BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9649

Length=862
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010257893.1|  PREDICTED: polypyrimidine tract-binding prot...    307   4e-98   
ref|XP_010257885.1|  PREDICTED: polypyrimidine tract-binding prot...    307   9e-98   Nelumbo nucifera [Indian lotus]
ref|XP_010257877.1|  PREDICTED: polypyrimidine tract-binding prot...    308   1e-97   Nelumbo nucifera [Indian lotus]
ref|XP_010257870.1|  PREDICTED: polypyrimidine tract-binding prot...    308   1e-97   Nelumbo nucifera [Indian lotus]
ref|XP_010257849.1|  PREDICTED: polypyrimidine tract-binding prot...    307   2e-97   
ref|XP_009595271.1|  PREDICTED: polypyrimidine tract-binding prot...    305   5e-97   Nicotiana tomentosiformis
ref|XP_009760987.1|  PREDICTED: polypyrimidine tract-binding prot...    305   7e-97   Nicotiana sylvestris
ref|XP_010257821.1|  PREDICTED: polypyrimidine tract-binding prot...    302   9e-96   Nelumbo nucifera [Indian lotus]
ref|XP_010088136.1|  Polypyrimidine tract-binding protein-1-like ...    301   4e-95   Morus notabilis
ref|XP_009760986.1|  PREDICTED: polypyrimidine tract-binding prot...    300   5e-95   Nicotiana sylvestris
ref|XP_012084721.1|  PREDICTED: polypyrimidine tract-binding prot...    294   3e-94   Jatropha curcas
ref|XP_006384308.1|  hypothetical protein POPTR_0004s12210g             295   6e-93   Populus trichocarpa [western balsam poplar]
ref|XP_008230782.1|  PREDICTED: polypyrimidine tract-binding prot...    295   8e-93   Prunus mume [ume]
ref|XP_007215290.1|  hypothetical protein PRUPE_ppa004961mg             295   1e-92   Prunus persica
ref|XP_012084720.1|  PREDICTED: polypyrimidine tract-binding prot...    294   1e-92   Jatropha curcas
gb|ABB55397.1|  polypyrimidine tract-binding protein-like               293   2e-92   Solanum tuberosum [potatoes]
gb|ABK95931.1|  unknown                                                 293   2e-92   Populus trichocarpa [western balsam poplar]
ref|XP_011002486.1|  PREDICTED: polypyrimidine tract-binding prot...    293   5e-92   Populus euphratica
ref|NP_001275258.1|  polypyrimidine tract-binding protein homolog...    292   6e-92   Solanum tuberosum [potatoes]
ref|XP_002283748.1|  PREDICTED: polypyrimidine tract-binding prot...    290   1e-91   Vitis vinifera
ref|XP_004232215.1|  PREDICTED: polypyrimidine tract-binding prot...    290   4e-91   Solanum lycopersicum
ref|XP_007032572.1|  Polypyrimidine tract-binding protein 1 isofo...    284   2e-90   
ref|XP_010693256.1|  PREDICTED: polypyrimidine tract-binding prot...    287   3e-90   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009376283.1|  PREDICTED: polypyrimidine tract-binding prot...    288   3e-90   Pyrus x bretschneideri [bai li]
ref|XP_007032571.1|  Polypyrimidine tract-binding protein 1 isofo...    285   7e-90   
ref|XP_011467949.1|  PREDICTED: polypyrimidine tract-binding prot...    284   9e-90   Fragaria vesca subsp. vesca
ref|XP_008379365.1|  PREDICTED: polypyrimidine tract-binding prot...    283   2e-89   
gb|KJB33521.1|  hypothetical protein B456_006G014900                    285   2e-89   Gossypium raimondii
gb|KCW51897.1|  hypothetical protein EUGRSUZ_J013582                    283   2e-89   Eucalyptus grandis [rose gum]
ref|XP_007032570.1|  Polypyrimidine tract-binding protein 1 isofo...    285   3e-89   
ref|XP_002533124.1|  polypyrimidine tract binding protein, putative     285   4e-89   
ref|XP_004304288.1|  PREDICTED: polypyrimidine tract-binding prot...    285   6e-89   Fragaria vesca subsp. vesca
gb|ABB02630.1|  polypyrimidine tract-binding-like                       283   9e-89   Solanum tuberosum [potatoes]
ref|XP_011035783.1|  PREDICTED: polypyrimidine tract-binding prot...    282   9e-89   Populus euphratica
ref|XP_010032504.1|  PREDICTED: polypyrimidine tract-binding prot...    283   2e-88   Eucalyptus grandis [rose gum]
ref|XP_009360610.1|  PREDICTED: polypyrimidine tract-binding prot...    283   2e-88   Pyrus x bretschneideri [bai li]
ref|XP_009404082.1|  PREDICTED: polypyrimidine tract-binding prot...    282   3e-88   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG17551.1|  Polypyrimidine tract-binding -like protein              283   4e-88   Gossypium arboreum [tree cotton]
ref|XP_008379363.1|  PREDICTED: polypyrimidine tract-binding prot...    283   4e-88   
ref|XP_011035782.1|  PREDICTED: polypyrimidine tract-binding prot...    281   8e-88   Populus euphratica
gb|KJB33526.1|  hypothetical protein B456_006G014900                    281   1e-87   Gossypium raimondii
ref|XP_008341593.1|  PREDICTED: polypyrimidine tract-binding prot...    278   2e-87   
ref|XP_008783784.1|  PREDICTED: polypyrimidine tract-binding prot...    280   2e-87   
ref|XP_002324068.1|  hypothetical protein POPTR_0017s12160g             280   2e-87   
ref|XP_008783771.1|  PREDICTED: polypyrimidine tract-binding prot...    280   2e-87   
ref|XP_010939821.1|  PREDICTED: polypyrimidine tract-binding prot...    276   3e-86   Elaeis guineensis
ref|XP_003534438.1|  PREDICTED: polypyrimidine tract-binding prot...    278   3e-86   Glycine max [soybeans]
ref|XP_008802573.1|  PREDICTED: polypyrimidine tract-binding prot...    277   3e-86   Phoenix dactylifera
ref|XP_008341592.1|  PREDICTED: polypyrimidine tract-binding prot...    278   3e-86   Malus domestica [apple tree]
ref|XP_010939819.1|  PREDICTED: polypyrimidine tract-binding prot...    276   5e-86   Elaeis guineensis
gb|KJB33523.1|  hypothetical protein B456_006G014900                    275   7e-86   Gossypium raimondii
gb|KJB33524.1|  hypothetical protein B456_006G014900                    275   8e-86   Gossypium raimondii
ref|XP_007139529.1|  hypothetical protein PHAVU_008G037600g             276   1e-85   Phaseolus vulgaris [French bean]
ref|XP_011098645.1|  PREDICTED: polypyrimidine tract-binding prot...    276   2e-85   Sesamum indicum [beniseed]
ref|XP_010937181.1|  PREDICTED: polypyrimidine tract-binding prot...    275   3e-85   Elaeis guineensis
ref|XP_006431186.1|  hypothetical protein CICLE_v10011680mg             274   5e-85   Citrus clementina [clementine]
ref|XP_008379364.1|  PREDICTED: polypyrimidine tract-binding prot...    274   1e-84   
gb|KJB75710.1|  hypothetical protein B456_012G052900                    273   1e-84   Gossypium raimondii
gb|KHN11624.1|  Polypyrimidine tract-binding protein like 1             277   2e-84   Glycine soja [wild soybean]
ref|XP_006482618.1|  PREDICTED: polypyrimidine tract-binding prot...    270   1e-83   Citrus sinensis [apfelsine]
ref|XP_004491824.1|  PREDICTED: polypyrimidine tract-binding prot...    268   6e-83   Cicer arietinum [garbanzo]
ref|XP_011622366.1|  PREDICTED: polypyrimidine tract-binding prot...    269   7e-83   Amborella trichopoda
ref|XP_003552536.1|  PREDICTED: polypyrimidine tract-binding prot...    269   1e-82   Glycine max [soybeans]
gb|KHN13603.1|  Polypyrimidine tract-binding protein like 1             269   1e-82   Glycine soja [wild soybean]
gb|ERM94534.1|  hypothetical protein AMTR_s00010p00265290               269   1e-82   Amborella trichopoda
ref|XP_009382956.1|  PREDICTED: polypyrimidine tract-binding prot...    264   2e-82   
ref|XP_004491823.1|  PREDICTED: polypyrimidine tract-binding prot...    266   7e-82   Cicer arietinum [garbanzo]
ref|XP_009382955.1|  PREDICTED: polypyrimidine tract-binding prot...    265   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009380148.1|  PREDICTED: polypyrimidine tract-binding prot...    265   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006660154.1|  PREDICTED: polypyrimidine tract-binding prot...    262   3e-81   Oryza brachyantha
gb|ACF81680.1|  unknown                                                 258   6e-81   Zea mays [maize]
gb|ACG33108.1|  hypothetical protein                                    257   7e-81   Zea mays [maize]
ref|XP_004974731.1|  PREDICTED: polypyrimidine tract-binding prot...    259   4e-80   
ref|XP_009395951.1|  PREDICTED: polypyrimidine tract-binding prot...    258   8e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008665827.1|  PREDICTED: uncharacterized protein LOC100217...    258   1e-78   
gb|AFK33571.1|  unknown                                                 257   1e-78   Lotus japonicus
ref|NP_001050223.1|  Os03g0376900                                       257   3e-78   
ref|XP_002444395.1|  hypothetical protein SORBIDRAFT_07g021250          256   4e-78   Sorghum bicolor [broomcorn]
gb|EMS67773.1|  Polypyrimidine tract-binding protein-like protein 1     249   1e-77   Triticum urartu
ref|XP_004984223.1|  PREDICTED: polypyrimidine tract-binding prot...    252   2e-77   
ref|XP_010926566.1|  PREDICTED: polypyrimidine tract-binding prot...    254   3e-77   Elaeis guineensis
dbj|BAJ99105.1|  predicted protein                                      250   3e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94455.1|  predicted protein                                      253   3e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001061885.1|  Os08g0436000                                       254   3e-77   
ref|XP_008780489.1|  PREDICTED: polypyrimidine tract-binding prot...    249   6e-77   
gb|EMT31249.1|  Polypyrimidine tract-binding protein-1-like protein     251   7e-77   
ref|XP_008780492.1|  PREDICTED: polypyrimidine tract-binding prot...    249   7e-77   
ref|XP_008780497.1|  PREDICTED: polypyrimidine tract-binding prot...    249   9e-77   
ref|XP_004984222.1|  PREDICTED: polypyrimidine tract-binding prot...    253   1e-76   Setaria italica
ref|XP_008780483.1|  PREDICTED: polypyrimidine tract-binding prot...    250   1e-76   
ref|XP_008665821.1|  PREDICTED: uncharacterized protein LOC100217...    252   2e-76   Zea mays [maize]
ref|XP_008678588.1|  PREDICTED: polypyrimidine tract-binding prot...    251   2e-76   Zea mays [maize]
gb|AFW62276.1|  hypothetical protein ZEAMMB73_137441                    251   3e-76   
gb|AES77477.2|  polypyrimidine tract-binding-like protein               252   4e-76   Medicago truncatula
gb|EEC83626.1|  hypothetical protein OsI_29352                          251   5e-76   Oryza sativa Indica Group [Indian rice]
ref|XP_006650134.1|  PREDICTED: polypyrimidine tract-binding prot...    251   5e-76   Oryza brachyantha
ref|XP_004489403.1|  PREDICTED: polypyrimidine tract-binding prot...    250   6e-76   Cicer arietinum [garbanzo]
ref|XP_008669881.1|  PREDICTED: uncharacterized protein LOC100275...    251   7e-76   
ref|XP_008780475.1|  PREDICTED: polypyrimidine tract-binding prot...    250   7e-76   Phoenix dactylifera
dbj|BAJ92028.1|  predicted protein                                      250   8e-76   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008802574.1|  PREDICTED: polypyrimidine tract-binding prot...    247   1e-75   
ref|XP_010463574.1|  PREDICTED: polypyrimidine tract-binding prot...    243   3e-75   Camelina sativa [gold-of-pleasure]
ref|XP_002467789.1|  hypothetical protein SORBIDRAFT_01g034060          249   4e-75   
ref|XP_010939820.1|  PREDICTED: polypyrimidine tract-binding prot...    248   5e-75   
ref|XP_010228563.1|  PREDICTED: polypyrimidine tract-binding prot...    248   6e-75   Brachypodium distachyon [annual false brome]
emb|CDY43271.1|  BnaC05g48640D                                          246   6e-75   Brassica napus [oilseed rape]
ref|XP_003574527.1|  PREDICTED: polypyrimidine tract-binding prot...    247   9e-75   Brachypodium distachyon [annual false brome]
gb|KDO72600.1|  hypothetical protein CISIN_1g026756mg                   240   1e-74   Citrus sinensis [apfelsine]
ref|XP_008678587.1|  PREDICTED: polypyrimidine tract-binding prot...    246   4e-74   Zea mays [maize]
ref|XP_010463573.1|  PREDICTED: polypyrimidine tract-binding prot...    243   7e-74   Camelina sativa [gold-of-pleasure]
gb|EYU34057.1|  hypothetical protein MIMGU_mgv1a007431mg                243   8e-74   Erythranthe guttata [common monkey flower]
ref|XP_010926567.1|  PREDICTED: polypyrimidine tract-binding prot...    242   1e-73   Elaeis guineensis
gb|KFK37576.1|  hypothetical protein AALP_AA3G001300                    243   1e-73   Arabis alpina [alpine rockcress]
ref|NP_001118547.1|  polypyrimidine tract-binding protein 1             242   1e-73   
ref|XP_006297839.1|  hypothetical protein CARUB_v10013877mg             243   2e-73   
ref|XP_003621259.1|  Polypyrimidine tract-binding protein-like pr...    251   2e-73   
ref|NP_186764.1|  polypyrimidine tract-binding protein 1                242   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550047.1|  PREDICTED: polypyrimidine tract-binding prot...    239   2e-73   Tarenaya hassleriana [spider flower]
gb|AAC62015.1|  polypyrimidine tract-binding protein homolog            243   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001151769.1|  polypyrimidine tract-binding protein               244   3e-73   
gb|EMS55172.1|  Polypyrimidine tract-binding protein-like protein 1     245   5e-73   Triticum urartu
ref|XP_010926565.1|  PREDICTED: polypyrimidine tract-binding prot...    243   7e-73   Elaeis guineensis
ref|XP_009147401.1|  PREDICTED: polypyrimidine tract-binding prot...    240   9e-73   Brassica rapa
ref|XP_010424077.1|  PREDICTED: polypyrimidine tract-binding prot...    241   9e-73   Camelina sativa [gold-of-pleasure]
emb|CDY37541.1|  BnaA05g34060D                                          240   1e-72   Brassica napus [oilseed rape]
gb|EMT31084.1|  Polypyrimidine tract-binding protein-1-like protein     244   2e-72   
ref|XP_008658781.1|  PREDICTED: uncharacterized protein LOC100381...    242   2e-72   
ref|XP_002884293.1|  polypyrimidine tract-binding                       239   2e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_010550046.1|  PREDICTED: polypyrimidine tract-binding prot...    239   7e-72   Tarenaya hassleriana [spider flower]
ref|XP_004984227.1|  PREDICTED: polypyrimidine tract-binding prot...    233   9e-72   
gb|AES74737.2|  polypyrimidine tract-binding-like protein               239   1e-71   Medicago truncatula
ref|XP_006408466.1|  hypothetical protein EUTSA_v10020700mg             238   3e-71   
gb|KJB33520.1|  hypothetical protein B456_006G014900                    233   7e-71   Gossypium raimondii
emb|CDY55803.1|  BnaCnng29130D                                          234   2e-70   Brassica napus [oilseed rape]
gb|AIG20415.1|  polypyrimidine tract-binding protein 1                  234   2e-70   Brassica oleracea var. alboglabra [Chinese broccoli]
gb|KCW51898.1|  hypothetical protein EUGRSUZ_J013582                    226   9e-69   Eucalyptus grandis [rose gum]
ref|XP_010521384.1|  PREDICTED: polypyrimidine tract-binding prot...    227   1e-68   Tarenaya hassleriana [spider flower]
ref|XP_010521385.1|  PREDICTED: polypyrimidine tract-binding prot...    227   2e-68   Tarenaya hassleriana [spider flower]
ref|XP_006431182.1|  hypothetical protein CICLE_v10011680mg             227   2e-68   
gb|KCW46509.1|  hypothetical protein EUGRSUZ_K00333                     227   4e-68   Eucalyptus grandis [rose gum]
ref|XP_010035223.1|  PREDICTED: polypyrimidine tract-binding prot...    227   4e-68   Eucalyptus grandis [rose gum]
ref|XP_010257901.1|  PREDICTED: polypyrimidine tract-binding prot...    227   5e-68   
ref|XP_010035224.1|  PREDICTED: polypyrimidine tract-binding prot...    226   5e-68   
ref|XP_010671513.1|  PREDICTED: polypyrimidine tract-binding prot...    226   1e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010521382.1|  PREDICTED: polypyrimidine tract-binding prot...    228   1e-67   Tarenaya hassleriana [spider flower]
ref|XP_010671512.1|  PREDICTED: polypyrimidine tract-binding prot...    226   1e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010035222.1|  PREDICTED: polypyrimidine tract-binding prot...    228   2e-67   Eucalyptus grandis [rose gum]
ref|XP_006581629.1|  PREDICTED: polypyrimidine tract-binding prot...    224   2e-67   Glycine max [soybeans]
ref|XP_006581626.1|  PREDICTED: polypyrimidine tract-binding prot...    224   3e-67   
ref|XP_006581628.1|  PREDICTED: polypyrimidine tract-binding prot...    224   5e-67   
gb|ABK24339.1|  unknown                                                 228   6e-67   Picea sitchensis
ref|XP_010671511.1|  PREDICTED: polypyrimidine tract-binding prot...    226   8e-67   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO56120.1|  hypothetical protein CISIN_1g013150mg                   221   8e-67   Citrus sinensis [apfelsine]
ref|XP_004308003.1|  PREDICTED: polypyrimidine tract-binding prot...    226   1e-66   Fragaria vesca subsp. vesca
ref|XP_003526695.1|  PREDICTED: polypyrimidine tract-binding prot...    224   4e-66   
ref|XP_006578932.1|  PREDICTED: polypyrimidine tract-binding prot...    221   4e-66   
ref|XP_010485537.1|  PREDICTED: polypyrimidine tract-binding prot...    216   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006578930.1|  PREDICTED: polypyrimidine tract-binding prot...    221   4e-66   
gb|KHG26309.1|  hypothetical protein F383_06939                         224   4e-66   Gossypium arboreum [tree cotton]
gb|KDO56119.1|  hypothetical protein CISIN_1g013150mg                   221   4e-66   Citrus sinensis [apfelsine]
ref|XP_006578929.1|  PREDICTED: polypyrimidine tract-binding prot...    222   5e-66   Glycine max [soybeans]
ref|XP_006578931.1|  PREDICTED: polypyrimidine tract-binding prot...    221   5e-66   
gb|ADE77057.1|  unknown                                                 226   8e-66   Picea sitchensis
ref|XP_006490561.1|  PREDICTED: polypyrimidine tract-binding prot...    221   9e-66   Citrus sinensis [apfelsine]
ref|XP_006490562.1|  PREDICTED: polypyrimidine tract-binding prot...    220   9e-66   
ref|XP_007218008.1|  hypothetical protein PRUPE_ppa005791mg             223   1e-65   Prunus persica
ref|XP_006581624.1|  PREDICTED: polypyrimidine tract-binding prot...    224   1e-65   Glycine max [soybeans]
ref|XP_007038965.1|  Polypyrimidine tract-binding protein isoform 2     223   1e-65   
ref|XP_006595613.1|  PREDICTED: uncharacterized protein LOC100810...    223   1e-65   Glycine max [soybeans]
ref|NP_001242348.1|  uncharacterized protein LOC100810102               223   2e-65   Glycine max [soybeans]
gb|KJB23809.1|  hypothetical protein B456_004G115700                    223   2e-65   Gossypium raimondii
ref|XP_007038964.1|  Polypyrimidine tract-binding protein isoform 1     223   2e-65   
ref|XP_011654625.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...    220   2e-65   Cucumis sativus [cucumbers]
gb|KJB23812.1|  hypothetical protein B456_004G115700                    223   3e-65   Gossypium raimondii
ref|XP_006401736.1|  hypothetical protein EUTSA_v10016110mg             218   3e-65   Eutrema salsugineum [saltwater cress]
ref|XP_003523383.1|  PREDICTED: polypyrimidine tract-binding prot...    222   4e-65   Glycine max [soybeans]
emb|CDY61491.1|  BnaCnng37910D                                          219   4e-65   Brassica napus [oilseed rape]
ref|XP_006401734.1|  hypothetical protein EUTSA_v10016110mg             218   5e-65   
ref|XP_006490558.1|  PREDICTED: polypyrimidine tract-binding prot...    221   8e-65   Citrus sinensis [apfelsine]
ref|XP_009132497.1|  PREDICTED: polypyrimidine tract-binding prot...    221   8e-65   Brassica rapa
ref|XP_008343787.1|  PREDICTED: polypyrimidine tract-binding prot...    221   8e-65   
emb|CDY38731.1|  BnaC03g15180D                                          221   9e-65   Brassica napus [oilseed rape]
gb|ABY59992.1|  polypyrimidine tract-binding protein-like protein       214   1e-64   Robinia pseudoacacia [black locust]
gb|KJB52616.1|  hypothetical protein B456_008G270300                    220   1e-64   Gossypium raimondii
ref|XP_008380607.1|  PREDICTED: polypyrimidine tract-binding prot...    220   2e-64   
ref|XP_010537119.1|  PREDICTED: polypyrimidine tract-binding prot...    217   2e-64   Tarenaya hassleriana [spider flower]
ref|XP_010537118.1|  PREDICTED: polypyrimidine tract-binding prot...    217   2e-64   Tarenaya hassleriana [spider flower]
emb|CDY64347.1|  BnaA03g12420D                                          220   3e-64   Brassica napus [oilseed rape]
ref|XP_007136549.1|  hypothetical protein PHAVU_009G0542001g            225   3e-64   Phaseolus vulgaris [French bean]
gb|KGN49879.1|  hypothetical protein Csa_5G139570                       220   3e-64   Cucumis sativus [cucumbers]
ref|XP_011084492.1|  PREDICTED: polypyrimidine tract-binding prot...    216   4e-64   
ref|XP_006401735.1|  hypothetical protein EUTSA_v10016110mg             218   5e-64   Eutrema salsugineum [saltwater cress]
ref|XP_010442874.1|  PREDICTED: polypyrimidine tract-binding prot...    216   6e-64   
ref|XP_010097853.1|  Polypyrimidine tract-binding protein-2-like ...    219   6e-64   Morus notabilis
ref|XP_012090109.1|  PREDICTED: polypyrimidine tract-binding prot...    217   7e-64   
ref|XP_004498399.1|  PREDICTED: polypyrimidine tract-binding prot...    218   7e-64   Cicer arietinum [garbanzo]
ref|XP_010442875.1|  PREDICTED: polypyrimidine tract-binding prot...    215   7e-64   Camelina sativa [gold-of-pleasure]
ref|XP_011076026.1|  PREDICTED: polypyrimidine tract-binding prot...    216   8e-64   Sesamum indicum [beniseed]
gb|KEH40410.1|  polypyrimidine tract-binding-like protein               218   9e-64   Medicago truncatula
ref|XP_011076027.1|  PREDICTED: polypyrimidine tract-binding prot...    215   9e-64   Sesamum indicum [beniseed]
ref|XP_001782305.1|  predicted protein                                  215   1e-63   
gb|KEH35445.1|  polypyrimidine tract-binding-like protein               216   1e-63   Medicago truncatula
ref|XP_003541515.1|  PREDICTED: polypyrimidine tract-binding prot...    218   1e-63   Glycine max [soybeans]
ref|XP_002865956.1|  hypothetical protein ARALYDRAFT_495390             218   1e-63   
ref|XP_002976368.1|  hypothetical protein SELMODRAFT_104811             218   1e-63   Selaginella moellendorffii
ref|XP_010537117.1|  PREDICTED: polypyrimidine tract-binding prot...    218   2e-63   Tarenaya hassleriana [spider flower]
ref|XP_003618519.1|  Polypyrimidine tract-binding protein-like pr...    219   2e-63   
ref|NP_001078750.1|  polypyrimidine tract-binding protein 2             214   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445605.1|  PREDICTED: polypyrimidine tract-binding prot...    214   2e-63   Camelina sativa [gold-of-pleasure]
ref|XP_008437579.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...    223   2e-63   Cucumis melo [Oriental melon]
ref|XP_010482705.1|  PREDICTED: polypyrimidine tract-binding prot...    214   3e-63   Camelina sativa [gold-of-pleasure]
ref|XP_012090107.1|  PREDICTED: polypyrimidine tract-binding prot...    217   4e-63   Jatropha curcas
ref|XP_011001850.1|  PREDICTED: polypyrimidine tract-binding prot...    213   4e-63   Populus euphratica
ref|XP_010442873.1|  PREDICTED: polypyrimidine tract-binding prot...    216   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_011084489.1|  PREDICTED: polypyrimidine tract-binding prot...    216   5e-63   Sesamum indicum [beniseed]
ref|XP_002513582.1|  polypyrimidine tract binding protein, putative     216   6e-63   Ricinus communis
ref|XP_011076025.1|  PREDICTED: polypyrimidine tract-binding prot...    216   8e-63   Sesamum indicum [beniseed]
ref|XP_011001848.1|  PREDICTED: polypyrimidine tract-binding prot...    213   1e-62   Populus euphratica
ref|XP_010445601.1|  PREDICTED: polypyrimidine tract-binding prot...    215   1e-62   Camelina sativa [gold-of-pleasure]
ref|XP_006422128.1|  hypothetical protein CICLE_v10006435mg             224   1e-62   
ref|XP_011001849.1|  PREDICTED: polypyrimidine tract-binding prot...    213   1e-62   Populus euphratica
ref|XP_010482704.1|  PREDICTED: polypyrimidine tract-binding prot...    214   2e-62   Camelina sativa [gold-of-pleasure]
