEKLYRAALLRGRFADIIIKAQENSIEKGNRPDPEKLKLEREELERRRK  404

Query  786  kekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLE  607
            +EKARLQAEAKAAEEAR++AE EAAAEAKRKRE EREAARQAL +ME+TV+INE S+F+E
Sbjct  405  EEKARLQAEAKAAEEARRKAELEAAAEAKRKRELEREAARQALQQMEKTVDINEGSQFIE  464

Query  606  DLEMLRVGPTEQHSSL-NESSPQ-HSLDALGSFKFTG-SNPLEQLGLYMKedddfeecep  436
            D +ML   P EQ  SL  E  P+    D LGSFKF G SNPLEQLGLYMK +D+ EE E 
Sbjct  465  DFDMLASAPDEQLQSLIAELDPKDEENDVLGSFKFQGNSNPLEQLGLYMKNEDEDEEVET  524

Query  435  pPSSVPKDAKD-VEEGEID  382
                +   + D  EEGEID
Sbjct  525  QSVLLDNTSNDPPEEGEID  543



>ref|XP_009391147.1| PREDICTED: transcription factor GTE9-like [Musa acuminata subsp. 
malaccensis]
Length=725

 Score = 95.1 bits (235),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 118/221 (53%), Positives = 154/221 (70%), Gaps = 6/221 (3%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             +S    +E     KP S + DG  +G+ + ++R  SPEKLYR   LK+RFADTI+KA + 
Sbjct  508   LSGLTPLEMDVDSKPLSGDSDGCPEGKHASSERKVSPEKLYRTVWLKSRFADTIVKA-QN  566

Query  861   TLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe  682
             +L Q ++GDP++L+RERE +E QR++E+ARLQAEAKAAE+AR+RAE EAAAEAKRKRE E
Sbjct  567   SLDQADRGDPEKLQREREEMERQRREERARLQAEAKAAEDARRRAEVEAAAEAKRKRERE  626

Query  681   reaarqALLKMEQTVEINENSRFLEDLEML-RVGPTEQHSSLNESSPQHS-LDALGSFKF  508
             REAARQAL +ME+T EI++    L+DLE+L R+       SLNE  P H  LD +  F+F
Sbjct  627   REAARQALSQMEKTAEIDDYRLVLKDLEILTRIPAGRIPMSLNEKCPVHYFLDDVEDFRF  686

Query  507   TGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEI  385
              G NP+EQLG +MK DD+ EE      + P    DVEEGEI
Sbjct  687   GGINPMEQLGSFMKVDDEEEEEGKTKRAPP---SDVEEGEI  724



>ref|XP_007037912.1| Nuclear protein X1 isoform 3 [Theobroma cacao]
 gb|EOY22413.1| Nuclear protein X1 isoform 3 [Theobroma cacao]
Length=663

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -1

Query  1056  DGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTIL  877
             DG+  ++   QVE     KP++ E +G QD E +  +R  SPEKLYRAA+L+ RFADTIL
Sbjct  556   DGNQSLNELGQVELKFHDKPSAIEAEGHQDEESAPAERQVSPEKLYRAAVLRKRFADTIL  615

Query  876   KAREKTLGQGEKGDPDQLRREREVLE  799
             KAREK L +GEKGDP++LR ERE LE
Sbjct  616   KAREKALEKGEKGDPEKLRMEREELE  641



>ref|XP_008800952.1| PREDICTED: transcription factor GTE10-like isoform X1 [Phoenix 
dactylifera]
Length=647

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/78 (60%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLG  853
              DQ EQ +   P S E +  Q G  + ++RP SP+KLYRAALL+NRFADTILKAREKTL 
Sbjct  509   LDQPEQDADPIPASVEANSHQKGGNTPSERPVSPKKLYRAALLRNRFADTILKAREKTLD  568

Query  852   QGEKGDPDQLRREREVLE  799
             QGEK DP++L+ E+E LE
Sbjct  569   QGEKRDPEKLQLEKEELE  586



>gb|KDO69316.1| hypothetical protein CISIN_1g004033mg [Citrus sinensis]
Length=688

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = -1

Query  1074  GVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNR  895
             GV D+  G+  ++  DQVE +SQ KP +   DG  +GE + ++R  SP+KLYRAALL+NR
Sbjct  548   GVPDI--GNSSVNSLDQVELNSQGKPVAIVADGHHEGESAPSERQVSPDKLYRAALLRNR  605

Query  894   FADTILKAREKTLGQGEKGDPDQL  823
             FADTILKAREK L +GEK DP++L
Sbjct  606   FADTILKAREKALEKGEKRDPEKL  629



>ref|XP_006440055.1| hypothetical protein CICLE_v10018939mg [Citrus clementina]
 gb|ESR53295.1| hypothetical protein CICLE_v10018939mg [Citrus clementina]
Length=688

 Score = 90.5 bits (223),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = -1

Query  1074  GVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNR  895
             GV D+  G+  ++  DQVE +SQ KP +   DG  +GE + ++R  SP+KLYRAALL+NR
Sbjct  548   GVPDI--GNSSVNSLDQVELNSQGKPVAIVADGHHEGESAPSERQVSPDKLYRAALLRNR  605

Query  894   FADTILKAREKTLGQGEKGDPDQL  823
             FADTILKAREK L +GEK DP++L
Sbjct  606   FADTILKAREKALEKGEKRDPEKL  629



