BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9704

Length=744
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006362349.1|  PREDICTED: vacuolar-sorting receptor 1-like        224   6e-65   Solanum tuberosum [potatoes]
ref|XP_009801642.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    219   3e-63   Nicotiana sylvestris
ref|XP_010327707.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    219   5e-63   Solanum lycopersicum
ref|XP_009611966.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    219   6e-63   Nicotiana tomentosiformis
emb|CDP06387.1|  unnamed protein product                                216   6e-62   Coffea canephora [robusta coffee]
ref|XP_010327706.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    215   1e-61   Solanum lycopersicum
ref|XP_009801640.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    213   8e-61   Nicotiana sylvestris
ref|XP_010253065.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    213   8e-61   Nelumbo nucifera [Indian lotus]
ref|XP_009611965.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    213   1e-60   Nicotiana tomentosiformis
ref|XP_009611473.1|  PREDICTED: vacuolar-sorting receptor 1-like        212   2e-60   Nicotiana tomentosiformis
ref|XP_011095146.1|  PREDICTED: vacuolar-sorting receptor 1-like        211   4e-60   Sesamum indicum [beniseed]
ref|XP_009775401.1|  PREDICTED: vacuolar-sorting receptor 1-like        210   9e-60   Nicotiana sylvestris
gb|EYU42029.1|  hypothetical protein MIMGU_mgv1a002928mg                210   1e-59   Erythranthe guttata [common monkey flower]
emb|CAN66483.1|  hypothetical protein VITISV_015390                     208   6e-59   Vitis vinifera
ref|XP_002267833.2|  PREDICTED: vacuolar-sorting receptor 1             207   1e-58   Vitis vinifera
gb|ACS91931.1|  vacuolar sorting receptor protein                       206   2e-58   Lilium longiflorum [Easter lily]
ref|NP_001275302.1|  vacuolar sorting receptor protein PV72-like ...    205   7e-58   Solanum tuberosum [potatoes]
gb|KGN58685.1|  hypothetical protein Csa_3G728020                       192   9e-58   Cucumis sativus [cucumbers]
ref|XP_008788526.1|  PREDICTED: vacuolar-sorting receptor 1-like        204   2e-57   Phoenix dactylifera
ref|XP_004246285.1|  PREDICTED: vacuolar-sorting receptor 1-like        202   7e-57   Solanum lycopersicum
ref|XP_010922756.1|  PREDICTED: vacuolar-sorting receptor 1-like        200   4e-56   
ref|XP_002309184.1|  vacuolar sorting receptor family protein           200   4e-56   Populus trichocarpa [western balsam poplar]
ref|XP_011086922.1|  PREDICTED: vacuolar-sorting receptor 1-like        199   2e-55   Sesamum indicum [beniseed]
ref|XP_004302536.1|  PREDICTED: vacuolar-sorting receptor 1-like        198   3e-55   Fragaria vesca subsp. vesca
ref|XP_006842496.1|  PREDICTED: vacuolar-sorting receptor 1             198   3e-55   Amborella trichopoda
ref|XP_011019003.1|  PREDICTED: vacuolar-sorting receptor 1-like        197   5e-55   Populus euphratica
ref|XP_008792241.1|  PREDICTED: vacuolar-sorting receptor 1-like        197   6e-55   Phoenix dactylifera
ref|XP_007207200.1|  hypothetical protein PRUPE_ppa002877mg             196   2e-54   Prunus persica
ref|XP_010931377.1|  PREDICTED: vacuolar-sorting receptor 1-like        196   2e-54   Elaeis guineensis
ref|XP_006663158.1|  PREDICTED: vacuolar-sorting receptor 1-like        196   3e-54   Oryza brachyantha
ref|XP_006664280.1|  PREDICTED: vacuolar-sorting receptor 1-like        196   3e-54   Oryza brachyantha
ref|XP_006429591.1|  hypothetical protein CICLE_v10011298mg             195   3e-54   Citrus clementina [clementine]
gb|EEE52644.1|  hypothetical protein OsJ_35003                          194   3e-54   Oryza sativa Japonica Group [Japonica rice]
gb|ACN25155.1|  unknown                                                 188   4e-54   Zea mays [maize]
ref|XP_006374052.1|  hypothetical protein POPTR_0016s14430g             193   6e-54   
gb|EEE51529.1|  hypothetical protein OsJ_32728                          194   6e-54   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67546.1|  hypothetical protein OsI_34875                          194   6e-54   Oryza sativa Indica Group [Indian rice]
gb|EEC68730.1|  hypothetical protein OsI_37233                          194   7e-54   Oryza sativa Indica Group [Indian rice]
ref|XP_011001696.1|  PREDICTED: vacuolar-sorting receptor 1-like        192   1e-53   Populus euphratica
ref|NP_001065992.1|  Os12g0116000                                       194   2e-53   
pir||T00044  vacuolar sorting receptor protein homolog PV72 - cuc...    193   2e-53
ref|XP_004137673.1|  PREDICTED: vacuolar-sorting receptor 1             192   3e-53   Cucumis sativus [cucumbers]
ref|XP_011002594.1|  PREDICTED: vacuolar-sorting receptor 1-like        192   4e-53   Populus euphratica
ref|XP_008669942.1|  PREDICTED: vacuolar-sorting receptor 1-like        191   1e-52   Zea mays [maize]
ref|XP_004977384.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    191   1e-52   
gb|EMS62484.1|  Vacuolar-sorting receptor 1                             192   3e-52   Triticum urartu
ref|XP_010043186.1|  PREDICTED: vacuolar-sorting receptor 1-like        190   3e-52   Eucalyptus grandis [rose gum]
ref|XP_002450144.1|  hypothetical protein SORBIDRAFT_05g001160          189   4e-52   Sorghum bicolor [broomcorn]
gb|EMT24279.1|  Vacuolar-sorting receptor 1                             189   6e-52   
ref|XP_004978527.1|  PREDICTED: vacuolar-sorting receptor 1-like        189   6e-52   
ref|XP_010252052.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    187   6e-52   
ref|XP_002528694.1|  Vacuolar sorting receptor 1 precursor, putative    189   7e-52   Ricinus communis
gb|AAF22842.1|AF209910_1  vacuolar sorting receptor protein             177   7e-52   Prunus dulcis [sweet almond]
tpg|DAA39323.1|  TPA: hypothetical protein ZEAMMB73_720222              189   8e-52   
ref|XP_010093546.1|  Vacuolar-sorting receptor 1                        188   1e-51   Morus notabilis
gb|KHG15071.1|  Vacuolar-sorting receptor 3 -like protein               184   2e-51   Gossypium arboreum [tree cotton]
ref|XP_007033521.1|  Vacuolar sorting receptor isoform 1                188   2e-51   
ref|XP_008677615.1|  PREDICTED: uncharacterized protein LOC100383...    187   2e-51   
dbj|BAK03786.1|  predicted protein                                      188   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010252051.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    187   3e-51   Nelumbo nucifera [Indian lotus]
gb|KHG14060.1|  Vacuolar-sorting receptor 1 -like protein               187   3e-51   Gossypium arboreum [tree cotton]
ref|XP_009384326.1|  PREDICTED: vacuolar-sorting receptor 1-like        187   4e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR17683.1|  unknown                                                 186   6e-51   Picea sitchensis
gb|KJB71519.1|  hypothetical protein B456_011G126800                    186   6e-51   Gossypium raimondii
gb|KJB32252.1|  hypothetical protein B456_005G231800                    186   8e-51   Gossypium raimondii
ref|XP_008348888.1|  PREDICTED: vacuolar-sorting receptor 3-like        186   8e-51   
ref|XP_009349164.1|  PREDICTED: vacuolar-sorting receptor 3-like        186   9e-51   Pyrus x bretschneideri [bai li]
ref|XP_009375671.1|  PREDICTED: vacuolar-sorting receptor 3-like        186   9e-51   
gb|EMT19677.1|  Vacuolar-sorting receptor 1                             185   1e-50   
gb|EYU35791.1|  hypothetical protein MIMGU_mgv1a002876mg                184   3e-50   Erythranthe guttata [common monkey flower]
ref|XP_010529937.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    184   3e-50   Tarenaya hassleriana [spider flower]
gb|KHG23770.1|  Vacuolar-sorting receptor 1 -like protein               184   3e-50   Gossypium arboreum [tree cotton]
ref|XP_008236323.1|  PREDICTED: vacuolar-sorting receptor 3             184   4e-50   Prunus mume [ume]
ref|XP_012091044.1|  PREDICTED: vacuolar-sorting receptor 1-like        184   5e-50   Jatropha curcas
gb|KJB29888.1|  hypothetical protein B456_005G122400                    183   8e-50   Gossypium raimondii
ref|XP_004136938.1|  PREDICTED: vacuolar-sorting receptor 3-like        183   8e-50   Cucumis sativus [cucumbers]
ref|XP_003610620.1|  Vacuolar-sorting receptor                          183   8e-50   
ref|XP_008455032.1|  PREDICTED: vacuolar-sorting receptor 3-like        183   9e-50   Cucumis melo [Oriental melon]
gb|KJB79450.1|  hypothetical protein B456_013G050300                    183   9e-50   Gossypium raimondii
ref|XP_007042633.1|  Vaculolar sorting receptor 3 isoform 1             183   1e-49   Theobroma cacao [chocolate]
dbj|BAK00302.1|  predicted protein                                      182   1e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003579018.1|  PREDICTED: vacuolar-sorting receptor 1             182   2e-49   Brachypodium distachyon [annual false brome]
ref|XP_010272410.1|  PREDICTED: vacuolar-sorting receptor 3-like        182   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_002264769.1|  PREDICTED: vacuolar-sorting receptor 3             182   2e-49   Vitis vinifera
emb|CBI22461.3|  unnamed protein product                                182   3e-49   Vitis vinifera
ref|XP_004152276.1|  PREDICTED: vacuolar-sorting receptor 4 isofo...    182   3e-49   Cucumis sativus [cucumbers]
ref|XP_011652916.1|  PREDICTED: vacuolar-sorting receptor 4 isofo...    182   3e-49   Cucumis sativus [cucumbers]
ref|XP_009410512.1|  PREDICTED: vacuolar-sorting receptor 1             181   3e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHF97360.1|  Vacuolar-sorting receptor 3 -like protein               181   3e-49   Gossypium arboreum [tree cotton]
gb|AEZ00905.1|  putative BP-80 vacuolar sorting receptor protein        173   4e-49   Elaeis guineensis
gb|KJB12291.1|  hypothetical protein B456_002G010300                    181   5e-49   Gossypium raimondii
ref|XP_007157213.1|  hypothetical protein PHAVU_002G052000g             181   5e-49   Phaseolus vulgaris [French bean]
gb|KJB12292.1|  hypothetical protein B456_002G010300                    181   5e-49   Gossypium raimondii
ref|XP_008442315.1|  PREDICTED: vacuolar-sorting receptor 1             181   5e-49   Cucumis melo [Oriental melon]
ref|XP_006300216.1|  hypothetical protein CARUB_v10016452mg             181   6e-49   Capsella rubella
ref|XP_008244809.1|  PREDICTED: vacuolar-sorting receptor 1-like        181   6e-49   Prunus mume [ume]
gb|AGV54776.1|  vacuolar-sorting receptor                               181   6e-49   Phaseolus vulgaris [French bean]
ref|XP_009760191.1|  PREDICTED: vacuolar-sorting receptor 3-like        181   7e-49   Nicotiana sylvestris
ref|XP_010488908.1|  PREDICTED: vacuolar-sorting receptor 4             181   7e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010517675.1|  PREDICTED: vacuolar-sorting receptor 4-like        181   7e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010467255.1|  PREDICTED: vacuolar-sorting receptor 4-like        181   7e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002527509.1|  zinc finger protein, putative                      181   7e-49   Ricinus communis
ref|XP_008805693.1|  PREDICTED: vacuolar-sorting receptor 3-like        180   1e-48   Phoenix dactylifera
ref|XP_004511312.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    180   1e-48   Cicer arietinum [garbanzo]
gb|EEC82690.1|  hypothetical protein OsI_27347                          180   1e-48   Oryza sativa Indica Group [Indian rice]
ref|NP_001060643.1|  Os07g0680000                                       180   1e-48   
ref|XP_008454392.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    180   1e-48   Cucumis melo [Oriental melon]
ref|XP_008454393.1|  PREDICTED: vacuolar-sorting receptor 4-like ...    180   2e-48   Cucumis melo [Oriental melon]
ref|XP_004511311.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    180   2e-48   
ref|XP_007199755.1|  hypothetical protein PRUPE_ppa002822mg             179   2e-48   Prunus persica
gb|EMS63262.1|  Vacuolar-sorting receptor 1                             181   2e-48   Triticum urartu
ref|NP_179079.1|  vacuolar-sorting receptor 4                           179   2e-48   Arabidopsis thaliana [mouse-ear cress]
gb|KHN30433.1|  Vacuolar-sorting receptor 1                             179   2e-48   Glycine soja [wild soybean]
ref|XP_010529936.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    179   2e-48   Tarenaya hassleriana [spider flower]
ref|XP_003517598.2|  PREDICTED: vacuolar-sorting receptor 1-like ...    179   2e-48   Glycine max [soybeans]
ref|XP_006658133.1|  PREDICTED: vacuolar-sorting receptor 1-like        179   2e-48   Oryza brachyantha
gb|AAB72112.1|  vacuolar sorting receptor homolog                       179   3e-48   Arabidopsis thaliana [mouse-ear cress]
emb|CDY65441.1|  BnaCnng47180D                                          179   3e-48   Brassica napus [oilseed rape]
gb|KHN05603.1|  Vacuolar-sorting receptor 1                             178   4e-48   Glycine soja [wild soybean]
ref|XP_003538018.1|  PREDICTED: vacuolar-sorting receptor 1-like        178   4e-48   Glycine max [soybeans]
ref|XP_011030346.1|  PREDICTED: vacuolar-sorting receptor 3-like        178   5e-48   Populus euphratica
ref|XP_002883854.1|  hypothetical protein ARALYDRAFT_899691             178   5e-48   
ref|XP_009598407.1|  PREDICTED: vacuolar-sorting receptor 3-like        178   5e-48   Nicotiana tomentosiformis
ref|XP_006409638.1|  hypothetical protein EUTSA_v10022598mg             178   6e-48   Eutrema salsugineum [saltwater cress]
emb|CDY37219.1|  BnaA09g08400D                                          178   6e-48   Brassica napus [oilseed rape]
ref|XP_009123210.1|  PREDICTED: vacuolar-sorting receptor 3-like        178   7e-48   Brassica rapa
emb|CDX93144.1|  BnaA03g38660D                                          177   7e-48   
ref|XP_010065899.1|  PREDICTED: vacuolar-sorting receptor 1-like        178   7e-48   Eucalyptus grandis [rose gum]
ref|XP_009136249.1|  PREDICTED: vacuolar-sorting receptor 3             177   8e-48   Brassica rapa
ref|XP_006297095.1|  hypothetical protein CARUB_v10013097mg             178   9e-48   
gb|KFK39979.1|  hypothetical protein AALP_AA3G314200                    177   9e-48   Arabis alpina [alpine rockcress]
ref|XP_006422827.1|  hypothetical protein CICLE_v10028015mg             177   1e-47   Citrus clementina [clementine]
ref|XP_009372030.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    177   1e-47   Pyrus x bretschneideri [bai li]
ref|XP_011092498.1|  PREDICTED: vacuolar-sorting receptor 3-like        177   1e-47   Sesamum indicum [beniseed]
ref|XP_006409641.1|  hypothetical protein EUTSA_v10022594mg             177   1e-47   Eutrema salsugineum [saltwater cress]
ref|NP_179081.1|  vacuolar-sorting receptor 3                           177   1e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002298772.1|  hypothetical protein POPTR_0001s30160g             177   1e-47   Populus trichocarpa [western balsam poplar]
gb|KJB29886.1|  hypothetical protein B456_005G122400                    177   1e-47   Gossypium raimondii
gb|KHN06808.1|  Vacuolar-sorting receptor 1                             177   1e-47   Glycine soja [wild soybean]
ref|XP_004230700.1|  PREDICTED: vacuolar-sorting receptor 3             177   1e-47   Solanum lycopersicum
gb|KJB29887.1|  hypothetical protein B456_005G122400                    177   1e-47   Gossypium raimondii
ref|XP_003536576.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    177   2e-47   Glycine max [soybeans]
emb|CDY38158.1|  BnaA07g02250D                                          171   2e-47   Brassica napus [oilseed rape]
ref|XP_012093114.1|  PREDICTED: vacuolar-sorting receptor 3             177   2e-47   Jatropha curcas
emb|CDY62642.1|  BnaCnng40690D                                          165   2e-47   Brassica napus [oilseed rape]
emb|CDX81459.1|  BnaC09g08700D                                          176   2e-47   
gb|ERN10922.1|  hypothetical protein AMTR_s00164p00059220               176   2e-47   Amborella trichopoda
emb|CDO97275.1|  unnamed protein product                                176   2e-47   Coffea canephora [robusta coffee]
ref|XP_006346308.1|  PREDICTED: vacuolar-sorting receptor 3-like        176   2e-47   Solanum tuberosum [potatoes]
ref|XP_010488909.1|  PREDICTED: vacuolar-sorting receptor 3             176   2e-47   Camelina sativa [gold-of-pleasure]
ref|XP_006849341.2|  PREDICTED: vacuolar-sorting receptor 3 isofo...    176   3e-47   Amborella trichopoda
ref|XP_008370266.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    176   4e-47   
ref|XP_002885935.1|  VSR-2                                              176   4e-47   
gb|KDO57884.1|  hypothetical protein CISIN_1g006786mg                   176   5e-47   Citrus sinensis [apfelsine]
gb|KDO57885.1|  hypothetical protein CISIN_1g006786mg                   176   5e-47   Citrus sinensis [apfelsine]
ref|XP_006486921.1|  PREDICTED: vacuolar-sorting receptor 3-like        176   5e-47   Citrus sinensis [apfelsine]
gb|KHN42313.1|  Vacuolar-sorting receptor 1                             175   5e-47   Glycine soja [wild soybean]
ref|XP_003555992.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    175   5e-47   Glycine max [soybeans]
ref|XP_008384516.1|  PREDICTED: vacuolar-sorting receptor 3-like        175   5e-47   
ref|XP_010517715.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    175   5e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010517708.1|  PREDICTED: vacuolar-sorting receptor 3-like ...    175   6e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010467256.1|  PREDICTED: vacuolar-sorting receptor 3-like        175   7e-47   Camelina sativa [gold-of-pleasure]
ref|XP_011457866.1|  PREDICTED: vacuolar-sorting receptor 3             175   8e-47   Fragaria vesca subsp. vesca
gb|AAB72113.1|  vacuolar sorting receptor homolog                       164   8e-47   
ref|XP_008370265.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    174   1e-46   
gb|KFK24686.1|  hypothetical protein AALP_AA8G011700                    174   1e-46   Arabis alpina [alpine rockcress]
dbj|BAK05589.1|  predicted protein                                      175   1e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS68621.1|  Vacuolar-sorting receptor 4                             167   1e-46   Triticum urartu
gb|EPS73119.1|  hypothetical protein M569_01632                         174   1e-46   Genlisea aurea
gb|KDO64104.1|  hypothetical protein CISIN_1g0100102mg                  162   1e-46   Citrus sinensis [apfelsine]
ref|XP_009372028.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    174   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_008388357.1|  PREDICTED: vacuolar-sorting receptor 1-like        174   2e-46   
emb|CDY04821.1|  BnaAnng00030D                                          174   2e-46   
ref|XP_006398566.1|  hypothetical protein EUTSA_v10015537mg             174   2e-46   
ref|XP_006650048.1|  PREDICTED: vacuolar-sorting receptor 1-like        174   2e-46   Oryza brachyantha
ref|XP_002489188.1|  hypothetical protein SORBIDRAFT_0013s004010        163   2e-46   
ref|XP_010942821.1|  PREDICTED: vacuolar-sorting receptor 1-like        174   2e-46   Elaeis guineensis
sp|P93484.1|VSR1_PEA  RecName: Full=Vacuolar-sorting receptor 1; ...    173   3e-46   Pisum sativum [garden pea]
ref|NP_001189637.1|  vacuolar-sorting receptor 2                        173   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180588.1|  vacuolar-sorting receptor 2                           173   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011001937.1|  PREDICTED: vacuolar-sorting receptor 3             173   3e-46   Populus euphratica
ref|XP_009404782.1|  PREDICTED: vacuolar-sorting receptor 4-like        173   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT02959.1|  Vacuolar-sorting receptor 4                             172   3e-46   
gb|EMS51356.1|  Vacuolar-sorting receptor 1                             173   3e-46   Triticum urartu
ref|XP_010036004.1|  PREDICTED: vacuolar-sorting receptor 1-like        173   4e-46   Eucalyptus grandis [rose gum]
ref|XP_010938945.1|  PREDICTED: vacuolar-sorting receptor 3-like        173   4e-46   Elaeis guineensis
ref|XP_010277061.1|  PREDICTED: vacuolar-sorting receptor 3-like        173   4e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010414284.1|  PREDICTED: vacuolar-sorting receptor 2             172   5e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010510382.1|  PREDICTED: vacuolar-sorting receptor 2-like        172   5e-46   Camelina sativa [gold-of-pleasure]
ref|NP_001050034.1|  Os03g0335300                                       172   5e-46   
gb|KFK39977.1|  hypothetical protein AALP_AA3G313900                    172   6e-46   Arabis alpina [alpine rockcress]
ref|XP_002881098.1|  hypothetical protein ARALYDRAFT_481940             172   6e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_010469873.1|  PREDICTED: vacuolar-sorting receptor 2-like        172   7e-46   Camelina sativa [gold-of-pleasure]
ref|XP_004496877.1|  PREDICTED: vacuolar-sorting receptor 1-like        172   8e-46   Cicer arietinum [garbanzo]
ref|XP_011625221.1|  PREDICTED: vacuolar-sorting receptor 3 isofo...    172   9e-46   
ref|XP_010683480.1|  PREDICTED: vacuolar-sorting receptor 1-like        172   9e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010111675.1|  Vacuolar-sorting receptor 3                        172   1e-45   Morus notabilis
gb|EYU37571.1|  hypothetical protein MIMGU_mgv1a002851mg                171   1e-45   Erythranthe guttata [common monkey flower]
ref|XP_006296113.1|  hypothetical protein CARUB_v10025264mg             171   1e-45   
ref|XP_002968618.1|  hypothetical protein SELMODRAFT_440462             171   2e-45   Selaginella moellendorffii
ref|XP_007143116.1|  hypothetical protein PHAVU_007G045100g             171   2e-45   Phaseolus vulgaris [French bean]
ref|XP_002975863.1|  hypothetical protein SELMODRAFT_175218             171   2e-45   
gb|EAY78120.1|  hypothetical protein OsI_33166                          162   3e-45   Oryza sativa Indica Group [Indian rice]
gb|ACR34782.1|  unknown                                                 165   3e-45   Zea mays [maize]
gb|AES62774.2|  vacuolar-sorting receptor-like protein                  170   3e-45   Medicago truncatula
ref|XP_003592523.1|  Vacuolar-sorting receptor                          170   3e-45   
ref|XP_010547949.1|  PREDICTED: vacuolar-sorting receptor 3-like        170   3e-45   Tarenaya hassleriana [spider flower]
ref|XP_002313909.1|  vacuolar sorting receptor protein BP-80            170   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_010547948.1|  PREDICTED: vacuolar-sorting receptor 3             170   4e-45   Tarenaya hassleriana [spider flower]
ref|XP_010687358.1|  PREDICTED: vacuolar-sorting receptor 4-like        168   2e-44   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010426913.1|  PREDICTED: vacuolar-sorting receptor 1-like        168   2e-44   Camelina sativa [gold-of-pleasure]
ref|XP_002967764.1|  hypothetical protein SELMODRAFT_169577             167   3e-44   Selaginella moellendorffii
ref|XP_002992389.1|  hypothetical protein SELMODRAFT_269926             167   3e-44   
ref|XP_008779827.1|  PREDICTED: vacuolar-sorting receptor 4-like        157   3e-44   
ref|XP_011088070.1|  PREDICTED: vacuolar-sorting receptor 3-like        167   4e-44   Sesamum indicum [beniseed]
ref|XP_010504032.1|  PREDICTED: vacuolar-sorting receptor 1             167   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010515761.1|  PREDICTED: vacuolar-sorting receptor 1-like        167   4e-44   
ref|NP_001064400.1|  Os10g0346600                                       167   4e-44   
ref|XP_003521852.1|  PREDICTED: vacuolar-sorting receptor 1-like        167   4e-44   Glycine max [soybeans]
gb|KHN42141.1|  Vacuolar-sorting receptor 2                             167   4e-44   Glycine soja [wild soybean]
ref|XP_003626680.1|  Vacuolar sorting receptor                          167   4e-44   Medicago truncatula
ref|NP_190853.1|  vacuolar-sorting receptor 1                           167   5e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAB72111.1|  vacuolar sorting receptor homolog                       167   5e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010233902.1|  PREDICTED: vacuolar-sorting receptor 1-like        167   5e-44   Brachypodium distachyon [annual false brome]
gb|AAK82551.1|  AT3g52850/F8J2_20                                       167   5e-44   Arabidopsis thaliana [mouse-ear cress]
emb|CDX78128.1|  BnaA09g33230D                                          166   8e-44   
ref|XP_006411071.1|  hypothetical protein EUTSA_v10016384mg             166   1e-43   Eutrema salsugineum [saltwater cress]
ref|XP_006403761.1|  hypothetical protein EUTSA_v10010181mg             166   1e-43   Eutrema salsugineum [saltwater cress]
ref|XP_004984464.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    166   1e-43   
ref|XP_006290748.1|  hypothetical protein CARUB_v10016844mg             166   2e-43   Capsella rubella
emb|CDX73599.1|  BnaC08g24040D                                          166   2e-43   
ref|XP_004984466.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    165   2e-43   Setaria italica
ref|XP_004984463.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    166   2e-43   
gb|KFK34530.1|  hypothetical protein AALP_AA5G158000                    165   2e-43   Arabis alpina [alpine rockcress]
ref|XP_004984465.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    165   2e-43   
emb|CDX67539.1|  BnaA07g15790D                                          165   2e-43   
gb|AAF80450.1|AF161719_1  vacuolar targeting receptor bp-80             165   3e-43   Triticum aestivum [Canadian hard winter wheat]
emb|CDY13344.1|  BnaC06g14130D                                          165   3e-43   Brassica napus [oilseed rape]
ref|XP_009125234.1|  PREDICTED: vacuolar-sorting receptor 1-like        165   3e-43   Brassica rapa
ref|XP_002876170.1|  hypothetical protein ARALYDRAFT_906663             165   3e-43   Arabidopsis lyrata subsp. lyrata
ref|NP_001292791.1|  vacuolar sorting receptor homolog1 precursor       164   4e-43   Zea mays [maize]
ref|XP_003529053.2|  PREDICTED: vacuolar-sorting receptor 1-like        164   7e-43   Glycine max [soybeans]
dbj|BAJ85815.1|  predicted protein                                      161   8e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002467906.1|  hypothetical protein SORBIDRAFT_01g036170          163   9e-43   Sorghum bicolor [broomcorn]
ref|XP_009115984.1|  PREDICTED: vacuolar-sorting receptor 1             163   1e-42   Brassica rapa
ref|XP_007140077.1|  hypothetical protein PHAVU_008G082200g             162   2e-42   Phaseolus vulgaris [French bean]
ref|XP_004492565.1|  PREDICTED: vacuolar-sorting receptor 1-like        162   3e-42   Cicer arietinum [garbanzo]
ref|XP_010228654.1|  PREDICTED: vacuolar-sorting receptor 1-like        162   4e-42   Brachypodium distachyon [annual false brome]
gb|AAN05373.1|  Putative vacuolar sorting receptor protein              161   6e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002463394.1|  hypothetical protein SORBIDRAFT_02g043010          160   8e-42   Sorghum bicolor [broomcorn]
ref|XP_007134557.1|  hypothetical protein PHAVU_010G057200g             160   8e-42   Phaseolus vulgaris [French bean]
ref|XP_009421105.1|  PREDICTED: vacuolar-sorting receptor 3-like        160   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009125765.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    159   4e-41   Brassica rapa
ref|NP_001169232.1|  hypothetical protein precursor                     159   4e-41   Zea mays [maize]
ref|XP_004959891.1|  PREDICTED: vacuolar-sorting receptor 1-like        157   2e-40   
ref|XP_003552313.1|  PREDICTED: vacuolar-sorting receptor 1-like        156   4e-40   Glycine max [soybeans]
gb|KHN40635.1|  Vacuolar-sorting receptor 1                             156   4e-40   Glycine soja [wild soybean]
dbj|BAB64531.1|  vacuolar sorting receptor                              155   5e-40   Vigna mungo [urad dal]
gb|ACN30885.1|  unknown                                                 155   6e-40   Zea mays [maize]
ref|NP_001130741.1|  uncharacterized protein LOC100191845 precursor     155   6e-40   Zea mays [maize]
ref|XP_006661708.1|  PREDICTED: vacuolar-sorting receptor 3-like        155   8e-40   Oryza brachyantha
ref|XP_009143376.1|  PREDICTED: vacuolar-sorting receptor 1-like        155   8e-40   Brassica rapa
emb|CDX91478.1|  BnaC04g06720D                                          155   9e-40   
emb|CDY60753.1|  BnaA05g34780D                                          155   9e-40   Brassica napus [oilseed rape]
ref|XP_004510100.1|  PREDICTED: vacuolar-sorting receptor 1-like        154   1e-39   Cicer arietinum [garbanzo]
ref|XP_004983263.1|  PREDICTED: vacuolar-sorting receptor 3-like        154   2e-39   Setaria italica
ref|XP_003623631.1|  Vacuolar sorting receptor                          153   3e-39   Medicago truncatula
ref|XP_010543160.1|  PREDICTED: vacuolar-sorting receptor 2             153   5e-39   Tarenaya hassleriana [spider flower]
ref|XP_001765481.1|  predicted protein                                  152   7e-39   
ref|XP_002528135.1|  hypothetical protein RCOM_1195900                  144   1e-38   
gb|EPS72755.1|  hypothetical protein M569_02000                         150   2e-38   Genlisea aurea
ref|XP_001777810.1|  predicted protein                                  150   4e-38   
ref|XP_001785165.1|  predicted protein                                  149   9e-38   
ref|XP_003534638.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    148   2e-37   Glycine max [soybeans]
gb|ACG44286.1|  vacuolar sorting receptor 3 precursor                   144   5e-36   Zea mays [maize]
gb|EPS57970.1|  hypothetical protein M569_16845                         144   5e-36   Genlisea aurea
ref|XP_001776090.1|  predicted protein                                  142   2e-35   
ref|XP_010260770.1|  PREDICTED: vacuolar-sorting receptor 7             142   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_006306993.1|  hypothetical protein CARUB_v10008569mg             142   3e-35   Capsella rubella
gb|ABR17707.1|  unknown                                                 142   5e-35   
ref|XP_003573873.1|  PREDICTED: vacuolar-sorting receptor 1-like        141   6e-35   
ref|XP_002890913.1|  hypothetical protein ARALYDRAFT_313733             141   7e-35   
ref|XP_002275462.3|  PREDICTED: vacuolar-sorting receptor 6-like        141   8e-35   
ref|XP_006653756.1|  PREDICTED: vacuolar-sorting receptor 6-like        140   8e-35   
emb|CDY02347.1|  BnaA09g25550D                                          140   2e-34   
ref|XP_009115026.1|  PREDICTED: vacuolar-sorting receptor 6             140   2e-34   
emb|CDY43178.1|  BnaCnng11060D                                          140   2e-34   
emb|CBI27239.3|  unnamed protein product                                142   3e-34   
ref|XP_012065972.1|  PREDICTED: vacuolar-sorting receptor 6-like        139   3e-34   
gb|EMT18407.1|  Vacuolar-sorting receptor 1                             138   6e-34   
ref|XP_006415395.1|  hypothetical protein EUTSA_v10007059mg             138   7e-34   
gb|AAG60258.1|  EGF receptor-like protein                               136   7e-34   
gb|KFK41675.1|  hypothetical protein AALP_AA2G158300                    138   1e-33   
ref|XP_010499644.1|  PREDICTED: vacuolar-sorting receptor 6-like        137   1e-33   
ref|XP_010478532.1|  PREDICTED: vacuolar-sorting receptor 6             137   1e-33   
gb|EEE61664.1|  hypothetical protein OsJ_16123                          137   1e-33   
ref|NP_174375.1|  vacuolar sorting receptor 6                           137   2e-33   
ref|NP_001053838.1|  Os04g0611400                                       137   2e-33   
ref|XP_004293795.1|  PREDICTED: vacuolar-sorting receptor 6             137   2e-33   
ref|XP_010519023.1|  PREDICTED: LOW QUALITY PROTEIN: vacuolar-sor...    137   2e-33   
emb|CAE03573.2|  OSJNBa0085I10.18                                       137   2e-33   
ref|XP_001759820.1|  predicted protein                                  137   2e-33   
ref|XP_003546387.1|  PREDICTED: vacuolar-sorting receptor 6-like        136   4e-33   
ref|XP_010100622.1|  Vacuolar-sorting receptor 6                        136   5e-33   
ref|XP_011096860.1|  PREDICTED: vacuolar-sorting receptor 6             136   6e-33   
ref|XP_001759928.1|  predicted protein                                  135   8e-33   
ref|XP_009393260.1|  PREDICTED: vacuolar-sorting receptor 6             135   9e-33   
gb|KHN26599.1|  Vacuolar-sorting receptor 6                             135   9e-33   
ref|XP_011022310.1|  PREDICTED: vacuolar-sorting receptor 6             135   1e-32   
ref|XP_003534862.1|  PREDICTED: vacuolar-sorting receptor 6-like        135   1e-32   
ref|XP_006448592.1|  hypothetical protein CICLE_v10014573mg             135   2e-32   
ref|XP_006448590.1|  hypothetical protein CICLE_v10014573mg             134   2e-32   
ref|XP_004976775.1|  PREDICTED: vacuolar-sorting receptor 6-like        134   2e-32   
ref|XP_010460907.1|  PREDICTED: vacuolar-sorting receptor 6-like        134   2e-32   
ref|XP_002879526.1|  hypothetical protein ARALYDRAFT_321210             134   3e-32   
gb|EEC81131.1|  hypothetical protein OsI_24020                          134   3e-32   
ref|XP_003581645.1|  PREDICTED: vacuolar-sorting receptor 7-like        134   3e-32   
gb|KJB32254.1|  hypothetical protein B456_005G231800                    133   3e-32   
ref|XP_010914289.1|  PREDICTED: vacuolar-sorting receptor 6             134   4e-32   
ref|XP_009368555.1|  PREDICTED: vacuolar-sorting receptor 7-like        134   4e-32   
ref|XP_002297915.2|  hypothetical protein POPTR_0001s12220g             134   4e-32   
ref|XP_008383256.1|  PREDICTED: vacuolar-sorting receptor 6-like        133   4e-32   
ref|XP_006468586.1|  PREDICTED: vacuolar-sorting receptor 6-like        134   4e-32   
ref|XP_008802338.1|  PREDICTED: vacuolar-sorting receptor 6-like        133   4e-32   
ref|XP_010537030.1|  PREDICTED: vacuolar-sorting receptor 7             133   5e-32   
ref|XP_009340258.1|  PREDICTED: vacuolar-sorting receptor 6-like        133   5e-32   
ref|XP_006853456.1|  PREDICTED: vacuolar-sorting receptor 6             133   5e-32   
ref|XP_006295863.1|  hypothetical protein CARUB_v10024993mg             133   5e-32   
gb|KEH37345.1|  vacuolar-sorting receptor                               133   6e-32   
ref|XP_002304606.1|  vacuolar sorting receptor family protein           133   6e-32   
ref|XP_009363270.1|  PREDICTED: vacuolar-sorting receptor 6-like        133   6e-32   
ref|XP_006656342.1|  PREDICTED: vacuolar-sorting receptor 6-like        133   6e-32   
ref|XP_009141412.1|  PREDICTED: vacuolar-sorting receptor 5             133   6e-32   
gb|KHG13712.1|  Vacuolar-sorting receptor 6 -like protein               133   7e-32   
dbj|BAJ97179.1|  predicted protein                                      133   8e-32   
dbj|BAJ91572.1|  predicted protein                                      133   8e-32   
gb|KJB48040.1|  hypothetical protein B456_008G051500                    133   8e-32   
ref|XP_007212810.1|  hypothetical protein PRUPE_ppa002849mg             132   1e-31   
ref|XP_010439615.1|  PREDICTED: vacuolar-sorting receptor 7-like        132   1e-31   
ref|NP_001058298.1|  Os06g0664300                                       132   1e-31   
ref|XP_001751750.1|  predicted protein                                  132   1e-31   
ref|XP_008805925.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    132   1e-31   
ref|XP_010509684.1|  PREDICTED: vacuolar-sorting receptor 5             132   1e-31   
ref|XP_008225932.1|  PREDICTED: vacuolar-sorting receptor 7             132   2e-31   
ref|XP_004965629.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    131   2e-31   
ref|XP_004965628.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    131   2e-31   
ref|XP_006403762.1|  hypothetical protein EUTSA_v10010181mg             131   3e-31   
emb|CDY43647.1|  BnaA04g20440D                                          131   3e-31   
emb|CDY64650.1|  BnaAnng19540D                                          130   4e-31   
ref|XP_009387953.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    130   6e-31   
emb|CDY50060.1|  BnaCnng18670D                                          130   6e-31   
ref|XP_010449220.1|  PREDICTED: vacuolar-sorting receptor 7-like        130   9e-31   
ref|XP_003563336.1|  PREDICTED: vacuolar-sorting receptor 6             129   1e-30   
gb|ACN28195.1|  unknown                                                 129   1e-30   
gb|AFW87686.1|  vacuolar sorting receptor 7                             129   1e-30   
gb|KFK36399.1|  hypothetical protein AALP_AA4G119300                    131   1e-30   
ref|NP_001152485.1|  vacuolar sorting receptor 7 precursor              129   1e-30   
ref|XP_011008227.1|  PREDICTED: vacuolar-sorting receptor 6-like        129   1e-30   
ref|XP_010941715.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    129   1e-30   
ref|XP_009133482.1|  PREDICTED: vacuolar-sorting receptor 7             129   1e-30   
emb|CDP18160.1|  unnamed protein product                                129   2e-30   
ref|XP_010516663.1|  PREDICTED: vacuolar-sorting receptor 5-like        129   2e-30   
gb|AAM96969.1|  vacuolar sorting receptor-like protein                  129   2e-30   
ref|XP_006283299.1|  hypothetical protein CARUB_v10004337mg             129   2e-30   
ref|XP_002447079.1|  hypothetical protein SORBIDRAFT_06g028180          129   3e-30   
ref|NP_193744.1|  vacuolar-sorting receptor 7                           128   3e-30   
ref|XP_007138862.1|  hypothetical protein PHAVU_009G243800g             128   3e-30   
ref|NP_001190777.1|  vacuolar-sorting receptor 7                        128   3e-30   
ref|XP_010684292.1|  PREDICTED: vacuolar-sorting receptor 7-like        128   3e-30   
ref|XP_002869948.1|  hypothetical protein ARALYDRAFT_492857             128   3e-30   
ref|XP_008439431.1|  PREDICTED: vacuolar-sorting receptor 6-like ...    127   6e-30   
ref|XP_010434318.1|  PREDICTED: vacuolar-sorting receptor 7             127   7e-30   
gb|EMS55782.1|  Vacuolar-sorting receptor 7                             126   7e-30   
emb|CDX78975.1|  BnaA01g10420D                                          127   8e-30   
ref|XP_004487890.1|  PREDICTED: vacuolar-sorting receptor 6-like        127   1e-29   
ref|XP_007040993.1|  Vacuolar sorting receptor 7                        127   1e-29   
gb|KJB12294.1|  hypothetical protein B456_002G010300                    126   2e-29   
ref|XP_009408244.1|  PREDICTED: vacuolar-sorting receptor 7             126   2e-29   
ref|XP_004134519.1|  PREDICTED: vacuolar-sorting receptor 6             125   3e-29   
ref|XP_006363163.1|  PREDICTED: vacuolar-sorting receptor 6-like        125   4e-29   
emb|CAA16619.1|  vacuolar sorting receptor-like protein                 125   4e-29   
ref|XP_006448589.1|  hypothetical protein CICLE_v10014573mg             125   4e-29   
ref|XP_006410651.1|  hypothetical protein EUTSA_v10016381mg             125   5e-29   
ref|XP_004232618.1|  PREDICTED: vacuolar-sorting receptor 6-like        124   7e-29   
ref|XP_009616647.1|  PREDICTED: vacuolar-sorting receptor 6-like        124   7e-29   
ref|XP_002437414.1|  hypothetical protein SORBIDRAFT_10g026544          124   2e-28   
gb|KFK28654.1|  hypothetical protein AALP_AA7G027800                    123   2e-28   
ref|XP_009794444.1|  PREDICTED: vacuolar-sorting receptor 6-like        123   2e-28   
ref|NP_181040.1|  vacuolar-sorting receptor 5                           123   3e-28   
ref|XP_006413899.1|  hypothetical protein EUTSA_v10024676mg             121   1e-27   
ref|XP_010504983.1|  PREDICTED: vacuolar-sorting receptor 5-like ...    120   2e-27   
ref|XP_010504984.1|  PREDICTED: vacuolar-sorting receptor 5-like ...    120   2e-27   
ref|XP_010058066.1|  PREDICTED: vacuolar-sorting receptor 6             119   5e-27   
gb|KDO64105.1|  hypothetical protein CISIN_1g0100102mg                  109   1e-26   
ref|XP_008787225.1|  PREDICTED: vacuolar-sorting receptor 3-like        117   1e-26   
gb|EYU43627.1|  hypothetical protein MIMGU_mgv1a002747mg                118   1e-26   
ref|XP_008371928.1|  PREDICTED: vacuolar-sorting receptor 6-like        117   3e-26   
gb|KCW75573.1|  hypothetical protein EUGRSUZ_E04321                     116   6e-26   
gb|AFW64624.1|  hypothetical protein ZEAMMB73_291086                    107   8e-26   
gb|AAF98196.1|AC000107_19  F17F8.23                                     116   9e-26   
dbj|BAJ91429.1|  predicted protein                                      110   1e-25   
gb|EPS72005.1|  hypothetical protein M569_02753                         113   5e-25   
gb|EYU23259.1|  hypothetical protein MIMGU_mgv1a0227551mg               105   4e-24   
dbj|BAJ88964.1|  predicted protein                                      110   7e-24   
gb|AFW68894.1|  hypothetical protein ZEAMMB73_054159                    108   3e-23   
gb|KJB71518.1|  hypothetical protein B456_011G126800                    107   5e-23   
ref|XP_010253066.1|  PREDICTED: vacuolar-sorting receptor 1-like ...    106   1e-22   
gb|AFW68893.1|  hypothetical protein ZEAMMB73_054159                    103   1e-21   
gb|AFW68895.1|  hypothetical protein ZEAMMB73_054159                    103   1e-21   
ref|XP_006341299.1|  PREDICTED: vacuolar-sorting receptor 1 isofo...    102   5e-21   
dbj|BAD94353.1|  putative vacuolar sorting receptor                   91.3    7e-20   
gb|KJB48041.1|  hypothetical protein B456_008G051500                  98.2    1e-19   
gb|KDO77200.1|  hypothetical protein CISIN_1g0067882mg                95.1    1e-18   
ref|XP_008439432.1|  PREDICTED: vacuolar-sorting receptor 6-like ...  92.8    9e-18   
emb|CDP17487.1|  unnamed protein product                              91.3    2e-17   
emb|CDY12449.1|  BnaC08g09380D                                        87.0    9e-17   
ref|XP_001419041.1|  predicted protein                                88.6    2e-16   
emb|CEG01308.1|  EGF-type aspartate/asparagine hydroxylation site     78.6    5e-13   
ref|XP_003080572.1|  vacuolar sorting receptor, putative (ISS)        77.8    9e-13   
gb|EMT15960.1|  hypothetical protein F775_17906                       72.8    2e-11   
ref|XP_003057973.1|  predicted protein                                66.6    4e-09   
ref|XP_002501531.1|  predicted protein                                63.2    5e-08   
ref|XP_002501193.1|  predicted protein                                62.4    7e-08   
ref|XP_004943411.1|  PREDICTED: mucin-4 isoform X4                    62.4    9e-08   
ref|XP_004943410.1|  PREDICTED: mucin-4 isoform X3                    62.4    9e-08   
ref|XP_004943409.1|  PREDICTED: mucin-4 isoform X2                    62.4    9e-08   
ref|XP_004943408.1|  PREDICTED: mucin-4 isoform X1                    62.4    9e-08   
gb|EMT30552.1|  hypothetical protein F775_21497                       62.0    9e-08   
ref|XP_007070286.1|  PREDICTED: uncharacterized protein LOC102947185  61.2    2e-07   
ref|XP_009388213.1|  PREDICTED: vacuolar-sorting receptor 1-like      60.5    3e-07   
ref|XP_010715078.1|  PREDICTED: mucin-4                               60.1    6e-07   
ref|XP_005643138.1|  hypothetical protein COCSUDRAFT_26335            58.9    1e-06   
ref|XP_006635048.1|  PREDICTED: EGF, latrophilin and seven transm...  58.5    2e-06   
ref|XP_006366359.1|  PREDICTED: wall-associated receptor kinase 2...  58.2    2e-06   
ref|XP_007191860.1|  PREDICTED: EGF, latrophilin and seven transm...  57.8    3e-06   
ref|XP_006106453.1|  PREDICTED: EGF-like module-containing mucin-...  57.0    5e-06   
ref|XP_004768022.1|  PREDICTED: hemicentin-1 isoform X2               57.4    5e-06   
ref|XP_009437971.1|  PREDICTED: hemicentin-1 isoform X2               57.4    6e-06   
ref|XP_011508340.1|  PREDICTED: hemicentin-1 isoform X2               57.0    6e-06   
ref|XP_010713843.1|  PREDICTED: hemicentin-1                          56.6    9e-06   
ref|XP_005622503.1|  PREDICTED: hemicentin-1 isoform X2               56.6    1e-05   
ref|XP_006998028.1|  PREDICTED: nidogen-2                             55.8    1e-05   
ref|XP_007103513.1|  PREDICTED: EGF, latrophilin and seven transm...  55.8    1e-05   
ref|XP_008512314.1|  PREDICTED: hemicentin-1 isoform X2               56.2    1e-05   
ref|XP_006894436.1|  PREDICTED: nidogen-2                             55.8    1e-05   
gb|ELV11507.1|  Hemicentin-1                                          55.8    2e-05   
ref|XP_005083640.1|  PREDICTED: nidogen-2                             55.1    3e-05   
ref|XP_009996158.1|  PREDICTED: hemicentin-1                          54.7    4e-05   
ref|XP_006529821.1|  PREDICTED: hemicentin-1 isoform X2               54.7    4e-05   
ref|XP_003792240.1|  PREDICTED: nidogen-2                             54.3    5e-05   
ref|XP_004649240.1|  PREDICTED: nidogen-2                             54.3    5e-05   
ref|XP_002732605.1|  PREDICTED: mucin-22-like                         54.3    5e-05   
ref|XP_005753342.1|  PREDICTED: nidogen-1-like                        53.9    6e-05   
ref|XP_008837800.1|  PREDICTED: nidogen-2                             53.9    6e-05   
ref|XP_005461388.1|  PREDICTED: nidogen-1-like isoform X1             53.9    7e-05   
ref|XP_004572433.1|  PREDICTED: nidogen-1-like                        53.9    7e-05   
ref|XP_011744702.1|  PREDICTED: hemicentin-1 isoform X4               53.9    7e-05   
ref|XP_011902792.1|  PREDICTED: hemicentin-1 isoform X7               53.9    7e-05   
ref|XP_007987353.1|  PREDICTED: hemicentin-1 isoform X4               53.9    7e-05   
ref|XP_005848603.1|  hypothetical protein CHLNCDRAFT_144100           53.5    8e-05   
ref|XP_005513330.1|  PREDICTED: mucin-4-like                          53.5    8e-05   
gb|ERE72246.1|  hemicentin-1-like protein                             53.9    8e-05   
ref|XP_005950478.1|  PREDICTED: nidogen-1-like                        53.5    9e-05   
emb|CDW57225.1|  NIDO and EGF 3 domain containing protein             53.1    1e-04   
ref|XP_006808769.1|  PREDICTED: nidogen-1-like                        53.1    1e-04   
ref|XP_009189845.1|  PREDICTED: hemicentin-1 isoform X2               53.5    1e-04   
ref|XP_005457138.1|  PREDICTED: mucin-4-like                          53.1    1e-04   
gb|EGV99559.1|  Hemicentin-1                                          53.1    1e-04   
gb|KFP07296.1|  Nidogen-2                                             53.1    1e-04   
ref|XP_008500412.1|  PREDICTED: nidogen-2                             53.1    1e-04   
ref|XP_010587195.1|  PREDICTED: LOW QUALITY PROTEIN: nidogen-2        52.8    1e-04   
ref|XP_006746144.1|  PREDICTED: nidogen-1                             52.8    2e-04   
ref|XP_006814902.1|  PREDICTED: uncharacterized protein LOC102801114  52.4    2e-04   
emb|CAD21572.3|  nidogen-2                                            52.8    2e-04   
gb|AAL71853.1|  nidogen 2 protein                                     52.8    2e-04   
ref|XP_007661323.1|  PREDICTED: nidogen-2                             52.8    2e-04   
ref|NP_032721.2|  nidogen-2 precursor                                 52.8    2e-04   
dbj|BAE37706.1|  unnamed protein product                              52.8    2e-04   
ref|XP_008068707.1|  PREDICTED: nidogen-2                             52.8    2e-04   
emb|CBY41174.1|  unnamed protein product                              52.4    2e-04   
ref|XP_008300391.1|  PREDICTED: nidogen-1-like                        52.4    2e-04   
dbj|BAE24492.1|  unnamed protein product                              52.4    2e-04   
ref|XP_010990396.1|  PREDICTED: hemicentin-1                          52.4    2e-04   
dbj|BAC35170.1|  unnamed protein product                              52.4    2e-04   
gb|EDL01536.1|  nidogen 2, isoform CRA_b                              52.4    2e-04   
dbj|BAA32609.1|  entactin-2                                           52.4    2e-04   
ref|XP_008267875.1|  PREDICTED: LOW QUALITY PROTEIN: nidogen-2        52.4    2e-04   
ref|XP_005812443.1|  PREDICTED: latent-transforming growth factor...  52.4    2e-04   
ref|XP_003468101.1|  PREDICTED: pro-epidermal growth factor           52.4    2e-04   
ref|XP_006259917.1|  PREDICTED: EGF, latrophilin and seven transm...  52.0    3e-04   
ref|XP_007668516.1|  PREDICTED: LOW QUALITY PROTEIN: nidogen-1        52.0    3e-04   
ref|XP_007246189.1|  PREDICTED: nidogen-1                             52.0    3e-04   
gb|EDL01535.1|  nidogen 2, isoform CRA_a                              52.0    3e-04   
ref|XP_003064631.1|  predicted protein                                51.6    3e-04   
ref|XP_008305030.1|  PREDICTED: nidogen-1                             51.6    3e-04   
ref|XP_002932031.1|  PREDICTED: uromodulin-like                       51.6    4e-04   
ref|XP_005678305.1|  PREDICTED: EGF, latrophilin and seven transm...  51.6    4e-04   
ref|XP_003381855.1|  putative calcium binding EGF domain protein      51.6    4e-04   
ref|XP_009860920.1|  PREDICTED: uncharacterized protein LOC100183596  51.6    4e-04   
ref|XP_008319564.1|  PREDICTED: uncharacterized protein LOC103386910  51.2    5e-04   