gb|AES72454.2|  polypyrimidine tract-binding-like protein               216   2e-62   Medicago truncatula
ref|NP_200130.1|  polypyrimidine tract-binding protein 2                214   2e-62   Arabidopsis thaliana [mouse-ear cress]
emb|CDP05088.1|  unnamed protein product                                214   3e-62   Coffea canephora [robusta coffee]
ref|XP_003634092.1|  PREDICTED: polypyrimidine tract-binding prot...    214   3e-62   
ref|XP_001766117.1|  predicted protein                                  215   3e-62   
ref|XP_008376696.1|  PREDICTED: LOW QUALITY PROTEIN: polypyrimidi...    220   4e-62   
ref|XP_011001846.1|  PREDICTED: polypyrimidine tract-binding prot...    214   4e-62   Populus euphratica
ref|XP_009788719.1|  PREDICTED: polypyrimidine tract-binding prot...    210   1e-61   Nicotiana sylvestris
ref|XP_009788720.1|  PREDICTED: polypyrimidine tract-binding prot...    210   1e-61   Nicotiana sylvestris
gb|ADE76380.1|  unknown                                                 214   1e-61   Picea sitchensis
ref|XP_009788715.1|  PREDICTED: polypyrimidine tract-binding prot...    211   1e-61   Nicotiana sylvestris
ref|XP_008810837.1|  PREDICTED: polypyrimidine tract-binding prot...    218   2e-61   
ref|XP_006360176.1|  PREDICTED: polypyrimidine tract-binding prot...    209   2e-61   Solanum tuberosum [potatoes]
gb|EYU19625.1|  hypothetical protein MIMGU_mgv1a006329mg                212   2e-61   Erythranthe guttata [common monkey flower]
ref|XP_006374127.1|  hypothetical protein POPTR_0015s02250g             208   2e-61   
ref|XP_006360175.1|  PREDICTED: polypyrimidine tract-binding prot...    209   2e-61   Solanum tuberosum [potatoes]
ref|XP_009614815.1|  PREDICTED: polypyrimidine tract-binding prot...    209   3e-61   Nicotiana tomentosiformis
ref|XP_009614816.1|  PREDICTED: polypyrimidine tract-binding prot...    209   3e-61   Nicotiana tomentosiformis
ref|XP_002317750.2|  hypothetical protein POPTR_0012s01530g             212   3e-61   
gb|ABK95840.1|  unknown                                                 211   4e-61   Populus trichocarpa [western balsam poplar]
ref|XP_009788550.1|  PREDICTED: polypyrimidine tract-binding prot...    208   5e-61   Nicotiana sylvestris
ref|XP_009788716.1|  PREDICTED: polypyrimidine tract-binding prot...    208   5e-61   Nicotiana sylvestris
ref|XP_009788551.1|  PREDICTED: polypyrimidine tract-binding prot...    208   5e-61   Nicotiana sylvestris
ref|XP_003602203.1|  Polypyrimidine tract-binding protein-like pr...    217   6e-61   
ref|XP_009589653.1|  PREDICTED: polypyrimidine tract-binding prot...    207   6e-61   
ref|XP_009589652.1|  PREDICTED: polypyrimidine tract-binding prot...    207   8e-61   
ref|XP_009788718.1|  PREDICTED: polypyrimidine tract-binding prot...    208   8e-61   Nicotiana sylvestris
ref|XP_006374128.1|  hypothetical protein POPTR_0015s02250g             208   8e-61   
ref|XP_009788713.1|  PREDICTED: polypyrimidine tract-binding prot...    210   9e-61   Nicotiana sylvestris
ref|XP_009589651.1|  PREDICTED: polypyrimidine tract-binding prot...    208   9e-61   Nicotiana tomentosiformis
ref|XP_011005533.1|  PREDICTED: polypyrimidine tract-binding prot...    207   1e-60   Populus euphratica
ref|XP_010424516.1|  PREDICTED: polypyrimidine tract-binding prot...    207   1e-60   
ref|XP_006360174.1|  PREDICTED: polypyrimidine tract-binding prot...    210   2e-60   Solanum tuberosum [potatoes]
emb|CAN66869.1|  hypothetical protein VITISV_013673                     215   2e-60   Vitis vinifera
ref|XP_009614814.1|  PREDICTED: polypyrimidine tract-binding prot...    209   3e-60   Nicotiana tomentosiformis
ref|XP_002322027.1|  hypothetical protein POPTR_0015s02250g             209   3e-60   Populus trichocarpa [western balsam poplar]
ref|XP_009788549.1|  PREDICTED: polypyrimidine tract-binding prot...    209   4e-60   Nicotiana sylvestris
ref|XP_009589649.1|  PREDICTED: polypyrimidine tract-binding prot...    208   5e-60   Nicotiana tomentosiformis
gb|KJB23813.1|  hypothetical protein B456_004G115700                    205   6e-60   Gossypium raimondii
ref|XP_006837462.1|  PREDICTED: polypyrimidine tract-binding prot...    209   1e-59   Amborella trichopoda
ref|XP_006282271.1|  hypothetical protein CARUB_v10028550mg             216   1e-59   
emb|CBI22535.3|  unnamed protein product                                216   2e-59   Vitis vinifera
ref|XP_009410845.1|  PREDICTED: polypyrimidine tract-binding prot...    203   5e-59   
ref|XP_003621260.1|  Polypyrimidine tract-binding protein-like pr...    209   9e-59   
gb|KJB33525.1|  hypothetical protein B456_006G014900                    201   1e-58   Gossypium raimondii
ref|XP_009410844.1|  PREDICTED: polypyrimidine tract-binding prot...    202   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACI23510.1|  putative polypyrimidine tract-binding protein 2         197   1e-58   Triticum monococcum [einkorn wheat]
ref|XP_009404083.1|  PREDICTED: polypyrimidine tract-binding prot...    201   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010661080.1|  PREDICTED: polypyrimidine tract-binding prot...    200   3e-58   Vitis vinifera
ref|XP_011098646.1|  PREDICTED: polypyrimidine tract-binding prot...    199   5e-58   Sesamum indicum [beniseed]
ref|XP_009410842.1|  PREDICTED: polypyrimidine tract-binding prot...    204   6e-58   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACI23511.1|  putative polypyrimidine tract-binding protein 2         195   1e-57   Aegilops speltoides
ref|XP_012084722.1|  PREDICTED: polypyrimidine tract-binding prot...    198   1e-57   Jatropha curcas
ref|XP_006350577.1|  PREDICTED: polypyrimidine tract-binding prot...    198   2e-57   
ref|XP_010317474.1|  PREDICTED: polypyrimidine tract-binding prot...    197   4e-57   Solanum lycopersicum
gb|ACI23509.1|  putative polypyrimidine tract-binding protein 2         193   5e-57   Secale cereale
gb|KJB33527.1|  hypothetical protein B456_006G014900                    197   7e-57   Gossypium raimondii
gb|EYU25201.1|  hypothetical protein MIMGU_mgv1a006270mg                199   2e-56   
ref|XP_006482619.1|  PREDICTED: polypyrimidine tract-binding prot...    195   3e-56   
ref|XP_010257838.1|  PREDICTED: polypyrimidine tract-binding prot...    195   3e-56   
gb|KHG04021.1|  hypothetical protein F383_30279                         197   4e-56   
ref|XP_008230783.1|  PREDICTED: polypyrimidine tract-binding prot...    194   5e-56   
ref|NP_001043595.1|  Os01g0619000                                       198   6e-56   
ref|XP_006350576.1|  PREDICTED: polypyrimidine tract-binding prot...    197   6e-56   
ref|XP_010693257.1|  PREDICTED: polypyrimidine tract-binding prot...    194   6e-56   
ref|XP_011467950.1|  PREDICTED: polypyrimidine tract-binding prot...    194   7e-56   
ref|XP_010257909.1|  PREDICTED: polypyrimidine tract-binding prot...    195   8e-56   
ref|XP_004234176.1|  PREDICTED: polypyrimidine tract-binding prot...    197   9e-56   
ref|XP_010032506.1|  PREDICTED: polypyrimidine tract-binding prot...    194   1e-55   
ref|XP_010924847.1|  PREDICTED: polypyrimidine tract-binding prot...    198   1e-55   
ref|XP_009380149.1|  PREDICTED: polypyrimidine tract-binding prot...    193   2e-55   
ref|XP_008802575.1|  PREDICTED: polypyrimidine tract-binding prot...    193   2e-55   
ref|XP_009395954.1|  PREDICTED: polypyrimidine tract-binding prot...    193   2e-55   
dbj|BAD61523.1|  polypyrimidine tract-binding protein 1-like            199   2e-55   
gb|AEI28160.1|  polypyrimidine tract-binding protein 1                  187   2e-55   
ref|XP_008665838.1|  PREDICTED: uncharacterized protein LOC100217...    192   2e-55   
ref|XP_004969188.1|  PREDICTED: polypyrimidine tract-binding prot...    198   3e-55   
gb|EAY74991.1|  hypothetical protein OsI_02889                          198   5e-55   
gb|ADR78665.1|  polypyrimidine tract-binding protein 1                  185   5e-55   
ref|XP_008783790.1|  PREDICTED: polypyrimidine tract-binding prot...    191   1e-54   
gb|EMT32527.1|  Polypyrimidine tract-binding protein-2-like protein     198   3e-54   
ref|XP_008379366.1|  PREDICTED: polypyrimidine tract-binding prot...    189   4e-54   
gb|EMS51124.1|  Polypyrimidine tract-binding protein-like protein 2     196   5e-54   
ref|XP_008341594.1|  PREDICTED: polypyrimidine tract-binding prot...    189   6e-54   
ref|XP_004984225.1|  PREDICTED: polypyrimidine tract-binding prot...    189   6e-54   
ref|XP_010228564.1|  PREDICTED: polypyrimidine tract-binding prot...    188   1e-53   
ref|XP_004489404.1|  PREDICTED: polypyrimidine tract-binding prot...    188   1e-53   
emb|CDM83427.1|  unnamed protein product                                193   1e-53   
ref|XP_006587748.1|  PREDICTED: polypyrimidine tract-binding prot...    188   2e-53   
ref|XP_008678589.1|  PREDICTED: polypyrimidine tract-binding prot...    187   2e-53   
ref|XP_006602914.1|  PREDICTED: polypyrimidine tract-binding prot...    186   7e-53   
dbj|BAJ86511.1|  predicted protein                                      186   8e-53   
gb|ABF96229.1|  Polypyrimidine tract-binding protein, putative, e...    186   8e-53   
gb|AAM13217.1|  putative polypyrimidine tract-binding protein           181   3e-52   
ref|XP_008669895.1|  PREDICTED: uncharacterized protein LOC100275...    185   3e-52   
ref|XP_010939823.1|  PREDICTED: polypyrimidine tract-binding prot...    184   3e-52   
ref|XP_008802576.1|  PREDICTED: polypyrimidine tract-binding prot...    184   4e-52   
ref|XP_003566893.1|  PREDICTED: polypyrimidine tract-binding prot...    189   5e-52   
ref|XP_008675348.1|  PREDICTED: polypyrimidine tract-binding prot...    187   5e-52   
ref|XP_008665833.1|  PREDICTED: uncharacterized protein LOC100217...    183   1e-51   
ref|XP_004491825.1|  PREDICTED: polypyrimidine tract-binding prot...    182   2e-51   
ref|XP_008675347.1|  PREDICTED: polypyrimidine tract-binding prot...    187   4e-51   
ref|XP_010926569.1|  PREDICTED: polypyrimidine tract-binding prot...    181   6e-51   
ref|XP_002458169.1|  hypothetical protein SORBIDRAFT_03g028150          186   1e-50   
gb|ADR78667.1|  polypyrimidine tract-binding protein 1                  173   3e-50   
ref|XP_008780510.1|  PREDICTED: polypyrimidine tract-binding prot...    177   2e-49   
gb|ADR78666.1|  polypyrimidine tract-binding protein 1                  170   5e-49   
ref|XP_003539236.1|  PREDICTED: polypyrimidine tract-binding prot...    177   5e-48   
gb|KHN21288.1|  Polypyrimidine tract-binding protein like 1             176   1e-47   
gb|KHN45514.1|  Polypyrimidine tract-binding protein like 1             169   2e-46   
emb|CDY49465.1|  BnaA10g06550D                                          169   2e-46   
ref|XP_010926568.1|  PREDICTED: polypyrimidine tract-binding prot...    170   2e-46   
ref|XP_006360177.1|  PREDICTED: polypyrimidine tract-binding prot...    166   2e-45   
ref|XP_009788552.1|  PREDICTED: polypyrimidine tract-binding prot...    166   6e-45   
ref|XP_009614817.1|  PREDICTED: polypyrimidine tract-binding prot...    165   6e-45   
ref|XP_007151245.1|  hypothetical protein PHAVU_004G030300g             168   7e-45   
ref|XP_010485538.1|  PREDICTED: polypyrimidine tract-binding prot...    153   5e-43   
gb|KHG13252.1|  Polypyrimidine tract-binding -like protein              156   3e-42   
tpg|DAA48994.1|  TPA: hypothetical protein ZEAMMB73_491521              148   3e-39   
ref|XP_006431180.1|  hypothetical protein CICLE_v10011680mg             149   8e-39   
ref|XP_006431178.1|  hypothetical protein CICLE_v10011680mg             149   9e-39   
ref|XP_008678590.1|  PREDICTED: polypyrimidine tract-binding prot...    148   1e-38   
ref|NP_001137030.1|  uncharacterized protein LOC100217199               147   2e-38   
tpg|DAA58540.1|  TPA: hypothetical protein ZEAMMB73_710436              145   4e-37   
ref|XP_006587749.1|  PREDICTED: polypyrimidine tract-binding prot...    144   4e-37   
gb|AFW87968.1|  hypothetical protein ZEAMMB73_683995                    137   1e-36   
ref|XP_006602915.1|  PREDICTED: polypyrimidine tract-binding prot...    143   1e-36   
gb|ACU18422.1|  unknown                                                 143   1e-36   
ref|XP_004984226.1|  PREDICTED: polypyrimidine tract-binding prot...    142   3e-36   
gb|ABF96230.1|  Polypyrimidine tract-binding protein, putative, e...    140   2e-35   
gb|KCW62554.1|  hypothetical protein EUGRSUZ_G00047                     134   8e-35   
ref|XP_008669886.1|  PREDICTED: uncharacterized protein LOC100275...    138   1e-34   
gb|KCW78030.1|  hypothetical protein EUGRSUZ_D02255                     133   2e-34   
ref|XP_010489631.1|  PREDICTED: polypyrimidine tract-binding prot...    137   3e-34   
ref|XP_005643800.1|  RNA-binding domain-containing protein              139   3e-34   
ref|XP_010054849.1|  PREDICTED: polypyrimidine tract-binding prot...    133   3e-34   
gb|KHG13251.1|  Polypyrimidine tract-binding -like protein              130   7e-33   
gb|KJB23814.1|  hypothetical protein B456_004G115700                    131   3e-32   
ref|XP_003621261.1|  Polypyrimidine tract-binding protein-like pr...    133   1e-31   
ref|XP_010925172.1|  PREDICTED: polypyrimidine tract-binding prot...    119   2e-29   
ref|XP_010889436.1|  PREDICTED: polypyrimidine tract-binding prot...    114   3e-25   
ref|NP_001133504.1|  polypyrimidine tract-binding protein 2             112   1e-24   
gb|ABY75231.1|  polypyrimidine tract-binding protein-like protein       106   6e-24   
ref|XP_010889437.1|  PREDICTED: polypyrimidine tract-binding prot...    110   9e-24   
ref|XP_007250455.1|  PREDICTED: polypyrimidine tract-binding prot...    110   9e-24   
ref|XP_007245175.1|  PREDICTED: polypyrimidine tract-binding prot...    109   3e-23   
ref|XP_007245174.1|  PREDICTED: polypyrimidine tract-binding prot...    109   3e-23   
ref|XP_007250456.1|  PREDICTED: polypyrimidine tract-binding prot...    108   3e-23   
emb|CAF88128.1|  unnamed protein product                                104   4e-23   
ref|NP_001018313.1|  polypyrimidine tract binding protein 1a            107   2e-22   
pdb|1SJR|A  Chain A, Nmr Structure Of Rrm2 From Human Polypyrimid...    101   2e-22   
ref|XP_008947932.1|  PREDICTED: polypyrimidine tract-binding prot...    105   3e-22   
pdb|2ADB|A  Chain A, Solution Structure Of Polypyrimidine Tract B...    100   3e-22   
emb|CDQ85008.1|  unnamed protein product                                104   3e-22   
dbj|BAO03403.1|  polypyrimidine tract binding protein 1b splicing...    103   5e-22   
ref|XP_006815131.1|  PREDICTED: polypyrimidine tract-binding prot...    104   5e-22   
ref|XP_005509320.1|  PREDICTED: polypyrimidine tract-binding prot...    105   5e-22   
ref|XP_005991998.1|  PREDICTED: polypyrimidine tract-binding prot...    105   5e-22   
gb|EMC82640.1|  Polypyrimidine tract-binding protein 1                  105   5e-22   
ref|XP_010330760.1|  PREDICTED: polypyrimidine tract-binding prot...    106   6e-22   
ref|XP_006876769.1|  PREDICTED: polypyrimidine tract-binding prot...    105   6e-22   
ref|XP_009938201.1|  PREDICTED: polypyrimidine tract-binding prot...    105   7e-22   
gb|KFQ02736.1|  Polypyrimidine tract-binding protein 1                  104   8e-22   
ref|XP_007652621.1|  PREDICTED: polypyrimidine tract-binding prot...    102   8e-22   
ref|XP_003460926.1|  PREDICTED: polypyrimidine tract-binding prot...    104   8e-22   
ref|XP_005406080.1|  PREDICTED: polypyrimidine tract-binding prot...    104   8e-22   
ref|XP_010633269.1|  PREDICTED: polypyrimidine tract-binding prot...    104   9e-22   
ref|XP_005332001.1|  PREDICTED: polypyrimidine tract-binding prot...    104   9e-22   
ref|XP_006815130.1|  PREDICTED: polypyrimidine tract-binding prot...    105   9e-22   
ref|XP_004906928.1|  PREDICTED: polypyrimidine tract-binding prot...    104   9e-22   
ref|XP_004866064.1|  PREDICTED: polypyrimidine tract-binding prot...    104   9e-22   
ref|XP_004632713.1|  PREDICTED: polypyrimidine tract-binding prot...    104   9e-22   
gb|EDL31650.1|  mCG13402, isoform CRA_g                                 103   9e-22   
ref|XP_007434699.1|  PREDICTED: polypyrimidine tract-binding prot...    103   1e-21   
ref|XP_010137848.1|  PREDICTED: polypyrimidine tract-binding prot...    104   1e-21   
ref|XP_007524853.1|  PREDICTED: polypyrimidine tract-binding prot...    104   1e-21   
gb|AAI03384.1|  PTBP1 protein                                           103   1e-21   
dbj|BAG58340.1|  unnamed protein product                                102   1e-21   
ref|XP_010204940.1|  PREDICTED: polypyrimidine tract-binding prot...    104   1e-21   
ref|XP_003386453.1|  PREDICTED: polypyrimidine tract-binding prot...    103   1e-21   
ref|XP_008985119.1|  PREDICTED: polypyrimidine tract-binding prot...    103   1e-21   
ref|XP_009467378.1|  PREDICTED: polypyrimidine tract-binding prot...    104   1e-21   
dbj|BAB71743.1|  PTB-like protein S                                     102   1e-21   
ref|XP_011594748.1|  PREDICTED: polypyrimidine tract-binding prot...    103   1e-21   
ref|XP_004866059.1|  PREDICTED: polypyrimidine tract-binding prot...    104   2e-21   
ref|XP_010561454.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
gb|KFP83126.1|  Polypyrimidine tract-binding protein 2                  102   2e-21   
ref|XP_005406077.1|  PREDICTED: polypyrimidine tract-binding prot...    104   2e-21   
ref|XP_009877061.1|  PREDICTED: polypyrimidine tract-binding prot...    102   2e-21   
gb|ELV09317.1|  Polypyrimidine tract-binding protein 1                  103   2e-21   
ref|XP_006876767.1|  PREDICTED: polypyrimidine tract-binding prot...    104   2e-21   
ref|XP_006639858.1|  PREDICTED: polypyrimidine tract-binding prot...    102   2e-21   
ref|XP_010073499.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
gb|KFQ17337.1|  Polypyrimidine tract-binding protein 1                  103   2e-21   
ref|XP_008985117.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
gb|KFR13470.1|  Polypyrimidine tract-binding protein 2                  102   2e-21   
dbj|BAC40161.1|  unnamed protein product                                101   2e-21   
ref|XP_009330112.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009947893.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_005312160.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_010123995.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009960969.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_010155598.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009979583.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009885515.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009503061.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009278071.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009707024.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009571761.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_007075804.1|  PREDICTED: polypyrimidine tract-binding prot...    102   2e-21   
ref|XP_009278070.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_005332002.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_010280053.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009811436.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_011819376.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_011594746.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_007072143.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_011848433.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009485340.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_005587390.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009688735.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_011848434.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_007489480.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_011472629.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009304155.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009872321.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009979581.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_005331999.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009979582.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
gb|EHH29401.1|  hypothetical protein EGK_09820                          103   2e-21   
gb|ETE68977.1|  Polypyrimidine tract-binding protein 1                  103   2e-21   
ref|XP_005331998.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_005017106.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_008305628.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_005359184.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
gb|EAW61153.1|  polypyrimidine tract binding protein 1, isoform C...    103   2e-21   
ref|XP_011819374.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009330111.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_009330110.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_005610460.1|  PREDICTED: polypyrimidine tract-binding prot...    102   2e-21   
ref|XP_004866062.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_006272578.1|  PREDICTED: polypyrimidine tract-binding prot...    103   2e-21   
ref|XP_010214729.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_005587385.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
gb|KFP49381.1|  Polypyrimidine tract-binding protein 1                  101   3e-21   
ref|XP_004906926.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_010373232.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_007992729.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_005281110.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_004448194.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_010633268.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_009915795.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_006017516.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_005017104.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_004059656.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_006876768.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_008590365.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
gb|EHB16932.1|  Polypyrimidine tract-binding protein 1                  103   3e-21   
ref|XP_003914596.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_006182607.1|  PREDICTED: polypyrimidine tract-binding prot...    102   3e-21   
ref|XP_004632711.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_005444362.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
dbj|BAE37269.1|  unnamed protein product                                103   3e-21   
ref|XP_005406078.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_005259654.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
gb|KFO28919.1|  Polypyrimidine tract-binding protein 1                  103   3e-21   
ref|XP_001375584.2|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_007952733.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_004632710.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
gb|KFQ80980.1|  Polypyrimidine tract-binding protein 2                  100   3e-21   
ref|XP_004448195.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_005017105.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|NP_002810.1|  polypyrimidine tract-binding protein 1 isoform a      103   3e-21   
gb|EOB03154.1|  Polypyrimidine tract-binding protein 1                  103   3e-21   
ref|NP_001072479.1|  polypyrimidine tract binding protein 2             103   3e-21   
ref|XP_003460925.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_003760903.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   
ref|XP_011472627.1|  PREDICTED: polypyrimidine tract-binding prot...    103   3e-21   