>dbj|BAH19453.1| AT5G14270 [Arabidopsis thaliana]
Length=549

 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 59/79 (75%), Gaps = 0/79 (0%)
 Frame = -1

Query  1032  FDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLG  853
              DQ+E +S +K +S E D QQDG  +QN++   PEK YRAA+LKNRFAD ILKAREK L 
Sbjct  471   LDQLESASPEKISSVEADCQQDGNSAQNEKQLPPEKSYRAAILKNRFADIILKAREKPLN  530

Query  852   QGEKGDPDQLRREREVLEM  796
             Q +  DP++L+RERE LE+
Sbjct  531   QNDTRDPEKLQREREELEL  549



>gb|KDO69317.1| hypothetical protein CISIN_1g004033mg [Citrus sinensis]
 gb|KDO69318.1| hypothetical protein CISIN_1g004033mg [Citrus sinensis]
Length=646

 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = -1

Query  1074  GVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNR  895
             GV D+  G+  ++  DQVE +SQ KP +   DG  +GE + ++R  SP+KLYRAALL+NR
Sbjct  548   GVPDI--GNSSVNSLDQVELNSQGKPVAIVADGHHEGESAPSERQVSPDKLYRAALLRNR  605

Query  894   FADTILKAREKTLGQGEKGDPDQL  823
             FADTILKAREK L +GEK DP++L
Sbjct  606   FADTILKAREKALEKGEKRDPEKL  629



>ref|XP_006440054.1| hypothetical protein CICLE_v10018939mg [Citrus clementina]
 ref|XP_006440057.1| hypothetical protein CICLE_v10018939mg [Citrus clementina]
 gb|ESR53294.1| hypothetical protein CICLE_v10018939mg [Citrus clementina]
 gb|ESR53297.1| hypothetical protein CICLE_v10018939mg [Citrus clementina]
Length=646

 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 2/84 (2%)
 Frame = -1

Query  1074  GVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNR  895
             GV D+  G+  ++  DQVE +SQ KP +   DG  +GE + ++R  SP+KLYRAALL+NR
Sbjct  548   GVPDI--GNSSVNSLDQVELNSQGKPVAIVADGHHEGESAPSERQVSPDKLYRAALLRNR  605

Query  894   FADTILKAREKTLGQGEKGDPDQL  823
             FADTILKAREK L +GEK DP++L
Sbjct  606   FADTILKAREKALEKGEKRDPEKL  629



>gb|EAZ05455.1| hypothetical protein OsI_27669 [Oryza sativa Indica Group]
Length=791

 Score = 89.7 bits (221),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 114/219 (52%), Positives = 144/219 (66%), Gaps = 16/219 (7%)
 Frame = -1

Query  1020  EQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEK  841
             +QSS   P S+E +G+    +S+   P  P K YRAA+L NRFADTI KAREKTL Q  K
Sbjct  583   QQSSDPVPISAEDEGEN---VSEKQVP--PAKQYRAAVLLNRFADTIFKAREKTLDQVAK  637

Query  840   GDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefereaarqA  661
              DP++L+ + E LE  R++E+AR+QAEAKAAE+ARKRAE  AAAEA  + + +RE  R+A
Sbjct  638   KDPEKLQHDMEELERLRREERARIQAEAKAAEDARKRAEAAAAAEAAAEAKRQREREREA  697

Query  660   LLKMEQTVE----INENSRFLEDLEML-RVGPTEQH-SSLNESSPQHSLDALGSFKFTGS  499
               K  Q +E    INE + FL+DLEML  V   EQ  SS+ E+SP H+ + LG F+  GS
Sbjct  698   ARKALQQMEKTVDINEGNLFLKDLEMLGTVTSGEQFPSSVGETSPTHTPEGLG-FQL-GS  755

Query  498   NPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
             NPLEQLGLYMK DD+ +E             DVEEGEID
Sbjct  756   NPLEQLGLYMKNDDEEDEEGESADE---PTIDVEEGEID  791



>ref|XP_009412706.1| PREDICTED: transcription factor GTE9-like [Musa acuminata subsp. 
malaccensis]
Length=726

 Score = 86.7 bits (213),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 66/94 (70%), Gaps = 4/94 (4%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSNPLEQ  484
            LL+ME+TVEINE+S FL+DLE+LR  P E   SS+ E+SP  S + +  F+  GSNPLEQ
Sbjct  636  LLQMEKTVEINESSVFLKDLEILRTAPGEHLPSSVGETSPDRSPEGISGFQLGGSNPLEQ  695

Query  483  LGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            LGLYMK DD+ +E   P S+    A D EEGEID
Sbjct  696  LGLYMKADDEEDEEVEPNSAT---ANDAEEGEID  726


 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 65/96 (68%), Gaps = 4/96 (4%)
 Frame = -1

Query  1110  QACLAASIIDRKGVNDLA---DGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRP  940
             ++ L+   +D++ ++DL+   DG+      +Q EQ +  KP S   +  ++G+ + ++R 
Sbjct  480   KSILSGQALDQE-ISDLSNPRDGNRTSEGTNQQEQVAHPKPESVVIEQNREGDNAPSERQ  538