>ref|XP_006362349.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum tuberosum]
Length=624

 Score =   224 bits (571),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGFKGDGV  C+DIDECKER+ACQCPDCKCKNTWG Y+CSC GNLLYM EHDT
Sbjct  495  TKGCKCPPGFKGDGVNVCDDIDECKERLACQCPDCKCKNTWGGYQCSCSGNLLYMQEHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CI   GKA FSWG VWVII GLA AGV  YAVYKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  555  CIGNDGKAAFSWGLVWVIILGLAVAGVGAYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGE  614

Query  384  VPNHVSHGNV  355
            VPNH+SHGNV
Sbjct  615  VPNHISHGNV  624



>ref|XP_009801642.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
sylvestris]
Length=624

 Score =   219 bits (559),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGFKGDGV  CEDIDECKER+ACQCP+CKCKNTWG Y+CSC  NLLYMHEHDT
Sbjct  495  TKGCKCPPGFKGDGVNSCEDIDECKERLACQCPECKCKNTWGGYDCSCNSNLLYMHEHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK  K EFSWG VWVII GLAAAGV  YAVYKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  555  CISKDVKTEFSWGLVWVIILGLAAAGVGAYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGE  614

Query  384  VPNHVSHGNV  355
            VPNHVSHGNV
Sbjct  615  VPNHVSHGNV  624



>ref|XP_010327707.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Solanum 
lycopersicum]
Length=624

 Score =   219 bits (557),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGFKGDGV  CEDIDECKER+ACQCPDCKCKNTWG Y+CSC GNLLYM EHDT
Sbjct  495  TKGCKCPPGFKGDGVNLCEDIDECKERLACQCPDCKCKNTWGGYQCSCSGNLLYMQEHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CI   GKA FSWG VWVII GLA AG   YAVYKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  555  CIGNDGKAAFSWGLVWVIILGLAVAGAGAYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGE  614

Query  384  VPNHVSHGNV  355
            VPNH+SHGNV
Sbjct  615  VPNHISHGNV  624



>ref|XP_009611966.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=624

 Score =   219 bits (557),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 114/130 (88%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CP GFKGDGV  CEDIDECKER+ACQCP+CKCKNTWG Y+CSC+GNLLYMHEHDT
Sbjct  495  TKGCKCPLGFKGDGVNSCEDIDECKERLACQCPECKCKNTWGGYDCSCKGNLLYMHEHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK  K EFSWG VWVII GLAAAGV  YAVYKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  555  CISKDVKTEFSWGLVWVIILGLAAAGVGAYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGE  614

Query  384  VPNHVSHGNV  355
            VPNHVSHGNV
Sbjct  615  VPNHVSHGNV  624



>emb|CDP06387.1| unnamed protein product [Coffea canephora]
Length=628

 Score =   216 bits (550),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGF+GDGV  CEDIDECKER ACQCP+C+CKNTWGSY+CSCRGNLLYMHEHDT
Sbjct  499  TKGCTCPPGFRGDGVKSCEDIDECKERAACQCPECRCKNTWGSYDCSCRGNLLYMHEHDT  558

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK  K +FSW F+WVII  +AA G  GYA+YKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  559  CISKDVKTDFSWSFIWVIILAVAAVGAGGYAMYKYRIRRYMDSEIRAIMAQYMPLDNQGE  618

Query  384  VPNHVSHGNV  355
            VP H  HGNV
Sbjct  619  VPLHNPHGNV  628



>ref|XP_010327706.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Solanum 
lycopersicum]
Length=626

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 115/132 (87%), Gaps = 2/132 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGFKGDGV  CEDIDECKER+ACQCPDCKCKNTWG Y+CSC GNLLYM EHDT
Sbjct  495  TKGCKCPPGFKGDGVNLCEDIDECKERLACQCPDCKCKNTWGGYQCSCSGNLLYMQEHDT  554

Query  564  CISKA--GKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI+    GKA FSWG VWVII GLA AG   YAVYKYRIRRYMDSEIRAIMAQYMPLDNQ
Sbjct  555  CIAAGNDGKAAFSWGLVWVIILGLAVAGAGAYAVYKYRIRRYMDSEIRAIMAQYMPLDNQ  614

Query  390  GEVPNHVSHGNV  355
            GEVPNH+SHGNV
Sbjct  615  GEVPNHISHGNV  626



>ref|XP_009801640.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
sylvestris]
Length=626

 Score =   213 bits (542),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGFKGDGV  CEDIDECKER+ACQCP+CKCKNTWG Y+CSC  NLLYMHEHDT
Sbjct  495  TKGCKCPPGFKGDGVNSCEDIDECKERLACQCPECKCKNTWGGYDCSCNSNLLYMHEHDT  554

Query  564  CIS--KAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI+  K  K EFSWG VWVII GLAAAGV  YAVYKYRIRRYMDSEIRAIMAQYMPLDNQ
Sbjct  555  CINAGKDVKTEFSWGLVWVIILGLAAAGVGAYAVYKYRIRRYMDSEIRAIMAQYMPLDNQ  614

Query  390  GEVPNHVSHGNV  355
            GEVPNHVSHGNV
Sbjct  615  GEVPNHVSHGNV  626



>ref|XP_010253065.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=623

 Score =   213 bits (542),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGFKGDGV  CED+DECKE++ACQCP+CKCKNTWGSYECSC GNLLYM EHDT
Sbjct  494  SKGCKCPPGFKGDGVNSCEDVDECKEKLACQCPECKCKNTWGSYECSCSGNLLYMQEHDT  553

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK G +  SW FVWV++  LA  GV GY VYKYRIRRYMDSEIRAIMAQYMPLD+QGE
Sbjct  554  CISKEGTSTVSWNFVWVMVLALAGVGVIGYGVYKYRIRRYMDSEIRAIMAQYMPLDSQGE  613

Query  384  VPNHVSHGNV  355
            VPNH+ HGN+
Sbjct  614  VPNHIHHGNI  623



>ref|XP_009611965.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=626

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/132 (86%), Positives = 118/132 (89%), Gaps = 2/132 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CP GFKGDGV  CEDIDECKER+ACQCP+CKCKNTWG Y+CSC+GNLLYMHEHDT
Sbjct  495  TKGCKCPLGFKGDGVNSCEDIDECKERLACQCPECKCKNTWGGYDCSCKGNLLYMHEHDT  554

Query  564  CIS--KAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI+  K  K EFSWG VWVII GLAAAGV  YAVYKYRIRRYMDSEIRAIMAQYMPLDNQ
Sbjct  555  CINAGKDVKTEFSWGLVWVIILGLAAAGVGAYAVYKYRIRRYMDSEIRAIMAQYMPLDNQ  614

Query  390  GEVPNHVSHGNV  355
            GEVPNHVSHGNV
Sbjct  615  GEVPNHVSHGNV  626



>ref|XP_009611473.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana tomentosiformis]
Length=623

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 114/130 (88%), Gaps = 1/130 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGFKGDGV  CEDIDECKE++ACQCP CKCKNTWGS++CSC GNLLYMHEHDT
Sbjct  495  TKGCKCPPGFKGDGVNSCEDIDECKEKLACQCPACKCKNTWGSFDCSCGGNLLYMHEHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK  K+EFSWG VW II GLA A V GYAVYKYRIRRYMDSEIRAIMAQYMPLD QGE
Sbjct  555  CISKDSKSEFSWGLVWTIILGLAVAVVVGYAVYKYRIRRYMDSEIRAIMAQYMPLD-QGE  613

Query  384  VPNHVSHGNV  355
              NHVSHGNV
Sbjct  614  GANHVSHGNV  623



>ref|XP_011095146.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=624

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGF+GDGV  CEDIDECKE +ACQCP+CKCKNTWGSYECSC  N LY+HEHDT
Sbjct  495  TKGCKCPPGFRGDGVNSCEDIDECKENLACQCPECKCKNTWGSYECSCSSNALYIHEHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK    E+SW FVWV+  GLA AG AGYA+YKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  555  CISKDASTEYSWSFVWVVFLGLAVAGAAGYALYKYRIRRYMDSEIRAIMAQYMPLDNQGE  614