>ref|XP_010257893.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X5 [Nelumbo nucifera]
Length=432

 Score =   307 bits (786),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 168/205 (82%), Gaps = 5/205 (2%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +Q  VG DGKKKE ESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  181  DYTNPYLPVNPSAIEGTMQSTVGPDGKKKELESNVLLASIENMQYAVTVDVLHTVFSAFG  240

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  241  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  300

Query  474  YSDKSRDYTVPESG---LQQPSALPNTAPAWQNPQYVSVHSAAPPATMP--MQNPWDPTM  310
            ++D+SRDYT+PESG   +QQ +A+P+    WQ  Q  S+++   PA +P      WDP+M
Sbjct  301  HNDRSRDYTIPESGILPMQQAAAVPSAVGGWQTSQATSMYTGNVPAQLPDGQVASWDPSM  360

Query  309  QGGRPAFISSPTTFPGQEYASPLVP  235
            Q GRP F+S PTTFPGQ Y  P VP
Sbjct  361  QTGRPTFVSVPTTFPGQTYPPPAVP  385


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 54/84 (64%), Gaps = 6/84 (7%)
 Frame = -2

Query  675  TVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLH  514
            TVFSAFG V KIA FEK  G QA IQ+ D  TA+ A++AL+G  I         G C L 
Sbjct  102  TVFSAFGFVHKIATFEKAAGFQALIQFSDAETASSARNALDGRSIPRYLLPEHVGSCHLR  161

Query  513  LSYSRHTDLNVKAYSDKSRDYTVP  442
            +S+S HTDLN+K  S +SRDYT P
Sbjct  162  ISFSAHTDLNIKFQSHRSRDYTNP  185



>ref|XP_010257885.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X4 [Nelumbo nucifera]
Length=462

 Score =   307 bits (786),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 168/205 (82%), Gaps = 5/205 (2%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +Q  VG DGKKKE ESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  211  DYTNPYLPVNPSAIEGTMQSTVGPDGKKKELESNVLLASIENMQYAVTVDVLHTVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  271  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  330

Query  474  YSDKSRDYTVPESG---LQQPSALPNTAPAWQNPQYVSVHSAAPPATMP--MQNPWDPTM  310
            ++D+SRDYT+PESG   +QQ +A+P+    WQ  Q  S+++   PA +P      WDP+M
Sbjct  331  HNDRSRDYTIPESGILPMQQAAAVPSAVGGWQTSQATSMYTGNVPAQLPDGQVASWDPSM  390

Query  309  QGGRPAFISSPTTFPGQEYASPLVP  235
            Q GRP F+S PTTFPGQ Y  P VP
Sbjct  391  QTGRPTFVSVPTTFPGQTYPPPAVP  415


 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDAETASSARNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +S+S HTDLN+K  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVGSCHLRISFSAHTDLNIKFQSHRSRDYTNP  215



>ref|XP_010257877.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X3 [Nelumbo nucifera]
Length=492

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 168/205 (82%), Gaps = 5/205 (2%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +Q  VG DGKKKE ESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  241  DYTNPYLPVNPSAIEGTMQSTVGPDGKKKELESNVLLASIENMQYAVTVDVLHTVFSAFG  300

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  301  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  360

Query  474  YSDKSRDYTVPESG---LQQPSALPNTAPAWQNPQYVSVHSAAPPATMP--MQNPWDPTM  310
            ++D+SRDYT+PESG   +QQ +A+P+    WQ  Q  S+++   PA +P      WDP+M
Sbjct  361  HNDRSRDYTIPESGILPMQQAAAVPSAVGGWQTSQATSMYTGNVPAQLPDGQVASWDPSM  420

Query  309  QGGRPAFISSPTTFPGQEYASPLVP  235
            Q GRP F+S PTTFPGQ Y  P VP
Sbjct  421  QTGRPTFVSVPTTFPGQTYPPPAVP  445