Query  939   ASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDP  832
              SPEKLYRAA+LK+RFADTILKAREKTL QGE  DP
Sbjct  539   FSPEKLYRAAILKSRFADTILKAREKTLDQGESRDP  574



>ref|XP_010930071.1| PREDICTED: transcription factor GTE10-like isoform X3 [Elaeis 
guineensis]
Length=660

 Score = 86.3 bits (212),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/56 (73%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = -1

Query  993  SSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQ  826
            S E DG Q+GE + ++R  SPEKLYRAALL++RFADTILKAREKTLGQGEKGDP++
Sbjct  547  SVEVDGNQEGENAPSERQVSPEKLYRAALLRSRFADTILKAREKTLGQGEKGDPEK  602



>gb|AFK46997.1| unknown [Lotus japonicus]
Length=89

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/91 (60%), Positives = 65/91 (71%), Gaps = 3/91 (3%)
 Frame = -1

Query  651  MEQTVEINENSRFLEDLEMLRVGPTEQHSSLN-ESSPQHSLDALGSFKFTGSNPLEQLGL  475
            ME+TVEINE+S+FLEDLEML     +   S   E+SP H  + LGSFK  G NPLEQLGL
Sbjct  1    MEKTVEINESSQFLEDLEMLSAVHDDITPSFKEETSPDHPENELGSFKLQG-NPLEQLGL  59

Query  474  YMKedddfeeceppPSSVPKDAKDVEEGEID  382
            YMK D++ EE E PPS+    +KDVEEGEID
Sbjct  60   YMKVDEEDEEEELPPSAA-GPSKDVEEGEID  89



>gb|KDO77998.1| hypothetical protein CISIN_1g007584mg [Citrus sinensis]
 gb|KDO77999.1| hypothetical protein CISIN_1g007584mg [Citrus sinensis]
Length=597

 Score = 80.5 bits (197),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 112/200 (56%), Gaps = 11/200 (6%)
 Frame = -1

Query  1056  DGDGVISLFD--QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADT  883
             D DG +S  D   +  SSQ  P +++    ++      D   SP+K  RAA+LK+RFADT
Sbjct  380   DSDGAVSALDDGNLCPSSQLTPPATDSASAEEWTTPLLDVQMSPKKALRAAMLKSRFADT  439

Query  882   ILKAREKT-LGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaae  706
             ILKA+++T L  G+K DP +L++E+E LE +   ++          + A   +  +A  E
Sbjct  440   ILKAQQRTLLDHGDKADPVKLQQEKERLEQR---QREEKARIEAQIKAAEAASRMKAEIE  496

Query  705   akrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDA  526
              K++RE EREAAR AL KME+TVEI  N   L++LEML       H  LN S  Q     
Sbjct  497   LKKQREKEREAARVALQKMERTVEIEHNLEILKELEMLSGCCLSPH-LLNGSEAQKRAFK  555

Query  525   LGSFKFTGSNPLEQLGLYMK  466
                FK    NPLE++GL+MK
Sbjct  556   EAHFK----NPLERIGLFMK  571



>ref|XP_010485369.1| PREDICTED: transcription factor GTE9-like isoform X4 [Camelina 
sativa]
Length=677

 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 63/93 (68%), Gaps = 2/93 (2%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFTGSNPLEQL  481
            LL+ME++VEINEN RFL DLE+L+   T+  ++L E    H  D LG F F GSNPLEQL
Sbjct  587  LLEMEKSVEINENPRFLNDLELLKTVNTDHLTNLREVEVGHDSDGLGVFGFGGSNPLEQL  646

Query  480  GLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            GL+MK D+D +E +      P  + +VEEGEID
Sbjct  647  GLFMKHDEDEDEADLLCFQDP--SNEVEEGEID  677


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSE-FDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKARE  865
             +S  +Q+E +S+ K +  E  D  +DG  +QN++   PEK YRAALLK+++AD ILKARE
Sbjct  455   VSGLNQLEDASKGKLSPVEGADSHKDGNSAQNEKQLPPEKRYRAALLKSQYADLILKARE  514

Query  864   KTLGQGEKGDPDQLR  820
             KTL Q EK +P++LR
Sbjct  515   KTLNQNEKRNPEKLR  529



>ref|XP_006467562.1| PREDICTED: transcription factor GTE9-like [Citrus sinensis]
Length=597

 Score = 80.1 bits (196),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 112/200 (56%), Gaps = 11/200 (6%)
 Frame = -1

Query  1056  DGDGVISLFD--QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADT  883
             D DG +S  D   +  SSQ  P +++    ++      D   SP+K  RAA+LK+RFADT
Sbjct  380   DSDGAVSALDDGNLCPSSQLTPPATDSASAEEWTTPLLDVQMSPKKALRAAMLKSRFADT  439

Query  882   ILKAREKT-LGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaae  706
             ILKA+++T L  G+K DP +L++E+E LE +   ++          + A   +  +A  E
Sbjct  440   ILKAQQRTLLDHGDKADPVKLQQEKERLEQR---QREEKARIEAQIKAAEAASRMKAEIE  496

Query  705   akrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDA  526
              K++RE EREAAR AL KME+TVEI  N   L++LEML       H  LN S  Q     
Sbjct  497   LKKQREKEREAARVALQKMERTVEIEHNLEILKELEMLSGCCLSPH-LLNGSEAQKRAFK  555