Query  384  VPNHVSHGNV  355
            VPNH++ G+V
Sbjct  615  VPNHMTQGHV  624



>ref|XP_009775401.1| PREDICTED: vacuolar-sorting receptor 1-like [Nicotiana sylvestris]
Length=623

 Score =   210 bits (535),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGFKGDGV  CEDIDECKE++ACQCP+CKCKNTWGS++CSC  NLLYMHEHDT
Sbjct  495  TKGCKCPPGFKGDGVNSCEDIDECKEKLACQCPECKCKNTWGSFDCSCGSNLLYMHEHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK  K+EFSWG VW II GLA A V  +AVYKYRIRRYMDSEIRAIMAQYMPLD QGE
Sbjct  555  CISKDSKSEFSWGLVWTIILGLAVAAVVAFAVYKYRIRRYMDSEIRAIMAQYMPLD-QGE  613

Query  384  VPNHVSHGNV  355
              NHVSHGN+
Sbjct  614  GANHVSHGNI  623



>gb|EYU42029.1| hypothetical protein MIMGU_mgv1a002928mg [Erythranthe guttata]
Length=624

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 113/130 (87%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CP GFKGDG   CEDIDECKE+ ACQC DCKCKNTWGSYECSC GN LY+HEHDT
Sbjct  495  TKGCKCPAGFKGDGTNSCEDIDECKEKTACQCSDCKCKNTWGSYECSCGGNSLYIHEHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK    E+SW FVWV+I GLA +GVAGYA+YKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  555  CISKDSNTEYSWSFVWVVILGLAVSGVAGYALYKYRIRRYMDSEIRAIMAQYMPLDNQGE  614

Query  384  VPNHVSHGNV  355
            VP+H+SHG V
Sbjct  615  VPDHMSHGRV  624



>emb|CAN66483.1| hypothetical protein VITISV_015390 [Vitis vinifera]
Length=625

 Score =   208 bits (529),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CP GFKGDGV  CED++ECK+++AC CP+CKCKNTWGSYECSC GNLLYM EHD 
Sbjct  496  SKGCQCPQGFKGDGVKTCEDVNECKDKVACNCPECKCKNTWGSYECSCSGNLLYMREHDA  555

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK  K E SW F+WVII GLAAAGV GYA+YKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  556  CISKHVKTEVSWSFIWVIILGLAAAGVGGYALYKYRIRRYMDSEIRAIMAQYMPLDNQGE  615

Query  384  VPNHVSHGNV  355
            +PNHV HG++
Sbjct  616  IPNHVPHGDI  625



>ref|XP_002267833.2| PREDICTED: vacuolar-sorting receptor 1 [Vitis vinifera]
 emb|CBI18031.3| unnamed protein product [Vitis vinifera]
Length=624

 Score =   207 bits (526),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 114/130 (88%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CP GFKGDGV  CED++ECK+++AC CP+CKCKNTWGSYECSC GNLLYM EHD 
Sbjct  495  SKGCQCPQGFKGDGVKTCEDVNECKDKVACNCPECKCKNTWGSYECSCSGNLLYMREHDA  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK  K E SW F+WVII GLAAAGV GYA+YKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  555  CISKHVKTEVSWSFIWVIILGLAAAGVGGYALYKYRIRRYMDSEIRAIMAQYMPLDNQGE  614

Query  384  VPNHVSHGNV  355
            +PNHV HG++
Sbjct  615  IPNHVPHGDI  624



>gb|ACS91931.1| vacuolar sorting receptor protein [Lilium longiflorum]
Length=567

 Score =   206 bits (524),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/130 (77%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGFKGDGV  CED+DECKE++ACQC  CKCKNTWGSY+CSC G+LLYM EHDT
Sbjct  438  SKGCKCPPGFKGDGVNSCEDVDECKEKVACQCSQCKCKNTWGSYDCSCSGDLLYMKEHDT  497

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK    E  W F+W+I  GLA AG++GYAVYKYRIR YMDSEIRAIMAQYMPLDNQGE
Sbjct  498  CISKKPTTEVGWNFLWIIFLGLAVAGISGYAVYKYRIRSYMDSEIRAIMAQYMPLDNQGE  557

Query  384  VPNHVSHGNV  355
            VPNHVSHG++
Sbjct  558  VPNHVSHGDI  567



>ref|NP_001275302.1| vacuolar sorting receptor protein PV72-like protein precursor 
[Solanum tuberosum]
 gb|ABC01915.1| vacuolar sorting receptor protein PV72-like protein [Solanum 
tuberosum]
Length=621

 Score =   205 bits (521),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 112/130 (86%), Gaps = 1/130 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGFKGDGV  CEDIDECKE++ACQC +CKCKNTWGSY+CSC  NLLYMHEHDT
Sbjct  493  TKGCKCPPGFKGDGVNSCEDIDECKEKLACQCAECKCKNTWGSYDCSCNANLLYMHEHDT  552

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK  K+EFSWG VW II GLA AGV+ YAVYKYRIRRYMDSEIRAIMAQYMPLD QGE
Sbjct  553  CISKDAKSEFSWGLVWTIILGLAVAGVSAYAVYKYRIRRYMDSEIRAIMAQYMPLD-QGE  611

Query  384  VPNHVSHGNV  355
               +V HGNV
Sbjct  612  GATNVPHGNV  621



>gb|KGN58685.1| hypothetical protein Csa_3G728020 [Cucumis sativus]
Length=161

 Score =   192 bits (489),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGFKGDGV  CED+DECKE++ACQCP+CKC+NTWGSY+CSCR  LLYMHEHDT
Sbjct  32   TKGCKCPPGFKGDGVRKCEDVDECKEKLACQCPECKCRNTWGSYDCSCRNGLLYMHEHDT  91

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CI   G    SW  V + I  LA  G+ G+AVYKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  92   CIGNIGSTVTSWSVVKITILVLAITGITGFAVYKYRIRRYMDSEIRAIMAQYMPLDNQGE  151

Query  384  VPNHVSHGNV  355
              NHV+ G +
Sbjct  152  TSNHVARGGI  161



>ref|XP_008788526.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=624

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/128 (78%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CPPGFKGDGV  CEDIDECKERIACQC  CKCKNTWGS+ECSC G+LLY+ EHDTCI
Sbjct  497  GCKCPPGFKGDGVNTCEDIDECKERIACQCSACKCKNTWGSFECSCSGDLLYIKEHDTCI  556

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK   AE  W F+WVI FGLA AGV  Y VYKYRIR YMDSEIRAIMAQYMPLDNQGE P
Sbjct  557  SKKAAAEIGWSFLWVIFFGLAVAGVGAYMVYKYRIRSYMDSEIRAIMAQYMPLDNQGEAP  616

Query  378  NHVSHGNV  355
            NH+ HG++
Sbjct  617  NHIPHGDI  624



>ref|XP_004246285.1| PREDICTED: vacuolar-sorting receptor 1-like [Solanum lycopersicum]
Length=621

 Score =   202 bits (515),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 104/130 (80%), Positives = 111/130 (85%), Gaps = 1/130 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGFKGDGV  CEDIDECKE++ACQC +CKCKNTWGSY+CSC  NLLYMHEHDT
Sbjct  493  TKGCKCPPGFKGDGVNSCEDIDECKEKLACQCAECKCKNTWGSYDCSCSANLLYMHEHDT  552

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK  K+EFSWG VW II GLA AGV+ YAVYKYRIRRYMDSEIRAIMAQYMPL  QGE
Sbjct  553  CISKDAKSEFSWGLVWTIILGLAVAGVSAYAVYKYRIRRYMDSEIRAIMAQYMPL-GQGE  611

Query  384  VPNHVSHGNV  355
               +V HGNV
Sbjct  612  GATNVPHGNV  621



>ref|XP_010922756.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CPPGFKGDGV  CEDIDECKER ACQC  CKCKNTWGSY+CSC G+LLY+ EHDTCI
Sbjct  493  GCKCPPGFKGDGVKTCEDIDECKERTACQCSACKCKNTWGSYDCSCSGDLLYIKEHDTCI  552

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK    E  W F+WVI FGLA AGV  YAVYKYRIR YMDSEIRAIMAQYMPLDNQGE P
Sbjct  553  SKRATTEVGWSFLWVIFFGLAVAGVGAYAVYKYRIRSYMDSEIRAIMAQYMPLDNQGEAP  612

Query  378  NHVSHGNV  355
            NH+ HG++
Sbjct  613  NHIPHGDI  620



>ref|XP_002309184.1| vacuolar sorting receptor family protein [Populus trichocarpa]
 gb|EEE92707.1| vacuolar sorting receptor family protein [Populus trichocarpa]
Length=625

 Score =   200 bits (509),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 115/131 (88%), Gaps = 1/131 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            ++GC CPPGFKGDGV  CED+DECK+++ACQCP+CKCKNTWGSYECSC G LLYM EHDT
Sbjct  495  SQGCKCPPGFKGDGVNSCEDVDECKDKVACQCPECKCKNTWGSYECSCSGGLLYMREHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CIS A +AE+SW FVW+II GLA AGVAGYA+YKYRIRRYMDSEIRAIMAQYMPLD+Q +
Sbjct  555  CISNAARAEYSWSFVWIIILGLATAGVAGYAIYKYRIRRYMDSEIRAIMAQYMPLDSQAD  614

Query  384  VP-NHVSHGNV  355
            +P +H   G++
Sbjct  615  IPVHHAPRGDI  625



>ref|XP_011086922.1| PREDICTED: vacuolar-sorting receptor 1-like [Sesamum indicum]
Length=631

 Score =   199 bits (505),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 109/128 (85%), Gaps = 0/128 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CPPGF+GDGV  CEDIDECKE+ ACQC  C C+NTWGSYECSC GNLLY+HEHDTCI
Sbjct  504  GCKCPPGFRGDGVKECEDIDECKEKTACQCQHCSCRNTWGSYECSCSGNLLYIHEHDTCI  563

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK    E SWG +WVI+ G A AGVAGYA+YKYRIRRYMDSEIRAIMAQYMPLDNQG+VP
Sbjct  564  SKDSNREVSWGIMWVIVLGFALAGVAGYAIYKYRIRRYMDSEIRAIMAQYMPLDNQGDVP  623

Query  378  NHVSHGNV  355
            NH+  G+V
Sbjct  624  NHLPQGSV  631



>ref|XP_004302536.1| PREDICTED: vacuolar-sorting receptor 1-like [Fragaria vesca subsp. 
vesca]
Length=625

 Score =   198 bits (504),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGFKGDG   CED+DECKE++ACQC  CKCKNTWGSYECSC G LLYM EHD 
Sbjct  495  TKGCTCPPGFKGDGEKTCEDVDECKEKVACQCSQCKCKNTWGSYECSCGGGLLYMREHDA  554

Query  564  CISK-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            CI K A   E+SW F+WVII  L A GV GYAVYKYRIRRYMDSEIRAIMAQYMPLDNQG
Sbjct  555  CIGKNARNTEYSWSFIWVIILCLGAVGVGGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQG  614

Query  387  EVPNHVSHGNV  355
            E+PNHVS G++
Sbjct  615  EIPNHVSRGDI  625



>ref|XP_006842496.1| PREDICTED: vacuolar-sorting receptor 1 [Amborella trichopoda]
 ref|XP_011622665.1| PREDICTED: vacuolar-sorting receptor 1 [Amborella trichopoda]
 gb|ERN04171.1| hypothetical protein AMTR_s00077p00095230 [Amborella trichopoda]
Length=622

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGFKG+GV  CED+DECKE++ACQCP+CKCKNT+GSYEC+C G+LLYM EHDT
Sbjct  494  SKGCKCPPGFKGNGVDSCEDVDECKEKLACQCPECKCKNTFGSYECNCNGDLLYMREHDT  553

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK    E  W FVWVI  GLAAAG+ GYA+YKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  554  CISKKATTEVGWNFVWVIFLGLAAAGIGGYAIYKYRIRRYMDSEIRAIMAQYMPLDNQGE  613

Query  384  VPNHV  370
            +PNH+
Sbjct  614  IPNHM  618



>ref|XP_011019003.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 114/131 (87%), Gaps = 1/131 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            ++GC CPPGFKGDGV  C+D+DECK+++ACQCP+CKCKNTWGSYECSC G LLYM EHD 
Sbjct  495  SQGCKCPPGFKGDGVNSCDDVDECKDKVACQCPECKCKNTWGSYECSCSGGLLYMREHDA  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CIS A +AE+SW FVW+II GLA AGVAGYA+YKYRIRRYMDSEIRAIMAQYMPLD+Q +
Sbjct  555  CISNAARAEYSWSFVWIIILGLATAGVAGYAIYKYRIRRYMDSEIRAIMAQYMPLDSQAD  614

Query  384  VP-NHVSHGNV  355
            +P +H   G++
Sbjct  615  IPVHHAPRGDI  625



>ref|XP_008792241.1| PREDICTED: vacuolar-sorting receptor 1-like [Phoenix dactylifera]
Length=620

 Score =   197 bits (501),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CPPGFKGDGV  CEDIDECKE+IACQC  CKCKNTWGSY+CSC G+ LY+ EHDTCI
Sbjct  493  GCKCPPGFKGDGVNTCEDIDECKEKIACQCSACKCKNTWGSYDCSCSGDRLYIKEHDTCI  552

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK G  E  W F+WVI FGLA AG+  YAVYKYRIR YMDSEIRAIMAQYMPLDNQGE  
Sbjct  553  SKEGTTEVGWSFLWVIFFGLAVAGMGAYAVYKYRIRSYMDSEIRAIMAQYMPLDNQGEAS  612

Query  378  NHVSHGNV  355
            NH+ HG++
Sbjct  613  NHILHGDI  620



>ref|XP_007207200.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
 gb|EMJ08399.1| hypothetical protein PRUPE_ppa002877mg [Prunus persica]
Length=625

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 109/131 (83%), Gaps = 1/131 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            T GC CPPGFKGDG   CED+DECKE++ CQC  CKCKNTWGSYECSC G LLYM EHD 
Sbjct  495  TNGCKCPPGFKGDGEKTCEDVDECKEKVNCQCAQCKCKNTWGSYECSCGGGLLYMREHDA  554

Query  564  CISK-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            CISK A  +EF+WGF+WVII  L A GV GYAVYKYRIRRYMDSEIRAIMAQYMPLDNQG
Sbjct  555  CISKNASVSEFNWGFMWVIILCLGAVGVGGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQG  614

Query  387  EVPNHVSHGNV  355
            E+PNHV  G++
Sbjct  615  EIPNHVPRGDI  625



>ref|XP_010931377.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=620

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CPPGFKGDGV  CED+DECKE+IACQC  CKCKNTWG Y+CSC G+LLYM EHD CI
Sbjct  493  GCKCPPGFKGDGVKTCEDVDECKEKIACQCSACKCKNTWGGYDCSCSGDLLYMQEHDACI  552

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK    E  W F+WVI FGLA AG+  Y VYKYRIR YMDSEIRAIMAQYMPLDNQGE  
Sbjct  553  SKKATTEVGWSFLWVIFFGLAVAGIGAYVVYKYRIRSYMDSEIRAIMAQYMPLDNQGEAA  612

Query  378  NHVSHGNV  355
            NHV HG++
Sbjct  613  NHVLHGDI  620



>ref|XP_006663158.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=653

 Score =   196 bits (497),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDGV  CEDIDECKER ACQC +CKCKNTWGSYEC C G LLYM EHDTCI
Sbjct  526  GCKCPDGFKGDGVHKCEDIDECKERSACQCKECKCKNTWGSYECGCSGGLLYMKEHDTCI  585

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK+   E  W F+WVI FGL  AG+AGYA+YKYRIRRYMDSEIRAIMAQYMPLDNQGEVP
Sbjct  586  SKSAATEVGWNFLWVIFFGLVVAGIAGYALYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  645

Query  378  NHVSH  364
            NH  H
Sbjct  646  NHSHH  650



>ref|XP_006664280.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=698

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDGV  CEDIDECKER ACQC +CKCKNTWGSYEC C G LLYM EHDTCI
Sbjct  571  GCKCPDGFKGDGVHKCEDIDECKERSACQCKECKCKNTWGSYECGCSGGLLYMKEHDTCI  630

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK+   E  W F+WVI FGL  AG+AGYA+YKYRIRRYMDSEIRAIMAQYMPLDNQGEVP
Sbjct  631  SKSAATEVGWNFLWVIFFGLVVAGIAGYALYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  690

Query  378  NHVSH  364
            NH  H
Sbjct  691  NHSHH  695



>ref|XP_006429591.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
 ref|XP_006481200.1| PREDICTED: vacuolar-sorting receptor 1-like [Citrus sinensis]
 gb|ESR42831.1| hypothetical protein CICLE_v10011298mg [Citrus clementina]
Length=623

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 112/128 (88%), Gaps = 1/128 (1%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CPPGF+GDGV +CED+DEC+E++ACQCP+CKCK+TWGSYECSC   LLYM EHDTCI
Sbjct  497  GCKCPPGFRGDGVNNCEDVDECEEKLACQCPECKCKDTWGSYECSCGSGLLYMQEHDTCI  556

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK  ++E SWGFVW++I GLAA GVAGYA YKYRIRRYMDSEIRAIMAQYMPLD+Q EV 
Sbjct  557  SKDVRSEASWGFVWMVILGLAATGVAGYAFYKYRIRRYMDSEIRAIMAQYMPLDSQAEV-  615

Query  378  NHVSHGNV  355
             H SHG+V
Sbjct  616  QHASHGDV  623



>gb|EEE52644.1| hypothetical protein OsJ_35003 [Oryza sativa Japonica Group]
Length=591

 Score =   194 bits (494),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDGV  CEDIDECKER ACQC +CKCKNTWGSYEC C G LLYM EHDTCI
Sbjct  464  GCKCPDGFKGDGVHKCEDIDECKERTACQCKECKCKNTWGSYECGCSGGLLYMKEHDTCI  523

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK    E  W F+WVI FGL  AG+AGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQG+VP
Sbjct  524  SKNAATEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGDVP  583

Query  378  NHVSH  364
            NH  H
Sbjct  584  NHSHH  588



>gb|ACN25155.1| unknown [Zea mays]
Length=310

 Score =   188 bits (477),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDG   CED+DECKER  CQC +C+CKNTWGSYEC C G LLYM EHDTCI
Sbjct  183  GCRCPDGFKGDGKHKCEDVDECKERTVCQCEECRCKNTWGSYECGCSGGLLYMKEHDTCI  242

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK G +E  WGF+WV++FGL AAG+AGYAVYKYRIRRYMDSEIRAIMAQYMPLD+QG+V 
Sbjct  243  SKNGASEAGWGFLWVVVFGLVAAGIAGYAVYKYRIRRYMDSEIRAIMAQYMPLDSQGDVQ  302

Query  378  NHVSH  364
            +H  H
Sbjct  303  SHAHH  307



>ref|XP_006374052.1| hypothetical protein POPTR_0016s14430g [Populus trichocarpa]
 gb|ERP51849.1| hypothetical protein POPTR_0016s14430g [Populus trichocarpa]
Length=551

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            ++GC CPPGFKGDGV  CED+DECK+++ACQC +CKCKNTWGSY+CSC G LLYM EHDT
Sbjct  421  SQGCKCPPGFKGDGVNSCEDVDECKDKLACQCSECKCKNTWGSYDCSCGGGLLYMQEHDT  480

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISKA    +SW FVW+II GLAAAGVAGYA+YKYRIRRYMDSEIRAIMAQYMPLD+Q +
Sbjct  481  CISKAANTNYSWSFVWIIILGLAAAGVAGYAIYKYRIRRYMDSEIRAIMAQYMPLDSQAD  540

Query  384  VP-NHVSHGNV  355
            +P +H   G++
Sbjct  541  IPVHHAPRGDI  551



>gb|EEE51529.1| hypothetical protein OsJ_32728 [Oryza sativa Japonica Group]
Length=626

 Score =   194 bits (494),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDGV  CEDIDECKER ACQC +CKCKNTWGSYEC C G LLYM EHDTCI
Sbjct  499  GCKCPDGFKGDGVHKCEDIDECKERTACQCKECKCKNTWGSYECGCSGGLLYMKEHDTCI  558

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK    E  W F+WVI FGL  AG+AGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQG+VP
Sbjct  559  SKNAATEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGDVP  618

Query  378  NHVSH  364
            NH  H
Sbjct  619  NHSHH  623



>gb|EEC67546.1| hypothetical protein OsI_34875 [Oryza sativa Indica Group]
Length=626

 Score =   194 bits (494),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDGV  CEDIDECKER ACQC +CKCKNTWGSYEC C G LLYM EHDTCI
Sbjct  499  GCKCPDGFKGDGVHKCEDIDECKERTACQCKECKCKNTWGSYECGCSGGLLYMKEHDTCI  558

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK    E  W F+WVI FGL  AG+AGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQG+VP
Sbjct  559  SKNAATEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGDVP  618

Query  378  NHVSH  364
            NH  H
Sbjct  619  NHSHH  623



>gb|EEC68730.1| hypothetical protein OsI_37233 [Oryza sativa Indica Group]
Length=626

 Score =   194 bits (494),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDGV  CEDIDECKER ACQC +CKCKNTWGSYEC C G LLYM EHDTCI
Sbjct  499  GCKCPDGFKGDGVHKCEDIDECKERTACQCKECKCKNTWGSYECGCSGGLLYMKEHDTCI  558

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK    E  W F+WVI FGL  AG+AGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQG+VP
Sbjct  559  SKNAATEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGDVP  618

Query  378  NHVSH  364
            NH  H
Sbjct  619  NHSHH  623



>ref|XP_011001696.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=532

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            ++GC CPPGFKGDGV  CED+DECK+++ACQC +CKCKNTWGSY+CSC G LLYM EHD 
Sbjct  402  SQGCKCPPGFKGDGVNSCEDVDECKDKLACQCSECKCKNTWGSYDCSCSGGLLYMREHDA  461

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISKA   ++SW FVW+II GLAAAGVAGYA+YKYRIRRYMDSEIRAIMAQYMPLD+Q +
Sbjct  462  CISKAADTKYSWSFVWIIILGLAAAGVAGYAIYKYRIRRYMDSEIRAIMAQYMPLDSQAD  521

Query  384  VP-NHVSHGNV  355
            +P +H   G++
Sbjct  522  IPVHHAPRGDI  532



>ref|NP_001065992.1| Os12g0116000 [Oryza sativa Japonica Group]
 gb|ABA96293.2| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29011.1| Os12g0116000 [Oryza sativa Japonica Group]
 dbj|BAG90054.1| unnamed protein product [Oryza sativa Japonica Group]
Length=728

 Score =   194 bits (494),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDGV  CEDIDECKER ACQC +CKCKNTWGSYEC C G LLYM EHDTCI
Sbjct  601  GCKCPDGFKGDGVHKCEDIDECKERTACQCKECKCKNTWGSYECGCSGGLLYMKEHDTCI  660

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK    E  W F+WVI FGL  AG+AGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQG+VP
Sbjct  661  SKNAATEVGWNFLWVIFFGLVVAGIAGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGDVP  720

Query  378  NHVSH  364
            NH  H
Sbjct  721  NHSHH  725



>pir||T00044 vacuolar sorting receptor protein homolog PV72 - cucurbit
 dbj|BAA25079.1| PV72 [Cucurbita cv. Kurokawa Amakuri]
Length=624

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGFKGDGV  CED+DECKE++ACQCP+CKCKNTWGSYECSCR  LLYMHEHDT
Sbjct  495  TKGCKCPPGFKGDGVHTCEDVDECKEKLACQCPECKCKNTWGSYECSCRNGLLYMHEHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CI   G    SW  V ++I  LA  G+AGYA+YKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  555  CIGNIGSTVTSWSVVKIVILVLAITGIAGYAIYKYRIRRYMDSEIRAIMAQYMPLDNQGE  614

Query  384  VPNHVSHGNV  355
              +HV+ G V
Sbjct  615  TGSHVARGGV  624



>ref|XP_004137673.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis sativus]
Length=624

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGFKGDGV  CED+DECKE++ACQCP+CKC+NTWGSY+CSCR  LLYMHEHDT
Sbjct  495  TKGCKCPPGFKGDGVRKCEDVDECKEKLACQCPECKCRNTWGSYDCSCRNGLLYMHEHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CI   G    SW  V + I  LA  G+ G+AVYKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  555  CIGNIGSTVTSWSVVKITILVLAITGITGFAVYKYRIRRYMDSEIRAIMAQYMPLDNQGE  614

Query  384  VPNHVSHGNV  355
              NHV+ G +
Sbjct  615  TSNHVARGGI  624



>ref|XP_011002594.1| PREDICTED: vacuolar-sorting receptor 1-like [Populus euphratica]
Length=625

 Score =   192 bits (488),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            ++GC CPPGFKGDGV  CED+DECK+++ACQC +CKCKNTWGSY+CSC G LLYM EHD 
Sbjct  495  SQGCKCPPGFKGDGVNSCEDVDECKDKLACQCSECKCKNTWGSYDCSCSGGLLYMREHDA  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISKA   ++SW FVW+II GLAAAGVAGYA+YKYRIRRYMDSEIRAIMAQYMPLD+Q +
Sbjct  555  CISKAADTKYSWSFVWIIILGLAAAGVAGYAIYKYRIRRYMDSEIRAIMAQYMPLDSQAD  614

Query  384  VP-NHVSHGNV  355
            +P +H   G++
Sbjct  615  IPVHHAPRGDI  625



>ref|XP_008669942.1| PREDICTED: vacuolar-sorting receptor 1-like [Zea mays]
Length=624

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDG   CEDIDECKER  CQC +CKCKNTWGSYEC C G LLYM EHDTCI
Sbjct  497  GCKCPDGFKGDGRHKCEDIDECKERTVCQCKECKCKNTWGSYECGCSGGLLYMKEHDTCI  556

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK+G +E  WGF+WVI FGL AAGVAGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQG+V 
Sbjct  557  SKSGASEAGWGFLWVIFFGLVAAGVAGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGDVQ  616

Query  378  NHVSH  364
            +H  H
Sbjct  617  SHSHH  621



>ref|XP_004977384.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=624

 Score =   191 bits (485),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/125 (79%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDG   CEDIDECKER ACQC +CKCKNTWGSYEC C G LLYM EHDTCI
Sbjct  497  GCKCPDGFKGDGKHKCEDIDECKERTACQCKECKCKNTWGSYECGCSGGLLYMKEHDTCI  556

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK G  E  WGF+WVI FGL AAG+AGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQG+V 
Sbjct  557  SKNGATETGWGFLWVIFFGLVAAGIAGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGDVQ  616

Query  378  NHVSH  364
            +H  H
Sbjct  617  SHSHH  621



>gb|EMS62484.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=925

 Score =   192 bits (487),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/125 (76%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDG+  CEDIDECKER ACQC +C CKNTWGSYEC C G LLYM EHDTCI
Sbjct  798  GCKCPDGFKGDGIHKCEDIDECKERTACQCKECNCKNTWGSYECGCSGGLLYMKEHDTCI  857

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK+  A+  W F+WV+ FGLAA G+AGYAVYKYRIRRYMDSEIRAIMAQYMPL+NQGE+P
Sbjct  858  SKSAAAQVGWNFLWVVFFGLAAVGIAGYAVYKYRIRRYMDSEIRAIMAQYMPLENQGEIP  917

Query  378  NHVSH  364
            +H  H
Sbjct  918  SHSHH  922



>ref|XP_010043186.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW88338.1| hypothetical protein EUGRSUZ_A00725 [Eucalyptus grandis]
Length=632

 Score =   190 bits (482),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 114/132 (86%), Gaps = 2/132 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CP GF+GDGV  C+D+DECKE++ACQCP+CKCK+ WGSYECSC G LLYM EHD 
Sbjct  501  TKGCKCPHGFRGDGVNSCDDVDECKEKLACQCPECKCKDVWGSYECSCSGGLLYMQEHDM  560

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CI+K  + E+SWGF+W II GLAAAGVAGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  561  CINKNTRTEYSWGFIWTIILGLAAAGVAGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGE  620

Query  384  VPNHV--SHGNV  355
            +P+H   S G+V
Sbjct  621  IPSHTHASRGSV  632



>ref|XP_002450144.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
 gb|EES09132.1| hypothetical protein SORBIDRAFT_05g001160 [Sorghum bicolor]
Length=627

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDG   CEDIDECKE+ ACQC +CKCKNTWGSYEC C G LLYM EHDTCI
Sbjct  500  GCKCPDGFKGDGKHKCEDIDECKEKTACQCKECKCKNTWGSYECGCSGGLLYMREHDTCI  559

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK G +E  WGF+WV+ FGL AAG+AGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQG+V 
Sbjct  560  SKNGGSEAGWGFLWVVFFGLVAAGIAGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGDVQ  619

Query  378  NHVSH  364
            +H  H
Sbjct  620  SHSHH  624



>gb|EMT24279.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=625

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDG+  CEDIDECKER ACQC +C CKNTWGSYEC C G LLYM EHDTCI
Sbjct  498  GCKCPDGFKGDGIHKCEDIDECKERTACQCKECNCKNTWGSYECGCSGGLLYMKEHDTCI  557

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK+  A+  W F+WV+ FGLAA G+A YAVYKYRIRRYMDSEIRAIMAQYMPL+NQGE+P
Sbjct  558  SKSAAAQVGWNFLWVVFFGLAAVGIAAYAVYKYRIRRYMDSEIRAIMAQYMPLENQGEIP  617

Query  378  NHVSH  364
            ++  H
Sbjct  618  SNSHH  622



>ref|XP_004978527.1| PREDICTED: vacuolar-sorting receptor 1-like [Setaria italica]
Length=624