 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 70/135 (52%), Gaps = 37/135 (27%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLH------------------------------TVFSAFGTV  649
            NVLL +IE ++   V++DV+H                              TVFSAFG V
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLVHVNTEKSSLSAYCIGGNITCLLKLVASLTVFSAFGFV  170

Query  648  QKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHLSYSRHTDL  487
             KIA FEK  G QA IQ+ D  TA+ A++AL+G  I         G C L +S+S HTDL
Sbjct  171  HKIATFEKAAGFQALIQFSDAETASSARNALDGRSIPRYLLPEHVGSCHLRISFSAHTDL  230

Query  486  NVKAYSDKSRDYTVP  442
            N+K  S +SRDYT P
Sbjct  231  NIKFQSHRSRDYTNP  245



>ref|XP_010257870.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X2 [Nelumbo nucifera]
Length=493

 Score =   308 bits (788),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 168/205 (82%), Gaps = 5/205 (2%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +Q  VG DGKKKE ESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  242  DYTNPYLPVNPSAIEGTMQSTVGPDGKKKELESNVLLASIENMQYAVTVDVLHTVFSAFG  301

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  302  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  361

Query  474  YSDKSRDYTVPESG---LQQPSALPNTAPAWQNPQYVSVHSAAPPATMP--MQNPWDPTM  310
            ++D+SRDYT+PESG   +QQ +A+P+    WQ  Q  S+++   PA +P      WDP+M
Sbjct  362  HNDRSRDYTIPESGILPMQQAAAVPSAVGGWQTSQATSMYTGNVPAQLPDGQVASWDPSM  421

Query  309  QGGRPAFISSPTTFPGQEYASPLVP  235
            Q GRP F+S PTTFPGQ Y  P VP
Sbjct  422  QTGRPTFVSVPTTFPGQTYPPPAVP  446


 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 70/136 (51%), Gaps = 38/136 (28%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLH-------------------------------TVFSAFGT  652
            NVLL +IE ++   V++DV+H                               TVFSAFG 
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLQVHVNTEKSSLSAYCIGGNITCLLKLVASLTVFSAFGF  170

Query  651  VQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHLSYSRHTD  490
            V KIA FEK  G QA IQ+ D  TA+ A++AL+G  I         G C L +S+S HTD
Sbjct  171  VHKIATFEKAAGFQALIQFSDAETASSARNALDGRSIPRYLLPEHVGSCHLRISFSAHTD  230

Query  489  LNVKAYSDKSRDYTVP  442
            LN+K  S +SRDYT P
Sbjct  231  LNIKFQSHRSRDYTNP  246



>ref|XP_010257849.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010257857.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010257862.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Nelumbo nucifera]
Length=502

 Score =   307 bits (786),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 168/205 (82%), Gaps = 5/205 (2%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +Q  VG DGKKKE ESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  251  DYTNPYLPVNPSAIEGTMQSTVGPDGKKKELESNVLLASIENMQYAVTVDVLHTVFSAFG  310

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  311  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  370

Query  474  YSDKSRDYTVPESG---LQQPSALPNTAPAWQNPQYVSVHSAAPPATMP--MQNPWDPTM  310
            ++D+SRDYT+PESG   +QQ +A+P+    WQ  Q  S+++   PA +P      WDP+M
Sbjct  371  HNDRSRDYTIPESGILPMQQAAAVPSAVGGWQTSQATSMYTGNVPAQLPDGQVASWDPSM  430

Query  309  QGGRPAFISSPTTFPGQEYASPLVP  235
            Q GRP F+S PTTFPGQ Y  P VP
Sbjct  431  QTGRPTFVSVPTTFPGQTYPPPAVP  455


 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 54/84 (64%), Gaps = 6/84 (7%)
 Frame = -2

Query  675  TVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLH  514
            TVFSAFG V KIA FEK  G QA IQ+ D  TA+ A++AL+G  I         G C L 
Sbjct  172  TVFSAFGFVHKIATFEKAAGFQALIQFSDAETASSARNALDGRSIPRYLLPEHVGSCHLR  231

Query  513  LSYSRHTDLNVKAYSDKSRDYTVP  442
            +S+S HTDLN+K  S +SRDYT P
Sbjct  232  ISFSAHTDLNIKFQSHRSRDYTNP  255



>ref|XP_009595271.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 [Nicotiana 
tomentosiformis]
Length=469

 Score =   305 bits (781),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/225 (69%), Positives = 170/225 (76%), Gaps = 16/225 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKKKEPESNVL AS+ENMQYAVT+DVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAMEGLLQPVVGPDGKKKEPESNVLFASLENMQYAVTIDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQYPDVTTA  AKDALEGHCIYDGGYCKLHLSYSRHTDLNV+A
Sbjct  270  TVQKIAIFEKNGQTQALIQYPDVTTAAAAKDALEGHCIYDGGYCKLHLSYSRHTDLNVQA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQ-------YVSVHSAAPPATMPMQNP  325
            YSDKSRDYTVPES L   QQ SA+  T P W NPQ       Y +  +    A+    + 
Sbjct  330  YSDKSRDYTVPESSLLAMQQASAVHATPPVWHNPQSGPQSFGYAAAAAVPGQASTSQMSS  389

Query  324  WDPTMQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPPG  190
            W+P +QGG   F S+PT FPGQ YASP+  +         + PPG
Sbjct  390  WNPNLQGGGSTFPSTPTRFPGQSYASPVSAYAT------AVNPPG  428


 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 71/105 (68%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG VQKIA FEK  G QA IQ+ DV TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVQKIATFEKAAGFQALIQFSDVGTASAAREA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I          +C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPKYLLPEHVNHCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_009760987.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X2 [Nicotiana sylvestris]
Length=464

 Score =   305 bits (780),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 169/225 (75%), Gaps = 16/225 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKKKEPESNVL AS+ENMQYAVT+DVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAMEGLLQPVVGPDGKKKEPESNVLFASLENMQYAVTIDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIAIFEKNG TQA IQYPDVTTA  AKDALEGHCIYDGGYCKLHLSYSRHTDLN++A
Sbjct  270  AVQKIAIFEKNGQTQALIQYPDVTTAAAAKDALEGHCIYDGGYCKLHLSYSRHTDLNIQA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQ-------YVSVHSAAPPATMPMQNP  325
            YSDKSRDYTVPES L   QQ SA+  T P W NPQ       Y +  +    A+    + 
Sbjct  330  YSDKSRDYTVPESSLLAMQQVSAVHATPPVWHNPQSGPQSFGYAAAGAVPGQASTSQMSS  389

Query  324  WDPTMQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPPG  190
            W+P +QGG   F S+PT FPGQ YASP+  +         + PPG
Sbjct  390  WNPNLQGGGSTFPSTPTRFPGQSYASPVSAYAT------AVNPPG  428


 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 71/105 (68%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG VQKIA FEK  G QA IQ+ DV TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVQKIATFEKAAGFQALIQFSDVGTASAAREA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I          +C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPKYLLPEHVNHCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_010257821.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Nelumbo nucifera]
 ref|XP_010257830.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Nelumbo nucifera]
Length=465

 Score =   302 bits (773),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 152/207 (73%), Positives = 170/207 (82%), Gaps = 8/207 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +Q  +G DGKKKE ESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  211  DYTNPYLPVNPSAIEGTMQSTIGPDGKKKELESNVLLASIENMQYAVTVDVLHTVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  271  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  330

Query  474  YSDKSRDYTVPESG---LQQPSALPNTAPAWQNPQYVSVHSAAPPATMP---MQNPWDPT  313
            ++D+SRDYT+PESG   LQQ +A+ ++A  WQ PQ  SV+    PA +P   +   WDP+
Sbjct  331  HNDRSRDYTIPESGILPLQQAAAV-SSAGGWQTPQATSVYPGNMPAQLPDGQVGGSWDPS  389

Query  312  MQG-GRPAFISSPTTFPGQEYASPLVP  235
            MQ  GRP F+S PTTFPGQ Y  P VP
Sbjct  390  MQASGRPTFVSVPTTFPGQTYPPPAVP  416


 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDAETASSARNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +S+S HTDLN+K  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVGSCHLRISFSAHTDLNIKFQSHRSRDYTNP  215



>ref|XP_010088136.1| Polypyrimidine tract-binding protein-1-like protein [Morus notabilis]
 gb|EXB31948.1| Polypyrimidine tract-binding protein-1-like protein [Morus notabilis]
Length=484

 Score =   301 bits (770),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 148/215 (69%), Positives = 165/215 (77%), Gaps = 18/215 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG  QP VG DGK+KEPESNVLLASIENMQYAVTVDV+HTVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGISQPAVGPDGKRKEPESNVLLASIENMQYAVTVDVIHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIAIFEKNG TQA +QYPD+ TA VA++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  NVQKIAIFEKNGQTQALVQYPDIATAAVAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQ------------YVSVHSAAPPATM  340
            YSDKSRDYT+P++ L   QQ   +P T P WQNPQ              +V    PP  +
Sbjct  330  YSDKSRDYTIPDASLLAAQQIPGVPATPPLWQNPQAAPLYPGNEYGAAAAVQGQIPPGQV  389

Query  339  PMQNPWDPTMQGGRPAFISSPTTFPGQEYASPLVP  235
            P   PWDPTMQ GR  ++SSP+TF GQ Y +  VP
Sbjct  390  P---PWDPTMQAGRSTYVSSPSTFRGQNYGASSVP  421


 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 76/125 (61%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDAETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQP  421
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P          G+ QP
Sbjct  170  LDGRSIPRYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAIEGISQP  229

Query  420  SALPN  406
            +  P+
Sbjct  230  AVGPD  234



>ref|XP_009760986.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X1 [Nicotiana sylvestris]
Length=465

 Score =   300 bits (768),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 153/226 (68%), Positives = 169/226 (75%), Gaps = 17/226 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKKKEPESNVL AS+ENMQYAVT+DVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAMEGLLQPVVGPDGKKKEPESNVLFASLENMQYAVTIDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNV-K  478
             VQKIAIFEKNG TQA IQYPDVTTA  AKDALEGHCIYDGGYCKLHLSYSRHTDLN+ +
Sbjct  270  AVQKIAIFEKNGQTQALIQYPDVTTAAAAKDALEGHCIYDGGYCKLHLSYSRHTDLNIQQ  329

Query  477  AYSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQ-------YVSVHSAAPPATMPMQN  328
            AYSDKSRDYTVPES L   QQ SA+  T P W NPQ       Y +  +    A+    +
Sbjct  330  AYSDKSRDYTVPESSLLAMQQVSAVHATPPVWHNPQSGPQSFGYAAAGAVPGQASTSQMS  389

Query  327  PWDPTMQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPPG  190
             W+P +QGG   F S+PT FPGQ YASP+  +         + PPG
Sbjct  390  SWNPNLQGGGSTFPSTPTRFPGQSYASPVSAYAT------AVNPPG  429


 Score =   107 bits (267),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 71/105 (68%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG VQKIA FEK  G QA IQ+ DV TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVQKIATFEKAAGFQALIQFSDVGTASAAREA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I          +C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPKYLLPEHVNHCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_012084721.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X2 [Jatropha curcas]
Length=342

 Score =   294 bits (752),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 166/207 (80%), Gaps = 8/207 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG VQP VG DGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  83   DYTNPYLPVNPTAIEGPVQPAVGPDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  142

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPD+ TA VAK+ LEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  143  TVQKIAIFEKNGGTQALIQYPDIATAAVAKETLEGHCIYDGGYCKLHLSYSRHTDLNVKA  202

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQNPQYVSVH----SAAPPATMPMQNP-WD  319
            YS+KSRDYT+P++ L    Q S +P    AWQNPQ   ++     AAPP     Q P WD
Sbjct  203  YSEKSRDYTIPDASLLAAGQISGVPAAPTAWQNPQAAPIYPPNNYAAPPQVPVGQVPAWD  262

Query  318  PTMQGGRPAFISSPTTFPGQEYASPLV  238
            PT++   PA+ S P T+PGQ Y+SP V
Sbjct  263  PTVRASGPAYASVPGTYPGQTYSSPPV  289


 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 53/83 (64%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++AL+G  I         G C L +
Sbjct  5    VFSAFGFVHKIATFEKAAGFQALIQFTDSDTASAARNALDGRSIPKYLLPEHVGSCHLRI  64

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            SYS HTDLN+K  S +SRDYT P
Sbjct  65   SYSAHTDLNIKFQSHRSRDYTNP  87



>ref|XP_006384308.1| hypothetical protein POPTR_0004s12210g [Populus trichocarpa]
 gb|ERP62105.1| hypothetical protein POPTR_0004s12210g [Populus trichocarpa]
Length=473

 Score =   295 bits (755),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 164/208 (79%), Gaps = 11/208 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG VQP VGVDGKKKEPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGPVQPTVGVDGKKKEPESNVLLASIENMQYAVTIDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDV TA VAK+ LEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGGTQALIQYPDVATAAVAKETLEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSA---APPATMPMQNP-----  325
            YSDKSRDYT+P++ L   Q   L      WQNPQ  S+++    A  A +P+Q P     
Sbjct  330  YSDKSRDYTIPDASLIAAQAPGLHTAPTMWQNPQAGSMYTGNNYATTAAVPVQVPPGQVP  389

Query  324  -WDPTMQGGRPAFISSPTTFPGQEYASP  244
             WDPTMQ G   + S P T+PGQ Y +P
Sbjct  390  AWDPTMQAGGQGYASVPGTYPGQTYPTP  417


 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGYVHKIATFEKAAGFQALIQFTDSETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_008230782.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X1 [Prunus mume]
Length=482

 Score =   295 bits (754),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 162/206 (79%), Gaps = 12/206 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG +QP VG DGKKKE ESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGIMQPAVGPDGKKKELESNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA +QYPDV TA VA++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGQTQALVQYPDVNTAAVAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYVSVHSA---APPATMPMQNP----  325
            +SDKSRDYT+PE+ L   QQ S  P    AWQNPQ   ++     +  A+M  Q P    
Sbjct  330  FSDKSRDYTIPEASLLAVQQVSGYPAAPAAWQNPQAAPMYHGNEFSGAASMQAQGPPGQG  389

Query  324  --WDPTMQGGRPAFISSPTTFPGQEY  253
              WDP MQ GR  F+S P+TFPGQ +
Sbjct  390  PSWDPAMQAGRSTFVSVPSTFPGQTF  415


 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 76/125 (61%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFNDAETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQP  421
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P          G+ QP
Sbjct  170  LDGRSIPRYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAIEGIMQP  229

Query  420  SALPN  406
            +  P+
Sbjct  230  AVGPD  234



>ref|XP_007215290.1| hypothetical protein PRUPE_ppa004961mg [Prunus persica]
 gb|EMJ16489.1| hypothetical protein PRUPE_ppa004961mg [Prunus persica]
Length=483

 Score =   295 bits (754),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 162/206 (79%), Gaps = 12/206 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG +QP VG DGKKKE ESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGIMQPAVGPDGKKKELESNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA +QYPDV TA VA++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGQTQALVQYPDVNTAAVAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYVSVHSA---APPATMPMQNP----  325
            +SDKSRDYT+PE+ L   QQ S  P    AWQNPQ   ++     +  A+M  Q P    
Sbjct  330  FSDKSRDYTIPEASLLAAQQVSGYPAAPAAWQNPQAAPMYHGNEFSGAASMQAQGPPGQG  389

Query  324  --WDPTMQGGRPAFISSPTTFPGQEY  253
              WDP MQ GR  F+S P+TFPGQ +
Sbjct  390  PSWDPAMQAGRSTFVSVPSTFPGQTF  415


 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 76/125 (61%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFNDAETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQP  421
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P          G+ QP
Sbjct  170  LDGRSIPRYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAIEGIMQP  229

Query  420  SALPN  406
            +  P+
Sbjct  230  AVGPD  234



>ref|XP_012084720.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X1 [Jatropha curcas]
 gb|KDP27164.1| hypothetical protein JCGZ_19863 [Jatropha curcas]
Length=469

 Score =   294 bits (752),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 165/205 (80%), Gaps = 8/205 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG VQP VG DGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGPVQPAVGPDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPD+ TA VAK+ LEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGGTQALIQYPDIATAAVAKETLEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQNPQYVSVH----SAAPPATMPMQNP-WD  319
            YS+KSRDYT+P++ L    Q S +P    AWQNPQ   ++     AAPP     Q P WD
Sbjct  330  YSEKSRDYTIPDASLLAAGQISGVPAAPTAWQNPQAAPIYPPNNYAAPPQVPVGQVPAWD  389

Query  318  PTMQGGRPAFISSPTTFPGQEYASP  244
            PT++   PA+ S P T+PGQ Y+SP
Sbjct  390  PTVRASGPAYASVPGTYPGQTYSSP  414


 Score =   104 bits (259),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFTDSDTASAARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPKYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>gb|ABB55397.1| polypyrimidine tract-binding protein-like [Solanum tuberosum]
Length=442

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 162/200 (81%), Gaps = 8/200 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKKKEPESNVL AS+ENMQYAVTVDVL+TVFSAFG
Sbjct  210  DYTNPYLPVNPTAMEGVLQPVVGPDGKKKEPESNVLFASLENMQYAVTVDVLNTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQYPDVT A  AKDALEGHCIYDGGYCKLHLSYSRHTDLNV+A
Sbjct  270  TVQKIAIFEKNGQTQALIQYPDVTIAAAAKDALEGHCIYDGGYCKLHLSYSRHTDLNVQA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYVSVHSAAPPA---TMPMQNP--WD  319
            YSDKSRDYTVPES L   QQ SA+  T P W NPQ   V S+A  A   T+P Q P  W+
Sbjct  330  YSDKSRDYTVPESSLLAMQQASAVHATPPVWHNPQSGPVQSSAGYATTGTVPGQAPPAWN  389