Query  525   LGSFKFTGSNPLEQLGLYMK  466
                FK    NPLE++GL+MK
Sbjct  556   EAHFK----NPLERIGLFMK  571



>ref|XP_006449595.1| hypothetical protein CICLE_v10014673mg [Citrus clementina]
 gb|ESR62835.1| hypothetical protein CICLE_v10014673mg [Citrus clementina]
Length=597

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 80/200 (40%), Positives = 112/200 (56%), Gaps = 11/200 (6%)
 Frame = -1

Query  1056  DGDGVISLFD--QVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADT  883
             D DG +S  D   +  SSQ  P +++    ++      D   SP+K  RAA+LK+RFADT
Sbjct  380   DSDGAVSALDDGNLCPSSQLTPPATDSASAEEWITPLLDVQMSPKKALRAAMLKSRFADT  439

Query  882   ILKAREKT-LGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaae  706
             ILKA+++T L  G+K DP +L++E+E LE +   ++          + A   +  +A  E
Sbjct  440   ILKAQQRTLLDHGDKADPVKLQQEKERLEQR---QREEKARIEAQIKAAEAASRMKAEIE  496

Query  705   akrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDA  526
              K++RE EREAAR AL KME+TVEI  N   L++LEML       H  LN S  Q     
Sbjct  497   LKKQREKEREAARVALQKMERTVEIEHNLEILKELEMLSGCCLSPH-LLNGSEAQKRAFK  555

Query  525   LGSFKFTGSNPLEQLGLYMK  466
                FK    NPLE++GL+MK
Sbjct  556   EAHFK----NPLERIGLFMK  571



>ref|XP_010485365.1| PREDICTED: transcription factor GTE9-like isoform X1 [Camelina 
sativa]
 ref|XP_010485367.1| PREDICTED: transcription factor GTE9-like isoform X1 [Camelina 
sativa]
Length=676

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 63/93 (68%), Gaps = 4/93 (4%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFTGSNPLEQL  481
            LL+ME++VEINEN RFL DLE+L+   T+  ++L E    H  D LG F F GSNPLEQL
Sbjct  588  LLEMEKSVEINENPRFLNDLELLKTVNTDHLTNLREVG--HDSDWLGVFGFGGSNPLEQL  645

Query  480  GLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            GLYMK DDD +E +      P  + +VEEGEID
Sbjct  646  GLYMKHDDDEDEADLLGFQDP--SNEVEEGEID  676


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSE-FDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKARE  865
             +S  +Q+E +S+ K +  E  D  +DG  +QN++   PEK YRAALLK+++AD ILKARE
Sbjct  456   VSGLNQLEDASKGKLSPVEGADSHKDGNSAQNEKQLPPEKRYRAALLKSQYADLILKARE  515

Query  864   KTLGQGEKGDPDQLR  820
             KTL Q EK +P++LR
Sbjct  516   KTLNQNEKRNPEKLR  530



>ref|XP_010485368.1| PREDICTED: transcription factor GTE9-like isoform X3 [Camelina 
sativa]
Length=675

 Score = 79.3 bits (194),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 63/93 (68%), Gaps = 4/93 (4%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFTGSNPLEQL  481
            LL+ME++VEINEN RFL DLE+L+   T+  ++L E    H  D LG F F GSNPLEQL
Sbjct  587  LLEMEKSVEINENPRFLNDLELLKTVNTDHLTNLREVG--HDSDWLGVFGFGGSNPLEQL  644

Query  480  GLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            GLYMK DDD +E +      P  + +VEEGEID
Sbjct  645  GLYMKHDDDEDEADLLGFQDP--SNEVEEGEID  675


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSE-FDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKARE  865
             +S  +Q+E +S+ K +  E  D  +DG  +QN++   PEK YRAALLK+++AD ILKARE
Sbjct  455   VSGLNQLEDASKGKLSPVEGADSHKDGNSAQNEKQLPPEKRYRAALLKSQYADLILKARE  514

Query  864   KTLGQGEKGDPDQLR  820
             KTL Q EK +P++LR
Sbjct  515   KTLNQNEKRNPEKLR  529



>gb|KDO69319.1| hypothetical protein CISIN_1g004033mg [Citrus sinensis]
 gb|KDO69320.1| hypothetical protein CISIN_1g004033mg [Citrus sinensis]
Length=624

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 53/73 (73%), Gaps = 2/73 (3%)
 Frame = -1

Query  1074  GVNDLADGDGVISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNR  895
             GV D+  G+  ++  DQVE +SQ KP +   DG  +GE + ++R  SP+KLYRAALL+NR
Sbjct  548   GVPDI--GNSSVNSLDQVELNSQGKPVAIVADGHHEGESAPSERQVSPDKLYRAALLRNR  605

Query  894   FADTILKAREKTL  856
             FADTILKAREK L
Sbjct  606   FADTILKAREKAL  618



>ref|XP_010273394.1| PREDICTED: transcription factor GTE10 [Nelumbo nucifera]
Length=698

 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 90/239 (38%), Positives = 122/239 (51%), Gaps = 26/239 (11%)
 Frame = -1

Query  1056  DGDGVISLFDQVEQSSQQKPNSSEFDGQ--QDGEISQNDRPASPEKLYRAALLKNRFADT  883
             D DG +S+ D+       +P +        +  E S  D   SP K  RAA+LK+RFADT
Sbjct  469   DSDGAVSIVDEENGRPSSRPATPAIVAAPGERWEDSVYDGQLSPNKALRAAMLKSRFADT  528