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDG   CEDIDECKER ACQC +CKCKNTWGSYEC C G LLYM EHDTCI
Sbjct  497  GCKCPDGFKGDGKHKCEDIDECKERTACQCKECKCKNTWGSYECGCSGGLLYMKEHDTCI  556

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK G  E  WGF+WVI  GL AAG+AGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQG+V 
Sbjct  557  SKNGATETGWGFLWVIFLGLVAAGIAGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGDVQ  616

Query  378  NHVSH  364
            +H  H
Sbjct  617  SHSHH  621



>ref|XP_010252052.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Nelumbo 
nucifera]
Length=495

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGFKGDGV  CED++ECKE++ACQCP+C CKNTWGSYECSC GNLLYM EHDT
Sbjct  366  SKGCKCPPGFKGDGVNTCEDVNECKEKLACQCPECICKNTWGSYECSCSGNLLYMREHDT  425

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK G +   W  V VI+  LAA GV GYAVYKYRIRRYMDSEIRAIMAQYMPLD+QG+
Sbjct  426  CISKQGTSTMGWNIVGVIVLALAAIGVGGYAVYKYRIRRYMDSEIRAIMAQYMPLDSQGD  485

Query  384  VPNHVSHGNV  355
              + V+H ++
Sbjct  486  NFSRVTHADI  495



>ref|XP_002528694.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
 gb|EEF33683.1| Vacuolar sorting receptor 1 precursor, putative [Ricinus communis]
Length=625

 Score =   189 bits (479),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            ++GC CPPGFKGDGV  CED+DECKE+ ACQCP+CKCKNTWG Y+CSC   LLY+ EHDT
Sbjct  495  SQGCKCPPGFKGDGVNSCEDVDECKEKSACQCPECKCKNTWGGYDCSCSSGLLYIQEHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISKA   E  W F+W+II  LAAAGVAGYA YKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  555  CISKAANTEVGWSFIWIIILALAAAGVAGYATYKYRIRRYMDSEIRAIMAQYMPLDNQGE  614

Query  384  VP-NHVSHGNV  355
            +P +H + G++
Sbjct  615  IPVHHAARGDI  625



>gb|AAF22842.1|AF209910_1 vacuolar sorting receptor protein [Prunus dulcis]
Length=159

 Score =   177 bits (450),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV  CED+DECKE+ ACQCP+C CKNTWGSY+CSC GNLLY+ +HDTCIS
Sbjct  32   CQCPHGFKGDGVKSCEDVDECKEKKACQCPECTCKNTWGSYDCSCSGNLLYIKDHDTCIS  91

Query  555  KAGK-AEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            KA    + +W  VWVI+ GLA AG   Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  92   KAASGGKSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQAEVP  151

Query  378  NHVS  367
            NHV+
Sbjct  152  NHVN  155



>tpg|DAA39323.1| TPA: hypothetical protein ZEAMMB73_720222, partial [Zea mays]
Length=620

 Score =   189 bits (479),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDG   CEDIDECKER  CQC +CKCKNTWGSYEC C G LLYM EHDTCI
Sbjct  497  GCKCPDGFKGDGRHKCEDIDECKERTVCQCKECKCKNTWGSYECGCSGGLLYMKEHDTCI  556

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK+G +E  WGF+WVI FGL AAGVAGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQG+V 
Sbjct  557  SKSGASEAGWGFLWVIFFGLVAAGVAGYAVYKYRIRRYMDSEIRAIMAQYMPLDNQGDVQ  616

Query  378  NH  373
            +H
Sbjct  617  SH  618



>ref|XP_010093546.1| Vacuolar-sorting receptor 1 [Morus notabilis]
 gb|EXB54253.1| Vacuolar-sorting receptor 1 [Morus notabilis]
Length=628

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 106/132 (80%), Gaps = 2/132 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGFKGDGV  CEDI+ECKE++ACQC DCKCKNTWGSY+CSC G  +YM EHDT
Sbjct  497  TKGCNCPPGFKGDGVNSCEDINECKEKVACQCSDCKCKNTWGSYDCSCNGGSIYMQEHDT  556

Query  564  CISKA--GKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CIS         S G ++ II  LAA GV  YAVYKYRIRRYMDSEIRAIMAQYMPLDNQ
Sbjct  557  CISATVESSVRLSMGGIFFIILCLAAVGVCAYAVYKYRIRRYMDSEIRAIMAQYMPLDNQ  616

Query  390  GEVPNHVSHGNV  355
            GE+P HVSHGN+
Sbjct  617  GEIPTHVSHGNI  628



>gb|KHG15071.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=418

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 105/125 (84%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDECKE+ ACQCP+C CKNTWGSYEC+C G+LLY+ +HDTCIS
Sbjct  291  CQCPPGFKGDGVKSCEDIDECKEKRACQCPECSCKNTWGSYECTCNGDLLYIRDHDTCIS  350

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K+G +   +W  +WVI+ GLA AG   Y VYKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  351  KSGTEVRSAWAAMWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQGEVP  410

Query  378  NHVSH  364
            NHVS+
Sbjct  411  NHVSN  415



>ref|XP_007033521.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 ref|XP_007033522.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04447.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
 gb|EOY04448.1| Vacuolar sorting receptor isoform 1 [Theobroma cacao]
Length=621

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            + GC CPPGFKGDGV  CED+DECKE++ACQC +CKCKNTWGSYECSC G  LYM EHDT
Sbjct  495  SHGCKCPPGFKGDGVNSCEDVDECKEKLACQCRECKCKNTWGSYECSCSGGSLYMREHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CI K    + SWG+VW IIFGL AAG AGYA YKYRIRRYMDSEIRAIMAQYMPLDNQ  
Sbjct  555  CIGKEASTKVSWGYVWAIIFGLVAAGAAGYAFYKYRIRRYMDSEIRAIMAQYMPLDNQ--  612

Query  384  VPNHVSHGNV  355
             PN+V H ++
Sbjct  613  -PNNVHHPDI  621



>ref|XP_008677615.1| PREDICTED: uncharacterized protein LOC100383531 isoform X1 [Zea 
mays]
 gb|AFW64625.1| hypothetical protein ZEAMMB73_291086 [Zea mays]
Length=623

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDG   CED+DECKER  CQC +C+CKNTWGSYEC C G LLYM EHDTCI
Sbjct  496  GCRCPDGFKGDGKHKCEDVDECKERTVCQCEECRCKNTWGSYECGCSGGLLYMKEHDTCI  555

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK G +E  WGF+WV++FGL AAG+AGYAVYKYRIRRYMDSEIRAIMAQYMPLD+QG+V 
Sbjct  556  SKNGASEAGWGFLWVVVFGLVAAGIAGYAVYKYRIRRYMDSEIRAIMAQYMPLDSQGDVQ  615

Query  378  NHVSH  364
            +H  H
Sbjct  616  SHAHH  620



>dbj|BAK03786.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=695

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDGV  C D+DECKER ACQC DCKCKNTWGSYEC C G LLYM EHDTCI
Sbjct  568  GCKCPDGFKGDGVHKCIDVDECKERTACQCKDCKCKNTWGSYECGCGGGLLYMKEHDTCI  627

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK   A   W F+WV++FGLAAAG+A YAVYKYRIR YMDSEIRAIMAQYMPLDNQGE+P
Sbjct  628  SKDAGARVGWNFLWVVLFGLAAAGIAVYAVYKYRIRSYMDSEIRAIMAQYMPLDNQGEIP  687

Query  378  NHVSH  364
            +H  H
Sbjct  688  SHSHH  692



>ref|XP_010252051.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Nelumbo 
nucifera]
Length=624

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 108/130 (83%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGFKGDGV  CED++ECKE++ACQCP+C CKNTWGSYECSC GNLLYM EHDT
Sbjct  495  SKGCKCPPGFKGDGVNTCEDVNECKEKLACQCPECICKNTWGSYECSCSGNLLYMREHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK G +   W  V VI+  LAA GV GYAVYKYRIRRYMDSEIRAIMAQYMPLD+QG+
Sbjct  555  CISKQGTSTMGWNIVGVIVLALAAIGVGGYAVYKYRIRRYMDSEIRAIMAQYMPLDSQGD  614

Query  384  VPNHVSHGNV  355
              + V+H ++
Sbjct  615  NFSRVTHADI  624



>gb|KHG14060.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            + GC CP GF+GDGV  CED+DECKE++ACQCP CKCKNTWGSYECSC G  LYM EHDT
Sbjct  495  SHGCKCPYGFRGDGVKSCEDVDECKEKLACQCPGCKCKNTWGSYECSCSGGSLYMREHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK  K E SWG VWVII GL AAG  GYA+YKYRIRRYMDSEIRAIMAQYMPLDNQ  
Sbjct  555  CISKNVKTEVSWGSVWVIILGLVAAGAGGYAIYKYRIRRYMDSEIRAIMAQYMPLDNQ--  612

Query  384  VPNHVSHGNV  355
             PN+V H ++
Sbjct  613  -PNNVHHPDI  621



>ref|XP_009384326.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009384327.1| PREDICTED: vacuolar-sorting receptor 1-like [Musa acuminata subsp. 
malaccensis]
Length=621

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CPPGFKGDG+  CED+DECKE+ ACQC  CKCKNTWGSYECSC G+LLYM EHDTCI
Sbjct  495  GCKCPPGFKGDGINKCEDVDECKEKTACQCSGCKCKNTWGSYECSCGGDLLYMKEHDTCI  554

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK    E  W F+WVI+FGL  AG+ GYAVYKYRIR YMDSEIRAIMAQYMPLDNQ E  
Sbjct  555  SKKASTEVGWSFLWVILFGLVIAGIGGYAVYKYRIRSYMDSEIRAIMAQYMPLDNQ-EGQ  613

Query  378  NHVSHGNV  355
             HV HG++
Sbjct  614  IHVHHGDI  621



>gb|ABR17683.1| unknown [Picea sitchensis]
Length=635

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 108/127 (85%), Gaps = 1/127 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            T GC CPPGF+GDGV  CEDI+ECKE++ACQC +C CKNTWGSY+CSC+G+LLYM +HDT
Sbjct  505  TTGCKCPPGFRGDGVDKCEDINECKEKVACQCSECSCKNTWGSYDCSCKGDLLYMRDHDT  564

Query  564  CIS-KAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            CIS KA + +  W  VWV++ GLAAAGV  Y VYKYR+R YMDSEIRAIMAQYMPLD+QG
Sbjct  565  CISKKAEQGKVGWAAVWVVLLGLAAAGVGAYVVYKYRLRSYMDSEIRAIMAQYMPLDSQG  624

Query  387  EVPNHVS  367
            E+PNHV+
Sbjct  625  EIPNHVN  631



>gb|KJB71519.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
 gb|KJB71520.1| hypothetical protein B456_011G126800 [Gossypium raimondii]
Length=621

 Score =   186 bits (473),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/130 (74%), Positives = 106/130 (82%), Gaps = 3/130 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            + GC CP GF+GDGV  CED+DECKE++ACQCP CKC+NTWGSYECSC G  LYM EHDT
Sbjct  495  SHGCKCPYGFRGDGVKSCEDVDECKEKLACQCPGCKCRNTWGSYECSCSGGSLYMREHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK  K E SWG VWVII GL AAG  GYA+YKYRIRRYMDSEIRAIMAQYMPLDNQ  
Sbjct  555  CISKNVKTEVSWGSVWVIILGLVAAGAGGYAIYKYRIRRYMDSEIRAIMAQYMPLDNQ--  612

Query  384  VPNHVSHGNV  355
             PN+V H ++
Sbjct  613  -PNNVHHPDI  621



>gb|KJB32252.1| hypothetical protein B456_005G231800 [Gossypium raimondii]
Length=630

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV +CEDIDECKE+ ACQCP+C CKNTWGSYEC+C G+LLY+ +HDTCIS
Sbjct  503  CQCPPGFKGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYECTCSGDLLYIRDHDTCIS  562

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K+G +   SW  VWVI+ GLA A    Y +YKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  563  KSGTEVRSSWAAVWVILIGLAMASGGAYLIYKYRLRSYMDSEIRAIMAQYMPLDSQAEVP  622

Query  378  NHVS  367
            NHVS
Sbjct  623  NHVS  626



>ref|XP_008348888.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=628

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 92/125 (74%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDECKER ACQCP+C CKNTWGSY+CSC GNLLY+ +HDTCIS
Sbjct  501  CQCPPGFKGDGVKSCEDIDECKERKACQCPECSCKNTWGSYDCSCGGNLLYIRDHDTCIS  560

Query  555  KA-GKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            KA G  + +W  VWVI+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  561  KASGGGKSAWVAVWVILLGLAMAAGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQAEVP  620

Query  378  NHVSH  364
            NHV+ 
Sbjct  621  NHVNE  625



>ref|XP_009349164.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDECKER ACQCP+C CK+TWGSYECSC GNLLY+ +HDTCIS
Sbjct  501  CQCPPGFKGDGVKSCEDIDECKERKACQCPECSCKDTWGSYECSCSGNLLYIRDHDTCIS  560

Query  555  KA-GKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            KA G  + +W  VW+I+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  561  KASGGGKSAWVAVWIILLGLAMAAGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQAEVP  620

Query  378  NHVSH  364
            NHV+ 
Sbjct  621  NHVNE  625



>ref|XP_009375671.1| PREDICTED: vacuolar-sorting receptor 3-like [Pyrus x bretschneideri]
Length=628

 Score =   186 bits (471),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 102/125 (82%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDECKER ACQCP+C CK+TWGSYECSC GNLLY+ +HDTCIS
Sbjct  501  CQCPPGFKGDGVKSCEDIDECKERKACQCPECSCKDTWGSYECSCSGNLLYIRDHDTCIS  560

Query  555  KA-GKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            KA G  + +W  VW+I+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  561  KASGGGKSAWVAVWIILLGLAMAAGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQAEVP  620

Query  378  NHVSH  364
            NHV+ 
Sbjct  621  NHVNE  625



>gb|EMT19677.1| Vacuolar-sorting receptor 1 [Aegilops tauschii]
Length=618

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/125 (75%), Positives = 101/125 (81%), Gaps = 0/125 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDGV  CED+DECKER ACQC +CKC NTWGSYEC C G  LYM EHDTCI
Sbjct  491  GCKCPDGFKGDGVHKCEDVDECKERTACQCKECKCNNTWGSYECGCGGGFLYMKEHDTCI  550

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK   A   W F+W ++FGLAA G+AGYAVYKYRIR YMDSEIRAIMAQYMPLDNQGE+P
Sbjct  551  SKDAGARVGWNFLWFLLFGLAAVGIAGYAVYKYRIRSYMDSEIRAIMAQYMPLDNQGEIP  610

Query  378  NHVSH  364
            NH  H
Sbjct  611  NHSHH  615



>gb|EYU35791.1| hypothetical protein MIMGU_mgv1a002876mg [Erythranthe guttata]
Length=628

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/125 (77%), Positives = 105/125 (84%), Gaps = 4/125 (3%)
 Frame = -1

Query  741  KGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTC  562
             GC CP GF+GDGV  CEDI+EC E++ACQCPDC CKNTWGSYECSC G LLY+HEHDTC
Sbjct  500  NGCKCPAGFRGDGVNGCEDINECAEKLACQCPDCSCKNTWGSYECSCGGQLLYIHEHDTC  559

Query  561  ISK-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            ISK A  +E SWG +WVII GL  AGVAGYA+YKYRIRRYMDSEIRAIMAQYMPLDNQ  
Sbjct  560  ISKDAANSEVSWGVMWVIILGLTVAGVAGYALYKYRIRRYMDSEIRAIMAQYMPLDNQ--  617

Query  384  VPNHV  370
             PNH+
Sbjct  618  -PNHM  621



>ref|XP_010529937.1| PREDICTED: vacuolar-sorting receptor 1 isoform X2 [Tarenaya hassleriana]
Length=624

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 104/128 (81%), Gaps = 3/128 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +K C CPPGFKGDGV  CED+DECKE++ACQCP+CKCKNTWGSYECSC   LLYM EHDT
Sbjct  495  SKDCKCPPGFKGDGVKKCEDVDECKEKVACQCPECKCKNTWGSYECSCSSGLLYMREHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CI K G  + SW  +W++IF LAAA ++GYA+YKYRIR YMDSEIRAIMAQYMPLD+Q  
Sbjct  555  CIGKVGATKLSWSMLWILIFALAAASLSGYALYKYRIRSYMDSEIRAIMAQYMPLDSQ--  612

Query  384  VPNHVSHG  361
             PN  S G
Sbjct  613  -PNTASTG  619



>gb|KHG23770.1| Vacuolar-sorting receptor 1 -like protein [Gossypium arboreum]
Length=621

 Score =   184 bits (467),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            + GC CPPGFKGDGV  CED+DECK+++ACQCP CKCKNTWGSYECSC    LYM EHD 
Sbjct  495  SHGCECPPGFKGDGVNSCEDVDECKDKLACQCPGCKCKNTWGSYECSCSDGSLYMREHDM  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK GK E S GF+W II GL  AG  GYA+YKYRIRRYMDSEIRAIMAQYMPLDNQ  
Sbjct  555  CISKNGKTEVSSGFIWAIILGLVVAGAVGYAIYKYRIRRYMDSEIRAIMAQYMPLDNQ--  612

Query  384  VPNHVSHGNV  355
             P+++ H ++
Sbjct  613  -PSNIHHPDI  621



>ref|XP_008236323.1| PREDICTED: vacuolar-sorting receptor 3 [Prunus mume]
Length=629

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CED+DECKE+ ACQCP+C CKNTWGSY+CSC GNLLY+ +HDTCIS
Sbjct  502  CQCPPGFKGDGVKSCEDVDECKEKKACQCPECSCKNTWGSYDCSCSGNLLYIKDHDTCIS  561

Query  555  KAGK-AEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            KA    + +W  VWVI+ GLA AG   Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  562  KAASGGKSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQAEVP  621

Query  378  NHVS  367
            NHV+
Sbjct  622  NHVN  625



>ref|XP_012091044.1| PREDICTED: vacuolar-sorting receptor 1-like [Jatropha curcas]
 gb|KDP21863.1| hypothetical protein JCGZ_00650 [Jatropha curcas]
Length=622

 Score =   184 bits (466),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 111/131 (85%), Gaps = 1/131 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            ++GC CPPGF+GDGV  CEDIDECK++ ACQC DCKCKNTWGSY+CSC   LLYM EHDT
Sbjct  492  SQGCKCPPGFRGDGVNSCEDIDECKDKTACQCSDCKCKNTWGSYDCSCGSGLLYMREHDT  551

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK   AE SW F+W II GLAAAG+AGYA+YKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  552  CISKDASAEVSWSFIWTIILGLAAAGIAGYAIYKYRIRRYMDSEIRAIMAQYMPLDNQGE  611

Query  384  VP-NHVSHGNV  355
            +P +H   G++
Sbjct  612  IPVHHAPRGDI  622



>gb|KJB29888.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/130 (72%), Positives = 104/130 (80%), Gaps = 3/130 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            + GC CPPGFKGDGV  CED+DECKE++ACQCP CKCKNTWGSYECSC    LYM EHD 
Sbjct  495  SHGCKCPPGFKGDGVNGCEDVDECKEKLACQCPGCKCKNTWGSYECSCCDGSLYMREHDM  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK GK E S GF+W II GL  AG  GYA+YKYRIRRYMDSEIRAIMAQYMPLDNQ  
Sbjct  555  CISKNGKTEVSSGFIWAIILGLVVAGAVGYAIYKYRIRRYMDSEIRAIMAQYMPLDNQ--  612

Query  384  VPNHVSHGNV  355
             P+++ H ++
Sbjct  613  -PSNIHHPDI  621



>ref|XP_004136938.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis sativus]
 gb|KGN43851.1| hypothetical protein Csa_7G071400 [Cucumis sativus]
Length=631

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDEC+E+ ACQCP+C CKNTWGSY+CSC G+LLY+ +HDTCIS
Sbjct  505  CSCPPGFKGDGVKSCEDIDECQEKKACQCPECSCKNTWGSYDCSCSGDLLYIRDHDTCIS  564

Query  555  KAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVPN  376
            KA     +W  VWVI+ GL  A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVPN
Sbjct  565  KASSGRSAWTAVWVILIGLTMAAGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQAEVPN  624

Query  375  HVSH  364
            +V+ 
Sbjct  625  YVNE  628



>ref|XP_003610620.1| Vacuolar-sorting receptor [Medicago truncatula]
 gb|AES93578.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=622

 Score =   183 bits (464),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV +CEDIDECKE+ ACQCP+C CKNTWGSY+CSC G+LLY+ +HDTCIS
Sbjct  495  CQCPTGFKGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYDCSCSGDLLYIKDHDTCIS  554

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A +A+ +W   WVI+ GL      G+ VYKYRIR+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  555  KTASQAKSTWAAFWVILIGLGMIAGGGFLVYKYRIRQYMDSEIRAIMAQYMPLDSQAEVP  614

Query  378  NHVSH  364
            NHV+H
Sbjct  615  NHVNH  619



>ref|XP_008455032.1| PREDICTED: vacuolar-sorting receptor 3-like [Cucumis melo]
Length=630

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDEC+E+ ACQCP+C CKNTWGSY+CSC G+LLY+ +HDTCIS
Sbjct  504  CSCPPGFKGDGVKSCEDIDECQEKKACQCPECSCKNTWGSYDCSCSGDLLYIRDHDTCIS  563

Query  555  KAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVPN  376
            KA     +W  VWVI+ GL  A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVPN
Sbjct  564  KASSGRSAWTAVWVILIGLVMAAGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQAEVPN  623

Query  375  HVSH  364
            +V+ 
Sbjct  624  YVNE  627



>gb|KJB79450.1| hypothetical protein B456_013G050300 [Gossypium raimondii]
Length=628

 Score =   183 bits (464),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGF+GDG+ +CEDIDECKE+ ACQCP+C CK+TWGSYEC+C G+LLY+ +HDTCIS
Sbjct  501  CQCPPGFRGDGINNCEDIDECKEKKACQCPECSCKDTWGSYECTCSGDLLYIRDHDTCIS  560

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K+G + + +W  VWVI+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  561  KSGTEVKSAWAAVWVILIGLAMASGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQSEVP  620

Query  378  NHVSH  364
            NHVS 
Sbjct  621  NHVSE  625



>ref|XP_007042633.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
 gb|EOX98464.1| Vaculolar sorting receptor 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CED+DEC E+ ACQCP+C CKNTWGSYEC+C G+LLY+ +HDTCIS
Sbjct  499  CQCPPGFKGDGVKSCEDVDECNEKKACQCPECSCKNTWGSYECTCSGDLLYIRDHDTCIS  558

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K+G +   +W  VWVI+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  559  KSGTEVRSAWAAVWVIVIGLAMAAGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQAEVP  618

Query  378  NHVSH  364
            NHVS 
Sbjct  619  NHVSE  623



>dbj|BAK00302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=642

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDG+  CEDIDECKER ACQC +C CKNTWGSYEC C G LLYM EHDTCI
Sbjct  515  GCKCPDGFKGDGIHKCEDIDECKERTACQCKECNCKNTWGSYECGCSGGLLYMKEHDTCI  574

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            S++  A+  W F+WVI FGLAAAG+AGYAVYKYRIRRYMDSEIRAIMAQYMPL+NQG++ 
Sbjct  575  SESAAAQVGWNFLWVIFFGLAAAGIAGYAVYKYRIRRYMDSEIRAIMAQYMPLENQGDIH  634

Query  378  NH  373
            +H
Sbjct  635  SH  636



>ref|XP_003579018.1| PREDICTED: vacuolar-sorting receptor 1 [Brachypodium distachyon]
Length=623

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDGV  CED+DECKE+ ACQC +CKCKNTWGSYEC C G +LYM EHDTCI
Sbjct  497  GCKCPDGFKGDGVHKCEDVDECKEKTACQCKECKCKNTWGSYECGCGGGMLYMKEHDTCI  556

Query  558  SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            SK+   +  W F+WV +F LA AG+AGYAVYKYRIR YMDSEIRAIMAQYMPLDNQGE+P
Sbjct  557  SKSA-GQAGWNFLWVTLFALATAGLAGYAVYKYRIRSYMDSEIRAIMAQYMPLDNQGEIP  615

Query  378  NHVSH  364
            NH  H
Sbjct  616  NHSHH  620



>ref|XP_010272410.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=635

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGF+GDGV  CEDIDECKE+  CQCP+C CKNTWGSY+C+C G LLY+ +HDTCIS
Sbjct  508  CKCPPGFRGDGVKSCEDIDECKEKKRCQCPECSCKNTWGSYDCTCSGELLYIRDHDTCIS  567

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K AG+ + +W  VWVI+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  568  KRAGEVKTAWAAVWVILIGLAIAAGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQTEVP  627

Query  378  NHVSH  364
            NHV H
Sbjct  628  NHVGH  632



>ref|XP_002264769.1| PREDICTED: vacuolar-sorting receptor 3 [Vitis vinifera]
Length=636

 Score =   182 bits (461),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  C+D+DECKE+ ACQCP+C CKNTWGSYEC+C G+LLY+ +HDTCIS
Sbjct  509  CECPPGFKGDGVKSCKDVDECKEKKACQCPECSCKNTWGSYECTCSGDLLYIRDHDTCIS  568

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A + + +W  VWVI+ GLA AG   Y VYKYRIR YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  569  KRATEVKSAWAAVWVILIGLAMAGTGAYLVYKYRIRSYMDSEIRAIMAQYMPLDSQTEVP  628

Query  378  NHVSH  364
            NHVS 
Sbjct  629  NHVSE  633



>emb|CBI22461.3| unnamed protein product [Vitis vinifera]
Length=631

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  C+D+DECKE+ ACQCP+C CKNTWGSYEC+C G+LLY+ +HDTCIS
Sbjct  504  CECPPGFKGDGVKSCKDVDECKEKKACQCPECSCKNTWGSYECTCSGDLLYIRDHDTCIS  563

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A + + +W  VWVI+ GLA AG   Y VYKYRIR YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  564  KRATEVKSAWAAVWVILIGLAMAGTGAYLVYKYRIRSYMDSEIRAIMAQYMPLDSQTEVP  623

Query  378  NHVSH  364
            NHVS 
Sbjct  624  NHVSE  628



>ref|XP_004152276.1| PREDICTED: vacuolar-sorting receptor 4 isoform X2 [Cucumis sativus]
 gb|KGN52769.1| hypothetical protein Csa_4G000880 [Cucumis sativus]
Length=632

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 103/127 (81%), Gaps = 2/127 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDI+ECKE+ ACQC +C C NTWGSY+CSC G+LLYM +HDTCIS
Sbjct  502  CKCPPGFKGDGVKTCEDINECKEKKACQCSECSCTNTWGSYDCSCSGDLLYMRDHDTCIS  561

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A  A+ SW F WVI+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  562  KNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYRLRAYMDSEIRAIMAQYMPLDSQGEVP  621

Query  378  NHVSHGN  358
            NHV HG+
Sbjct  622  NHV-HGD  627



>ref|XP_011652916.1| PREDICTED: vacuolar-sorting receptor 4 isoform X1 [Cucumis sativus]
Length=633

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 103/127 (81%), Gaps = 2/127 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDI+ECKE+ ACQC +C C NTWGSY+CSC G+LLYM +HDTCIS
Sbjct  503  CKCPPGFKGDGVKTCEDINECKEKKACQCSECSCTNTWGSYDCSCSGDLLYMRDHDTCIS  562

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A  A+ SW F WVI+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  563  KNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYRLRAYMDSEIRAIMAQYMPLDSQGEVP  622

Query  378  NHVSHGN  358
            NHV HG+
Sbjct  623  NHV-HGD  628



>ref|XP_009410512.1| PREDICTED: vacuolar-sorting receptor 1 [Musa acuminata subsp. 
malaccensis]
Length=622

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 92/129 (71%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = -1

Query  741  KGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTC  562
            +GC CP GFKGDGV  CED+DECKE+ ACQC  CKCKNTWGSYECSC  +LLY+ EHDTC
Sbjct  495  EGCKCPLGFKGDGVDKCEDVDECKEKTACQCSGCKCKNTWGSYECSCGDDLLYIKEHDTC  554

Query  561  ISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEV  382
            ISK    E  W F+WVI FGL  AGV  YA+YKYRIR YMDSEIRAIMAQYMPLDNQ E 
Sbjct  555  ISKKPSTEVGWSFLWVIFFGLVIAGVGAYAIYKYRIRSYMDSEIRAIMAQYMPLDNQ-EA  613

Query  381  PNHVSHGNV  355
             NH+ HG +
Sbjct  614  QNHIHHGEI  622



>gb|KHF97360.1| Vacuolar-sorting receptor 3 -like protein [Gossypium arboreum]
Length=628

 Score =   181 bits (460),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGF+GDG+  C+DIDECKE+ ACQCP+C CK+TWGSYEC+C G+LLY+ +HDTCIS
Sbjct  501  CQCPPGFRGDGINSCDDIDECKEKKACQCPECSCKDTWGSYECTCSGDLLYIRDHDTCIS  560

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K+G + + +W  VWVI+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  561  KSGTEVKSAWAAVWVILIGLAMASGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQSEVP  620

Query  378  NHVSH  364
            NHVS 
Sbjct  621  NHVSE  625



>gb|AEZ00905.1| putative BP-80 vacuolar sorting receptor protein, partial [Elaeis 
guineensis]
Length=243

 Score =   173 bits (438),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDG+  C DIDECKE+ ACQCP+C CKNTWGSYEC+C G LLYM EHDTCIS
Sbjct  115  CKCPLGFKGDGIKTCADIDECKEKTACQCPECSCKNTWGSYECTCSGGLLYMREHDTCIS  174

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A +A+ +W  +W+I+  LA A    + VYKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  175  KTASEAKATWTALWLILGLLAFAAFGAFIVYKYRLRSYMDSEIRAIMAQYMPLDSQGEVP  234