Query  318  PTMQGGRPAFISSPTTFPGQ  259
            P +QGG   F S+PT +PG 
Sbjct  390  PNLQGGGSTFPSAPTGYPGH  409


 Score =   107 bits (266),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 71/105 (68%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG VQKIA FEK  G QA IQ+ DV TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVQKIATFEKAAGFQALIQFSDVGTASAAREA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I          +C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPKYLLPEHVNHCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>gb|ABK95931.1| unknown [Populus trichocarpa]
Length=473

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 163/208 (78%), Gaps = 11/208 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG VQP VG DGKKKEPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGPVQPTVGADGKKKEPESNVLLASIENMQYAVTIDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDV TA VAK+ LEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGGTQALIQYPDVATAAVAKETLEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSA---APPATMPMQNP-----  325
            YSDKSRDYT+P++ L   Q   L      WQNPQ  S+++    A  A +P+Q P     
Sbjct  330  YSDKSRDYTIPDASLIAAQAPGLHTAPTMWQNPQAGSMYTGNNYATTAAVPVQVPPGQVP  389

Query  324  -WDPTMQGGRPAFISSPTTFPGQEYASP  244
             WDPTMQ G   + S P T+PGQ Y +P
Sbjct  390  AWDPTMQAGGQGYASVPGTYPGQTYPTP  417


 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG + KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGYLHKIATFEKAAGFQALIQFTDSETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_011002486.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
[Populus euphratica]
Length=473

 Score =   293 bits (749),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 162/208 (78%), Gaps = 11/208 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG VQP VG DGKKKEPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGPVQPTVGADGKKKEPESNVLLASIENMQYAVTIDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDV TA VAK+ LEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGGTQALIQYPDVATAAVAKETLEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSA---APPATMPMQNP-----  325
            YSDKSRDYT+P++ L   Q   L      WQNPQ  S+++       A +P+Q P     
Sbjct  330  YSDKSRDYTIPDASLIAAQAPGLQTAPTMWQNPQAGSMYTGNNYTTTAAVPVQVPPGQVP  389

Query  324  -WDPTMQGGRPAFISSPTTFPGQEYASP  244
             WDPTMQ G   + S P T+PGQ Y +P
Sbjct  390  AWDPTMQAGGQGYASVPGTYPGQTYPTP  417


 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGYVHKIATFEKAAGFQALIQFTDSETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|NP_001275258.1| polypyrimidine tract-binding protein homolog 1-like [Solanum 
tuberosum]
 gb|AEG89705.1| polypyrimidine tract-binding protein 7 [Solanum tuberosum]
Length=467

 Score =   292 bits (748),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 151/200 (76%), Positives = 162/200 (81%), Gaps = 8/200 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKKKEPESNVL AS+ENMQYAVTVDVL+TVFSAFG
Sbjct  210  DYTNPYLPVNPTAMEGVLQPVVGPDGKKKEPESNVLFASLENMQYAVTVDVLNTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQYPDVT A  AKDALEGHCIYDGGYCKLHLSYSRHTDLNV+A
Sbjct  270  TVQKIAIFEKNGQTQALIQYPDVTIAAAAKDALEGHCIYDGGYCKLHLSYSRHTDLNVQA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYVSVHSAAPPA---TMPMQNP--WD  319
            YSDKSRDYTVPES L   QQ SA+  T P W NPQ   V S+A  A   T+P Q P  W+
Sbjct  330  YSDKSRDYTVPESSLLAMQQASAVHATPPVWHNPQSGPVQSSAGYATTGTVPGQAPPAWN  389

Query  318  PTMQGGRPAFISSPTTFPGQ  259
            P +QGG   F S+PT +PG 
Sbjct  390  PNLQGGGSTFPSAPTGYPGH  409


 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 71/105 (68%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG VQKIA FEK  G QA IQ+ DV TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVQKIATFEKAAGFQALIQFSDVGTASAAREA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I          +C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPKYLLPEHVNHCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_002283748.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X1 [Vitis vinifera]
 emb|CBI22239.3| unnamed protein product [Vitis vinifera]
Length=449

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 146/201 (73%), Positives = 160/201 (80%), Gaps = 5/201 (2%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG  QP +G DGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGIAQPALGPDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYVSVHSAA-PPATMPMQNP-WDPTM  310
            +SD+SRDYT+P+SGL   QQ    P     WQNPQ   +++     A   +Q P WDP M
Sbjct  330  HSDRSRDYTIPDSGLLAVQQAPGHPGATTVWQNPQAAPLYTGHDAAAAAAVQVPSWDPNM  389

Query  309  QGGRPAFISSPTTFPGQEYAS  247
            Q GR  F S+ + FP Q +AS
Sbjct  390  QAGRSTFASAASAFPSQPFAS  410


 Score =   104 bits (259),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_004232215.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 [Solanum 
lycopersicum]
Length=466

 Score =   290 bits (742),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 153/219 (70%), Positives = 168/219 (77%), Gaps = 14/219 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKKKEPESNVL AS+ENMQYAVTVDVL+TVFSAFG
Sbjct  210  DYTNPYLPVNPTAMEGVLQPVVGPDGKKKEPESNVLFASLENMQYAVTVDVLNTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA +QYPDVT A  AKDALEGHCIYDGGYCKLHLSYSRHTDLNV+A
Sbjct  270  TVQKIAIFEKNGQTQALVQYPDVTIAAAAKDALEGHCIYDGGYCKLHLSYSRHTDLNVQA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYVSVHSAAPPA---TMPMQNP---W  322
            YSDKSRDYTVPES L   QQ SA+      W NPQ   V S+A  A    +P Q P   W
Sbjct  330  YSDKSRDYTVPESSLLAMQQASAVHAAPAVWHNPQSGPVQSSAGYAATGAVPGQAPPPAW  389

Query  321  DPTMQGGRPAFISSPTTFPGQEYASP-----LVPFGANQ  220
            +P +QGG   F S+PT +PG  YA P     + P G++Q
Sbjct  390  NPNLQGGGSTFPSAPTGYPGHSYAPPAYATGVHPIGSSQ  428


 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 71/105 (68%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG VQKIA FEK  G QA IQ+ DV TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVQKIATFEKAAGFQALIQFSDVGTASAAREA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I          +C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPKYLLPEHVNHCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_007032572.1| Polypyrimidine tract-binding protein 1 isoform 3 [Theobroma cacao]
 gb|EOY03498.1| Polypyrimidine tract-binding protein 1 isoform 3 [Theobroma cacao]
Length=339

 Score =   284 bits (727),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 164/228 (72%), Gaps = 12/228 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKK+EP+SNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  83   DYTNPYLPVNPTAMEGLMQPVVGPDGKKQEPQSNVLLASIENMQYAVTVDVLHTVFSAFG  142

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  143  TVQKIAIFEKNGGTQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  202

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSA---APPATMPMQNP-----  325
            YSDKSRDYT+ +  L   Q   LP     WQNPQ   ++        A M  Q P     
Sbjct  203  YSDKSRDYTISDPSLLATQVPGLPAAPNVWQNPQAAPLYPGTDYTASAAMQAQPPAGQVP  262

Query  324  -WDPTMQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPPGQP  184
             WDP +Q  RP + S P T P Q Y S  VP   N     G  P  QP
Sbjct  263  AWDPNLQ-ARPPYGSVPGTVPSQSYQSSSVPTYVNAATPAGSSPLSQP  309


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 58/103 (56%), Gaps = 14/103 (14%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++AL+G  I           C L +
Sbjct  5    VFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNALDGRSIPRYLLPEHVTSCHLRI  64

Query  510  SYSRHTDLNVKAYSDKSRDYTVP--------ESGLQQPSALPN  406
            SYS HTDLN+K  S +SRDYT P          GL QP   P+
Sbjct  65   SYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAMEGLMQPVVGPD  107



>ref|XP_010693256.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 168/217 (77%), Gaps = 13/217 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA +G  QPVVG DG KKE ESNVLLA++ENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAFDGLSQPVVGADGVKKEQESNVLLAAVENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQYPDV+TA+VAKD+LEGHCIYDGGYCKLHL+YSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGQTQALIQYPDVSTASVAKDSLEGHCIYDGGYCKLHLTYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPA--WQNPQY--------VSVHSAAPPATMPMQNP  325
            +SDKSRDYT+PE  +QQ S  P  APA  W NPQ          S ++  PP T     P
Sbjct  330  HSDKSRDYTIPEI-VQQTSGYPG-APAVPWMNPQTGAGYPPNGYSTNANMPPQTHAAPAP  387

Query  324  -WDPTMQGGRPAFISSPTTFPGQEYASPLVPFGANQP  217
             WDP+MQ GR  F+S P+TFPGQ Y +  VP  A+ P
Sbjct  388  SWDPSMQPGRRTFVSVPSTFPGQTYTASPVPAYASAP  424


 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E +Q   VT++V+H VFSAFG V KIA FEK  G QA IQ+ DV TA+ AK+A
Sbjct  110  NVLLVTMEGVQPGDVTIEVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDVDTASAAKNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPEHVSSCNLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_009376283.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
[Pyrus x bretschneideri]
Length=482

 Score =   288 bits (737),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 162/210 (77%), Gaps = 19/210 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVNPTA+EG +QP VG DGKKKE ESNVLLASIENMQYAVTVDV+HTVFSAFG
Sbjct  210  DYTNPLLPVNPTAIEGIMQPTVGPDGKKKELESNVLLASIENMQYAVTVDVIHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA +QYPD+ TA VA++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGQTQALVQYPDLNTAAVAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAP-AWQNPQ------------YVSVHSAAPPAT  343
            YSDKSRDYT+P++ L   QQ S  P   P AWQNPQ              SV + APP  
Sbjct  330  YSDKSRDYTIPDASLLAAQQVSGYPPPPPGAWQNPQAAPMYHGNEYSGAASVQAQAPPG-  388

Query  342  MPMQNPWDPTMQGGRPAFISSPTTFPGQEY  253
                + WDP MQ GR  F+S+P+TFPGQ Y
Sbjct  389  --QPSSWDPAMQAGRSTFVSAPSTFPGQTY  416


 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 77/125 (62%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA++A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDAGTASMARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQP  421
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P          G+ QP
Sbjct  170  LDGRSIPRYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNPLLPVNPTAIEGIMQP  229

Query  420  SALPN  406
            +  P+
Sbjct  230  TVGPD  234



>ref|XP_007032571.1| Polypyrimidine tract-binding protein 1 isoform 2 [Theobroma cacao]
 gb|EOY03497.1| Polypyrimidine tract-binding protein 1 isoform 2 [Theobroma cacao]
Length=397

 Score =   285 bits (728),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 164/228 (72%), Gaps = 12/228 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKK+EP+SNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  141  DYTNPYLPVNPTAMEGLMQPVVGPDGKKQEPQSNVLLASIENMQYAVTVDVLHTVFSAFG  200

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  201  TVQKIAIFEKNGGTQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  260

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSA---APPATMPMQNP-----  325
            YSDKSRDYT+ +  L   Q   LP     WQNPQ   ++        A M  Q P     
Sbjct  261  YSDKSRDYTISDPSLLATQVPGLPAAPNVWQNPQAAPLYPGTDYTASAAMQAQPPAGQVP  320

Query  324  -WDPTMQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPPGQP  184
             WDP +Q  RP + S P T P Q Y S  VP   N     G  P  QP
Sbjct  321  AWDPNLQ-ARPPYGSVPGTVPSQSYQSSSVPTYVNAATPAGSSPLSQP  367


 Score = 99.8 bits (247),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 73/125 (58%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   VT++ +H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  41   NVLLVTIEGVEANDVTIETIHLVFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNA  100

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP--------ESGLQQP  421
            L+G  I           C L +SYS HTDLN+K  S +SRDYT P          GL QP
Sbjct  101  LDGRSIPRYLLPEHVTSCHLRISYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAMEGLMQP  160

Query  420  SALPN  406
               P+
Sbjct  161  VVGPD  165



>ref|XP_011467949.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X2 [Fragaria vesca subsp. vesca]
Length=384

 Score =   284 bits (726),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 176/241 (73%), Gaps = 25/241 (10%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG VQP VG DGKKKE ESNVLLASIENMQYAVTVDV+HTVFSAFG
Sbjct  124  DYTNPYLPVNPTAIEGVVQPAVGPDGKKKEMESNVLLASIENMQYAVTVDVIHTVFSAFG  183

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA +QYPD+ TA VA++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  184  TVQKIAIFEKNGQTQALVQYPDIATAAVAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  243

Query  474  YSDKSRDYTVPESGLQQ-PSALPNTAPAWQNPQYVSVH------------SAAPPATMPM  334
            YSDKSRDYT+P++ L    S  P    AWQN Q   V+            +  PP   P 
Sbjct  244  YSDKSRDYTIPDASLLAVQSGYPAAPAAWQNAQASPVYHGNEYSAAAAGPAEGPPGGPPG  303

Query  333  QNP-WDPTMQGGRPAFISSPTTFPGQ---------EYASPLVPFGANQPAHQ-GIPPPGQ  187
            Q P WDP MQ GRP+F+S P+TFPGQ          YAS  +P G++ P HQ G PP  +
Sbjct  304  QVPSWDPNMQAGRPSFVSVPSTFPGQIYPTSSGGPVYASAPMPPGSS-PMHQPGAPPHMR  362

Query  186  P  184
            P
Sbjct  363  P  363


 Score = 86.3 bits (212),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 53/83 (64%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++AL+G  I         G C L +
Sbjct  46   VFSAFGFVHKIATFEKAAGFQALIQFSDADTASAARNALDGRSIPRYLLPEHVGSCHLRI  105

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            SYS HTDLN+K  S +SRDYT P
Sbjct  106  SYSAHTDLNIKFQSHRSRDYTNP  128



>ref|XP_008379365.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X3 [Malus domestica]
Length=378

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 159/210 (76%), Gaps = 16/210 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVNPTA+EG +QP VG DGKKKE ESNVLLASIENMQYAVTVDV+HTVFSAFG
Sbjct  103  DYTNPLLPVNPTAIEGIMQPTVGPDGKKKELESNVLLASIENMQYAVTVDVIHTVFSAFG  162

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA +QYPD+ TA VA++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  163  TVQKIAIFEKNGQTQALVQYPDLNTAAVAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  222

Query  474  YSDKSRDYTVPESGLQQPSALPNTAP----AWQNPQ------------YVSVHSAAPPAT  343
            YSDKSRDYT+P++ L     +    P    AWQNPQ              SV + APP  
Sbjct  223  YSDKSRDYTIPDASLLAAQQVSGYXPPPPGAWQNPQAAPMYQGNEYSGAASVQAQAPPGP  282

Query  342  MPMQNPWDPTMQGGRPAFISSPTTFPGQEY  253
                + WDP MQ GR  F+S+P+TFPGQ Y
Sbjct  283  PGQPSSWDPAMQAGRSTFVSAPSTFPGQTY  312


 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 61/103 (59%), Gaps = 14/103 (14%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KIA FEK  G QA IQ+ D  TA++A++AL+G  I         G C L +
Sbjct  25   VFSAFGFVHKIATFEKAAGFQALIQFSDAGTASMARNALDGRSIPRYLLPEHVGSCHLRI  84

Query  510  SYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQPSALPN  406
            SYS HTDLN+K  S +SRDYT P          G+ QP+  P+
Sbjct  85   SYSAHTDLNIKFQSHRSRDYTNPLLPVNPTAIEGIMQPTVGPD  127



>gb|KJB33521.1| hypothetical protein B456_006G014900 [Gossypium raimondii]
Length=460

 Score =   285 bits (730),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 152/228 (67%), Positives = 169/228 (74%), Gaps = 12/228 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKK+EP+SNVLLASIENMQYAVTVDVLH+VFSAFG
Sbjct  210  DYTNPYLPVNPTAMEGLMQPVVGPDGKKQEPQSNVLLASIENMQYAVTVDVLHSVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTA VAK++LEGHCIY+GGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGGTQALIQYPDVTTAAVAKESLEGHCIYEGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVH---SAAPPATMPMQNP-----  325
            YSDKSRDYT+ +  L   Q   +P T  AWQNPQ   ++     A  A M  Q       
Sbjct  330  YSDKSRDYTISDLSLLATQGPGMPATPNAWQNPQNAPLYPGTDYAASAAMQAQPSAGQVP  389

Query  324  -WDPTMQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPPGQP  184
             WDP++Q  RP++ S P T PGQ Y +  VP   N     G  P  QP
Sbjct  390  AWDPSLQ-ARPSYGSVPGTVPGQAYQASAVPTYMNAAPPAGSSPLSQP  436


 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 75/125 (60%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   VT++ +H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEANDVTIETIHLVFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI---YDGGY---CKLHLSYSRHTDLNVKAYSDKSRDYTVP--------ESGLQQP  421
            L+G  I      G+   C L +SYS HTDLN+K  S +SRDYT P          GL QP
Sbjct  170  LDGRSIPRYLLPGHVTSCHLRISYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAMEGLMQP  229

Query  420  SALPN  406
               P+
Sbjct  230  VVGPD  234



>gb|KCW51897.1| hypothetical protein EUGRSUZ_J013582, partial [Eucalyptus grandis]
Length=398

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 153/198 (77%), Gaps = 4/198 (2%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG  QP +G DGKK EPESNVLLASIENMQYAVTVD LHTVFSAFG
Sbjct  149  DYTNPYLPVNPTAIEGINQPALGPDGKKTEPESNVLLASIENMQYAVTVDALHTVFSAFG  208

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIAIFEKNGGTQA IQYPD+TTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLN+KA
Sbjct  209  PVQKIAIFEKNGGTQALIQYPDITTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNIKA  268