Query  882   ILKAREKT-LGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaae  706
             ILKA++KT L  GEKGDP ++++E+E LE +   ++            A   +   A AE
Sbjct  529   ILKAQQKTLLNHGEKGDPIKMQQEKERLERK---QREEKARIEAQIRAAEAASRMRAEAE  585

Query  705   akrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQ-----  541
              K +RE  REAAR  L +ME+TVEI+EN   L+DLEM   G T+   +    +P+     
Sbjct  586   QKMQRERAREAARIKLQQMEKTVEIDENQAILKDLEMFG-GYTQPKDARGTEAPKCGNVD  644

Query  540   -------HSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEI  385
                    H L  L        NPLE+LGL+ K+D   EE E    +      DVEEGEI
Sbjct  645   EFADDFGHVLGTLEGCHH--GNPLERLGLFRKDDFMEEEEEEANLN-----GDVEEGEI  696



>ref|XP_010485366.1| PREDICTED: transcription factor GTE9-like isoform X2 [Camelina 
sativa]
Length=676

 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/93 (53%), Positives = 63/93 (68%), Gaps = 4/93 (4%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQHSLDALGSFKFTGSNPLEQL  481
            LL+ME++VEINEN RFL DLE+L+   T+  ++L E    H  D LG F F GSNPLEQL
Sbjct  588  LLEMEKSVEINENPRFLNDLELLKTVNTDHLTNLREVG--HDSDGLGVFGFGGSNPLEQL  645

Query  480  GLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            GL+MK D+D +E +      P  + +VEEGEID
Sbjct  646  GLFMKHDEDEDEADLLCFQDP--SNEVEEGEID  676


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 54/75 (72%), Gaps = 1/75 (1%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSE-FDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKARE  865
             +S  +Q+E +S+ K +  E  D  +DG  +QN++   PEK YRAALLK+++AD ILKARE
Sbjct  456   VSGLNQLEDASKGKLSPVEGADSHKDGNSAQNEKQLPPEKRYRAALLKSQYADLILKARE  515

Query  864   KTLGQGEKGDPDQLR  820
             KTL Q EK +P++LR
Sbjct  516   KTLNQNEKRNPEKLR  530



>ref|XP_010039682.1| PREDICTED: transcription factor GTE9-like [Eucalyptus grandis]
Length=96

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 57/86 (66%), Gaps = 8/86 (9%)
 Frame = -1

Query  1065  DLADGDGVISLFDQVEQSSQQKPNSS--EFDGQQDGEISQNDRPASPEKLYRAALLKNRF  892
             D A  DG+    DQV Q+SQ  PNS   E D Q + E +  +R  SPEK YRAALL+NRF
Sbjct  17    DTASVDGM----DQVVQNSQ--PNSLPLEADVQGEEESTPPERQVSPEKRYRAALLRNRF  70

Query  891   ADTILKAREKTLGQGEKGDPDQLRRE  814
             A+TI KAREK L + EK DP++LR E
Sbjct  71    AETIFKAREKALEKVEKRDPEKLRIE  96



>ref|XP_010095124.1| Transcription factor GTE12 [Morus notabilis]
 gb|EXB58290.1| Transcription factor GTE12 [Morus notabilis]
Length=569

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 120/226 (53%), Gaps = 15/226 (7%)
 Frame = -1

Query  1113  DQACLAASIIDRKG--------VNDLADGDGVISLFDQVEQS-SQQKPNSSEFDGQQDGE  961
             D AC  AS +D +          N   D DG +S FD+     S Q          ++G 
Sbjct  320   DPACSEASRMDYRTKSMSTSRISNSDPDSDGALSAFDEENTCRSSQVIAPVANAASREGR  379

Query  960   ISQNDRPASPEKLYRAALLKNRFADTILKAREKT-LGQGEKGDPDQLRREREVLEMQrkk  784
              +  D   SP+K  RAA+LK RFADTILKA++KT L  G++ DP++L++E+E LE   + 
Sbjct  380   NTPLDVQLSPQKALRAAMLKCRFADTILKAQQKTLLNHGDRNDPEKLKQEKERLE---RT  436

Query  783   ekarlqaeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLED  604
             ++            A   +  +A  E K++RE EREAAR AL KME+T+EI +N   L++
Sbjct  437   QREEKARIEAQIRAAEAASRLKAETELKQQREREREAARVALEKMEKTIEIGQNLEVLKE  496

Query  603   LEMLRVGPTEQHSSLNESSPQHSLDALGSFKFTGSNPLEQLGLYMK  466
             LE L  G    +  LN    +  L  + S+     +PLE+LGL++K
Sbjct  497   LETL-CGFAPSYHLLNRDKGREVL-MVSSWPADMRSPLEELGLFIK  540



>gb|KEH17396.1| global transcription factor group protein [Medicago truncatula]
Length=626

 Score = 74.3 bits (181),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/57 (61%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = -1

Query  963  EISQNDRPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQ  793
            E   ++R  SP+KL RAAL+KNRF DTIL AREKTL QG KGDP+++R ++E LEM+
Sbjct  559  ECGASERQISPDKLIRAALIKNRFVDTILNAREKTLTQGVKGDPEKMRLDKEKLEME  615