Query  378  NHVSH  364
            NH + 
Sbjct  235  NHANE  239



>gb|KJB12291.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=624

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 104/125 (83%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDECKE+ ACQCP+C CKNTWGSYEC+C G+LLY+ +HDTCIS
Sbjct  497  CQCPPGFKGDGVKSCEDIDECKEKRACQCPECSCKNTWGSYECTCNGDLLYIRDHDTCIS  556

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K+G +   +W  + VI+ GLA AG   Y VYKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  557  KSGTEVRSAWAAMSVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQGEVP  616

Query  378  NHVSH  364
            NHVS+
Sbjct  617  NHVSN  621



>ref|XP_007157213.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
 gb|ESW29207.1| hypothetical protein PHAVU_002G052000g [Phaseolus vulgaris]
Length=626

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV +CEDIDECKE+ ACQCPDC CKNTWGSY+CSC G+LLYM +HDTCIS
Sbjct  499  CQCPTGFKGDGVKNCEDIDECKEKKACQCPDCSCKNTWGSYDCSCSGDLLYMRDHDTCIS  558

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W   W+I+ G+       + VYKYRIR+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  559  KTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEIRAIMAQYMPLDSQAEVP  618

Query  378  NHVS  367
            NHV+
Sbjct  619  NHVN  622



>gb|KJB12292.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
 gb|KJB12293.1| hypothetical protein B456_002G010300 [Gossypium raimondii]
Length=629

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 104/125 (83%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDECKE+ ACQCP+C CKNTWGSYEC+C G+LLY+ +HDTCIS
Sbjct  502  CQCPPGFKGDGVKSCEDIDECKEKRACQCPECSCKNTWGSYECTCNGDLLYIRDHDTCIS  561

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K+G +   +W  + VI+ GLA AG   Y VYKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  562  KSGTEVRSAWAAMSVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQGEVP  621

Query  378  NHVSH  364
            NHVS+
Sbjct  622  NHVSN  626



>ref|XP_008442315.1| PREDICTED: vacuolar-sorting receptor 1 [Cucumis melo]
Length=622

 Score =   181 bits (459),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 90/130 (69%), Positives = 104/130 (80%), Gaps = 2/130 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            T+GC CPPGFKGDG+  CED+DECKE++ACQCP+CKC+NTWGSY+CSCR  LLYMHEHDT
Sbjct  495  TEGCKCPPGFKGDGIRKCEDVDECKEKLACQCPECKCQNTWGSYDCSCRNGLLYMHEHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CI   G    SW  V + I  LA  G+ G+AVYKYRIRRYMDSEIRAIMAQYMPLDNQGE
Sbjct  555  CIGNIGNTVTSWSVVKITILVLAITGITGFAVYKYRIRRYMDSEIRAIMAQYMPLDNQGE  614

Query  384  VPNHVSHGNV  355
               +V+ G +
Sbjct  615  T--YVARGGI  622



>ref|XP_006300216.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
 gb|EOA33114.1| hypothetical protein CARUB_v10016452mg [Capsella rubella]
Length=629

 Score =   181 bits (459),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDG   CEDIDECKE+ ACQCP+C CKNTWGSYECSC G+LLYM +HDTCIS
Sbjct  502  CECPPGFKGDGTKKCEDIDECKEKKACQCPECSCKNTWGSYECSCSGDLLYMRDHDTCIS  561

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  562  KTGAQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVP  621

Query  378  NHVS  367
            NHV+
Sbjct  622  NHVN  625



>ref|XP_008244809.1| PREDICTED: vacuolar-sorting receptor 1-like [Prunus mume]
Length=622

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 105/131 (80%), Gaps = 4/131 (3%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            T GC CPPGFKGDG   CED+DECKE++ CQC  CKCKNTWGSYECSC G LLYM EHD 
Sbjct  495  TNGCKCPPGFKGDGEKTCEDVDECKEKVNCQCAQCKCKNTWGSYECSCGGGLLYMREHDA  554

Query  564  CISK-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            CISK A  +EF+WGF+WVII  L A GV GYAV  Y I RYMDSEIRAIMAQYMPLDNQG
Sbjct  555  CISKNASVSEFNWGFMWVIILCLGAVGVGGYAV--YNI-RYMDSEIRAIMAQYMPLDNQG  611

Query  387  EVPNHVSHGNV  355
            E+PNHV  G++
Sbjct  612  EIPNHVPRGDI  622



>gb|AGV54776.1| vacuolar-sorting receptor [Phaseolus vulgaris]
Length=625

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV +CEDIDECKE+ ACQCPDC CKNTWGSY+CSC G+LLYM +HDTCIS
Sbjct  498  CQCPTGFKGDGVKNCEDIDECKEKKACQCPDCSCKNTWGSYDCSCSGDLLYMRDHDTCIS  557

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W   W+I+ G+       + VYKYRIR+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  558  KTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEIRAIMAQYMPLDSQAEVP  617

Query  378  NHVS  367
            NHV+
Sbjct  618  NHVN  621



>ref|XP_009760191.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana sylvestris]
Length=631

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 102/124 (82%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  C+DIDECKE+ ACQCP+C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  504  CSCPPGFKGDGVKSCDDIDECKEKKACQCPECSCKNTWGSYECSCSGDLLYIRDHDTCIS  563

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A + + +W  VW I+ GLA AG   Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  564  KRAREVKSAWAAVWAILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQNEVP  623

Query  378  NHVS  367
            NHVS
Sbjct  624  NHVS  627



>ref|XP_010488908.1| PREDICTED: vacuolar-sorting receptor 4 [Camelina sativa]
Length=626

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLYM +HDTCIS
Sbjct  499  CECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYMRDHDTCIS  558

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K  G+   +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  559  KTGGQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVP  618

Query  378  NHVS  367
            NHV+
Sbjct  619  NHVN  622



>ref|XP_010517675.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLYM +HDTCIS
Sbjct  499  CECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYMRDHDTCIS  558

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  559  KTGAQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVP  618

Query  378  NHVS  367
            NHV+
Sbjct  619  NHVN  622



>ref|XP_010467255.1| PREDICTED: vacuolar-sorting receptor 4-like [Camelina sativa]
Length=626

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLYM +HDTCIS
Sbjct  499  CECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYMRDHDTCIS  558

Query  555  KA-GKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K  G+   +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  559  KTGGQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVP  618

Query  378  NHVS  367
            NHV+
Sbjct  619  NHVN  622



>ref|XP_002527509.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF34907.1| zinc finger protein, putative [Ricinus communis]
Length=633

 Score =   181 bits (458),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDECKE+ ACQCPDC CKNTWGSY+C+C G+LLY+ +HDTCIS
Sbjct  506  CECPPGFKGDGVKSCEDIDECKEKKACQCPDCSCKNTWGSYDCTCSGDLLYIRDHDTCIS  565

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W   WVI+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  566  KRGTEVRSAWAAFWVILIGLAMAAGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQAEVP  625

Query  378  NHVS  367
            NHV+
Sbjct  626  NHVN  629



>ref|XP_008805693.1| PREDICTED: vacuolar-sorting receptor 3-like [Phoenix dactylifera]
Length=633

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDG+  CEDIDECKE+ ACQCP+C CKNTWGSYEC+C G+LLY+ EHDTCIS
Sbjct  505  CTCPPGFKGDGIKTCEDIDECKEKTACQCPECSCKNTWGSYECTCSGDLLYIREHDTCIS  564

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K AG+A+ +   VWVI+  LA A    Y +YKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  565  KSAGEAKATQAAVWVILGVLAFAAFGAYILYKYRLRSYMDSEIRAIMAQYMPLDSQGEVP  624

Query  378  NHVSHGN  358
            NH    N
Sbjct  625  NHAHEQN  631



>ref|XP_004511312.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Cicer 
arietinum]
Length=623

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV +CEDIDECK++ ACQCP+C CKNTWGSY CSCRG+LLY+ + DTCIS
Sbjct  496  CQCPTGFKGDGVKNCEDIDECKDKKACQCPECSCKNTWGSYNCSCRGDLLYIKDQDTCIS  555

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A +   +W   WVI+ GL       + VYKYRIR+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  556  KTASQGRSTWAAFWVILIGLVMISGGAFLVYKYRIRQYMDSEIRAIMAQYMPLDSQAEVP  615

Query  378  NHVSH  364
            NHV+H
Sbjct  616  NHVNH  620



>gb|EEC82690.1| hypothetical protein OsI_27347 [Oryza sativa Indica Group]
Length=626

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 106/134 (79%), Gaps = 5/134 (4%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRG-NLLYMHEHD  568
            +KGC CPPGFKGDG+  CEDIDECK+++ CQC DC C+NTWGSYECSC G N+LYM EHD
Sbjct  494  SKGCKCPPGFKGDGIKSCEDIDECKDKLFCQCKDCSCENTWGSYECSCGGSNMLYMREHD  553

Query  567  TCISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            TCISK   +   WGF+WVI FGLA AG+  YAVYKYR+R YMDSEIRAIMAQYMPL+NQ 
Sbjct  554  TCISKVASSSVGWGFLWVIFFGLALAGIGAYAVYKYRLRSYMDSEIRAIMAQYMPLENQ-  612

Query  387  EVPNH---VSHGNV  355
            E PN    V H ++
Sbjct  613  ETPNQHRPVEHADI  626



>ref|NP_001060643.1| Os07g0680000 [Oryza sativa Japonica Group]
 dbj|BAC80001.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAD31218.1| putative vacuolar targeting receptor [Oryza sativa Japonica Group]
 dbj|BAF22557.1| Os07g0680000 [Oryza sativa Japonica Group]
 gb|EAZ41102.1| hypothetical protein OsJ_25594 [Oryza sativa Japonica Group]
 dbj|BAG93090.1| unnamed protein product [Oryza sativa Japonica Group]
Length=626

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 106/134 (79%), Gaps = 5/134 (4%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRG-NLLYMHEHD  568
            +KGC CPPGFKGDG+  CEDIDECK+++ CQC DC C+NTWGSYECSC G N+LYM EHD
Sbjct  494  SKGCKCPPGFKGDGIKSCEDIDECKDKLFCQCKDCSCENTWGSYECSCGGSNMLYMREHD  553

Query  567  TCISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            TCISK   +   WGF+WVI FGLA AG+  YAVYKYR+R YMDSEIRAIMAQYMPL+NQ 
Sbjct  554  TCISKVASSSVGWGFLWVIFFGLALAGIGAYAVYKYRLRSYMDSEIRAIMAQYMPLENQ-  612

Query  387  EVPNH---VSHGNV  355
            E PN    V H ++
Sbjct  613  ETPNQHRPVEHADI  626



>ref|XP_008454392.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X1 [Cucumis 
melo]
Length=633

 Score =   180 bits (456),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGF+GDGV  CEDI+ECKER ACQC +C C NTWGSY+CSC G+LLYM +HD CIS
Sbjct  503  CKCPPGFRGDGVKTCEDINECKERKACQCSECSCTNTWGSYDCSCSGDLLYMRDHDICIS  562

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A  A+ SW F WVI+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  563  KNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYRLRAYMDSEIRAIMAQYMPLDSQGEVP  622

Query  378  NHVS  367
            NHV+
Sbjct  623  NHVN  626



>ref|XP_008454393.1| PREDICTED: vacuolar-sorting receptor 4-like isoform X2 [Cucumis 
melo]
Length=632

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGF+GDGV  CEDI+ECKER ACQC +C C NTWGSY+CSC G+LLYM +HD CIS
Sbjct  502  CKCPPGFRGDGVKTCEDINECKERKACQCSECSCTNTWGSYDCSCSGDLLYMRDHDICIS  561

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A  A+ SW F WVI+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  562  KNASAAKSSWSFFWVILIGLAIAAGGAYMVYKYRLRAYMDSEIRAIMAQYMPLDSQGEVP  621

Query  378  NHVS  367
            NHV+
Sbjct  622  NHVN  625



>ref|XP_004511311.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Cicer 
arietinum]
Length=654

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV +CEDIDECK++ ACQCP+C CKNTWGSY CSCRG+LLY+ + DTCIS
Sbjct  527  CQCPTGFKGDGVKNCEDIDECKDKKACQCPECSCKNTWGSYNCSCRGDLLYIKDQDTCIS  586

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A +   +W   WVI+ GL       + VYKYRIR+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  587  KTASQGRSTWAAFWVILIGLVMISGGAFLVYKYRIRQYMDSEIRAIMAQYMPLDSQAEVP  646

Query  378  NHVSH  364
            NHV+H
Sbjct  647  NHVNH  651



>ref|XP_007199755.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
 gb|EMJ00954.1| hypothetical protein PRUPE_ppa002822mg [Prunus persica]
Length=629

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV  CED+DECKE+ ACQCP+C CKNTWGSY+CSC GNLLY+ +HDTCIS
Sbjct  502  CQCPHGFKGDGVKSCEDVDECKEKKACQCPECTCKNTWGSYDCSCSGNLLYIKDHDTCIS  561

Query  555  KAGK-AEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            KA    + +W  VWVI+ GLA AG   Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  562  KAASGGKSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQAEVP  621

Query  378  NHVS  367
            NHV+
Sbjct  622  NHVN  625



>gb|EMS63262.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=864

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 123/192 (64%), Gaps = 31/192 (16%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            GC CP GFKGDGV  CED+DECKER ACQC +CKCKNTWGSYEC C G LLYM EHDTCI
Sbjct  434  GCKCPVGFKGDGVHKCEDVDECKERTACQCKECKCKNTWGSYECGCGGGLLYMKEHDTCI  493

Query  558  S--------------KAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAI  421
            +              K   A   W F+W ++FGLAA G+AGYAVYKYRIR YMDSEIRAI
Sbjct  494  NYLLKAYKVNTFYSGKDAGARVGWNFLWFLLFGLAAVGIAGYAVYKYRIRSYMDSEIRAI  553

Query  420  MAQYMPLDNQGEVPNHVSHGNV*ASSYHRLAGWLAGISVTKP-PL----QIKNQNPYNLA  256
            MAQYMPLDNQGE+PNH  H  +          W  G+  +KP P+     ++      + 
Sbjct  554  MAQYMPLDNQGEIPNHSHHIEI----------W--GVVSSKPYPVLALPSVRKNKKAMVD  601

Query  255  LRSFYPMPLPSR  220
            + S  P P+P++
Sbjct  602  VVSSTPYPVPAK  613



>ref|NP_179079.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 ref|NP_849954.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 sp|Q56ZQ3.2|VSR4_ARATH RecName: Full=Vacuolar-sorting receptor 4; Short=AtVSR4; AltName: 
Full=BP80-like protein a; Short=AtBP80a; AltName: Full=Epidermal 
growth factor receptor-like protein 2b; Short=AtELP2b; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24185.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAL32822.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15052.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAP37749.1| At2g14720 [Arabidopsis thaliana]
 gb|AEC06326.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
 gb|AEC06327.1| vacuolar-sorting receptor 4 [Arabidopsis thaliana]
Length=628

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLYM +HDTCIS
Sbjct  501  CECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYMRDHDTCIS  560

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G + + +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  561  KTGSQVKSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVP  620

Query  378  NHVS  367
            NH +
Sbjct  621  NHTN  624



>gb|KHN30433.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=643

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GF+GDGV +C+DIDECKE+ ACQCPDC CKNTWGSY+CSC G+LLYM +HDTCIS
Sbjct  516  CQCPTGFRGDGVKNCQDIDECKEKKACQCPDCSCKNTWGSYDCSCSGDLLYMRDHDTCIS  575

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W   W+I+ G+       + VYKYRIR+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  576  KTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEIRAIMAQYMPLDSQAEVP  635

Query  378  NHVS  367
            NHV+
Sbjct  636  NHVN  639



>ref|XP_010529936.1| PREDICTED: vacuolar-sorting receptor 1 isoform X1 [Tarenaya hassleriana]
Length=626

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 104/130 (80%), Gaps = 5/130 (4%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +K C CPPGFKGDGV  CED+DECKE++ACQCP+CKCKNTWGSYECSC   LLYM EHDT
Sbjct  495  SKDCKCPPGFKGDGVKKCEDVDECKEKVACQCPECKCKNTWGSYECSCSSGLLYMREHDT  554

Query  564  CI--SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI   K G  + SW  +W++IF LAAA ++GYA+YKYRIR YMDSEIRAIMAQYMPLD+Q
Sbjct  555  CIGSGKVGATKLSWSMLWILIFALAAASLSGYALYKYRIRSYMDSEIRAIMAQYMPLDSQ  614

Query  390  GEVPNHVSHG  361
               PN  S G
Sbjct  615  ---PNTASTG  621



>ref|XP_003517598.2| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=643

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GF+GDGV +C+DIDECKE+ ACQCPDC CKNTWGSY+CSC G+LLYM +HDTCIS
Sbjct  516  CQCPTGFRGDGVKNCQDIDECKEKKACQCPDCSCKNTWGSYDCSCSGDLLYMRDHDTCIS  575

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W   W+I+ G+       + VYKYRIR+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  576  KTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEIRAIMAQYMPLDSQAEVP  635

Query  378  NHVS  367
            NHV+
Sbjct  636  NHVN  639



>ref|XP_006658133.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   179 bits (454),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 104/133 (78%), Gaps = 3/133 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRG-NLLYMHEHD  568
            +KGC CPPGFKGDG+  CEDIDECK+++ CQC DC C NTWGSYECSC G N+LYM EHD
Sbjct  498  SKGCKCPPGFKGDGINSCEDIDECKDKLFCQCKDCTCDNTWGSYECSCGGNNMLYMREHD  557

Query  567  TCISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            TCISK G +   WGF+WVI FGLA AGV  YAVYKYR+R YMDSEIRAIMAQYMPL+NQ 
Sbjct  558  TCISKVGSSSVGWGFLWVIFFGLALAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLENQE  617

Query  387  EVPNH--VSHGNV  355
                H  V H ++
Sbjct  618  TQNQHRPVEHADI  630



>gb|AAB72112.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=630

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLYM +HDTCIS
Sbjct  503  CECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYMRDHDTCIS  562

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G + + +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  563  KTGSQVKSAWAGVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVP  622

Query  378  NHVS  367
            NH +
Sbjct  623  NHTN  626



>emb|CDY65441.1| BnaCnng47180D [Brassica napus]
Length=631

 Score =   179 bits (453),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  504  CECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYIRDHDTCIS  563

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G + + +W  VW+I+  L  A    Y VYK+R+R+YMDSEIRAIMAQYMPLDNQ EVP
Sbjct  564  KTGSQVKSAWTAVWLIVLSLGLAAGGAYLVYKHRLRQYMDSEIRAIMAQYMPLDNQPEVP  623

Query  378  NHVS  367
            NHV+
Sbjct  624  NHVN  627



>gb|KHN05603.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=628

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GF+GDGV +CEDIDECKE+ ACQCP+C CKNTWGSY+CSC G+LLYM +HDTCIS
Sbjct  501  CQCPTGFRGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYDCSCSGDLLYMRDHDTCIS  560

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W   W+I+ G+       + VYKYRIR+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  561  KTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEIRAIMAQYMPLDSQAEVP  620

Query  378  NHVS  367
            NHV+
Sbjct  621  NHVN  624



>ref|XP_003538018.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=628

 Score =   178 bits (452),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GF+GDGV +CEDIDECKE+ ACQCP+C CKNTWGSY+CSC G+LLYM +HDTCIS
Sbjct  501  CQCPTGFRGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYDCSCSGDLLYMRDHDTCIS  560

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W   W+I+ G+       + VYKYRIR+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  561  KTGSQGRSTWAAFWLILLGVVMIAGGAFLVYKYRIRQYMDSEIRAIMAQYMPLDSQAEVP  620

Query  378  NHVS  367
            NHV+
Sbjct  621  NHVN  624



>ref|XP_011030346.1| PREDICTED: vacuolar-sorting receptor 3-like [Populus euphratica]
Length=630

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C+CPPGFKGDGV  C D+DECKER ACQCP C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  503  CHCPPGFKGDGVKSCVDVDECKERKACQCPACSCKNTWGSYECSCSGDLLYIRDHDTCIS  562

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K+G + + +W  VWVI  GLA A   GY VYK+++R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  563  KSGTEVKSAWTVVWVIFIGLAMAAGGGYLVYKHKLRSYMDSEIRAIMAQYMPLDSQAEVP  622

Query  378  NHV  370
            NHV
Sbjct  623  NHV  625



>ref|XP_002883854.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60113.1| hypothetical protein ARALYDRAFT_899691 [Arabidopsis lyrata subsp. 
lyrata]
Length=627

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDG+  CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  500  CQCPPGFKGDGIKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYIRDHDTCIS  559

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  560  KTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVP  619

Query  378  NHVS  367
            NHV+
Sbjct  620  NHVN  623



>ref|XP_009598407.1| PREDICTED: vacuolar-sorting receptor 3-like [Nicotiana tomentosiformis]
Length=631

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDG   CED+DECK++ ACQCP+C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  504  CSCPPGFKGDGFKSCEDVDECKDKKACQCPECSCKNTWGSYECSCSGDLLYIRDHDTCIS  563

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A + + +W  VW I+ GLA AG   Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  564  KRAREVKSAWAAVWAILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQNEVP  623

Query  378  NHVS  367
            NHVS
Sbjct  624  NHVS  627



>ref|XP_006409638.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
 gb|ESQ51091.1| hypothetical protein EUTSA_v10022598mg [Eutrema salsugineum]
Length=626

 Score =   178 bits (451),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGF+GDG+  CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  499  CECPPGFRGDGIKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYIRDHDTCIS  558

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L  A    Y VYKYR+RRYMDSEIRAIMAQYMPLD+Q E+P
Sbjct  559  KTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRRYMDSEIRAIMAQYMPLDSQPEIP  618

Query  378  NHVS  367
            NHV+
Sbjct  619  NHVN  622



>emb|CDY37219.1| BnaA09g08400D [Brassica napus]
Length=624

 Score =   178 bits (451),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDG   CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLYM +HDTCIS
Sbjct  497  CECPPGFKGDGFKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYMRDHDTCIS  556

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  557  KTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVP  616

Query  378  NHVS  367
            NHV+
Sbjct  617  NHVN  620



>ref|XP_009123210.1| PREDICTED: vacuolar-sorting receptor 3-like [Brassica rapa]
Length=624

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDG   CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLYM +HDTCIS
Sbjct  497  CECPPGFKGDGFKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYMRDHDTCIS  556

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  557  KTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVP  616

Query  378  NHVS  367
            NHV+
Sbjct  617  NHVN  620



>emb|CDX93144.1| BnaA03g38660D [Brassica napus]
Length=610

 Score =   177 bits (450),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  483  CECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYIRDHDTCIS  542

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G + + +W  VW+I+  L  A    Y VYK+R+R+YMDSEIRAIMAQYMPLDNQ EVP
Sbjct  543  KIGSQVKSAWTAVWLIMLSLGLAAGGAYLVYKHRLRQYMDSEIRAIMAQYMPLDNQPEVP  602

Query  378  NHVS  367
            NHV+
Sbjct  603  NHVN  606



>ref|XP_010065899.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW63606.1| hypothetical protein EUGRSUZ_G01233 [Eucalyptus grandis]
Length=644

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 103/125 (82%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV  CEDIDECKE+ ACQCP+C CKNTWGSYEC+C G+LLY+ +HDTCIS
Sbjct  517  CQCPRGFKGDGVKTCEDIDECKEKKACQCPECSCKNTWGSYECTCSGDLLYIRDHDTCIS  576

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K+  + + +W  VWVI+ GLA AG  GY VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  577  KSSTETKSAWAAVWVIVIGLAMAGGGGYLVYKYRLRSYMDSEIRAIMAQYMPLDSQAEVP  636

Query  378  NHVSH  364
            NHV+ 
Sbjct  637  NHVNE  641



>ref|XP_009136249.1| PREDICTED: vacuolar-sorting receptor 3 [Brassica rapa]
Length=631

 Score =   177 bits (450),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 101/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  504  CECPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYIRDHDTCIS  563

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G + + +W  VW+I+  L  A    Y VYK+R+R+YMDSEIRAIMAQYMPLDNQ EVP
Sbjct  564  KIGSQVKSAWTAVWLIMLSLGLAAGGAYLVYKHRLRQYMDSEIRAIMAQYMPLDNQPEVP  623

Query  378  NHVS  367
            NHV+
Sbjct  624  NHVN  627



>ref|XP_006297095.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
 gb|EOA29993.1| hypothetical protein CARUB_v10013097mg, partial [Capsella rubella]
Length=698

 Score =   178 bits (451),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDG+  CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G LLY+ +HDTCIS
Sbjct  571  CQCPPGFKGDGIKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGGLLYIRDHDTCIS  630

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G + + +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q E+P
Sbjct  631  KTGAQVKSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEIP  690

Query  378  NHVS  367
            NHV+
Sbjct  691  NHVN  694



>gb|KFK39979.1| hypothetical protein AALP_AA3G314200 [Arabis alpina]
Length=627

 Score =   177 bits (450),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDG+  CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  500  CECPPGFKGDGIKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYIRDHDTCIS  559

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  +W+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  560  KTGAQVRSAWAAIWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVP  619

Query  378  NHVS  367
            NHV+
Sbjct  620  NHVN  623



>ref|XP_006422827.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
 gb|ESR36067.1| hypothetical protein CICLE_v10028015mg [Citrus clementina]
Length=631

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  C DIDECKER ACQC +C CKNTWGSYEC+C G+LLY+ +HDTCIS
Sbjct  504  CQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKNTWGSYECTCSGDLLYIRDHDTCIS  563

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A +   +W  VWVI+ GLA AG   Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  564  KTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQSEVP  623

Query  378  NHVS  367
            NHV+
Sbjct  624  NHVN  627



>ref|XP_009372030.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Pyrus 
x bretschneideri]
Length=625

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 101/131 (77%), Gaps = 1/131 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            T GC CPPGFKGDG   CED+DECKE+  CQC  CKCKNTWGSY+CSC G LLYM  +D 
Sbjct  495  TNGCSCPPGFKGDGEKTCEDVDECKEKTVCQCAHCKCKNTWGSYDCSCGGGLLYMQAYDA  554

Query  564  CISK-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            CISK A  +  SWG +W+II  L A GV GYAVYKYRIRRYMDSEIRAIMAQYMPL N+G
Sbjct  555  CISKNASGSGSSWGLIWIIILCLGAVGVGGYAVYKYRIRRYMDSEIRAIMAQYMPLGNEG  614

Query  387  EVPNHVSHGNV  355
            E P HVS G +
Sbjct  615  EAPGHVSRGEI  625



>ref|XP_011092498.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=630

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGF+GDGV  C DIDECKE+ ACQCP+C CKNTWGSYEC+C G+LLY+ EHDTCIS
Sbjct  503  CTCPPGFRGDGVKSCVDIDECKEKKACQCPECSCKNTWGSYECACSGDLLYIREHDTCIS  562

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K   + + +W  VW+I+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  563  KTTAEVKSAWTAVWIILIGLAMAAGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQNEVP  622

Query  378  NHV  370
            NHV
Sbjct  623  NHV  625



>ref|XP_006409641.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
 gb|ESQ51094.1| hypothetical protein EUTSA_v10022594mg [Eutrema salsugineum]
Length=631

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLYM +HDTCIS
Sbjct  504  CQCPPGFKGDGVKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYMRDHDTCIS  563

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EV 
Sbjct  564  KTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVA  623

Query  378  NHVS  367
            NHV+
Sbjct  624  NHVN  627



>ref|NP_179081.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 ref|NP_849955.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 sp|O80977.1|VSR3_ARATH RecName: Full=Vacuolar-sorting receptor 3; Short=AtVSR3; AltName: 
Full=BP80-like protein a'; Short=AtBP80a'; AltName: Full=Epidermal 
growth factor receptor-like protein 2a; Short=AtELP2a; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC24183.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AAM15053.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC06328.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
 gb|AEC06329.1| vacuolar-sorting receptor 3 [Arabidopsis thaliana]
Length=628

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDG   CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  501  CECPPGFKGDGTKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYIRDHDTCIS  560

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q E+P
Sbjct  561  KTGAQVRSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEIP  620

Query  378  NHVS  367
            NHV+
Sbjct  621  NHVN  624



>ref|XP_002298772.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
 gb|EEE83577.1| hypothetical protein POPTR_0001s30160g [Populus trichocarpa]
Length=630

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 100/123 (81%), Gaps = 1/123 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  C D+DECKER ACQCP C CK+TWGSYECSC G+LLYM +HDTCIS
Sbjct  503  CQCPPGFKGDGVKSCLDVDECKERKACQCPACSCKDTWGSYECSCSGDLLYMRDHDTCIS  562

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K+G + + +W  VWVI  GLA A   GY VYK+++R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  563  KSGTEVKSAWTVVWVIFIGLAMAAGGGYLVYKHKLRSYMDSEIRAIMAQYMPLDSQAEVP  622

Query  378  NHV  370
            NHV
Sbjct  623  NHV  625



>gb|KJB29886.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=623

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 104/132 (79%), Gaps = 5/132 (4%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            + GC CPPGFKGDGV  CED+DECKE++ACQCP CKCKNTWGSYECSC    LYM EHD 
Sbjct  495  SHGCKCPPGFKGDGVNGCEDVDECKEKLACQCPGCKCKNTWGSYECSCCDGSLYMREHDM  554

Query  564  CIS--KAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI+  K GK E S GF+W II GL  AG  GYA+YKYRIRRYMDSEIRAIMAQYMPLDNQ
Sbjct  555  CINAGKNGKTEVSSGFIWAIILGLVVAGAVGYAIYKYRIRRYMDSEIRAIMAQYMPLDNQ  614

Query  390  GEVPNHVSHGNV  355
               P+++ H ++
Sbjct  615  ---PSNIHHPDI  623