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPTMQG  304
            YSDKSRDYTVP+  L   Q  S  P   P WQNP   +  SA  P        WD TM  
Sbjct  269  YSDKSRDYTVPDPSLLAAQPTSGHPAGPPVWQNPAMSAATSAQSPMPGGQVPSWDQTMH-  327

Query  303  GRPAFISSPTTFPGQEYA  250
             RP F+S+  +FPGQ +A
Sbjct  328  ARPGFVSASGSFPGQNFA  345


 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 74/125 (59%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ DV TA+ A+  
Sbjct  49   NVLLVTMEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDVETASAARAQ  108

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQP  421
            L+G  I           C L ++YS HTDLN+K  S +SRDYT P          G+ QP
Sbjct  109  LDGRSIPRYLLPEHVKSCNLRITYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAIEGINQP  168

Query  420  SALPN  406
            +  P+
Sbjct  169  ALGPD  173



>ref|XP_007032570.1| Polypyrimidine tract-binding protein 1 isoform 1 [Theobroma cacao]
 gb|EOY03496.1| Polypyrimidine tract-binding protein 1 isoform 1 [Theobroma cacao]
Length=466

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 154/228 (68%), Positives = 164/228 (72%), Gaps = 12/228 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKK+EP+SNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAMEGLMQPVVGPDGKKQEPQSNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGGTQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVH---SAAPPATMPMQNP-----  325
            YSDKSRDYT+ +  L   Q   LP     WQNPQ   ++        A M  Q P     
Sbjct  330  YSDKSRDYTISDPSLLATQVPGLPAAPNVWQNPQAAPLYPGTDYTASAAMQAQPPAGQVP  389

Query  324  -WDPTMQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPPGQP  184
             WDP +Q  RP + S P T P Q Y S  VP   N     G  P  QP
Sbjct  390  AWDPNLQ-ARPPYGSVPGTVPSQSYQSSSVPTYVNAATPAGSSPLSQP  436


 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 73/125 (58%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   VT++ +H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEANDVTIETIHLVFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP--------ESGLQQP  421
            L+G  I           C L +SYS HTDLN+K  S +SRDYT P          GL QP
Sbjct  170  LDGRSIPRYLLPEHVTSCHLRISYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAMEGLMQP  229

Query  420  SALPN  406
               P+
Sbjct  230  VVGPD  234



>ref|XP_002533124.1| polypyrimidine tract binding protein, putative [Ricinus communis]
 gb|EEF29269.1| polypyrimidine tract binding protein, putative [Ricinus communis]
Length=483

 Score =   285 bits (729),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 165/210 (79%), Gaps = 13/210 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG VQP VG DGKKKEPESNVLLASIENMQYAVTVDV+HTVFSAFG
Sbjct  218  DYTNPYLPVNPTAIEGPVQPAVGPDGKKKEPESNVLLASIENMQYAVTVDVIHTVFSAFG  277

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA +QYPDV TA VAK+ LEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  278  TVQKIAIFEKNGGTQALVQYPDVATAAVAKETLEGHCIYDGGYCKLHLSYSRHTDLNVKA  337

Query  474  YSDKSRDYTVPESGLQQPSALPN--TAPA-WQNPQ---YVSVHSAAPPATMPMQNP----  325
            YSDKSRDYT+P++ L     +P   TAP  WQNPQ      V+S A  A +  Q P    
Sbjct  338  YSDKSRDYTIPDASLLAAGQVPGVPTAPTMWQNPQASPMYPVNSYASAAAVTAQVPAGQV  397

Query  324  --WDPTMQGGRPAFISS-PTTFPGQEYASP  244
              W+P+M+ G PA+ S  P TFPGQ Y +P
Sbjct  398  PAWNPSMEAGGPAYPSVPPGTFPGQSYPAP  427


 Score = 80.5 bits (197),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 63/113 (56%), Gaps = 15/113 (13%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI--YDGGYCKLHLS------YSRHT------DLNVKAYSDKSRDYTVP  442
            L+G  I  Y      LHLS      YSR T      DL         RDYT P
Sbjct  170  LDGRSIPKYSFFSLNLHLSLNSALLYSRFTQSKSLDDLQFLICLLNFRDYTNP  222



>ref|XP_004304288.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X1 [Fragaria vesca subsp. vesca]
Length=470

 Score =   285 bits (728),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 158/241 (66%), Positives = 176/241 (73%), Gaps = 25/241 (10%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG VQP VG DGKKKE ESNVLLASIENMQYAVTVDV+HTVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGVVQPAVGPDGKKKEMESNVLLASIENMQYAVTVDVIHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA +QYPD+ TA VA++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGQTQALVQYPDIATAAVAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQ-PSALPNTAPAWQNPQYVSVH------------SAAPPATMPM  334
            YSDKSRDYT+P++ L    S  P    AWQN Q   V+            +  PP   P 
Sbjct  330  YSDKSRDYTIPDASLLAVQSGYPAAPAAWQNAQASPVYHGNEYSAAAAGPAEGPPGGPPG  389

Query  333  QNP-WDPTMQGGRPAFISSPTTFPGQ---------EYASPLVPFGANQPAHQ-GIPPPGQ  187
            Q P WDP MQ GRP+F+S P+TFPGQ          YAS  +P G++ P HQ G PP  +
Sbjct  390  QVPSWDPNMQAGRPSFVSVPSTFPGQIYPTSSGGPVYASAPMPPGSS-PMHQPGAPPHMR  448

Query  186  P  184
            P
Sbjct  449  P  449


 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDADTASAARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>gb|ABB02630.1| polypyrimidine tract-binding-like [Solanum tuberosum]
Length=437

 Score =   283 bits (724),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 145/187 (78%), Positives = 154/187 (82%), Gaps = 8/187 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKKKEPESNVL AS+ENMQYAVTVDVL+TVFSAFG
Sbjct  210  DYTNPYLPVNPTAMEGVLQPVVGPDGKKKEPESNVLFASLENMQYAVTVDVLNTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQYPDVT A  AKDALEGHCIYDGGYCKLHLSYSRHTDLNV+A
Sbjct  270  TVQKIAIFEKNGQTQALIQYPDVTIAAAAKDALEGHCIYDGGYCKLHLSYSRHTDLNVQA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYVSVHSAAPPA---TMPMQNP--WD  319
            YSDKSRDYTVPES L   QQ SA+  T P W NPQ   V S+A  A   T+P Q P  W+
Sbjct  330  YSDKSRDYTVPESSLLAMQQASAVHATPPVWHNPQSGPVQSSAGYATTGTVPGQAPPTWN  389

Query  318  PTMQGGR  298
            P +QG R
Sbjct  390  PNLQGWR  396


 Score =   106 bits (265),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 71/105 (68%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG VQKIA FEK  G QA IQ+ DV TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVQKIATFEKAAGFQALIQFSDVGTASAAREA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I          +C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPKYLLPEHVNHCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_011035783.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X2 [Populus euphratica]
Length=403

 Score =   282 bits (721),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 158/208 (76%), Gaps = 11/208 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA++G  Q  VG DGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  141  DYTNPYLPVNPTAIDGPFQSTVGADGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  200

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDV TA VAK+ LEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  201  TVQKIAIFEKNGGTQALIQYPDVATAAVAKETLEGHCIYDGGYCKLHLSYSRHTDLNVKA  260

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVH-------SAAPPATMP--MQN  328
            +SDKSRDYT+P++     Q   L     +WQNPQ  S+H       +AA PA +P     
Sbjct  261  FSDKSRDYTIPDASFLTAQAPGLHTAPTSWQNPQAGSMHLGSNYATTAAAPAQVPPGQVA  320

Query  327  PWDPTMQGGRPAFISSPTTFPGQEYASP  244
             WD TMQ G P + S    +PGQ Y +P
Sbjct  321  AWDLTMQAGGPGYASVRGMYPGQTYPTP  348


 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  41   NVLLVTIEGVEAGDVSIDVIHLVFSAFGYVHKIATFEKAAGFQALIQFTDAETASSARNA  100

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  101  LDGRSIPRYLLPEHVGSCNLRISYSAHTDLNIKFQSHRSRDYTNP  145



>ref|XP_010032504.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X1 [Eucalyptus grandis]
 ref|XP_010032505.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X1 [Eucalyptus grandis]
Length=459

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 153/198 (77%), Gaps = 4/198 (2%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG  QP +G DGKK EPESNVLLASIENMQYAVTVD LHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGINQPALGPDGKKTEPESNVLLASIENMQYAVTVDALHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIAIFEKNGGTQA IQYPD+TTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLN+KA
Sbjct  270  PVQKIAIFEKNGGTQALIQYPDITTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNIKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPTMQG  304
            YSDKSRDYTVP+  L   Q  S  P   P WQNP   +  SA  P        WD TM  
Sbjct  330  YSDKSRDYTVPDPSLLAAQPTSGHPAGPPVWQNPAMSAATSAQSPMPGGQVPSWDQTMH-  388

Query  303  GRPAFISSPTTFPGQEYA  250
             RP F+S+  +FPGQ +A
Sbjct  389  ARPGFVSASGSFPGQNFA  406


 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 74/125 (59%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ DV TA+ A+  
Sbjct  110  NVLLVTMEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDVETASAARAQ  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQP  421
            L+G  I           C L ++YS HTDLN+K  S +SRDYT P          G+ QP
Sbjct  170  LDGRSIPRYLLPEHVKSCNLRITYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAIEGINQP  229

Query  420  SALPN  406
            +  P+
Sbjct  230  ALGPD  234



>ref|XP_009360610.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
[Pyrus x bretschneideri]
Length=484

 Score =   283 bits (725),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 160/209 (77%), Gaps = 15/209 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP+LPVNPTA+EG +QP VG DGK+KE ESNVLLASIENMQYAVTVDV+HTVFSAFG
Sbjct  210  DYTNPHLPVNPTAIEGIMQPTVGPDGKRKEVESNVLLASIENMQYAVTVDVIHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA +QYPD+ TA VA++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGQTQALVQYPDLNTAAVAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQ------------YVSVHSAAPPATM  340
            YSDKSRDYT+P++ L   QQ +  P    AWQNPQ              SV + APP   
Sbjct  330  YSDKSRDYTIPDASLLAAQQVAGYPPPPGAWQNPQAAPMYHGNEYSGATSVQAQAPPGPP  389

Query  339  PMQNPWDPTMQGGRPAFISSPTTFPGQEY  253
                 WDP MQGG   F SSP+TFPGQ Y
Sbjct  390  GQSPSWDPAMQGGISTFGSSPSTFPGQPY  418


 Score =   108 bits (271),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 78/125 (62%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA++A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDAVTASMARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQP  421
            L+G  I       + G C L +SYS HTDLN+K  S +SRDYT P          G+ QP
Sbjct  170  LDGRSIPRYLLPENVGSCNLRISYSAHTDLNIKFQSHRSRDYTNPHLPVNPTAIEGIMQP  229

Query  420  SALPN  406
            +  P+
Sbjct  230  TVGPD  234



>ref|XP_009404082.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=451

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/204 (72%), Positives = 162/204 (79%), Gaps = 16/204 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QPV+G DGK KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  211  DYTNPYLPVNPSAIEGTLQPVLGPDGKIKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLS+SRHTDLNVKA
Sbjct  271  TVQKIAIFEKNGGTQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSFSRHTDLNVKA  330

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQ-NPQYVSVHSAAPPATMPMQNPWDPTMQ  307
            YSDKSRDYT+P+SGL    Q SA+P  + +WQ NPQ    +  +    MP    WDP+  
Sbjct  331  YSDKSRDYTIPDSGLLTNPQASAVPTASTSWQTNPQAAGTY-VSSVGQMPT---WDPS--  384

Query  306  GGRPAFISSPTTFPGQEYASPLVP  235
              +  F S+  TFPGQ    P VP
Sbjct  385  --KTTFASAAGTFPGQ----PFVP  402


 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            E   NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ 
Sbjct  107  EVAGNVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYNDAATASE  166

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            A+++L+G  I           C L +S+S HTDLN+K  S +SRDYT P
Sbjct  167  ARNSLDGRSIPRYLLQDHVTSCHLRISFSAHTDLNIKFQSHRSRDYTNP  215



>gb|KHG17551.1| Polypyrimidine tract-binding -like protein [Gossypium arboreum]
Length=494

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 151/228 (66%), Positives = 168/228 (74%), Gaps = 12/228 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKK+EP+SNVLLASIENMQYAVTVDVLH+VFSAFG
Sbjct  244  DYTNPYLPVNPTAMEGLMQPVVGPDGKKQEPQSNVLLASIENMQYAVTVDVLHSVFSAFG  303

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTA VAK++LEGHCIY+GGYCKLHLSYSRHTDLNVKA
Sbjct  304  TVQKIAIFEKNGGTQALIQYPDVTTAAVAKESLEGHCIYEGGYCKLHLSYSRHTDLNVKA  363

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVH---SAAPPATMPMQNP-----  325
            YSDKSRDYT+ +  L   Q   +P T   WQNPQ   ++     A  A M  Q       
Sbjct  364  YSDKSRDYTISDLSLLATQGPGMPATPNTWQNPQNAPLYPGTDYAASAAMQAQPSAGQVP  423

Query  324  -WDPTMQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPPGQP  184
             WDP++Q  RP++ S P T PGQ Y +  VP   N     G  P  QP
Sbjct  424  AWDPSLQ-ARPSYGSVPGTVPGQAYQASAVPTYMNAAPPAGSSPLSQP  470


 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 68/116 (59%), Gaps = 9/116 (8%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   VT++ +H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEANDVTIETIHLVFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPESGLQQPSALP  409
            L+G  I           C L +SYS HTDLN+K  S +SR    P  G Q    LP
Sbjct  170  LDGRSIPRYLLPDHVTSCHLRISYSAHTDLNIKFQSHRSRVLVKP--GSQHTDVLP  223



>ref|XP_008379363.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Malus domestica]
Length=485

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 159/210 (76%), Gaps = 16/210 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVNPTA+EG +QP VG DGKKKE ESNVLLASIENMQYAVTVDV+HTVFSAFG
Sbjct  210  DYTNPLLPVNPTAIEGIMQPTVGPDGKKKELESNVLLASIENMQYAVTVDVIHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA +QYPD+ TA VA++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGQTQALVQYPDLNTAAVAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQPSALPNTAP----AWQNPQ------------YVSVHSAAPPAT  343
            YSDKSRDYT+P++ L     +    P    AWQNPQ              SV + APP  
Sbjct  330  YSDKSRDYTIPDASLLAAQQVSGYXPPPPGAWQNPQAAPMYQGNEYSGAASVQAQAPPGP  389

Query  342  MPMQNPWDPTMQGGRPAFISSPTTFPGQEY  253
                + WDP MQ GR  F+S+P+TFPGQ Y
Sbjct  390  PGQPSSWDPAMQAGRSTFVSAPSTFPGQTY  419


 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 77/125 (62%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA++A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDAGTASMARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQP  421
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P          G+ QP
Sbjct  170  LDGRSIPRYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNPLLPVNPTAIEGIMQP  229

Query  420  SALPN  406
            +  P+
Sbjct  230  TVGPD  234



>ref|XP_011035782.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Populus euphratica]
Length=472

 Score =   281 bits (720),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 158/208 (76%), Gaps = 11/208 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA++G  Q  VG DGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAIDGPFQSTVGADGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDV TA VAK+ LEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGGTQALIQYPDVATAAVAKETLEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVH-------SAAPPATMP--MQN  328
            +SDKSRDYT+P++     Q   L     +WQNPQ  S+H       +AA PA +P     
Sbjct  330  FSDKSRDYTIPDASFLTAQAPGLHTAPTSWQNPQAGSMHLGSNYATTAAAPAQVPPGQVA  389

Query  327  PWDPTMQGGRPAFISSPTTFPGQEYASP  244
             WD TMQ G P + S    +PGQ Y +P
Sbjct  390  AWDLTMQAGGPGYASVRGMYPGQTYPTP  417


 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGYVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPEHVGSCNLRISYSAHTDLNIKFQSHRSRDYTNP  214



>gb|KJB33526.1| hypothetical protein B456_006G014900 [Gossypium raimondii]
Length=461

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 152/229 (66%), Positives = 169/229 (74%), Gaps = 13/229 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQ-PVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAF  658
            DYTNPYLPVNPTAMEG +Q PVVG DGKK+EP+SNVLLASIENMQYAVTVDVLH+VFSAF
Sbjct  210  DYTNPYLPVNPTAMEGLMQVPVVGPDGKKQEPQSNVLLASIENMQYAVTVDVLHSVFSAF  269

Query  657  GTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVK  478
            GTVQKIAIFEKNGGTQA IQYPDVTTA VAK++LEGHCIY+GGYCKLHLSYSRHTDLNVK
Sbjct  270  GTVQKIAIFEKNGGTQALIQYPDVTTAAVAKESLEGHCIYEGGYCKLHLSYSRHTDLNVK  329

Query  477  AYSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVH---SAAPPATMPMQNP----  325
            AYSDKSRDYT+ +  L   Q   +P T  AWQNPQ   ++     A  A M  Q      
Sbjct  330  AYSDKSRDYTISDLSLLATQGPGMPATPNAWQNPQNAPLYPGTDYAASAAMQAQPSAGQV  389

Query  324  --WDPTMQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPPGQP  184
              WDP++Q  RP++ S P T PGQ Y +  VP   N     G  P  QP
Sbjct  390  PAWDPSLQ-ARPSYGSVPGTVPGQAYQASAVPTYMNAAPPAGSSPLSQP  437


 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   VT++ +H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEANDVTIETIHLVFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI---YDGGY---CKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I      G+   C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPGHVTSCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_008341593.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X2 [Malus domestica]
Length=376