>gb|EYU23138.1| hypothetical protein MIMGU_mgv1a019799mg [Erythranthe guttata]
Length=683

 Score = 73.6 bits (179),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 82/162 (51%), Positives = 111/162 (69%), Gaps = 12/162 (7%)
 Frame = -1

Query  945  RPASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlq  766
            R  SPEKLYRAALL+ RFAD I+KA+E T+ +G   DP++L+ E+   E   ++ +    
Sbjct  510  RQVSPEKLYRAALLRGRFADIIIKAQENTVEKG--ADPEKLKFEK---EEFERRRREEKA  564

Query  765  aeakaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRV  586
                 AEEAR++ EEEAAAEA+RKR+ EREAARQAL +ME+TV+I+E+S+F+E L     
Sbjct  565  RLQAEAEEARRKVEEEAAAEAQRKRQAEREAARQALQQMEKTVDIDESSQFMEAL-----  619

Query  585  GPTEQHSSLNESSPQHS-LDALGSFKF-TGSNPLEQLGLYMK  466
            G     S + ++ P++   + LG FKF   SNPLEQLGLYMK
Sbjct  620  GVFTDQSFIQDTIPENCDENGLGGFKFPVTSNPLEQLGLYMK  661



>gb|AFW74428.1| hypothetical protein ZEAMMB73_413666 [Zea mays]
Length=757

 Score = 73.6 bits (179),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 142/225 (63%), Gaps = 23/225 (10%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             +S  +  EQS+   P S   DG+  G +S+  +  SP+K  RAALL++RFADTILKAREK
Sbjct  551   LSTLNLPEQSTN--PISVSADGE-GGNVSE--KQVSPDKQIRAALLRSRFADTILKAREK  605

Query  861   TLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe  682
              L Q  K DP++LRRERE LE  +++E+ARLQAEAKAAE+ RKRAE  AAAEA  + + +
Sbjct  606   ALDQTTKKDPEKLRREREELERVQREERARLQAEAKAAEDVRKRAEAAAAAEAAAEAKRQ  665

Query  681   reaarqALLKMEQTVE----INENSRFLEDLEMLRVGPTEQHSSL-NESSPQHSLDALGS  517
             RE  R+A  K  Q +E    INE S FL+DLEML     EQ  +L  E+SP   +     
Sbjct  666   RELEREAARKALQEMEKTVDINEGSHFLKDLEMLGSVTGEQIPNLVGETSPGFQM-----  720

Query  516   FKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
                 GSN LE+LGLYMK D+D E+ +     V     DVEEGEID
Sbjct  721   ----GSNTLEKLGLYMKNDEDDEDGDFTDEPV----ADVEEGEID  757



>ref|XP_008648432.1| PREDICTED: transcription factor GTE9-like [Zea mays]
Length=758

 Score = 73.2 bits (178),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 112/225 (50%), Positives = 142/225 (63%), Gaps = 23/225 (10%)
 Frame = -1

Query  1041  ISLFDQVEQSSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREK  862
             +S  +  EQS+   P S   DG+  G +S+  +  SP+K  RAALL++RFADTILKAREK
Sbjct  552   LSTLNLPEQSTN--PISVSADGE-GGNVSE--KQVSPDKQIRAALLRSRFADTILKAREK  606

Query  861   TLGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraeeeaaaeakrkrefe  682
              L Q  K DP++LRRERE LE  +++E+ARLQAEAKAAE+ RKRAE  AAAEA  + + +
Sbjct  607   ALDQTTKKDPEKLRREREELERVQREERARLQAEAKAAEDVRKRAEAAAAAEAAAEAKRQ  666

Query  681   reaarqALLKMEQTVE----INENSRFLEDLEMLRVGPTEQHSSL-NESSPQHSLDALGS  517
             RE  R+A  K  Q +E    INE S FL+DLEML     EQ  +L  E+SP   +     
Sbjct  667   RELEREAARKALQEMEKTVDINEGSHFLKDLEMLGSVTGEQIPNLVGETSPGFQM-----  721

Query  516   FKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
                 GSN LE+LGLYMK D+D E+ +     V     DVEEGEID
Sbjct  722   ----GSNTLEKLGLYMKNDEDDEDGDFTDEPV----ADVEEGEID  758



>ref|XP_009397772.1| PREDICTED: transcription factor GTE9-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=673

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 109/191 (57%), Gaps = 27/191 (14%)
 Frame = -1

Query  936  SPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaea  757
            SP K  RAA+LK+RFADTILKA++++LG   K DP +L+RERE LE +        + E 
Sbjct  502  SPSKALRAAMLKSRFADTILKAQQQSLGV--KIDPAKLQREREKLEKR-------QREEK  552

Query  756  kaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPT  577
               E   K AE  A  +A+ +   +REAAR AL KME+TVEI+ NS  L+DLE L   P 
Sbjct  553  ARIEAQVKAAEIAAKMKAEAELTRQREAARLALQKMEKTVEID-NSHILKDLENLGC-PL  610

Query  576  EQHSSLNESSPQHSLDALGSF-----KFTG-SNPLEQLGLYMKedddfeeceppPSSVPK  415
              H  + +       + +G F       +G  NPLEQLGL+MK +D  E  E   S+   
Sbjct  611  PGHFDMTD-------ETVGKFMQELEMHSGLVNPLEQLGLFMKNEDLDEVDEWISSA---  660