>gb|KHN06808.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 98/126 (78%), Gaps = 2/126 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV +CEDIDECKE+ ACQCP+C CKNTWGSY+C+C G+LLY+ +HDTCIS
Sbjct  503  CKCPAGFKGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYDCTCSGDLLYIRDHDTCIS  562

Query  555  KAGKAE--FSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEV  382
            K    E   +W   WVI+ GL  A    Y VYKYRIR YMDSEIRAIMAQYMPLD+QGE+
Sbjct  563  KTASQEGRSAWAAFWVILIGLVVAAAGAYLVYKYRIRSYMDSEIRAIMAQYMPLDSQGEI  622

Query  381  PNHVSH  364
             NHVS 
Sbjct  623  VNHVSE  628



>ref|XP_004230700.1| PREDICTED: vacuolar-sorting receptor 3 [Solanum lycopersicum]
Length=630

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDEC+E+ ACQCP+C CKNTWGSYECSC G LLY+ +HDTCIS
Sbjct  503  CTCPPGFKGDGVKSCEDIDECREKKACQCPECSCKNTWGSYECSCSGELLYIRDHDTCIS  562

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A + + +W  VW I+ GLA AG   Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EV 
Sbjct  563  KRAREVKSAWAAVWAILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQNEVQ  622

Query  378  NHVSHGNV  355
            +HV+ G+ 
Sbjct  623  SHVNEGHA  630



>gb|KJB29887.1| hypothetical protein B456_005G122400 [Gossypium raimondii]
Length=621

 Score =   177 bits (448),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 104/132 (79%), Gaps = 5/132 (4%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            + GC CPPGFKGDGV  CED+DECKE++ACQCP CKCKNTWGSYECSC    LYM EHD 
Sbjct  493  SHGCKCPPGFKGDGVNGCEDVDECKEKLACQCPGCKCKNTWGSYECSCCDGSLYMREHDM  552

Query  564  CIS--KAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI+  K GK E S GF+W II GL  AG  GYA+YKYRIRRYMDSEIRAIMAQYMPLDNQ
Sbjct  553  CINAGKNGKTEVSSGFIWAIILGLVVAGAVGYAIYKYRIRRYMDSEIRAIMAQYMPLDNQ  612

Query  390  GEVPNHVSHGNV  355
               P+++ H ++
Sbjct  613  ---PSNIHHPDI  621



>ref|XP_003536576.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 98/126 (78%), Gaps = 2/126 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV +CEDIDECKE+ ACQCP+C CKNTWGSY+C+C G+LLY+ +HDTCIS
Sbjct  503  CKCPAGFKGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYDCTCSGDLLYIRDHDTCIS  562

Query  555  KAGKAE--FSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEV  382
            K    E   +W   WVI+ GL  A    Y VYKYRIR YMDSEIRAIMAQYMPLD+QGE+
Sbjct  563  KTASQEGRSAWAAFWVILIGLVVAAAGAYLVYKYRIRSYMDSEIRAIMAQYMPLDSQGEI  622

Query  381  PNHVSH  364
             NHVS 
Sbjct  623  VNHVSE  628



>emb|CDY38158.1| BnaA07g02250D [Brassica napus]
Length=302

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGFK DG+ +CED++EC+E+ ACQC  CKCKNTWGSYECSC G+LLY+ EHD 
Sbjct  174  SKGCKCPPGFKRDGLKNCEDVNECEEKTACQCRGCKCKNTWGSYECSCSGSLLYIREHDI  233

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CISK  + + SWG +W+I+ GL AA +  Y VYKYRIR YMDSEIRAIMAQYMPLDN 
Sbjct  234  CISKDARGDVSWGVIWIILMGLGAAALGAYTVYKYRIRTYMDSEIRAIMAQYMPLDNH  291



>ref|XP_012093114.1| PREDICTED: vacuolar-sorting receptor 3 [Jatropha curcas]
 gb|KDP44487.1| hypothetical protein JCGZ_16320 [Jatropha curcas]
Length=630

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDG T CEDIDECK+R ACQCP+C CKNTWGSY+C+C G+LLY+ +HDTCIS
Sbjct  503  CQCPTGFKGDGTTKCEDIDECKDRTACQCPECNCKNTWGSYDCTCSGDLLYIRDHDTCIS  562

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W   WVI+ GL  A   GY +YKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  563  KRGTEVRSAWAAFWVILIGLGMAAGGGYLIYKYRLRSYMDSEIRAIMAQYMPLDSQAEVP  622

Query  378  NHVS  367
            NHV+
Sbjct  623  NHVN  626



>emb|CDY62642.1| BnaCnng40690D [Brassica napus]
Length=140

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = -1

Query  741  KGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTC  562
            KGC CPPGF GDG  +C D++EC+E+  CQC  CKCKNTWGSYECSC G+LLY+ EHD C
Sbjct  14   KGCKCPPGFSGDGFKNCTDVNECEEKTVCQCRGCKCKNTWGSYECSCNGSLLYIREHDIC  73

Query  561  ISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            ISK  + + SWG +W+II GL AA +  Y VYKYRIR YMDSEIRAIMAQYMPLDN 
Sbjct  74   ISKDARGDASWGVIWIIIMGLGAAALGAYTVYKYRIRTYMDSEIRAIMAQYMPLDNH  130



>emb|CDX81459.1| BnaC09g08700D [Brassica napus]
Length=624

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDG   CEDI+ECKE+ ACQCP+C CKNTWGSY+CSC G+LLYM +HDTCIS
Sbjct  497  CECPPGFKGDGFKKCEDINECKEKKACQCPECSCKNTWGSYDCSCSGDLLYMRDHDTCIS  556

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  557  KTGSQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVP  616

Query  378  NHVS  367
            NHV+
Sbjct  617  NHVN  620



>gb|ERN10922.1| hypothetical protein AMTR_s00164p00059220 [Amborella trichopoda]
Length=611

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 1/127 (1%)
 Frame = -1

Query  741  KGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTC  562
            KGC CP GF+GDG+  CEDIDECKE+ ACQCP+C CK+TWG YEC+C G+LLY+ +HDTC
Sbjct  482  KGCQCPAGFRGDGIKSCEDIDECKEKRACQCPECSCKDTWGGYECTCSGDLLYITDHDTC  541

Query  561  ISK-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            ISK A + + +W  +WVI  GLA A    Y VYKYR++ YMDSEIRAIMAQYMPLD+Q E
Sbjct  542  ISKSAQQVKTAWAAMWVIFIGLAVAAAGAYIVYKYRLKSYMDSEIRAIMAQYMPLDSQSE  601

Query  384  VPNHVSH  364
            VPNHVS 
Sbjct  602  VPNHVSE  608



>emb|CDO97275.1| unnamed protein product [Coffea canephora]
Length=630

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CED+DECKE+ ACQC +C CKNTWGSY+CSC G+LLY+ +HDTCIS
Sbjct  503  CACPPGFKGDGVKSCEDVDECKEKKACQCAECSCKNTWGSYDCSCSGDLLYIRDHDTCIS  562

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A + +  W  VWVI+ GL  AG   Y VYKYR R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  563  KRATEVKSGWAAVWVILIGLGMAGGGAYLVYKYRWRSYMDSEIRAIMAQYMPLDSQNEVP  622

Query  378  NHVS  367
            NHVS
Sbjct  623  NHVS  626



>ref|XP_006346308.1| PREDICTED: vacuolar-sorting receptor 3-like [Solanum tuberosum]
Length=630

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDEC+E+ ACQCP+C CKNTWGSYECSC G LLY+ +HDTCIS
Sbjct  503  CSCPPGFKGDGVKSCEDIDECREKKACQCPECSCKNTWGSYECSCSGELLYIRDHDTCIS  562

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A + + +W  VW I+ GLA AG   Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EV 
Sbjct  563  KRAREVKSAWAAVWAILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQSEVQ  622

Query  378  NHVSH  364
            NHV+ 
Sbjct  623  NHVNE  627



>ref|XP_010488909.1| PREDICTED: vacuolar-sorting receptor 3 [Camelina sativa]
Length=626

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDG+  CEDI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLYM +HDTCIS
Sbjct  499  CECPPGFKGDGIKKCEDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYMRDHDTCIS  558

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EV 
Sbjct  559  KTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVQ  618

Query  378  NHVS  367
            NHV+
Sbjct  619  NHVN  622



>ref|XP_006849341.2| PREDICTED: vacuolar-sorting receptor 3 isoform X1 [Amborella 
trichopoda]
Length=629

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 1/127 (1%)
 Frame = -1

Query  741  KGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTC  562
            KGC CP GF+GDG+  CEDIDECKE+ ACQCP+C CK+TWG YEC+C G+LLY+ +HDTC
Sbjct  500  KGCQCPAGFRGDGIKSCEDIDECKEKRACQCPECSCKDTWGGYECTCSGDLLYITDHDTC  559

Query  561  ISK-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            ISK A + + +W  +WVI  GLA A    Y VYKYR++ YMDSEIRAIMAQYMPLD+Q E
Sbjct  560  ISKSAQQVKTAWAAMWVIFIGLAVAAAGAYIVYKYRLKSYMDSEIRAIMAQYMPLDSQSE  619

Query  384  VPNHVSH  364
            VPNHVS 
Sbjct  620  VPNHVSE  626



>ref|XP_008370266.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Malus 
domestica]
Length=625

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/131 (73%), Positives = 105/131 (80%), Gaps = 1/131 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            T GC CPPGFKGDG   CED+DECKE+ ACQC  CKCKNTWGSYECSC G LLYM E+D 
Sbjct  495  TNGCSCPPGFKGDGEKTCEDVDECKEKTACQCSQCKCKNTWGSYECSCGGGLLYMRENDA  554

Query  564  CISK-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            CI K    +  SWG +WVII  L A GV G+AVYKYRIRRYMDSEIRAIMAQYMPLDNQG
Sbjct  555  CIGKNGSGSGSSWGLIWVIILCLGAVGVGGFAVYKYRIRRYMDSEIRAIMAQYMPLDNQG  614

Query  387  EVPNHVSHGNV  355
            EVP+HV+ G++
Sbjct  615  EVPSHVARGDI  625



>ref|XP_002885935.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62194.1| VSR-2 [Arabidopsis lyrata subsp. lyrata]
Length=627

 Score =   176 bits (445),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 98/124 (79%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDI+ECKE+  CQCP+C CKNTWGSYECSC G+LLYM +HD CIS
Sbjct  500  CECPPGFKGDGVKKCEDINECKEKKTCQCPECSCKNTWGSYECSCSGDLLYMRDHDACIS  559

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G + + +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q E+P
Sbjct  560  KTGSQVKSAWAAVWLIMLSLGLAAAGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEIP  619

Query  378  NHVS  367
            NH +
Sbjct  620  NHAN  623



>gb|KDO57884.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=629

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  C DIDECKER ACQC +C CK+TWGSYEC+C G+LLY+ +HDTCIS
Sbjct  502  CQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYECTCSGDLLYIRDHDTCIS  561

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A +   +W  VWVI+ GLA AG   Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  562  KTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQSEVP  621

Query  378  NHVS  367
            NHV+
Sbjct  622  NHVN  625



>gb|KDO57885.1| hypothetical protein CISIN_1g006786mg [Citrus sinensis]
Length=631

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  C DIDECKER ACQC +C CK+TWGSYEC+C G+LLY+ +HDTCIS
Sbjct  504  CQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYECTCSGDLLYIRDHDTCIS  563

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A +   +W  VWVI+ GLA AG   Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  564  KTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQSEVP  623

Query  378  NHVS  367
            NHV+
Sbjct  624  NHVN  627



>ref|XP_006486921.1| PREDICTED: vacuolar-sorting receptor 3-like [Citrus sinensis]
Length=631

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  C DIDECKER ACQC +C CK+TWGSYEC+C G+LLY+ +HDTCIS
Sbjct  504  CQCPPGFKGDGVKSCVDIDECKERKACQCSECSCKDTWGSYECTCSGDLLYIRDHDTCIS  563

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A +   +W  VWVI+ GLA AG   Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  564  KTATEVRSAWAAVWVILIGLAMAGGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQSEVP  623

Query  378  NHVS  367
            NHV+
Sbjct  624  NHVN  627



>gb|KHN42313.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=631

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV +CEDIDECKE+ ACQCP+C CKNTWGSY+C+C G+LLY+ +HDTCIS
Sbjct  503  CQCPAGFKGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYDCTCSGDLLYIRDHDTCIS  562

Query  555  KAGKAE--FSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEV  382
            K    E   +W   WVI+ GL  A    Y VYKYRIR YMDSEIRAIMAQYMPLD+QGEV
Sbjct  563  KTASQEGRSAWAAFWVILVGLVVAAAGAYLVYKYRIRSYMDSEIRAIMAQYMPLDSQGEV  622

Query  381  PNHV  370
             NHV
Sbjct  623  VNHV  626



>ref|XP_003555992.1| PREDICTED: vacuolar-sorting receptor 1-like isoform 1 [Glycine 
max]
Length=631

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 97/124 (78%), Gaps = 2/124 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV +CEDIDECKE+ ACQCP+C CKNTWGSY+C+C G+LLY+ +HDTCIS
Sbjct  503  CQCPAGFKGDGVKNCEDIDECKEKKACQCPECSCKNTWGSYDCTCSGDLLYIRDHDTCIS  562

Query  555  KAGKAE--FSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEV  382
            K    E   +W   WVI+ GL  A    Y VYKYRIR YMDSEIRAIMAQYMPLD+QGEV
Sbjct  563  KTASQEGRSAWAAFWVILVGLVVAAAGAYLVYKYRIRSYMDSEIRAIMAQYMPLDSQGEV  622

Query  381  PNHV  370
             NHV
Sbjct  623  VNHV  626



>ref|XP_008384516.1| PREDICTED: vacuolar-sorting receptor 3-like [Malus domestica]
Length=629

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 99/126 (79%), Gaps = 2/126 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI-  559
            C CPPGFKG+GV  CEDIDECK+R ACQCP+C CKNTWGSY+CSC GNLLY+ +HDTCI 
Sbjct  501  CQCPPGFKGBGVKSCEDIDECKDRKACQCPECSCKNTWGSYDCSCSGNLLYIRDHDTCIS  560

Query  558  -SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEV  382
             S  G    +W  VWVI+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EV
Sbjct  561  KSSGGGKSSAWVAVWVILIGLAMAAGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQAEV  620

Query  381  PNHVSH  364
            PNHV+ 
Sbjct  621  PNHVNE  626



>ref|XP_010517715.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X2 [Camelina 
sativa]
Length=626

 Score =   175 bits (444),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDG+  CEDI+ECKE+ ACQCP+C CKNTWGS+ECSC G+LLYM +HDTCIS
Sbjct  499  CQCPPGFKGDGIKKCEDINECKEKKACQCPECSCKNTWGSFECSCSGDLLYMRDHDTCIS  558

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EV 
Sbjct  559  KTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVQ  618

Query  378  NHVS  367
            NHV+
Sbjct  619  NHVN  622



>ref|XP_010517708.1| PREDICTED: vacuolar-sorting receptor 3-like isoform X1 [Camelina 
sativa]
Length=626

 Score =   175 bits (444),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDG+  CEDI+ECKE+ ACQCP+C CKNTWGS+ECSC G+LLYM +HDTCIS
Sbjct  499  CQCPPGFKGDGIKKCEDINECKEKKACQCPECSCKNTWGSFECSCSGDLLYMRDHDTCIS  558

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EV 
Sbjct  559  KTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVQ  618

Query  378  NHVS  367
            NHV+
Sbjct  619  NHVN  622



>ref|XP_010467256.1| PREDICTED: vacuolar-sorting receptor 3-like [Camelina sativa]
Length=629

 Score =   175 bits (443),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 99/124 (80%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDG+  C+DI+ECKE+ ACQCP+C CKNTWGSYECSC G+LLYM +HDTCIS
Sbjct  502  CECPPGFKGDGIKKCDDINECKEKKACQCPECSCKNTWGSYECSCSGDLLYMRDHDTCIS  561

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L  A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EV 
Sbjct  562  KTGAQVRSAWAAVWLIMLSLGLAAGGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVQ  621

Query  378  NHVS  367
            NHV+
Sbjct  622  NHVN  625



>ref|XP_011457866.1| PREDICTED: vacuolar-sorting receptor 3 [Fragaria vesca subsp. 
vesca]
Length=630

 Score =   175 bits (443),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 98/125 (78%), Gaps = 2/125 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI-  559
            C CPPGFKGDGV  CEDIDECKE+ ACQCP+C CKNTWGSY+CSC  NLLY+ +HDTCI 
Sbjct  502  CKCPPGFKGDGVKTCEDIDECKEKKACQCPECSCKNTWGSYDCSCSANLLYIRDHDTCIS  561

Query  558  -SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEV  382
             +  G    +W  VWVI+ GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EV
Sbjct  562  KTSGGSKSSAWAAVWVILIGLAMASGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQAEV  621

Query  381  PNHVS  367
            PNHV+
Sbjct  622  PNHVN  626



>gb|AAB72113.1| vacuolar sorting receptor homolog [Zea mays]
Length=152

 Score =   164 bits (415),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSC-RGNLLYMHEHD  568
            ++GC CP GFKGDG   CEDIDEC+E++ CQC  C CKNTWGSYECSC   N+LYM EHD
Sbjct  19   SEGCKCPVGFKGDGEKSCEDIDECQEKLYCQCKGCSCKNTWGSYECSCGDDNMLYMREHD  78

Query  567  TCISKAGKA-EFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            TCISK G A    W F+WVI FGL  AGV  YAVYKYR+R YMDSEIRAIMAQYMPLDNQ
Sbjct  79   TCISKEGTATTVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLDNQ  138

Query  390  -GEVPNHVSHGN  358
             G   + V H N
Sbjct  139  VGANQHQVVHAN  150



>ref|XP_008370265.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Malus 
domestica]
Length=626

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 107/134 (80%), Gaps = 6/134 (4%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            T GC CPPGFKGDG   CED+DECKE+ ACQC  CKCKNTWGSYECSC G LLYM E+D 
Sbjct  495  TNGCSCPPGFKGDGEKTCEDVDECKEKTACQCSQCKCKNTWGSYECSCGGGLLYMRENDA  554

Query  564  CISKAGK----AEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLD  397
            CI  AGK    +  SWG +WVII  L A GV G+AVYKYRIRRYMDSEIRAIMAQYMPLD
Sbjct  555  CI--AGKNGSGSGSSWGLIWVIILCLGAVGVGGFAVYKYRIRRYMDSEIRAIMAQYMPLD  612

Query  396  NQGEVPNHVSHGNV  355
            NQGEVP+HV+ G++
Sbjct  613  NQGEVPSHVARGDI  626



>gb|KFK24686.1| hypothetical protein AALP_AA8G011700 [Arabis alpina]
Length=627

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGFKGDG+ +C D++EC+E+ ACQC  CKCKNTWGSYECSC GNLLY+ EHD 
Sbjct  499  SKGCKCPPGFKGDGLKNCTDVNECEEKTACQCRGCKCKNTWGSYECSCSGNLLYIREHDI  558

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CISK  + + SWG +W+II GL AA +  Y VYKYRIR YMDSEIRAIMAQYMPLDN 
Sbjct  559  CISKDARGDVSWGVIWIIIMGLGAAALGAYTVYKYRIRTYMDSEIRAIMAQYMPLDNH  616



>dbj|BAK05589.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=802

 Score =   175 bits (444),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 102/133 (77%), Gaps = 3/133 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRG-NLLYMHEHD  568
            TKGC CP GFKGDGV  CED+DECKER+ CQC DC C+NTWGSYEC C G N+LYM EHD
Sbjct  670  TKGCKCPQGFKGDGVHGCEDVDECKERLFCQCKDCSCENTWGSYECGCGGSNMLYMREHD  729

Query  567  TCISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            TCISK   +   WGF+WVI FGL  AGV  YAVYKYR+R YMDSEIRAIMAQYMPL+NQ 
Sbjct  730  TCISKVATSSVGWGFLWVIFFGLGFAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLENQE  789

Query  387  EVPN--HVSHGNV  355
               +  HV H ++
Sbjct  790  TSSHQRHVEHADI  802



>gb|EMS68621.1| Vacuolar-sorting receptor 4 [Triticum urartu]
Length=265

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = -1

Query  741  KGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTC  562
            + C CP GF+GDGV  C+DIDECKER ACQCP+C C++TWG Y+C+C G+LLY+ EHDTC
Sbjct  133  QNCKCPAGFRGDGVKKCDDIDECKERKACQCPECSCRDTWGGYDCTCSGDLLYIKEHDTC  192

Query  561  ISKAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            ISK   +A+ +W  VW I+  L       Y VYKYR+R YMDSEIRAIMAQYMPLD+QGE
Sbjct  193  ISKTTVQAKAAWAAVWGILVALVIVAAGSYVVYKYRLRSYMDSEIRAIMAQYMPLDSQGE  252

Query  384  VPN  376
            VPN
Sbjct  253  VPN  255



>gb|EPS73119.1| hypothetical protein M569_01632, partial [Genlisea aurea]
Length=636

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 106/147 (72%), Gaps = 23/147 (16%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGCYCPPGFKGDGV  C+DIDECKE+ ACQC +C CKNT+GSYECSC  NLLY+HE DT
Sbjct  490  TKGCYCPPGFKGDGVNTCDDIDECKEKSACQCSECNCKNTYGSYECSCSKNLLYLHEQDT  549

Query  564  CISK---------------------AGKAEF--SWGFVWVIIFGLaaagvagyavYKYRI  454
            CISK                     AGKA    SW   WV+I  +AA G+AGY VYKYRI
Sbjct  550  CISKHKKVIVSLSFIIHILTTVVCIAGKAGSGPSWSVAWVVILAMAAVGLAGYTVYKYRI  609

Query  453  RRYMDSEIRAIMAQYMPLDNQGEVPNH  373
            RRYMDSEIRAIMAQYMPLDN+GE+ NH
Sbjct  610  RRYMDSEIRAIMAQYMPLDNEGEMRNH  636



>gb|KDO64104.1| hypothetical protein CISIN_1g0100102mg, partial [Citrus sinensis]
Length=109

 Score =   162 bits (410),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 84/110 (76%), Positives = 96/110 (87%), Gaps = 1/110 (1%)
 Frame = -1

Query  684  IDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCISKAGKAEFSWGFVWVIIF  505
            +DEC+E++ACQCP+CKCK+TWGSYECSC   LLYM EHDTCISK  ++E SWGFVW++I 
Sbjct  1    VDECEEKLACQCPECKCKDTWGSYECSCGSGLLYMQEHDTCISKDVRSEASWGFVWMVIL  60

Query  504  GLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVPNHVSHGNV  355
            GLAA GVAGYA YKYRIRRYMDSEIRAIMAQYMPLD+Q EV  H SHG+V
Sbjct  61   GLAATGVAGYAFYKYRIRRYMDSEIRAIMAQYMPLDSQAEV-QHASHGDV  109



>ref|XP_009372028.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Pyrus 
x bretschneideri]
Length=626

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 100/132 (76%), Gaps = 2/132 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            T GC CPPGFKGDG   CED+DECKE+  CQC  CKCKNTWGSY+CSC G LLYM  +D 
Sbjct  495  TNGCSCPPGFKGDGEKTCEDVDECKEKTVCQCAHCKCKNTWGSYDCSCGGGLLYMQAYDA  554

Query  564  CIS--KAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI+   A  +  SWG +W+II  L A GV GYAVYKYRIRRYMDSEIRAIMAQYMPL N+
Sbjct  555  CITGKNASGSGSSWGLIWIIILCLGAVGVGGYAVYKYRIRRYMDSEIRAIMAQYMPLGNE  614

Query  390  GEVPNHVSHGNV  355
            GE P HVS G +
Sbjct  615  GEAPGHVSRGEI  626



>ref|XP_008388357.1| PREDICTED: vacuolar-sorting receptor 1-like [Malus domestica]
Length=626

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 101/131 (77%), Gaps = 1/131 (1%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            T GC CPPGFKGDG   CED+DECKE+ ACQC  CKCKNTWGSY+CSC G LLYM  +D 
Sbjct  496  TNGCSCPPGFKGDGEKTCEDVDECKEKTACQCAHCKCKNTWGSYDCSCGGGLLYMRGYDA  555

Query  564  CISK-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            CI K A  +  S G +W+II  L A GV GY VYKYRIRRYMDSEIRAIMAQYMPLDN+G
Sbjct  556  CIGKNASGSGSSRGLIWIIILCLGAVGVGGYIVYKYRIRRYMDSEIRAIMAQYMPLDNEG  615

Query  387  EVPNHVSHGNV  355
             VP HVS G++
Sbjct  616  AVPGHVSRGDI  626



>emb|CDY04821.1| BnaAnng00030D [Brassica napus]
Length=635

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGFKGDG+ +CED++EC+E+ ACQC  CKCKNTWGSYECSC G+LLY+ EHD 
Sbjct  507  SKGCKCPPGFKGDGLKNCEDVNECEEKTACQCRGCKCKNTWGSYECSCSGSLLYIREHDI  566

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CISK  + + SWG +W+I+ GL AA +  Y VYKYRIR YMDSEIRAIMAQYMPLDN 
Sbjct  567  CISKDARGDVSWGVIWIILMGLGAAALGAYTVYKYRIRTYMDSEIRAIMAQYMPLDNH  624



>ref|XP_006398566.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
 gb|ESQ40019.1| hypothetical protein EUTSA_v10015537mg [Eutrema salsugineum]
Length=627

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGFKGDG+ +CED++EC+E+ ACQC  CKCKNTWGSYECSC G+LLY+ EHD 
Sbjct  499  SKGCKCPPGFKGDGLKNCEDVNECEEKTACQCRGCKCKNTWGSYECSCSGSLLYIREHDI  558

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CISK  + + SWG +W+I+ GL AA +  Y VYKYRIR YMDSEIRAIMAQYMPLDN 
Sbjct  559  CISKDARGDVSWGVIWIIVMGLGAAALGAYTVYKYRIRTYMDSEIRAIMAQYMPLDNH  616



>ref|XP_006650048.1| PREDICTED: vacuolar-sorting receptor 1-like [Oryza brachyantha]
Length=630

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 104/131 (79%), Gaps = 4/131 (3%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRG-NLLYMHEHD  568
            ++GC CPPGF+GDG+  CEDIDECK+++ CQC  C C+NTWGSYECSC G N+LYM EHD
Sbjct  497  SEGCKCPPGFRGDGIKSCEDIDECKDKLYCQCKGCSCENTWGSYECSCGGNNMLYMREHD  556

Query  567  TCISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            TC+SK   +   W F+WVI FGLA AGV  YAVYKYR+R YMDSEIRAIMAQYMPLDNQ 
Sbjct  557  TCLSKEATSTVGWSFLWVIFFGLALAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLDNQ-  615

Query  387  EVPN--HVSHG  361
            E PN  HV+H 
Sbjct  616  EAPNQHHVAHA  626



>ref|XP_002489188.1| hypothetical protein SORBIDRAFT_0013s004010 [Sorghum bicolor]
 gb|EES20283.1| hypothetical protein SORBIDRAFT_0013s004010, partial [Sorghum 
bicolor]
Length=165

 Score =   163 bits (413),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 96/123 (78%), Gaps = 1/123 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GF+GDGV  CEDIDECKER ACQC +C C++TWG Y+C+C G+LLY+ EHDTCIS
Sbjct  37   CRCPAGFRGDGVKQCEDIDECKERKACQCSECNCRDTWGGYDCTCSGDLLYIREHDTCIS  96

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K   +A+ +W  VW I+  +A   V  Y VYKYR+R YMDSEIRAIMAQYMPLDNQG+VP
Sbjct  97   KTTVQAKAAWAAVWGILIVVAVVAVGSYVVYKYRLRSYMDSEIRAIMAQYMPLDNQGDVP  156

Query  378  NHV  370
            NH 
Sbjct  157  NHT  159



>ref|XP_010942821.1| PREDICTED: vacuolar-sorting receptor 1-like [Elaeis guineensis]
Length=631

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 99/125 (79%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDG+  C DIDECKE+ ACQCP+C CKNTWGSYEC+C G LLYM EHDTCIS
Sbjct  503  CKCPLGFKGDGIKTCADIDECKEKTACQCPECSCKNTWGSYECTCSGGLLYMREHDTCIS  562

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A +A+ +W  +W+I+  LA A    + VYKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  563  KTASEAKATWTALWLILGLLAFAAFGAFIVYKYRLRSYMDSEIRAIMAQYMPLDSQGEVP  622

Query  378  NHVSH  364
            NH + 
Sbjct  623  NHANE  627



>sp|P93484.1|VSR1_PEA RecName: Full=Vacuolar-sorting receptor 1; AltName: Full=80 kDa 
proaleurein-binding protein; AltName: Full=BP-80; Flags: 
Precursor [Pisum sativum]
 gb|AAB72110.1| BP-80 vacuolar sorting receptor [Pisum sativum]
Length=623

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 100/125 (80%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV +CEDIDECK++ ACQCP+C CKNTWGSY CSC G+LLY+ + DTCIS
Sbjct  496  CQCPAGFKGDGVKNCEDIDECKDKKACQCPECSCKNTWGSYNCSCSGDLLYIKDQDTCIS  555

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A +A+ +W   WV++  LA     G+ VYKYRIR+YMDSEIRAIMAQYMPLD+Q E P
Sbjct  556  KTASQAKSTWAAFWVVLIALAMIAGGGFLVYKYRIRQYMDSEIRAIMAQYMPLDSQEEGP  615

Query  378  NHVSH  364
            NHV+H
Sbjct  616  NHVNH  620



>ref|NP_001189637.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 gb|AEC08367.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=641

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGF GDG+  C+D++EC+E+ ACQC DCKCKNTWGSYECSC G+LLY+ EHD 
Sbjct  497  SKGCKCPPGFIGDGLKECKDVNECEEKTACQCRDCKCKNTWGSYECSCSGSLLYIREHDI  556