 Score =   278 bits (710),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 158/209 (76%), Gaps = 16/209 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVNPTA+EG +QP VG DGK+KE ESNVLLASIENMQYAVTVDV+HTVFSAFG
Sbjct  103  DYTNPLLPVNPTAIEGIMQPTVGPDGKRKELESNVLLASIENMQYAVTVDVIHTVFSAFG  162

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA +QYPD+ TA VA++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  163  TVQKIAIFEKNGQTQALVQYPDLNTAAVAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  222

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQ------------YVSVHSAAPPATM  340
            YSDKSRDYT+P++ L   QQ S  P    AWQNPQ              SV + APP   
Sbjct  223  YSDKSRDYTIPDASLLAAQQVSGYPPPG-AWQNPQAAPMYHGNEYSGAASVQAQAPPGPP  281

Query  339  PMQNPWDPTMQGGRPAFISSPTTFPGQEY  253
                 WDP MQ G   F S+P+TFPGQ Y
Sbjct  282  GQSPSWDPAMQAGISTFGSAPSTFPGQPY  310


 Score = 89.4 bits (220),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 62/103 (60%), Gaps = 14/103 (14%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KIA FEK  G QA IQ+ D  TA++A++AL+G  I       + G C L +
Sbjct  25   VFSAFGFVHKIATFEKAAGFQALIQFSDAVTASMARNALDGRSIPRYLLPENVGSCNLRI  84

Query  510  SYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQPSALPN  406
            SYS HTDLN+K  S +SRDYT P          G+ QP+  P+
Sbjct  85   SYSAHTDLNIKFQSHRSRDYTNPLLPVNPTAIEGIMQPTVGPD  127



>ref|XP_008783784.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X2 [Phoenix dactylifera]
Length=469

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 166/213 (78%), Gaps = 19/213 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QP +G DG+KKEPESNVLLASIENMQYAVTVDVLH VFS FG
Sbjct  211  DYTNPYLPVNPSAIEGTLQPTLGPDGRKKEPESNVLLASIENMQYAVTVDVLHKVFSTFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDV TA VAK++LEGHCIY+GGYCKLHLSYSRHTDLNVKA
Sbjct  271  TVQKIAIFEKNGGMQALIQYPDVATAAVAKESLEGHCIYEGGYCKLHLSYSRHTDLNVKA  330

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQ-NPQYVSVHSA----------APPATMP  337
            ++D+SRDYT+P++G+    Q   LP  A  WQ NPQ  S+++            P   MP
Sbjct  331  HNDRSRDYTIPDTGMLTIPQAPGLPTAAAGWQANPQSASMYAGNEYAVGAQAPGPNRQMP  390

Query  336  MQNPWDPTMQGGRPAFISSPTTFPGQEYASPLV  238
                WDP+M+GG  A++++P+T+PGQ +A P V
Sbjct  391  T---WDPSMRGG--AYVAAPSTYPGQTFAPPPV  418


 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ A++A
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYSDAETASNARNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +S+S HTDLN+K  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVTSCHLRISFSAHTDLNIKFQSHRSRDYTNP  215



>ref|XP_002324068.1| hypothetical protein POPTR_0017s12160g [Populus trichocarpa]
 gb|EEF04201.1| hypothetical protein POPTR_0017s12160g [Populus trichocarpa]
Length=476

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 158/208 (76%), Gaps = 11/208 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA++G VQ  VG DGKKKEPESNVLLASIENMQYAVTVDVLHTVFS FG
Sbjct  214  DYTNPYLPVNPTAIDGPVQSTVGADGKKKEPESNVLLASIENMQYAVTVDVLHTVFSGFG  273

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDV TA VAK+ LEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  274  TVQKIAIFEKNGGTQALIQYPDVATAAVAKETLEGHCIYDGGYCKLHLSYSRHTDLNVKA  333

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVH-------SAAPPATMP--MQN  328
            +SDKSRDYT+P++     Q   L      WQNPQ  S++       +AA PA +P     
Sbjct  334  FSDKSRDYTIPDASFLTAQAPGLHTAPTTWQNPQAGSMYLGSNYATTAAAPAQVPPGQVA  393

Query  327  PWDPTMQGGRPAFISSPTTFPGQEYASP  244
             WDP+MQ G P + S    +PGQ Y +P
Sbjct  394  AWDPSMQAGGPGYSSVRGMYPGQTYPTP  421


 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 69/109 (63%), Gaps = 11/109 (10%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGYVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCIY----------DGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I             G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRNIMFKKFRYLLPEHVGSCNLRISYSAHTDLNIKFQSHRSRDYTNP  218



>ref|XP_008783771.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Phoenix dactylifera]
 ref|XP_008783777.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Phoenix dactylifera]
Length=473

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 166/213 (78%), Gaps = 19/213 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QP +G DG+KKEPESNVLLASIENMQYAVTVDVLH VFS FG
Sbjct  211  DYTNPYLPVNPSAIEGTLQPTLGPDGRKKEPESNVLLASIENMQYAVTVDVLHKVFSTFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDV TA VAK++LEGHCIY+GGYCKLHLSYSRHTDLNVKA
Sbjct  271  TVQKIAIFEKNGGMQALIQYPDVATAAVAKESLEGHCIYEGGYCKLHLSYSRHTDLNVKA  330

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQ-NPQYVSVHSA----------APPATMP  337
            ++D+SRDYT+P++G+    Q   LP  A  WQ NPQ  S+++            P   MP
Sbjct  331  HNDRSRDYTIPDTGMLTIPQAPGLPTAAAGWQANPQSASMYAGNEYAVGAQAPGPNRQMP  390

Query  336  MQNPWDPTMQGGRPAFISSPTTFPGQEYASPLV  238
                WDP+M+GG  A++++P+T+PGQ +A P V
Sbjct  391  T---WDPSMRGG--AYVAAPSTYPGQTFAPPPV  418


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ A++A
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYSDAETASNARNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +S+S HTDLN+K  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVTSCHLRISFSAHTDLNIKFQSHRSRDYTNP  215



>ref|XP_010939821.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X3 [Elaeis guineensis]
Length=433

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 166/209 (79%), Gaps = 15/209 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QP +G+DGKKKEPESNVLLASIEN+QYAVTVDVLH VFS FG
Sbjct  179  DYTNPYLPVNPSAIEGTLQPTLGLDGKKKEPESNVLLASIENLQYAVTVDVLHKVFSTFG  238

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK +LEGHCIY+GGYCKLHLSYSRHTDLNVKA
Sbjct  239  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKGSLEGHCIYEGGYCKLHLSYSRHTDLNVKA  298

Query  474  YSDKSRDYTVPESGL----QQPSALPNTAPAWQ-NPQYVSVHSA---APPATMPMQN---  328
            ++D+SRDYT+P+SG+    Q P     +A  WQ NPQ  S++     A  A  P+ N   
Sbjct  299  HNDRSRDYTIPDSGILTMPQAPGMPTTSAAGWQTNPQAASMYVGNEYAVGAQAPVPNGQI  358

Query  327  -PWDPTMQGGRPAFISSPTTFPGQEYASP  244
              WDP+MQGG  A++ SP+T+PGQ +A P
Sbjct  359  ATWDPSMQGG--AYV-SPSTYPGQTFAPP  384


 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ A++A
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAQTASTARNA  170

Query  558  LEGHCI  541
            L+G  I
Sbjct  171  LDGRSI  176



>ref|XP_003534438.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoformX1 [Glycine max]
Length=496

 Score =   278 bits (712),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 162/207 (78%), Gaps = 12/207 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVN TA+EG VQ  VG DGK+KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPMLPVNYTAIEGAVQTAVGPDGKRKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQYPD+ TA+ A++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGQTQALIQYPDIITASAAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQPSALPNTAP--AWQNPQYVSVHSAAPPATMPM----QNP-WDP  316
            +SDKSRDYTVP+     PS L    P  AWQNPQ  S++  + PA        Q P WDP
Sbjct  330  FSDKSRDYTVPD-----PSLLAAQGPPTAWQNPQAASMYPGSAPAYHTQVPGGQVPSWDP  384

Query  315  TMQGGRPAFISSPTTFPGQEYASPLVP  235
            ++Q  RP++ S+P TFP Q  A+P +P
Sbjct  385  SLQAVRPSYASAPGTFPVQTGAAPPMP  411


 Score =   106 bits (265),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A+DA
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKTAGFQALIQFTDAETASSARDA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS H DLN+K  S++SRDYT P
Sbjct  170  LDGRSIPRYLLPAHVGSCNLRISYSAHKDLNIKFQSNRSRDYTNP  214



>ref|XP_008802573.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Phoenix dactylifera]
Length=466

 Score =   277 bits (709),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 163/210 (78%), Gaps = 14/210 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QP +G DGKKKEPESNVLLASIENMQYAVTVDVLH VFS FG
Sbjct  211  DYTNPYLPVNPSAIEGTLQPTLGPDGKKKEPESNVLLASIENMQYAVTVDVLHKVFSTFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK ALEGHCIY+GGYCKLHLSYSRHTDLNVKA
Sbjct  271  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKGALEGHCIYEGGYCKLHLSYSRHTDLNVKA  330

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQ-NPQYVSVHSA---APPATMPMQN----  328
            ++D+SRDYT+P++G+    Q   LP  A  WQ NPQ  S++     A  A  P+ N    
Sbjct  331  HNDRSRDYTIPDTGILAMPQAPGLPTAAAGWQANPQAASMYVGNEYAVGAQAPVPNGQMP  390

Query  327  PWDPTMQGGRPAFISSPTTFPGQEYASPLV  238
             WDP+MQGG  A   SP+T+P Q +A P V
Sbjct  391  TWDPSMQGGAYA---SPSTYPAQTFAPPPV  417


 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ A++A
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAETASNARNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +S+S HTDLN+K  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVASCHLRISFSAHTDLNIKFQSHRSRDYTNP  215



>ref|XP_008341592.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Malus domestica]
Length=483

 Score =   278 bits (710),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 158/209 (76%), Gaps = 16/209 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVNPTA+EG +QP VG DGK+KE ESNVLLASIENMQYAVTVDV+HTVFSAFG
Sbjct  210  DYTNPLLPVNPTAIEGIMQPTVGPDGKRKELESNVLLASIENMQYAVTVDVIHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA +QYPD+ TA VA++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGQTQALVQYPDLNTAAVAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQ------------YVSVHSAAPPATM  340
            YSDKSRDYT+P++ L   QQ S  P    AWQNPQ              SV + APP   
Sbjct  330  YSDKSRDYTIPDASLLAAQQVSGYPPPG-AWQNPQAAPMYHGNEYSGAASVQAQAPPGPP  388

Query  339  PMQNPWDPTMQGGRPAFISSPTTFPGQEY  253
                 WDP MQ G   F S+P+TFPGQ Y
Sbjct  389  GQSPSWDPAMQAGISTFGSAPSTFPGQPY  417


 Score =   108 bits (269),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 78/125 (62%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA++A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDAVTASMARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQP  421
            L+G  I       + G C L +SYS HTDLN+K  S +SRDYT P          G+ QP
Sbjct  170  LDGRSIPRYLLPENVGSCNLRISYSAHTDLNIKFQSHRSRDYTNPLLPVNPTAIEGIMQP  229

Query  420  SALPN  406
            +  P+
Sbjct  230  TVGPD  234



>ref|XP_010939819.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Elaeis guineensis]
Length=465

 Score =   276 bits (707),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 166/209 (79%), Gaps = 15/209 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QP +G+DGKKKEPESNVLLASIEN+QYAVTVDVLH VFS FG
Sbjct  211  DYTNPYLPVNPSAIEGTLQPTLGLDGKKKEPESNVLLASIENLQYAVTVDVLHKVFSTFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK +LEGHCIY+GGYCKLHLSYSRHTDLNVKA
Sbjct  271  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKGSLEGHCIYEGGYCKLHLSYSRHTDLNVKA  330

Query  474  YSDKSRDYTVPESGL----QQPSALPNTAPAWQ-NPQYVSVHSA---APPATMPMQN---  328
            ++D+SRDYT+P+SG+    Q P     +A  WQ NPQ  S++     A  A  P+ N   
Sbjct  331  HNDRSRDYTIPDSGILTMPQAPGMPTTSAAGWQTNPQAASMYVGNEYAVGAQAPVPNGQI  390

Query  327  -PWDPTMQGGRPAFISSPTTFPGQEYASP  244
              WDP+MQGG  A++ SP+T+PGQ +A P
Sbjct  391  ATWDPSMQGG--AYV-SPSTYPGQTFAPP  416


 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ A++A
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAQTASTARNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +S+S HTDLN+K  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVTSCHLRISFSAHTDLNIKFQSHRSRDYTNP  215



>gb|KJB33523.1| hypothetical protein B456_006G014900 [Gossypium raimondii]
Length=434

 Score =   275 bits (704),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 145/220 (66%), Positives = 161/220 (73%), Gaps = 22/220 (10%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKK+EP+SNVLLASIENMQYAVTVDVLH+VFSAFG
Sbjct  210  DYTNPYLPVNPTAMEGLMQPVVGPDGKKQEPQSNVLLASIENMQYAVTVDVLHSVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTA VAK++LEGHCIY+GGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGGTQALIQYPDVTTAAVAKESLEGHCIYEGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPTMQG  304
            YSDKSRDYT+ +  L   Q P+A+     A Q P                   WDP++Q 
Sbjct  330  YSDKSRDYTISDLSLLATQGPAAMQAQPSAGQVP------------------AWDPSLQ-  370

Query  303  GRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPPGQP  184
             RP++ S P T PGQ Y +  VP   N     G  P  QP
Sbjct  371  ARPSYGSVPGTVPGQAYQASAVPTYMNAAPPAGSSPLSQP  410


 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 75/125 (60%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   VT++ +H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEANDVTIETIHLVFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI---YDGGY---CKLHLSYSRHTDLNVKAYSDKSRDYTVP--------ESGLQQP  421
            L+G  I      G+   C L +SYS HTDLN+K  S +SRDYT P          GL QP
Sbjct  170  LDGRSIPRYLLPGHVTSCHLRISYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAMEGLMQP  229

Query  420  SALPN  406
               P+
Sbjct  230  VVGPD  234



>gb|KJB33524.1| hypothetical protein B456_006G014900 [Gossypium raimondii]
Length=436

 Score =   275 bits (704),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 161/217 (74%), Gaps = 14/217 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKK+EP+SNVLLASIENMQYAVTVDVLH+VFSAFG
Sbjct  210  DYTNPYLPVNPTAMEGLMQPVVGPDGKKQEPQSNVLLASIENMQYAVTVDVLHSVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTA VAK++LEGHCIY+GGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGGTQALIQYPDVTTAAVAKESLEGHCIYEGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPTMQGGRP  295
            YSDKSRDYT+ +  L           A Q P   ++ +      +P    WDP++Q  RP
Sbjct  330  YSDKSRDYTISDLSLL----------ATQGPASAAMQAQPSAGQVP---AWDPSLQ-ARP  375

Query  294  AFISSPTTFPGQEYASPLVPFGANQPAHQGIPPPGQP  184
            ++ S P T PGQ Y +  VP   N     G  P  QP
Sbjct  376  SYGSVPGTVPGQAYQASAVPTYMNAAPPAGSSPLSQP  412


 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 75/125 (60%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   VT++ +H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEANDVTIETIHLVFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI---YDGGY---CKLHLSYSRHTDLNVKAYSDKSRDYTVP--------ESGLQQP  421
            L+G  I      G+   C L +SYS HTDLN+K  S +SRDYT P          GL QP
Sbjct  170  LDGRSIPRYLLPGHVTSCHLRISYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAMEGLMQP  229

Query  420  SALPN  406
               P+
Sbjct  230  VVGPD  234



>ref|XP_007139529.1| hypothetical protein PHAVU_008G037600g [Phaseolus vulgaris]
 gb|ESW11523.1| hypothetical protein PHAVU_008G037600g [Phaseolus vulgaris]
Length=472

 Score =   276 bits (706),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 164/222 (74%), Gaps = 11/222 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVN TA+EG VQ  +G DGK+KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPMLPVNYTAIEGTVQTAIGPDGKRKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQYPDV TA  A++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGQTQALIQYPDVMTAAAAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPPA--TMPMQNPWDPTMQGG  301
            +SDKSRDYTVP+  L    A    A AWQNPQ   ++  + PA  T      WDP++Q  
Sbjct  330  FSDKSRDYTVPDPSL---VAAQGPATAWQNPQAAPMYHGSAPAYHTQVPSGQWDPSLQAV  386

Query  300  RPAFISSPTTFPGQEYASPLV--PFGANQPAHQGIPPPGQPR  181
            RP++IS+P TF     +SPL   P G N     GI   G PR
Sbjct  387  RPSYISAPGTFAA---SSPLASSPIGHNANP-TGIAQSGVPR  424


 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKTAGFQALIQFTDAETASAAREA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS H DLN+K  S++SRDYT P
Sbjct  170  LDGRSIPRYLLPAHVGSCNLRISYSAHKDLNIKFQSNRSRDYTNP  214



>ref|XP_011098645.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X1 [Sesamum indicum]
Length=473

 Score =   276 bits (705),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 150/204 (74%), Gaps = 10/204 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEGF+QP VG DGKK E ESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAMEGFLQPAVGADGKKMEFESNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQYPD+TTA  AK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGATQALIQYPDITTAAAAKNALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPES-GLQQPSALPNTAPAWQNP---------QYVSVHSAAPPATMPMQNP  325
            YSDKSRDYT+P S  +QQ   +P T    QNP          Y S         MP  + 
Sbjct  330  YSDKSRDYTIPLSLAMQQTPGVPTTVAGLQNPPAASAVPGVGYTSGGMVQAQTPMPPVSS  389