Query  414  DAKDVEEGEID  382
               DVEEGEID
Sbjct  661  GNGDVEEGEID  671



>ref|XP_009397773.1| PREDICTED: transcription factor GTE9-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 109/191 (57%), Gaps = 27/191 (14%)
 Frame = -1

Query  936  SPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQLRREREVLEMQrkkekarlqaea  757
            SP K  RAA+LK+RFADTILKA++++LG   K DP +L+RERE LE +        + E 
Sbjct  501  SPSKALRAAMLKSRFADTILKAQQQSLGV--KIDPAKLQREREKLEKR-------QREEK  551

Query  756  kaaeearkraeeeaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPT  577
               E   K AE  A  +A+ +   +REAAR AL KME+TVEI+ NS  L+DLE L   P 
Sbjct  552  ARIEAQVKAAEIAAKMKAEAELTRQREAARLALQKMEKTVEID-NSHILKDLENLGC-PL  609

Query  576  EQHSSLNESSPQHSLDALGSF-----KFTG-SNPLEQLGLYMKedddfeeceppPSSVPK  415
              H  + +       + +G F       +G  NPLEQLGL+MK +D  E  E   S+   
Sbjct  610  PGHFDMTD-------ETVGKFMQELEMHSGLVNPLEQLGLFMKNEDLDEVDEWISSA---  659

Query  414  DAKDVEEGEID  382
               DVEEGEID
Sbjct  660  GNGDVEEGEID  670



>ref|NP_001047353.1| Os02g0601800 [Oryza sativa Japonica Group]
 dbj|BAD19337.1| putative global transcription factor group E [Oryza sativa Japonica 
Group]
 dbj|BAD22163.1| putative global transcription factor group E [Oryza sativa Japonica 
Group]
 dbj|BAF09267.1| Os02g0601800 [Oryza sativa Japonica Group]
 gb|EEE57320.1| hypothetical protein OsJ_07416 [Oryza sativa Japonica Group]
Length=714

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 64/94 (68%), Gaps = 5/94 (5%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSNPLEQ  484
            L +ME+TVEIN+N   L+DLEML    TE   SS++E+SP+HS D + SF     NPLEQ
Sbjct  625  LQEMERTVEINDN-LHLKDLEMLGTATTEHIVSSVDETSPEHSQDGMPSFLPGSGNPLEQ  683

Query  483  LGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            LGL+MK   D EE E  PSSVP   KD EEGEI+
Sbjct  684  LGLFMK--ADEEEEEEDPSSVPS-TKDAEEGEIN  714



>gb|EEC73546.1| hypothetical protein OsI_07959 [Oryza sativa Indica Group]
Length=714

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 64/94 (68%), Gaps = 5/94 (5%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSNPLEQ  484
            L +ME+TVEIN+N   L+DLEML    TE   SS++E+SP+HS D + SF     NPLEQ
Sbjct  625  LQEMERTVEINDN-LHLKDLEMLGTATTEHIVSSVDETSPEHSQDGMPSFLPGSGNPLEQ  683

Query  483  LGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            LGL+MK   D EE E  PSSVP   KD EEGEI+
Sbjct  684  LGLFMK--ADEEEEEEDPSSVP-STKDAEEGEIN  714



>ref|XP_010929323.1| PREDICTED: transcription factor GTE9-like isoform X2 [Elaeis 
guineensis]
Length=698

 Score = 71.6 bits (174),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 90/232 (39%), Positives = 126/232 (54%), Gaps = 24/232 (10%)
 Frame = -1

Query  1059  ADGDGVISLFDQVEQSSQQ--KPNSSEFDGQQD----GEISQNDRPASPEKLYRAALLKN  898
             +D DGV  +   + QS      P ++   G+ D    G++S       P K  RAA+LK+
Sbjct  481   SDSDGVSVVDKDIVQSGSHPSSPVTTATKGEVDLLCAGQLS-------PTKALRAAMLKS  533

Query  897   RFADTILKAREKT-LGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraee  721
             RFADTILKA++K  L  GEK DP +L+RERE LE +   ++          + A   A  
Sbjct  534   RFADTILKAQQKALLTHGEKVDPAKLQREREKLEKK---QREEKARIEAEVKAAEAAARM  590

Query  720   eaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQ  541
             +A AE K +RE EREAAR AL KME+TV++ +NS  ++DLE         H  + +    
Sbjct  591   KAEAEMKMQREREREAARLALQKMEKTVDV-DNSHLVKDLEDFGY---PHHLDMPDEVVV  646

Query  540   HSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEI  385
             + +D     +   +NPLEQLGL+MK +   EE +   S+   D  DVEEGEI
Sbjct  647   NFVDGF-ELQTYLANPLEQLGLFMKNEYMDEEVDNWISAT--DNGDVEEGEI  695



>ref|XP_010929315.1| PREDICTED: transcription factor GTE9-like isoform X1 [Elaeis 
guineensis]
Length=703

 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 90/232 (39%), Positives = 126/232 (54%), Gaps = 24/232 (10%)
 Frame = -1