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI++  + +FSWG +W+II GL AA +  Y VYKYRIR YMDSEIRAIMAQYMPLDN 
Sbjct  557  CINRDARGDFSWGVIWIIIMGLGAAALGAYTVYKYRIRTYMDSEIRAIMAQYMPLDNN  614



>ref|NP_180588.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
 sp|O22925.1|VSR2_ARATH RecName: Full=Vacuolar-sorting receptor 2; Short=AtVSR2; AltName: 
Full=BP80-like protein c; Short=AtBP80c; AltName: Full=Epidermal 
growth factor receptor-like protein 4; Short=AtELP4; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC16948.1| putative vacuolar sorting receptor [Arabidopsis thaliana]
 gb|ABE65874.1| vacuolar sorting receptor [Arabidopsis thaliana]
 gb|AEC08366.1| vacuolar-sorting receptor 2 [Arabidopsis thaliana]
Length=625

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGF GDG+  C+D++EC+E+ ACQC DCKCKNTWGSYECSC G+LLY+ EHD 
Sbjct  497  SKGCKCPPGFIGDGLKECKDVNECEEKTACQCRDCKCKNTWGSYECSCSGSLLYIREHDI  556

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI++  + +FSWG +W+II GL AA +  Y VYKYRIR YMDSEIRAIMAQYMPLDN 
Sbjct  557  CINRDARGDFSWGVIWIIIMGLGAAALGAYTVYKYRIRTYMDSEIRAIMAQYMPLDNN  614



>ref|XP_011001937.1| PREDICTED: vacuolar-sorting receptor 3 [Populus euphratica]
Length=630

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 101/123 (82%), Gaps = 1/123 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  C D+DECKER ACQCP C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  503  CQCPPGFKGDGVKSCVDVDECKERKACQCPACSCKNTWGSYECSCSGDLLYIRDHDTCIS  562

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K+G +   +W  VWVI+ GLA AG  GY +YKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  563  KSGTEVRSAWAAVWVILLGLAMAGGGGYLIYKYRLRSYMDSEIRAIMAQYMPLDSQAEVP  622

Query  378  NHV  370
            NHV
Sbjct  623  NHV  625



>ref|XP_009404782.1| PREDICTED: vacuolar-sorting receptor 4-like [Musa acuminata subsp. 
malaccensis]
Length=633

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 101/122 (83%), Gaps = 1/122 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GF+GDGV  CEDI+ECK++ ACQCPDC CK+TWGSY+C+C G+LLY+ EHDTCIS
Sbjct  505  CQCPAGFEGDGVKACEDINECKKKTACQCPDCSCKDTWGSYDCTCSGDLLYIKEHDTCIS  564

Query  555  -KAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
             KA +A+ +W  VWV++  LA A    YA+YKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  565  KKASEAKVTWAAVWVLLIVLAVAAFGAYAIYKYRLRSYMDSEIRAIMAQYMPLDSQGEVP  624

Query  378  NH  373
            NH
Sbjct  625  NH  626



>gb|EMT02959.1| Vacuolar-sorting receptor 4 [Aegilops tauschii]
Length=575

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 101/133 (76%), Gaps = 3/133 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRG-NLLYMHEHD  568
             KGC CP GFKGDG+  CED+DECKER+ CQC DC C+NTWGSYEC C G N+LYM EHD
Sbjct  443  AKGCKCPQGFKGDGIHGCEDVDECKERLFCQCKDCSCENTWGSYECGCGGSNMLYMREHD  502

Query  567  TCISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            TCISK   +   WGF+WVI FGL  AGV  YAVYKYR+R YMDSEIRAIMAQYMPL+NQ 
Sbjct  503  TCISKVATSSVGWGFMWVIFFGLGFAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLENQE  562

Query  387  EVPN--HVSHGNV  355
               +  HV H ++
Sbjct  563  TSSHQRHVDHADI  575



>gb|EMS51356.1| Vacuolar-sorting receptor 1 [Triticum urartu]
Length=640

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 99/128 (77%), Gaps = 2/128 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRG-NLLYMHEHD  568
             KGC CP GFKGDG+  CED+DECKER+ CQC DC C+NTWGSYEC C G N+LYM EHD
Sbjct  508  AKGCKCPQGFKGDGIHGCEDVDECKERLFCQCKDCSCENTWGSYECGCGGSNMLYMREHD  567

Query  567  TCISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            TCISK   +   WGF+WVI FGL  AGV  YAVYKYR+R YMDSEIRAIMAQYMPL+NQ 
Sbjct  568  TCISKVATSSLGWGFMWVIFFGLGFAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLENQ-  626

Query  387  EVPNHVSH  364
            E  +H  H
Sbjct  627  ETSSHQRH  634



>ref|XP_010036004.1| PREDICTED: vacuolar-sorting receptor 1-like [Eucalyptus grandis]
 gb|KCW47526.1| hypothetical protein EUGRSUZ_K01287 [Eucalyptus grandis]
Length=628

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 100/130 (77%), Gaps = 0/130 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            + GC CPPGF GDGV  CED+DECKE+  CQCP+CKCK+TWGS+EC+C G LLYM E+DT
Sbjct  499  STGCKCPPGFTGDGVNSCEDVDECKEKKVCQCPECKCKDTWGSFECTCSGGLLYMQEYDT  558

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CIS     +    F W++I GL AAGV  Y VYKYRIR YMDSEIR+IMAQYMPLD Q E
Sbjct  559  CISTHPVTKSFGVFFWIVILGLTAAGVGAYMVYKYRIRSYMDSEIRSIMAQYMPLDGQAE  618

Query  384  VPNHVSHGNV  355
            VP+H SH ++
Sbjct  619  VPSHGSHTDI  628



>ref|XP_010938945.1| PREDICTED: vacuolar-sorting receptor 3-like [Elaeis guineensis]
Length=633

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDG+  CEDIDECKE+ ACQCP+C CK+TWGSYEC+C  +LLY+ EHD CIS
Sbjct  505  CVCPSGFKGDGIKTCEDIDECKEKTACQCPECSCKDTWGSYECTCSRDLLYIREHDICIS  564

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A +A+ +W  VWVI+  L  A    Y VYKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  565  KSASEAKATWTAVWVILVVLIFAAFGAYIVYKYRLRSYMDSEIRAIMAQYMPLDSQGEVP  624

Query  378  NHVSHGN  358
            NH    N
Sbjct  625  NHAHEEN  631



>ref|XP_010277061.1| PREDICTED: vacuolar-sorting receptor 3-like [Nelumbo nucifera]
Length=634

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 96/125 (77%), Gaps = 1/125 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGF GDGV  CEDIDECKE+ ACQCP+C C N WGSYEC+C G LLY+ +HDTCIS
Sbjct  507  CQCPPGFIGDGVKSCEDIDECKEKKACQCPECSCNNIWGSYECTCSGELLYIRDHDTCIS  566

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A + + +W  VWVI  GLA A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q +VP
Sbjct  567  KRASETKTAWTAVWVIFIGLAMAAGGAYLVYKYRLRSYMDSEIRAIMAQYMPLDSQTDVP  626

Query  378  NHVSH  364
            NH S 
Sbjct  627  NHASE  631



>ref|XP_010414284.1| PREDICTED: vacuolar-sorting receptor 2 [Camelina sativa]
Length=625

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGFKGDG+  C+D++EC+E+ ACQC DCKCKNTWGSYECSC G+LLY+ EHD 
Sbjct  497  SKGCKCPPGFKGDGLKDCQDVNECEEKTACQCRDCKCKNTWGSYECSCSGSLLYIREHDI  556

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI+K  + + SWG +W+I  GL+AA +  Y +YKYRIR YMDSEIRAIMAQYMPLDN 
Sbjct  557  CINKDARGDVSWGVIWIIFMGLSAAALGAYTIYKYRIRTYMDSEIRAIMAQYMPLDNN  614



>ref|XP_010510382.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 97/118 (82%), Gaps = 0/118 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGFKGDG+  C+D++EC+E+ ACQC DCKCKNTWGSYECSC G+LLY+ EHD 
Sbjct  497  SKGCKCPPGFKGDGLKDCQDVNECEEKTACQCRDCKCKNTWGSYECSCSGSLLYIREHDI  556

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI+K  + + SWG +W+I  GL+AA +  Y +YKYRIR YMDSEIRAIMAQYMPLDN 
Sbjct  557  CINKDARGDVSWGVIWIIFMGLSAAALGAYTIYKYRIRTYMDSEIRAIMAQYMPLDNN  614



>ref|NP_001050034.1| Os03g0335300 [Oryza sativa Japonica Group]
 gb|ABF95810.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11948.1| Os03g0335300 [Oryza sativa Japonica Group]
 dbj|BAG93773.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00476.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75202.1| hypothetical protein OsI_11454 [Oryza sativa Indica Group]
 gb|EEE59012.1| hypothetical protein OsJ_10747 [Oryza sativa Japonica Group]
Length=628

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 102/131 (78%), Gaps = 4/131 (3%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRG-NLLYMHEHD  568
            ++GC CPPGFKGDG+  CEDIDECKE++ CQC  C C+NTWGSYECSC G N+LYM EHD
Sbjct  495  SEGCKCPPGFKGDGIKSCEDIDECKEKLYCQCKGCSCENTWGSYECSCGGNNMLYMREHD  554

Query  567  TCISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            TC+SK   +   W F+WVI FGL  AGV  YAVYKYR+R YMDSEIRAIMAQYMPLDNQ 
Sbjct  555  TCLSKEATSAVGWSFLWVIFFGLVLAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLDNQ-  613

Query  387  EVPN--HVSHG  361
            E  N  HV+H 
Sbjct  614  EAANQHHVAHA  624



>gb|KFK39977.1| hypothetical protein AALP_AA3G313900 [Arabis alpina]
Length=626

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 99/124 (80%), Gaps = 2/124 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDECKE+ ACQCP+C CKNTWGSYECSC G+LLYM +HDTCIS
Sbjct  500  CQCPPGFKGDGVKKCEDIDECKEKKACQCPECSCKNTWGSYECSCSGDLLYMRDHDTCIS  559

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G + + +W  VW+I+  L  A    Y +YK+R+R+YMDSEIRAIMAQYMPLD+Q EV 
Sbjct  560  KTGAQVKSAWAAVWLIMLSLGLAAGGAYLLYKHRLRQYMDSEIRAIMAQYMPLDSQAEV-  618

Query  378  NHVS  367
            NH +
Sbjct  619  NHAN  622



>ref|XP_002881098.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57357.1| hypothetical protein ARALYDRAFT_481940 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   172 bits (436),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGFKGDG+  C+D++EC+E+ ACQC  CKCKNTWGSYECSC G+LLY+ EHD 
Sbjct  495  SKGCKCPPGFKGDGLKDCQDVNECEEKTACQCRGCKCKNTWGSYECSCSGSLLYIREHDI  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI+K  + + SWG +W+II GL AA +  Y VYKYRIR YMDSEIRAIMAQYMPLDN 
Sbjct  555  CINKDARGDLSWGVIWIIIMGLGAAALGAYTVYKYRIRTYMDSEIRAIMAQYMPLDNH  612



>ref|XP_010469873.1| PREDICTED: vacuolar-sorting receptor 2-like [Camelina sativa]
Length=625

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGFKGDG+  C+D++EC+E+ ACQC DCKCKNTWGSYECSC G+LLY+ EHD 
Sbjct  497  SKGCKCPPGFKGDGLKDCQDVNECEEKTACQCRDCKCKNTWGSYECSCSGSLLYIREHDI  556

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI+K  + + SWG +W+I  GL AA +  Y +YKYRIR YMDSEIRAIMAQYMPLDN 
Sbjct  557  CINKDARGDVSWGVIWIIFMGLGAAALGAYTIYKYRIRTYMDSEIRAIMAQYMPLDNN  614



>ref|XP_004496877.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=630

 Score =   172 bits (436),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 95/125 (76%), Gaps = 2/125 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV +CEDIDECK++ ACQCP+C CKNTWGSY CSC G+LLY+ +HD CIS
Sbjct  502  CVCPAGFKGDGVKNCEDIDECKDKKACQCPECSCKNTWGSYNCSCSGDLLYIRDHDACIS  561

Query  555  KAGKAE--FSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEV  382
            K    E   +W   WVI+ GL  A    Y VYKYRIR YMDSEIRAIMAQYMPLD+Q EV
Sbjct  562  KTASQEGKSAWAAFWVIVIGLVLAASGAYLVYKYRIRSYMDSEIRAIMAQYMPLDSQAEV  621

Query  381  PNHVS  367
             NHV+
Sbjct  622  VNHVN  626



>ref|XP_011625221.1| PREDICTED: vacuolar-sorting receptor 3 isoform X2 [Amborella 
trichopoda]
Length=627

 Score =   172 bits (435),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = -1

Query  741  KGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTC  562
            KGC CP GF+GDG+  CEDIDECKE+ ACQCP+C CK+TWG YEC+C G+LLY+ +HDTC
Sbjct  500  KGCQCPAGFRGDGIKSCEDIDECKEKRACQCPECSCKDTWGGYECTCSGDLLYITDHDTC  559

Query  561  ISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEV  382
             S A + + +W  +WVI  GLA A    Y VYKYR++ YMDSEIRAIMAQYMPLD+Q EV
Sbjct  560  KS-AQQVKTAWAAMWVIFIGLAVAAAGAYIVYKYRLKSYMDSEIRAIMAQYMPLDSQSEV  618

Query  381  PNHVSH  364
            PNHVS 
Sbjct  619  PNHVSE  624



>ref|XP_010683480.1| PREDICTED: vacuolar-sorting receptor 1-like [Beta vulgaris subsp. 
vulgaris]
Length=626

 Score =   172 bits (435),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 97/125 (78%), Gaps = 2/125 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            T GC CPPGFKGDG+ HCEDIDECKE++ACQCP+C CKNTWGSY+CSC   LLYM EHDT
Sbjct  499  THGCKCPPGFKGDGI-HCEDIDECKEKLACQCPECSCKNTWGSYDCSCSNGLLYMQEHDT  557

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CIS  G     W   ++II  L A G  GYA YKYRIRRYMDSEIRAIMAQYMPLDNQ E
Sbjct  558  CISNGGGG-VGWASAFMIILVLGAVGTGGYAFYKYRIRRYMDSEIRAIMAQYMPLDNQVE  616

Query  384  VPNHV  370
            +  H+
Sbjct  617  ITTHI  621



>ref|XP_010111675.1| Vacuolar-sorting receptor 3 [Morus notabilis]
 gb|EXC31466.1| Vacuolar-sorting receptor 3 [Morus notabilis]
Length=631

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 97/125 (78%), Gaps = 2/125 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  C DIDECKER ACQC +C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  505  CKCPPGFKGDGVHSCTDIDECKERKACQCSECSCKNTWGSYECSCNGDLLYIRDHDTCIS  564

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A +   +W  VWVI+  +  A    Y VYKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  565  KTASETRSAWAIVWVILI-VGMAAGGAYRVYKYRLRSYMDSEIRAIMAQYMPLDSQAEVP  623

Query  378  NHVSH  364
            NHV+ 
Sbjct  624  NHVNE  628



>gb|EYU37571.1| hypothetical protein MIMGU_mgv1a002851mg [Erythranthe guttata]
Length=631

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 99/125 (79%), Gaps = 2/125 (2%)
 Frame = -1

Query  735  CYCPPGFKGD-GVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI  559
            C CPPGFKGD G   CEDIDECKE+ ACQCPDC CKNTWGSYEC+C G+LLY+ +HDTCI
Sbjct  503  CQCPPGFKGDDGAKSCEDIDECKEKKACQCPDCSCKNTWGSYECTCGGDLLYIRDHDTCI  562

Query  558  SK-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEV  382
            SK A + + +W  VW+I+ GL  A    Y VYK+R+R YMDSEIRAIMAQYMPLD+Q EV
Sbjct  563  SKRASEVKSAWTAVWIILLGLGMAAGGAYLVYKHRLRSYMDSEIRAIMAQYMPLDSQNEV  622

Query  381  PNHVS  367
             NHV+
Sbjct  623  QNHVN  627



>ref|XP_006296113.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
 gb|EOA29011.1| hypothetical protein CARUB_v10025264mg [Capsella rubella]
Length=623

 Score =   171 bits (434),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +KGC CPPGFKGDG+  C+D++EC+E+ ACQC  CKCKNTWGSYECSC G+LLY+ EHD 
Sbjct  495  SKGCKCPPGFKGDGLKDCQDVNECEEKTACQCRGCKCKNTWGSYECSCSGSLLYIREHDI  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI+K  + + SWG +W+II GL AA +  Y +YKYRIR YMDSEIRAIMAQYMPLDN 
Sbjct  555  CINKDARGDVSWGVIWIIIMGLGAAALGAYTIYKYRIRTYMDSEIRAIMAQYMPLDNN  612



>ref|XP_002968618.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
 gb|EFJ30872.1| hypothetical protein SELMODRAFT_440462 [Selaginella moellendorffii]
Length=624

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 1/127 (1%)
 Frame = -1

Query  741  KGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTC  562
            KGC CP GFKGDG   CEDIDEC+ER+ACQCPDC CKNT+GSY+CSC G+LLYM EHDTC
Sbjct  496  KGCQCPAGFKGDGFNTCEDIDECRERVACQCPDCTCKNTYGSYDCSCSGDLLYMREHDTC  555

Query  561  ISKAGK-AEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            ISK G  A+  W  ++ ++ GL+AA +AGY VYKYR+R YMDSEIRAIMAQYMPLD+Q +
Sbjct  556  ISKKGSTAKVGWVVIFTVLGGLSAAAIAGYVVYKYRLRSYMDSEIRAIMAQYMPLDSQND  615

Query  384  VPNHVSH  364
            V +H+  
Sbjct  616  VHHHLQE  622



>ref|XP_007143116.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
 gb|ESW15110.1| hypothetical protein PHAVU_007G045100g [Phaseolus vulgaris]
Length=630

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 96/125 (77%), Gaps = 2/125 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV +CEDIDEC+E+ ACQCP+C CKNTWGSY+C+C G+LLY+ +HDTCIS
Sbjct  502  CKCPAGFKGDGVKNCEDIDECREKKACQCPECSCKNTWGSYDCTCSGDLLYIRDHDTCIS  561

Query  555  KAGKAE--FSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEV  382
            K    E   +W   WVI+ GL  A    Y VYKYRIR YMDSEIRAIMAQYMPLD+Q EV
Sbjct  562  KTASQEGRSAWAAFWVILVGLVVAAGGAYLVYKYRIRSYMDSEIRAIMAQYMPLDSQSEV  621

Query  381  PNHVS  367
             NH +
Sbjct  622  VNHAN  626



>ref|XP_002975863.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
 gb|EFJ22768.1| hypothetical protein SELMODRAFT_175218 [Selaginella moellendorffii]
Length=624

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 1/127 (1%)
 Frame = -1

Query  741  KGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTC  562
            KGC CP GFKGDG   CEDIDEC+ER+ACQCPDC CKNT+GSY+CSC G+LLYM EHDTC
Sbjct  496  KGCQCPSGFKGDGFNTCEDIDECRERVACQCPDCTCKNTYGSYDCSCSGDLLYMREHDTC  555

Query  561  ISKAGK-AEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            ISK G  A+  W  ++ ++ GL+AA +AGY VYKYR+R YMDSEIRAIMAQYMPLD+Q +
Sbjct  556  ISKKGSTAKVGWVVIFTVLGGLSAAAIAGYVVYKYRLRSYMDSEIRAIMAQYMPLDSQND  615

Query  384  VPNHVSH  364
            V +H+  
Sbjct  616  VHHHLQE  622



>gb|EAY78120.1| hypothetical protein OsI_33166 [Oryza sativa Indica Group]
Length=215

 Score =   162 bits (410),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GF+GDGV  CEDI+ECKE+ ACQC +C C++TWG YEC+C G+LLY+ EHDTCIS
Sbjct  87   CQCPAGFRGDGVKKCEDINECKEKKACQCRECSCRDTWGDYECTCSGDLLYIKEHDTCIS  146

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A + + +W  VW I+  L       Y VYKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  147  KTAVQGKAAWAAVWGILIVLVVVAAGSYVVYKYRLRSYMDSEIRAIMAQYMPLDSQGEVP  206

Query  378  NHVS  367
            NH +
Sbjct  207  NHTN  210



>gb|ACR34782.1| unknown [Zea mays]
Length=317

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSC-RGNLLYMHEHD  568
            ++GC CP GFKGDG   CEDIDEC+E++ CQC  C CKNTWGSYECSC   N+LYM EHD
Sbjct  184  SEGCKCPMGFKGDGEKSCEDIDECQEKLYCQCKGCSCKNTWGSYECSCGDDNMLYMREHD  243

Query  567  TCISKAGKA-EFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            TCISK G A    W F+WVI FGL  AGV  YAVYKYR+R YMDSEIRAIMAQYMPLDNQ
Sbjct  244  TCISKEGTATTVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLDNQ  303

Query  390  -GEVPNHVSHGN  358
             G   + V H N
Sbjct  304  EGANQHQVVHAN  315



>gb|AES62774.2| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=632

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV +C DIDECKE+ ACQCP+C CKNTWGSY CSC G+LLY+ +HD CIS
Sbjct  503  CECPAGFKGDGVKNCADIDECKEKKACQCPECSCKNTWGSYNCSCSGDLLYIRDHDACIS  562

Query  555  KAGKAE---FSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            K    E    +W   WVI+ GL  A    Y VYKYRIR YMDSEIRAIMAQYMPLD+Q E
Sbjct  563  KTASQEGGKSAWAAFWVIVVGLVLAASGAYLVYKYRIRSYMDSEIRAIMAQYMPLDSQSE  622

Query  384  VPNHVS  367
            V NHV+
Sbjct  623  VVNHVN  628



>ref|XP_003592523.1| Vacuolar-sorting receptor [Medicago truncatula]
Length=601

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKGDGV +C DIDECKE+ ACQCP+C CKNTWGSY CSC G+LLY+ +HD CIS
Sbjct  472  CECPAGFKGDGVKNCADIDECKEKKACQCPECSCKNTWGSYNCSCSGDLLYIRDHDACIS  531

Query  555  KAGKAE---FSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            K    E    +W   WVI+ GL  A    Y VYKYRIR YMDSEIRAIMAQYMPLD+Q E
Sbjct  532  KTASQEGGKSAWAAFWVIVVGLVLAASGAYLVYKYRIRSYMDSEIRAIMAQYMPLDSQSE  591

Query  384  VPNHVS  367
            V NHV+
Sbjct  592  VVNHVN  597



>ref|XP_010547949.1| PREDICTED: vacuolar-sorting receptor 3-like [Tarenaya hassleriana]
Length=635

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDECKE+ ACQCP+C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  508  CQCPPGFKGDGVNKCEDIDECKEKKACQCPECSCKNTWGSYECSCSGDLLYIRDHDTCIS  567

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L+ A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EV 
Sbjct  568  KTGSQVRSAWAAVWLILLSLSLAAAGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVH  627

Query  378  NHV  370
            NH+
Sbjct  628  NHL  630



>ref|XP_002313909.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
 gb|EEE87864.1| vacuolar sorting receptor protein BP-80 [Populus trichocarpa]
Length=630

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 100/123 (81%), Gaps = 1/123 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  C D+DECKER ACQC  C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  503  CQCPPGFKGDGVKSCVDVDECKERKACQCSACSCKNTWGSYECSCSGDLLYIRDHDTCIS  562

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K+G +   +W  VWVI+ GLA AG  GY +YKYR+R YMDSEIRAIMAQYMPLD+Q EVP
Sbjct  563  KSGTEVRSAWAAVWVILLGLAMAGGGGYLIYKYRLRSYMDSEIRAIMAQYMPLDSQAEVP  622

Query  378  NHV  370
            NHV
Sbjct  623  NHV  625



>ref|XP_010547948.1| PREDICTED: vacuolar-sorting receptor 3 [Tarenaya hassleriana]
Length=635

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDECKE+ ACQCP+C CKNTWGSYECSC G+LLY+ +HDTCIS
Sbjct  508  CQCPPGFKGDGVNKCEDIDECKEKKACQCPECSCKNTWGSYECSCSGDLLYIRDHDTCIS  567

Query  555  KAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K G +   +W  VW+I+  L+ A    Y VYKYR+R+YMDSEIRAIMAQYMPLD+Q EV 
Sbjct  568  KTGSQVRSAWAAVWLILLSLSLAAAGAYLVYKYRLRQYMDSEIRAIMAQYMPLDSQPEVH  627

Query  378  NHV  370
            NH+
Sbjct  628  NHL  630



>ref|XP_010687358.1| PREDICTED: vacuolar-sorting receptor 4-like [Beta vulgaris subsp. 
vulgaris]
Length=633

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 99/122 (81%), Gaps = 1/122 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDECKE+ ACQC DC CKNTWGSYEC+C G+LLYM +HDTCIS
Sbjct  507  CKCPPGFKGDGVNSCEDIDECKEKKACQCSDCNCKNTWGSYECTCSGDLLYMKDHDTCIS  566

Query  555  KA-GKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K+  +A+ +W  VW+ + GLA     GY  YKYRIR+YMDSEIRAIMAQYMPLD+Q E+P
Sbjct  567  KSAAQAKSAWAAVWLSLIGLAMVAAGGYLFYKYRIRQYMDSEIRAIMAQYMPLDSQTEIP  626

Query  378  NH  373
            NH
Sbjct  627  NH  628



>ref|XP_010426913.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 98/120 (82%), Gaps = 2/120 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +K C CP GFKGDGV  CED+DECKE+  CQCPDCKCKNTWGSYECSC+  LLYM EHDT
Sbjct  496  SKDCKCPHGFKGDGVKSCEDVDECKEKTVCQCPDCKCKNTWGSYECSCKNGLLYMREHDT  555

Query  564  CI--SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI   K G  + SW F+WV+I G+A AG++GYAVYKYRIR YMD+EIR IMAQYMPL++Q
Sbjct  556  CIGSGKVGTTKLSWSFLWVLIIGVAVAGLSGYAVYKYRIRSYMDAEIRGIMAQYMPLESQ  615



>ref|XP_002967764.1| hypothetical protein SELMODRAFT_169577 [Selaginella moellendorffii]
 gb|EFJ31111.1| hypothetical protein SELMODRAFT_169577 [Selaginella moellendorffii]
Length=628

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CP GF+GDGV  CED+DECK ++ACQC +C CKNTWGSY+C C GNLLY+ EHDT
Sbjct  500  TKGCECPAGFRGDGVNQCEDVDECKSKLACQCKECHCKNTWGSYDCQCDGNLLYIKEHDT  559

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK       W   + I+ GLA  G  GY +YKYRIR YMDSEIRAIMAQYMPLD+Q E
Sbjct  560  CISKISVTRVGWSATFFILAGLAVVGAVGYVIYKYRIRSYMDSEIRAIMAQYMPLDSQNE  619

Query  384  VPNHV  370
            V  H+
Sbjct  620  VHRHL  624



>ref|XP_002992389.1| hypothetical protein SELMODRAFT_269926 [Selaginella moellendorffii]
 gb|EFJ06539.1| hypothetical protein SELMODRAFT_269926 [Selaginella moellendorffii]
Length=628

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CP GF+GDGV  CED+DECK ++ACQC +C CKNTWGSY+C C GNLLY+ EHDT
Sbjct  500  TKGCECPAGFRGDGVNQCEDVDECKSKLACQCKECHCKNTWGSYDCQCDGNLLYIKEHDT  559

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CISK       W   + I+ GLA  G  GY +YKYRIR YMDSEIRAIMAQYMPLD+Q E
Sbjct  560  CISKISVTRVGWSATFFILAGLAVVGAVGYVIYKYRIRSYMDSEIRAIMAQYMPLDSQNE  619

Query  384  VPNHV  370
            V  H+
Sbjct  620  VHRHL  624



>ref|XP_008779827.1| PREDICTED: vacuolar-sorting receptor 4-like, partial [Phoenix 
dactylifera]
Length=162

 Score =   157 bits (398),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GFKG+G   CEDIDECKE+ ACQC +C CKNTWGSYEC+C   LLYM E D CIS
Sbjct  34   CKCPTGFKGNGTKTCEDIDECKEKTACQCLECSCKNTWGSYECTCSDGLLYMREQDICIS  93

Query  555  -KAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
              A  A+ +W   WVI+   A A +  Y VYKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  94   DSASMAKATWIAFWVILILSAFAALGAYIVYKYRLRSYMDSEIRAIMAQYMPLDSQGEVP  153

Query  378  NHV  370
            NH 
Sbjct  154  NHT  156



>ref|XP_011088070.1| PREDICTED: vacuolar-sorting receptor 3-like [Sesamum indicum]
Length=629

 Score =   167 bits (424),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 98/124 (79%), Gaps = 0/124 (0%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CPPGFKGDGV  CEDIDECK++ ACQCP+C CKNTWGSYEC+C G+LLY+ +HDTCIS
Sbjct  503  CTCPPGFKGDGVNSCEDIDECKQKKACQCPECSCKNTWGSYECTCGGDLLYIRDHDTCIS  562

Query  555  KAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVPN  376
            K  + + +W  VW+I+  LA A    Y VYK R+R YMDSEIRAIMAQYMPLD+Q EVPN
Sbjct  563  KTTEVKSAWTAVWIILIALALAAGGAYVVYKRRLRSYMDSEIRAIMAQYMPLDSQNEVPN  622

Query  375  HVSH  364
            HV  
Sbjct  623  HVDE  626



>ref|XP_010504032.1| PREDICTED: vacuolar-sorting receptor 1 [Camelina sativa]
Length=626

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +K C CP GFKGDGV +CED+DECKE+  CQCPDCKCKNTWGSYECSC   LLYM EHDT
Sbjct  496  SKDCKCPHGFKGDGVKNCEDVDECKEKTVCQCPDCKCKNTWGSYECSCNNGLLYMREHDT  555