Query  1059  ADGDGVISLFDQVEQSSQQ--KPNSSEFDGQQD----GEISQNDRPASPEKLYRAALLKN  898
             +D DGV  +   + QS      P ++   G+ D    G++S       P K  RAA+LK+
Sbjct  486   SDSDGVSVVDKDIVQSGSHPSSPVTTATKGEVDLLCAGQLS-------PTKALRAAMLKS  538

Query  897   RFADTILKAREKT-LGQGEKGDPDQLRREREVLEMQrkkekarlqaeakaaeearkraee  721
             RFADTILKA++K  L  GEK DP +L+RERE LE +   ++          + A   A  
Sbjct  539   RFADTILKAQQKALLTHGEKVDPAKLQREREKLEKK---QREEKARIEAEVKAAEAAARM  595

Query  720   eaaaeakrkrefereaarqALLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSLNESSPQ  541
             +A AE K +RE EREAAR AL KME+TV++ +NS  ++DLE         H  + +    
Sbjct  596   KAEAEMKMQREREREAARLALQKMEKTVDV-DNSHLVKDLEDFGY---PHHLDMPDEVVV  651

Query  540   HSLDALGSFKFTGSNPLEQLGLYMKedddfeeceppPSSVPKDAKDVEEGEI  385
             + +D     +   +NPLEQLGL+MK +   EE +   S+   D  DVEEGEI
Sbjct  652   NFVDGF-ELQTYLANPLEQLGLFMKNEYMDEEVDNWISAT--DNGDVEEGEI  700



>ref|XP_006647467.1| PREDICTED: transcription factor GTE10-like [Oryza brachyantha]
Length=709

 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 64/94 (68%), Gaps = 5/94 (5%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSNPLEQ  484
            L +ME+TVEIN+N   L+D+EML    TE   SS++E+SP+HS D + SF     NPLEQ
Sbjct  620  LQEMERTVEINDN-LHLKDMEMLGTATTEHIVSSVDETSPEHSQDGMPSFLPGSGNPLEQ  678

Query  483  LGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            LGL+MK   D EE E  PSSVP   KD EEGEI+
Sbjct  679  LGLFMK--ADDEEEEEDPSSVP-STKDAEEGEIN  709



>ref|XP_006647466.1| PREDICTED: transcription factor GTE10-like [Oryza brachyantha]
Length=709

 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 64/94 (68%), Gaps = 5/94 (5%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSNPLEQ  484
            L +ME+TVEIN+N   L+D+EML    TE   SS++E+SP+HS D + SF     NPLEQ
Sbjct  620  LQEMERTVEINDN-LHLKDMEMLGTATTEHIVSSVDETSPEHSQDGMPSFLPGSGNPLEQ  678

Query  483  LGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            LGL+MK   D EE E  PSSVP   KD EEGEI+
Sbjct  679  LGLFMK--ADDEEEEEDPSSVP-STKDAEEGEIN  709



>dbj|BAB41205.1| kinase-like protein [Oryza sativa (japonica cultivar-group)]
Length=714

 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 63/94 (67%), Gaps = 5/94 (5%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQ-HSSLNESSPQHSLDALGSFKFTGSNPLEQ  484
            L +ME+TVEIN+N   L+DLEML    TE   SS++E+SP+HS D + SF     NPLEQ
Sbjct  625  LQEMERTVEINDN-LHLKDLEMLGTATTEHIVSSVDETSPEHSQDGMPSFLPGSGNPLEQ  683

Query  483  LGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            LGL+MK   D EE E  PS VP   KD EEGEI+
Sbjct  684  LGLFMK--ADEEEEEEDPSCVPS-TKDAEEGEIN  714



>emb|CDY48349.1| BnaCnng16110D [Brassica napus]
Length=61

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 39/52 (75%), Gaps = 6/52 (12%)
 Frame = -1

Query  1014  SSQQKPNSSEFDGQQDGEISQNDRPASPEKLYRAALLKNRFADTILKAREKT  859
             SSQQKP+S E DGQ D      + PAS EK YRAALLK++FAD ILKAREKT
Sbjct  4     SSQQKPSSDESDGQHD------ETPASSEKQYRAALLKSKFADIILKAREKT  49



>ref|XP_010234272.1| PREDICTED: transcription factor GTE9-like isoform X1 [Brachypodium 
distachyon]
Length=778

 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 59/94 (63%), Gaps = 6/94 (6%)
 Frame = -1

Query  660  LLKMEQTVEINENSRFLEDLEMLRVGPTEQHSSL-NESSPQHSLDALGSFKFTGSNPLEQ  484
            L +ME+TVEINE S FL+D EML     EQH  L  E +P H+ + LG F+  G NPLEQ
Sbjct  690  LQQMEKTVEINEGSLFLKDFEMLGTVAGEQHPDLVGEMNPTHTPEGLG-FQL-GGNPLEQ  747

Query  483  LGLYMKedddfeeceppPSSVPKDAKDVEEGEID  382
            LGLYMK   + +E +    S  +   DVEEGEID
Sbjct  748  LGLYMK---NDDEEDEEVGSAYEPTVDVEEGEID  778


 Score = 55.1 bits (131),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = -1

Query  939  ASPEKLYRAALLKNRFADTILKAREKTLGQGEKGDPDQL  823
             SP+K YRAALLK+RFADTILKAREK L Q  + DP+++
Sbjct  593  VSPDKKYRAALLKSRFADTILKAREKALDQVAQKDPEKV  631



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2991375847720