Query  564  CI--SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI   K G  + SW F+W++I G+  AG++GYAVYKYRIR YMD+EIR IMAQYMPL++Q
Sbjct  556  CIGSGKVGTTKLSWSFLWILIIGIGVAGLSGYAVYKYRIRSYMDAEIRGIMAQYMPLESQ  615



>ref|XP_010515761.1| PREDICTED: vacuolar-sorting receptor 1-like [Camelina sativa]
Length=626

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 97/120 (81%), Gaps = 2/120 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +K C CP GFKGDGV  CED+DECKE+  CQCPDCKCKNTWGSYECSC+  LLYM EHDT
Sbjct  496  SKDCKCPHGFKGDGVKSCEDVDECKEKTVCQCPDCKCKNTWGSYECSCKNGLLYMREHDT  555

Query  564  CI--SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI   K G  + SW F+W++I G+  AG++GYAVYKYRIR YMD+EIR IMAQYMPL++Q
Sbjct  556  CIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAEIRGIMAQYMPLESQ  615



>ref|NP_001064400.1| Os10g0346600 [Oryza sativa Japonica Group]
 gb|AAK92655.1|AC079634_16 Putative vacuolar sorting receptor protein homolog [Oryza sativa 
Japonica Group]
 gb|ABB47273.1| Vacuolar sorting receptor 1 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26314.1| Os10g0346600 [Oryza sativa Japonica Group]
 gb|EAZ15760.1| hypothetical protein OsJ_31179 [Oryza sativa Japonica Group]
Length=631

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 96/124 (77%), Gaps = 1/124 (1%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GF+GDGV  CEDI+ECKE+ ACQCP+C C++TWG YEC+C G+LLY+ EHDTCIS
Sbjct  503  CQCPAGFRGDGVKKCEDINECKEKKACQCPECSCRDTWGDYECTCSGDLLYIKEHDTCIS  562

Query  555  K-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEVP  379
            K A + + +W  VW I+  L       Y VYKYR+R YMDSEIRAIMAQYMPLD+QGEVP
Sbjct  563  KTAVQGKAAWAAVWGILIVLVVVAAGSYVVYKYRLRSYMDSEIRAIMAQYMPLDSQGEVP  622

Query  378  NHVS  367
            NH +
Sbjct  623  NHTN  626



>ref|XP_003521852.1| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
Length=624

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGF+GDG   CED+DECKE++ACQCP+C+CKNTWGSYECSC   L Y  E+D 
Sbjct  496  TKGCKCPPGFRGDGANSCEDVDECKEKLACQCPECQCKNTWGSYECSCSDGLFYARENDM  555

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CI K   +    G VW++I  L  AG   YA YKYRI+RYMDSEIRAIMAQYMPLDNQ E
Sbjct  556  CIGKYAASMAGGGIVWLVILVLGIAGTGVYAFYKYRIQRYMDSEIRAIMAQYMPLDNQPE  615

Query  384  VPNHVSHG  361
            + +    G
Sbjct  616  ISSQAHEG  623



>gb|KHN42141.1| Vacuolar-sorting receptor 2 [Glycine soja]
Length=622

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGF+GDG   CED+DECKE++ACQCP+C+CKNTWGSYECSC   L Y  E+D 
Sbjct  494  TKGCKCPPGFRGDGANSCEDVDECKEKLACQCPECQCKNTWGSYECSCSDGLFYARENDM  553

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CI K   +    G VW++I  L  AG   YA YKYRI+RYMDSEIRAIMAQYMPLDNQ E
Sbjct  554  CIGKYAASMAGGGIVWLVILVLGIAGTGVYAFYKYRIQRYMDSEIRAIMAQYMPLDNQPE  613

Query  384  VPNHVSHG  361
            + +    G
Sbjct  614  ISSQAHEG  621



>ref|XP_003626680.1| Vacuolar sorting receptor [Medicago truncatula]
 gb|AET01156.1| vacuolar-sorting receptor-like protein [Medicago truncatula]
Length=625

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 93/128 (73%), Gaps = 0/128 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGF+GDGV  C+D+DECKE++ACQCP+C CKNTWGSYEC C   L Y+ E D 
Sbjct  497  TKGCKCPPGFRGDGVHSCKDVDECKEKLACQCPECNCKNTWGSYECRCNNGLFYVRESDM  556

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CI K   +  S GF+W++I  L   G  GY  YKYRI+RYMD EIRAIMAQYMPLDNQ E
Sbjct  557  CIGKYSASVSSGGFIWLVILLLGTCGAVGYVFYKYRIQRYMDDEIRAIMAQYMPLDNQPE  616

Query  384  VPNHVSHG  361
              N V H 
Sbjct  617  HTNQVQHA  624



>ref|NP_190853.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
 sp|P93026.2|VSR1_ARATH RecName: Full=Vacuolar-sorting receptor 1; Short=AtVSR1; AltName: 
Full=BP80-like protein b; Short=AtBP80b; AltName: Full=Epidermal 
growth factor receptor-like protein 1; Short=AtELP; 
Short=AtELP1; AltName: Full=Spot 3 protein; Flags: Precursor 
[Arabidopsis thaliana]
 emb|CAA69222.1| Spot 3 protein [Arabidopsis thaliana]
 gb|AAB46988.1| EGF receptor like protein [Arabidopsis thaliana]
 gb|AEE79000.1| vacuolar-sorting receptor 1 [Arabidopsis thaliana]
Length=623

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 100/129 (78%), Gaps = 4/129 (3%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +K C CP GFKGDGV +CED+DECKE+  CQCP+CKCKNTWGSYECSC   LLYM EHDT
Sbjct  493  SKDCKCPLGFKGDGVKNCEDVDECKEKTVCQCPECKCKNTWGSYECSCSNGLLYMREHDT  552

Query  564  CI--SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI   K G  + SW F+W++I G+  AG++GYAVYKYRIR YMD+EIR IMAQYMPL++Q
Sbjct  553  CIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAEIRGIMAQYMPLESQ  612

Query  390  GEVPNHVSH  364
               PN   H
Sbjct  613  --PPNTSGH  619



>gb|AAB72111.1| vacuolar sorting receptor homolog [Arabidopsis thaliana]
Length=623

 Score =   167 bits (422),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 100/129 (78%), Gaps = 4/129 (3%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +K C CP GFKGDGV +CED+DECKE+  CQCP+CKCKNTWGSYECSC   LLYM EHDT
Sbjct  493  SKDCKCPLGFKGDGVKNCEDVDECKEKTVCQCPECKCKNTWGSYECSCSNGLLYMREHDT  552

Query  564  CI--SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI   K G  + SW F+W++I G+  AG++GYAVYKYRIR YMD+EIR IMAQYMPL++Q
Sbjct  553  CIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAEIRGIMAQYMPLESQ  612

Query  390  GEVPNHVSH  364
               PN   H
Sbjct  613  --PPNTSGH  619



>ref|XP_010233902.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=646

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 101/134 (75%), Gaps = 4/134 (3%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRG-NLLYMHEHD  568
            TKGC CPPGFKGDG+  CED+DECKE++ CQC  C C+NTWGSYEC C G N+LYM EHD
Sbjct  513  TKGCKCPPGFKGDGIHSCEDVDECKEKLFCQCKGCNCENTWGSYECGCGGNNMLYMREHD  572

Query  567  TCISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ-  391
            TCISK   +    GF+WVI FGLA AGV  YAVYKYR+R YMDSEIRAIMAQYMPL+N  
Sbjct  573  TCISKVASSSVGQGFLWVIFFGLAFAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLENHE  632

Query  390  -GEVPNH-VSHGNV  355
               +P   V H ++
Sbjct  633  MSSIPQRPVEHADI  646



>gb|AAK82551.1| AT3g52850/F8J2_20 [Arabidopsis thaliana]
Length=623

 Score =   167 bits (422),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 100/129 (78%), Gaps = 4/129 (3%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +K C CP GFKGDGV +CED+DECKE+  CQCP+CKCKNTWGSYECSC   LLYM EHDT
Sbjct  493  SKDCKCPLGFKGDGVKNCEDVDECKEKTVCQCPECKCKNTWGSYECSCSNGLLYMREHDT  552

Query  564  CI--SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI   K G  + SW F+W++I G+  AG++GYAVYKYRIR YMD+EIR IMAQYMPL++Q
Sbjct  553  CIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAEIRGIMAQYMPLESQ  612

Query  390  GEVPNHVSH  364
               PN   H
Sbjct  613  --PPNTSGH  619



>emb|CDX78128.1| BnaA09g33230D [Brassica napus]
Length=625

 Score =   166 bits (421),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 96/117 (82%), Gaps = 2/117 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI-  559
            C CP GFKGDGV  CED++ECKE+  CQCPDCKCKNTWGSYECSC+  LLYM EHDTCI 
Sbjct  499  CKCPLGFKGDGVKSCEDVNECKEKTGCQCPDCKCKNTWGSYECSCKNGLLYMREHDTCIG  558

Query  558  -SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
             SK G  + SW F+WV+I G+  AG+AGYAVYKYRIR YMD+EIR IMAQYMPL++Q
Sbjct  559  SSKVGTTKLSWSFLWVLIIGVGVAGLAGYAVYKYRIRSYMDAEIRGIMAQYMPLESQ  615



>ref|XP_006411071.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
 gb|ESQ52524.1| hypothetical protein EUTSA_v10016384mg [Eutrema salsugineum]
Length=622

 Score =   166 bits (420),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 96/118 (81%), Gaps = 0/118 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            + GC CPPGFKGDGV  CED+DECKE++ACQCP+CKCKNTWGSYECSC   L Y+ EHDT
Sbjct  495  SSGCKCPPGFKGDGVESCEDVDECKEKVACQCPECKCKNTWGSYECSCGKGLFYLREHDT  554

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI K G  + SW F+W+++   AAA + GYA+YKYRIR YMDSEIR IMAQYMPLD+Q
Sbjct  555  CIGKFGAMKLSWSFLWILLLASAAATLTGYAIYKYRIRSYMDSEIRTIMAQYMPLDSQ  612



>ref|XP_006403761.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
 gb|ESQ45214.1| hypothetical protein EUTSA_v10010181mg [Eutrema salsugineum]
Length=626

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            + GC CP GFKGDGV  CED+DECKE+  CQCP+CKCKNTWGSYECSC   LLYM EHDT
Sbjct  496  SNGCKCPVGFKGDGVKSCEDVDECKEKTVCQCPECKCKNTWGSYECSCSNGLLYMREHDT  555

Query  564  CI--SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI   K G  + SW F+W++I G+  AG++GYAVYKYRIR YMD+EIR IMAQYMPL++Q
Sbjct  556  CIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAEIRGIMAQYMPLESQ  615



>ref|XP_004984464.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X2 [Setaria 
italica]
Length=656

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 99/131 (76%), Gaps = 4/131 (3%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGN-LLYMHEHDTC  562
            GC CP GFKGDGV  CEDIDECKE++ CQC  C CKNTWGSYECSC  + +LYM EHDTC
Sbjct  524  GCKCPAGFKGDGVKSCEDIDECKEKLFCQCKGCSCKNTWGSYECSCGDDKMLYMREHDTC  583

Query  561  ISKAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ--  391
            ISK G  A   W F+WVI FGL  AGV  YAVYKYR+R YMDSEIRAIMAQYMPLDNQ  
Sbjct  584  ISKEGTTATVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLDNQEG  643

Query  390  GEVPNHVSHGN  358
                +HV+H +
Sbjct  644  ANQQHHVAHAD  654



>ref|XP_006290748.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
 gb|EOA23646.1| hypothetical protein CARUB_v10016844mg [Capsella rubella]
Length=626

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +K C CP GFKGDGV  CED+DECKE+  CQCPDCKCKNTWGSYECSC   LLYM EHDT
Sbjct  496  SKDCKCPHGFKGDGVKSCEDVDECKEKKVCQCPDCKCKNTWGSYECSCNNGLLYMREHDT  555

Query  564  CI--SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI   K G  + SW F+W++I G+  AG++GYAVYKYRIR YMD+EIR IMAQYMPL++Q
Sbjct  556  CIGSGKVGTTKLSWSFLWILIIGVGVAGLSGYAVYKYRIRSYMDAEIRGIMAQYMPLESQ  615



>emb|CDX73599.1| BnaC08g24040D [Brassica napus]
Length=625

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/117 (72%), Positives = 96/117 (82%), Gaps = 2/117 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI-  559
            C CP GFKGDGV  CED++ECKE+  CQCPDCKCKNTWGSYECSC+  LLYM EHDTCI 
Sbjct  499  CKCPLGFKGDGVKSCEDVNECKEKKVCQCPDCKCKNTWGSYECSCKNGLLYMREHDTCIG  558

Query  558  -SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
             SK G  + SW F+WV+I G+  AG+AGYAVYKYRIR YMD+EIR IMAQYMPL++Q
Sbjct  559  SSKVGTTKLSWSFLWVLIIGVGVAGLAGYAVYKYRIRTYMDAEIRGIMAQYMPLESQ  615



>ref|XP_004984466.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X4 [Setaria 
italica]
Length=629

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 99/131 (76%), Gaps = 4/131 (3%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGN-LLYMHEHDTC  562
            GC CP GFKGDGV  CEDIDECKE++ CQC  C CKNTWGSYECSC  + +LYM EHDTC
Sbjct  497  GCKCPAGFKGDGVKSCEDIDECKEKLFCQCKGCSCKNTWGSYECSCGDDKMLYMREHDTC  556

Query  561  ISKAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ--  391
            ISK G  A   W F+WVI FGL  AGV  YAVYKYR+R YMDSEIRAIMAQYMPLDNQ  
Sbjct  557  ISKEGTTATVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLDNQEG  616

Query  390  GEVPNHVSHGN  358
                +HV+H +
Sbjct  617  ANQQHHVAHAD  627



>ref|XP_004984463.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X1 [Setaria 
italica]
Length=682

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 99/131 (76%), Gaps = 4/131 (3%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGN-LLYMHEHDTC  562
            GC CP GFKGDGV  CEDIDECKE++ CQC  C CKNTWGSYECSC  + +LYM EHDTC
Sbjct  550  GCKCPAGFKGDGVKSCEDIDECKEKLFCQCKGCSCKNTWGSYECSCGDDKMLYMREHDTC  609

Query  561  ISKAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ--  391
            ISK G  A   W F+WVI FGL  AGV  YAVYKYR+R YMDSEIRAIMAQYMPLDNQ  
Sbjct  610  ISKEGTTATVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLDNQEG  669

Query  390  GEVPNHVSHGN  358
                +HV+H +
Sbjct  670  ANQQHHVAHAD  680



>gb|KFK34530.1| hypothetical protein AALP_AA5G158000 [Arabis alpina]
Length=625

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            + GC CP GFKGDGV  CED+DECKE+  CQCP+CKCKNTWGSYECSC   LLYM EHDT
Sbjct  496  SNGCKCPHGFKGDGVKSCEDVDECKEKTVCQCPECKCKNTWGSYECSCNNGLLYMREHDT  555

Query  564  CI--SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI   K G  + SW F+W++I G+  AG++GYA+YKYRIR YMD+EIR IMAQYMPL++Q
Sbjct  556  CIGSGKVGTTKLSWSFLWILIIGVGVAGISGYAIYKYRIRTYMDAEIRGIMAQYMPLESQ  615



>ref|XP_004984465.1| PREDICTED: vacuolar-sorting receptor 1-like isoform X3 [Setaria 
italica]
Length=655

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 90/131 (69%), Positives = 99/131 (76%), Gaps = 4/131 (3%)
 Frame = -1

Query  738  GCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGN-LLYMHEHDTC  562
            GC CP GFKGDGV  CEDIDECKE++ CQC  C CKNTWGSYECSC  + +LYM EHDTC
Sbjct  523  GCKCPAGFKGDGVKSCEDIDECKEKLFCQCKGCSCKNTWGSYECSCGDDKMLYMREHDTC  582

Query  561  ISKAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ--  391
            ISK G  A   W F+WVI FGL  AGV  YAVYKYR+R YMDSEIRAIMAQYMPLDNQ  
Sbjct  583  ISKEGTTATVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLDNQEG  642

Query  390  GEVPNHVSHGN  358
                +HV+H +
Sbjct  643  ANQQHHVAHAD  653



>emb|CDX67539.1| BnaA07g15790D [Brassica napus]
Length=625

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            + GC CP GFKGDGV  CED+DECKE+  CQCP+CKCKNTWGSYECSC+  LLYM EHDT
Sbjct  496  SNGCKCPLGFKGDGVKSCEDVDECKEKKVCQCPECKCKNTWGSYECSCKNGLLYMREHDT  555

Query  564  CI--SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI  +K G  + SW F+W +I  +  AG++GYA YKYRIRRYMD+EIR IMAQYMPL++Q
Sbjct  556  CIGSNKVGTTKLSWSFLWFLIIAVGVAGLSGYAAYKYRIRRYMDAEIRGIMAQYMPLESQ  615



>gb|AAF80450.1|AF161719_1 vacuolar targeting receptor bp-80 [Triticum aestivum]
Length=624

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 97/131 (74%), Gaps = 3/131 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRG-NLLYMHEHD  568
            ++GC CP GFKGDGV  CEDIDECK + ACQC  C C+NTWGSYECSC G N+LYM E D
Sbjct  491  SEGCKCPQGFKGDGVKSCEDIDECKAKSACQCNGCSCENTWGSYECSCGGNNMLYMREQD  550

Query  567  TCISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ-  391
            TCISK   +   W F+WVI FGL  AGV  YAVYKYR+R YMDSEIRAIMAQYMPLD+Q 
Sbjct  551  TCISKQAASSVGWSFMWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLDSQE  610

Query  390  -GEVPNHVSHG  361
                  HV+H 
Sbjct  611  GANQQQHVAHA  621



>emb|CDY13344.1| BnaC06g14130D [Brassica napus]
Length=625

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            + GC CP GFKGDGV  CED+DECKE+  CQCP+CKCKNTWGSYECSC+  LLYM EHDT
Sbjct  496  SNGCKCPLGFKGDGVKSCEDVDECKEKKVCQCPECKCKNTWGSYECSCKNGLLYMREHDT  555

Query  564  CI--SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI  +K G  + SW F+W +I  +  AG++GYA YKYRIRRYMD+EIR IMAQYMPL++Q
Sbjct  556  CIGSNKVGTTKLSWSFLWFLIIAVGVAGLSGYAAYKYRIRRYMDAEIRGIMAQYMPLESQ  615



>ref|XP_009125234.1| PREDICTED: vacuolar-sorting receptor 1-like [Brassica rapa]
Length=625

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            + GC CP GFKGDGV  CED+DECKE+  CQCP+CKCKNTWGSYECSC+  LLYM EHDT
Sbjct  496  SNGCKCPLGFKGDGVKSCEDVDECKEKKVCQCPECKCKNTWGSYECSCKNGLLYMREHDT  555

Query  564  CI--SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI  +K G  + SW F+W +I  +  AG++GYA YKYRIRRYMD+EIR IMAQYMPL++Q
Sbjct  556  CIGSNKVGTTKLSWSFLWFLIIAVGVAGLSGYAAYKYRIRRYMDAEIRGIMAQYMPLESQ  615



>ref|XP_002876170.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52429.1| hypothetical protein ARALYDRAFT_906663 [Arabidopsis lyrata subsp. 
lyrata]
Length=623

 Score =   165 bits (417),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 98/129 (76%), Gaps = 4/129 (3%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            +K C CP GFKGDGV  CED+DECKE+  CQCP+CKCKNTWGSYECSC   LLYM EHDT
Sbjct  493  SKDCKCPHGFKGDGVKSCEDVDECKEKTVCQCPECKCKNTWGSYECSCSNGLLYMREHDT  552

Query  564  CI--SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            CI   K G  + SW F+W +I G+  AG++GYAVYKYRIR YMD+EIR IMAQYMPL++Q
Sbjct  553  CIGSGKVGTTKLSWSFLWFLIIGVGVAGLSGYAVYKYRIRSYMDAEIRGIMAQYMPLESQ  612

Query  390  GEVPNHVSH  364
               PN   H
Sbjct  613  --PPNTSGH  619



>ref|NP_001292791.1| vacuolar sorting receptor homolog1 precursor [Zea mays]
 gb|ACG42879.1| vacuolar sorting receptor 1 precursor [Zea mays]
 gb|ACL53481.1| unknown [Zea mays]
 gb|ACN34401.1| unknown [Zea mays]
 gb|AFW88458.1| vacuolar sorting receptor-like protein [Zea mays]
Length=629

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSC-RGNLLYMHEHD  568
            ++GC CP GFKGDG   CEDIDEC+E++ CQC  C CKNTWGSYECSC   N+LYM EHD
Sbjct  496  SEGCKCPMGFKGDGEKSCEDIDECQEKLYCQCKGCSCKNTWGSYECSCGDDNMLYMREHD  555

Query  567  TCISKAGKA-EFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            TCISK G A    W F+WVI FGL  AGV  YAVYKYR+R YMDSEIRAIMAQYMPLDNQ
Sbjct  556  TCISKEGTATTVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLDNQ  615

Query  390  -GEVPNHVSHGN  358
             G   + V H N
Sbjct  616  EGANQHQVVHAN  627



>ref|XP_003529053.2| PREDICTED: vacuolar-sorting receptor 1-like [Glycine max]
 gb|KHN25078.1| Vacuolar-sorting receptor 1 [Glycine soja]
Length=624

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDT  565
            TKGC CPPGF+GDGV  CED+DECKE++ CQCP+C+CKNTWGSYEC+C  +L Y  E+D 
Sbjct  496  TKGCKCPPGFRGDGVHSCEDVDECKEKLVCQCPECQCKNTWGSYECTCSDDLFYTRENDM  555

Query  564  CISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            CI K   +    G VW++I  L  AG +GYA YKYRI+RYMDSEIRAIMAQYMPLDNQ E
Sbjct  556  CIGKYAASVAGGGIVWMVILVLGIAGTSGYAFYKYRIQRYMDSEIRAIMAQYMPLDNQPE  615

Query  384  VPNHV  370
            + +  
Sbjct  616  ISSQA  620



>dbj|BAJ85815.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score =   161 bits (408),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = -1

Query  741  KGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTC  562
            + C CP GF+GDGV  C DIDECKER ACQCP+C C++TWG Y+C+C G+LLY+ EHDTC
Sbjct  315  RNCKCPAGFRGDGVKKCHDIDECKERKACQCPECSCRDTWGGYDCTCSGDLLYIKEHDTC  374

Query  561  ISK-AGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGE  385
            ISK A KA+ +W  V  I+  L      GY VYKYR+R YMDSEIRAIMAQYMPLD+QGE
Sbjct  375  ISKTAVKAKEAWAAVCGILVALVIVAAGGYVVYKYRLRSYMDSEIRAIMAQYMPLDSQGE  434

Query  384  VPNHVSHGN  358
            VPN    G+
Sbjct  435  VPNDSHEGH  443



>ref|XP_002467906.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
 gb|EER94904.1| hypothetical protein SORBIDRAFT_01g036170 [Sorghum bicolor]
Length=629

 Score =   163 bits (413),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 89/132 (67%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSC-RGNLLYMHEHD  568
            ++GC CP GFKGDG   CEDIDECK+++ CQC  C CKNTWGSYECSC   N+LYM EHD
Sbjct  496  SEGCKCPVGFKGDGEKSCEDIDECKDKLYCQCKGCSCKNTWGSYECSCGDDNMLYMREHD  555

Query  567  TCISKAG-KAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            TCISK G  +   W F+WVI FGL  AGV  YAVYKYR+R YMDSEIRAIMAQYMPLDNQ
Sbjct  556  TCISKKGTTSTVGWSFLWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLDNQ  615

Query  390  -GEVPNHVSHGN  358
             G   + V H N
Sbjct  616  EGANQHQVVHAN  627



>ref|XP_009115984.1| PREDICTED: vacuolar-sorting receptor 1 [Brassica rapa]
Length=625

 Score =   163 bits (413),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/117 (71%), Positives = 95/117 (81%), Gaps = 2/117 (2%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCI-  559
            C CP GFKGDGV  CED++ECKE+  CQC DCKCKNTWGSYECSC+  LLYM EHDTCI 
Sbjct  499  CKCPLGFKGDGVKSCEDVNECKEKTVCQCADCKCKNTWGSYECSCKNGLLYMREHDTCIG  558

Query  558  -SKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
             SK G  + SW F+WV+I G+  AG+AGYAVYKYRIR YMD+EIR IMAQYMPL++Q
Sbjct  559  SSKVGTTKLSWSFLWVLIIGVGVAGLAGYAVYKYRIRSYMDAEIRGIMAQYMPLESQ  615



>ref|XP_007140077.1| hypothetical protein PHAVU_008G082200g [Phaseolus vulgaris]
 gb|ESW12071.1| hypothetical protein PHAVU_008G082200g [Phaseolus vulgaris]
Length=619

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 93/126 (74%), Gaps = 3/126 (2%)
 Frame = -1

Query  741  KGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTC  562
            KGC CPPGF+GDGV  CEDIDEC+E+ ACQCP CKCKNTWGSYEC C   L Y  E+DTC
Sbjct  495  KGCTCPPGFRGDGVKSCEDIDECQEKTACQCPSCKCKNTWGSYECKCGSGLFYSRENDTC  554

Query  561  ISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEV  382
            +     +  S   +W+I+  +  A   GYA YKYRI+RYMDSEIRAIMAQYMPLDNQ +V
Sbjct  555  LGAYSASGVS---IWMIMLIVVVAVSGGYAFYKYRIQRYMDSEIRAIMAQYMPLDNQPDV  611

Query  381  PNHVSH  364
            PN V H
Sbjct  612  PNQVHH  617



>ref|XP_004492565.1| PREDICTED: vacuolar-sorting receptor 1-like [Cicer arietinum]
Length=621

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 94/126 (75%), Gaps = 3/126 (2%)
 Frame = -1

Query  741  KGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTC  562
            KGC CPPG +GDGV  CEDIDECKE++ACQCP+CKCKNT+GSYEC C   LLY  E+DTC
Sbjct  497  KGCECPPGLRGDGVLSCEDIDECKEKLACQCPECKCKNTFGSYECKCGSGLLYSRENDTC  556

Query  561  ISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQGEV  382
            I   GK   S   +W+II  L      GYA YKYRI+RYMDSEIR+IMAQYMPLDNQ E+
Sbjct  557  I---GKYTSSVVNIWMIILVLVVTLSGGYAFYKYRIQRYMDSEIRSIMAQYMPLDNQPEI  613

Query  381  PNHVSH  364
             N V H
Sbjct  614  SNQVHH  619



>ref|XP_010228654.1| PREDICTED: vacuolar-sorting receptor 1-like [Brachypodium distachyon]
Length=627

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 96/132 (73%), Gaps = 4/132 (3%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRG--NLLYMHEH  571
            + GC CP GFKGDG+  CEDIDECK + ACQC  C C+NTWGSYECSC G  ++LYM E 
Sbjct  493  SNGCKCPEGFKGDGIKSCEDIDECKMKTACQCTGCSCENTWGSYECSCAGGDSMLYMREQ  552

Query  570  DTCISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQ  391
            DTCISK   +   W F+WVI FGL  AGV  YAVYKYR+R YMDSEIRAIMAQYMPLD+Q
Sbjct  553  DTCISKQAVSSVGWSFMWVIFFGLVFAGVGAYAVYKYRLRSYMDSEIRAIMAQYMPLDSQ  612

Query  390  --GEVPNHVSHG  361
                   HV+H 
Sbjct  613  EGANQQQHVAHA  624



>gb|AAN05373.1| Putative vacuolar sorting receptor protein [Oryza sativa Japonica 
Group]
Length=643

 Score =   161 bits (407),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 96/136 (71%), Gaps = 13/136 (10%)
 Frame = -1

Query  735  CYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRGNLLYMHEHDTCIS  556
            C CP GF+GDGV  CEDI+ECKE+ ACQCP+C C++TWG YEC+C G+LLY+ EHDTCIS
Sbjct  503  CQCPAGFRGDGVKKCEDINECKEKKACQCPECSCRDTWGDYECTCSGDLLYIKEHDTCIS  562

Query  555  ---------KAGK----AEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMA  415
                      AGK     + +W  VW I+  L       Y VYKYR+R YMDSEIRAIMA
Sbjct  563  HLIYYLFDQSAGKTAVQGKAAWAAVWGILIVLVVVAAGSYVVYKYRLRSYMDSEIRAIMA  622

Query  414  QYMPLDNQGEVPNHVS  367
            QYMPLD+QGEVPNH +
Sbjct  623  QYMPLDSQGEVPNHTN  638



>ref|XP_002463394.1| hypothetical protein SORBIDRAFT_02g043010 [Sorghum bicolor]
 gb|EER99915.1| hypothetical protein SORBIDRAFT_02g043010 [Sorghum bicolor]
Length=636

 Score =   160 bits (406),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 98/125 (78%), Gaps = 2/125 (2%)
 Frame = -1

Query  744  TKGCYCPPGFKGDGVTHCEDIDECKERIACQCPDCKCKNTWGSYECSCRG-NLLYMHEHD  568
             KGC CP GF+GDG+  CED+DECKE++ CQC DC C+NTWGSYECSC G N LY+ EHD
Sbjct  501  AKGCKCPSGFRGDGMNSCEDVDECKEKLFCQCKDCACENTWGSYECSCGGSNSLYIREHD  560

Query  567  TCISKAGKAEFSWGFVWVIIFGLaaagvagyavYKYRIRRYMDSEIRAIMAQYMPLDNQG  388
            TCISK   +   WGF+WVI  GLA AG   YAVYKYR+R YMDSEIRAIMAQYMPL++Q 
Sbjct  561  TCISKQSSSSLGWGFLWVIFIGLALAGAGAYAVYKYRLRSYMDSEIRAIMAQYMPLESQ-  619

Query  387  EVPNH  373
            E+PN 
Sbjct  620  EMPNQ  624



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1413938297850