Query  324  WDPTMQGGRPAFISSPTTFPGQEY  253
            W+P      P F+S  +TF  Q Y
Sbjct  390  WNPATVASAPTFMSVSSTFADQAY  413


 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQY DV TA+ A+D+
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYSDVQTASTARDS  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPSHVNDCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_010937181.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
[Elaeis guineensis]
Length=464

 Score =   275 bits (702),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 165/211 (78%), Gaps = 17/211 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QP +G DGKKKEPESNVLLASIENMQYAVTVDVLH VFS FG
Sbjct  211  DYTNPYLPVNPSAIEGTLQPALGPDGKKKEPESNVLLASIENMQYAVTVDVLHKVFSTFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK++LEGHCIY+GGYCKLHLSYSRHTDLNVKA
Sbjct  271  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKESLEGHCIYEGGYCKLHLSYSRHTDLNVKA  330

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQ-NPQYVSVHSA--------APPATMPMQ  331
            ++D+SRDYT+PE+G+    Q   L   A  WQ N Q  ++++          P   MP  
Sbjct  331  HNDRSRDYTIPETGMLTMPQAPGLLTGAAGWQANHQAATMYAGNAVGAPAPGPNGQMPT-  389

Query  330  NPWDPTMQGGRPAFISSPTTFPGQEYASPLV  238
              WDP+++GG  A++++P+T+PGQ +A P V
Sbjct  390  --WDPSVRGG--AYVAAPSTYPGQTFAPPPV  416


 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ A++A
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDSETASNARNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +S+S HTDLN+K  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVTSCHLRISFSAHTDLNIKFQSHRSRDYTNP  215



>ref|XP_006431186.1| hypothetical protein CICLE_v10011680mg [Citrus clementina]
 gb|ESR44426.1| hypothetical protein CICLE_v10011680mg [Citrus clementina]
Length=459

 Score =   274 bits (700),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 161/204 (79%), Gaps = 10/204 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG +QP +G DGKKKE ESNVLLASIENMQYAVTVDVL+TVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGVMQPTIGPDGKKKELESNVLLASIENMQYAVTVDVLNTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQK+AIFEKNGGTQA IQYPD+TTA VAK++LEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKVAIFEKNGGTQALIQYPDITTAAVAKESLEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYVSVHSAAPPAT-MPMQNP------  325
            YSDKSRDYTV +  L   QQ  ++P     WQ+ Q   ++S +  AT +P Q P      
Sbjct  330  YSDKSRDYTVQDQTLLATQQIPSVPAAPSVWQSHQAAPMYSGSEYATAVPGQVPPGQVPS  389

Query  324  WDPTMQGGRPAFISSPTTFPGQEY  253
            W+P+ Q G  A++S+   FPGQ Y
Sbjct  390  WNPSAQAGPAAYVSASGHFPGQTY  413


 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_008379364.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X2 [Malus domestica]
Length=483

 Score =   274 bits (700),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 157/210 (75%), Gaps = 18/210 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVNPTA+EG +QP VG DGKKKE ESNVLLASIENMQYAVTVDV+HTVFSAFG
Sbjct  210  DYTNPLLPVNPTAIEGIMQPTVGPDGKKKELESNVLLASIENMQYAVTVDVIHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA +QYPD+ TA VA++ALEGHCIYDGGYCKLHLSYSRHTDLN  A
Sbjct  270  TVQKIAIFEKNGQTQALVQYPDLNTAAVAREALEGHCIYDGGYCKLHLSYSRHTDLN--A  327

Query  474  YSDKSRDYTVPESGLQQPSALPNTAP----AWQNPQ------------YVSVHSAAPPAT  343
            YSDKSRDYT+P++ L     +    P    AWQNPQ              SV + APP  
Sbjct  328  YSDKSRDYTIPDASLLAAQQVSGYXPPPPGAWQNPQAAPMYQGNEYSGAASVQAQAPPGP  387

Query  342  MPMQNPWDPTMQGGRPAFISSPTTFPGQEY  253
                + WDP MQ GR  F+S+P+TFPGQ Y
Sbjct  388  PGQPSSWDPAMQAGRSTFVSAPSTFPGQTY  417


 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 77/125 (62%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA++A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDAGTASMARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQP  421
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P          G+ QP
Sbjct  170  LDGRSIPRYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNPLLPVNPTAIEGIMQP  229

Query  420  SALPN  406
            +  P+
Sbjct  230  TVGPD  234



>gb|KJB75710.1| hypothetical protein B456_012G052900 [Gossypium raimondii]
Length=466

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 149/228 (65%), Positives = 159/228 (70%), Gaps = 16/228 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKK+EP+SNVLLASIENMQYAVTVDVLHTVFSA G
Sbjct  210  DYTNPYLPVNPTAMEGLMQPVVGPDGKKQEPQSNVLLASIENMQYAVTVDVLHTVFSASG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIAIFEKNGGTQA IQYPDVTTA VAK++LEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  MVQKIAIFEKNGGTQALIQYPDVTTAAVAKESLEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSAAP-PATMPMQN--------  328
            YSDKSRDYT+ +  L   Q   LP    AWQNPQ V VH      A+  +Q         
Sbjct  330  YSDKSRDYTISDPSLLATQVPGLPAAPNAWQNPQGVPVHHGTDYSASAAIQGQPLAGQLP  389

Query  327  PWDPTMQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPPGQP  184
             WDP  Q   P       + PGQ Y S   P   N     G  P  QP
Sbjct  390  AWDPNFQARLPY-----GSVPGQTYQSLTAPTYVNVARPAGSSPLSQP  432


 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 73/125 (58%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   VT++ +H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEPNDVTIETIHLVFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP--------ESGLQQP  421
            L+G  I           C L +SYS HTDLN+K  S +SRDYT P          GL QP
Sbjct  170  LDGRSIPRYLLPDHVTSCYLRISYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAMEGLMQP  229

Query  420  SALPN  406
               P+
Sbjct  230  VVGPD  234



>gb|KHN11624.1| Polypyrimidine tract-binding protein like 1 [Glycine soja]
Length=647

 Score =   277 bits (709),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 162/207 (78%), Gaps = 12/207 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVN TA+EG VQ  VG DGK+KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  361  DYTNPMLPVNYTAIEGAVQTAVGPDGKRKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  420

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQYPD+ TA+ A++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  421  TVQKIAIFEKNGQTQALIQYPDIITASAAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  480

Query  474  YSDKSRDYTVPESGLQQPSALPNTAP--AWQNPQYVSVHSAAPPATMPM----QNP-WDP  316
            +SDKSRDYTVP+     PS L    P  AWQNPQ  S++  + PA        Q P WDP
Sbjct  481  FSDKSRDYTVPD-----PSLLAAQGPPTAWQNPQAASMYPGSAPAYHTQVPGGQVPSWDP  535

Query  315  TMQGGRPAFISSPTTFPGQEYASPLVP  235
            ++Q  RP++ S+P TFP Q  A+P +P
Sbjct  536  SLQAVRPSYASAPGTFPVQTGAAPPMP  562


 Score = 75.5 bits (184),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A+DA
Sbjct  284  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKTAGFQALIQFTDAETASSARDA  343

Query  558  LEGHCI  541
            L+G  I
Sbjct  344  LDGRSI  349



>ref|XP_006482618.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Citrus sinensis]
Length=459

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 160/204 (78%), Gaps = 10/204 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG +QP +G DGKKKE ESNVLLASIENMQYAVTVDVL+TVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGVMQPTIGPDGKKKELESNVLLASIENMQYAVTVDVLNTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQK+AIFEKNGGTQA IQYPD+TTA VAK++LEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKVAIFEKNGGTQALIQYPDITTAAVAKESLEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYVSVHSAAPPAT-MPMQNP------  325
            YSDKSRDYTV +  L   QQ  ++P     WQ+ Q   ++S +  AT +P Q P      
Sbjct  330  YSDKSRDYTVQDQTLLATQQIPSIPAAPLVWQSHQAAPMYSGSEYATAVPGQVPPGQVPS  389

Query  324  WDPTMQGGRPAFISSPTTFPGQEY  253
            W+P+ Q    A++S+   FPGQ Y
Sbjct  390  WNPSAQARPAAYVSASGPFPGQTY  413


 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_004491824.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X2 [Cicer arietinum]
Length=421

 Score =   268 bits (684),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 155/206 (75%), Gaps = 10/206 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVN +AMEG  QP +G DGK++EPESNVLLASIENMQYAVTVDV++TVFSAFG
Sbjct  210  DYTNPMLPVNHSAMEGAAQPTIGPDGKRREPESNVLLASIENMQYAVTVDVINTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            T+QKIA+FEKNG TQA IQYPDV TA  A++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TIQKIAMFEKNGQTQALIQYPDVVTAAAAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNP------WDPT  313
            +SDKSRDYTVP   L    A    A AWQNPQ   ++ A  PA    Q P      WDP 
Sbjct  330  FSDKSRDYTVPHPSL---VAAQVPATAWQNPQAAPMYHAGAPA-FQTQVPGGQVPSWDPN  385

Query  312  MQGGRPAFISSPTTFPGQEYASPLVP  235
            +Q  RP++IS P  +P Q  A P +P
Sbjct  386  LQSVRPSYISVPGAYPVQTGAVPPMP  411


 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKTAGFQALIQFTDAETASSAREA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS H DLN+K  S++SRDYT P
Sbjct  170  LDGRSIPRYLLPDHVGSCNLRISYSAHRDLNIKFQSNRSRDYTNP  214



>ref|XP_011622366.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 [Amborella 
trichopoda]
 ref|XP_011622369.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 [Amborella 
trichopoda]
Length=477

 Score =   269 bits (687),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 157/199 (79%), Gaps = 6/199 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG  QPVVG DGK+KEPESNVLLASIENMQY VTVDVLHTVFSAFG
Sbjct  211  DYTNPYLPVNPSAIEGTAQPVVGPDGKRKEPESNVLLASIENMQYVVTVDVLHTVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPD+TTA VAK+ LEGHCIY+GGYCKLHLSYSRHTDLNVKA
Sbjct  271  TVQKIAIFEKNGGLQALIQYPDITTAAVAKEHLEGHCIYEGGYCKLHLSYSRHTDLNVKA  330

Query  474  YSDKSRDYTVPES---GLQQPSALPNTAPAWQNPQYVSVHSAAPPATMP--MQNPWDPTM  310
            ++D+S+DYT+P+S   G+ Q   +P +AP WQ+P   + +S    A +P      W+P++
Sbjct  331  HNDRSKDYTIPDSNLLGVPQAPGIPPSAPGWQSP-LGNDYSGGSQAMVPDGQVGMWNPSL  389

Query  309  QGGRPAFISSPTTFPGQEY  253
            Q  R  F  +   FPGQ +
Sbjct  390  QAPRANFNPASNAFPGQAF  408


 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 76/119 (64%), Gaps = 8/119 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDSETASAARNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPESGLQQPSALPNTA  400
            L+G  I         G C L +S+S HTDLN+K  S +SRDYT P   +  PSA+  TA
Sbjct  171  LDGRSIPRYLLPEHVGSCHLRISFSAHTDLNIKFQSHRSRDYTNPYLPV-NPSAIEGTA  228



>ref|XP_003552536.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoformX1 
[Glycine max]
Length=496

 Score =   269 bits (688),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 153/199 (77%), Gaps = 18/199 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVN TA+EG VQ  VG DGK+KEP+SNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPMLPVNYTAIEGAVQTAVGPDGKRKEPDSNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQYPD+ TA+ A++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGQTQALIQYPDIITASAAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQPSALPNTAP--AWQNPQYV--------SVHSAAPPATMPMQNP  325
            +SDKSRDYTVP+     PS L    P  AWQNPQ          + H+  P   +P    
Sbjct  330  FSDKSRDYTVPD-----PSLLAAQGPATAWQNPQAAPMYPGSAPAYHTQVPGGQVPA---  381

Query  324  WDPTMQGGRPAFISSPTTF  268
            WDP +Q  RP+++S+P TF
Sbjct  382  WDPNLQAVRPSYVSAPGTF  400


 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A+DA
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKTAGFQALIQFTDAETASSARDA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS H DLN+K  S++SRDYT P
Sbjct  170  LDGRSIPRYLLPAHVGSCNLRISYSAHKDLNIKFQSNRSRDYTNP  214



>gb|KHN13603.1| Polypyrimidine tract-binding protein like 1 [Glycine soja]
Length=481

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/199 (68%), Positives = 153/199 (77%), Gaps = 18/199 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVN TA+EG VQ  VG DGK+KEP+SNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  195  DYTNPMLPVNYTAIEGAVQTAVGPDGKRKEPDSNVLLASIENMQYAVTVDVLHTVFSAFG  254

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQYPD+ TA+ A++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  255  TVQKIAIFEKNGQTQALIQYPDIITASAAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  314

Query  474  YSDKSRDYTVPESGLQQPSALPNTAP--AWQNPQYV--------SVHSAAPPATMPMQNP  325
            +SDKSRDYTVP+     PS L    P  AWQNPQ          + H+  P   +P    
Sbjct  315  FSDKSRDYTVPD-----PSLLAAQGPATAWQNPQAAPMYPGSAPAYHTQVPGGQVPA---  366

Query  324  WDPTMQGGRPAFISSPTTF  268
            WDP +Q  RP+++S+P TF
Sbjct  367  WDPNLQAVRPSYVSAPGTF  385


 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A+DA
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKTAGFQALIQFTDAETASSARDA  169

Query  558  LEGHCI  541
            L+G  I
Sbjct  170  LDGRSI  175



>gb|ERM94534.1| hypothetical protein AMTR_s00010p00265290 [Amborella trichopoda]
Length=492

 Score =   269 bits (687),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 157/199 (79%), Gaps = 6/199 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG  QPVVG DGK+KEPESNVLLASIENMQY VTVDVLHTVFSAFG
Sbjct  226  DYTNPYLPVNPSAIEGTAQPVVGPDGKRKEPESNVLLASIENMQYVVTVDVLHTVFSAFG  285

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPD+TTA VAK+ LEGHCIY+GGYCKLHLSYSRHTDLNVKA
Sbjct  286  TVQKIAIFEKNGGLQALIQYPDITTAAVAKEHLEGHCIYEGGYCKLHLSYSRHTDLNVKA  345

Query  474  YSDKSRDYTVPES---GLQQPSALPNTAPAWQNPQYVSVHSAAPPATMP--MQNPWDPTM  310
            ++D+S+DYT+P+S   G+ Q   +P +AP WQ+P   + +S    A +P      W+P++
Sbjct  346  HNDRSKDYTIPDSNLLGVPQAPGIPPSAPGWQSP-LGNDYSGGSQAMVPDGQVGMWNPSL  404

Query  309  QGGRPAFISSPTTFPGQEY  253
            Q  R  F  +   FPGQ +
Sbjct  405  QAPRANFNPASNAFPGQAF  423


 Score =   103 bits (258),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 76/119 (64%), Gaps = 8/119 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  126  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDSETASAARNA  185

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPESGLQQPSALPNTA  400
            L+G  I         G C L +S+S HTDLN+K  S +SRDYT P   +  PSA+  TA
Sbjct  186  LDGRSIPRYLLPEHVGSCHLRISFSAHTDLNIKFQSHRSRDYTNPYLPV-NPSAIEGTA  243



>ref|XP_009382956.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=357

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 158/213 (74%), Gaps = 25/213 (12%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            D+TNPYLPVNP+A+EG +QPV+G DGK KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  107  DFTNPYLPVNPSAIEGTLQPVLGPDGKMKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  166

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTATVAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  167  TVQKIAIFEKNGGTQALIQYPDVTTATVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  226

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQ-NPQY-------VSVHSAAPPATMPMQN  328
            YSDKSRDYTV ++G+    Q S++   +   Q NP         V +  A P   MP   
Sbjct  227  YSDKSRDYTVADTGILAAPQGSSVTIVSTGLQANPHVAGTFVSNVGMQQAFPNRQMP---  283

Query  327  PWDPTMQGGRPAFISSPTTFPGQEYASPLVPFG  229
             WDP     +  + S   TFPGQ       PFG
Sbjct  284  SWDPN----KANYASMGGTFPGQ-------PFG  305


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 62/108 (57%), Gaps = 16/108 (15%)
 Frame = -2

Query  735  NVLLASIENMQYAVTVDVLHT----VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVA  568
            ++L  SI   Q+      LH+    VFSAFG V KIA FEK  G QA IQY D  TA+ A
Sbjct  10   SILTRSISRYQH------LHSERYHVFSAFGYVHKIATFEKAAGFQALIQYTDAATASEA  63

Query  567  KDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            ++AL+G  I           C L +S+S HTDLN+K  S +SRD+T P
Sbjct  64   RNALDGRSIPRYLLPEHVTSCHLRISFSAHTDLNIKFQSHRSRDFTNP  111



>ref|XP_004491823.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Cicer arietinum]
Length=459

 Score =   266 bits (679),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 155/206 (75%), Gaps = 10/206 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVN +AMEG  QP +G DGK++EPESNVLLASIENMQYAVTVDV++TVFSAFG
Sbjct  210  DYTNPMLPVNHSAMEGAAQPTIGPDGKRREPESNVLLASIENMQYAVTVDVINTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            T+QKIA+FEKNG TQA IQYPDV TA  A++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TIQKIAMFEKNGQTQALIQYPDVVTAAAAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNP------WDPT  313
            +SDKSRDYTVP   L    A    A AWQNPQ   ++ A  PA    Q P      WDP 
Sbjct  330  FSDKSRDYTVPHPSL---VAAQVPATAWQNPQAAPMYHAGAPA-FQTQVPGGQVPSWDPN  385

Query  312  MQGGRPAFISSPTTFPGQEYASPLVP  235
            +Q  RP++IS P  +P Q  A P +P
Sbjct  386  LQSVRPSYISVPGAYPVQTGAVPPMP  411


 Score =   104 bits (259),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKTAGFQALIQFTDAETASSAREA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS H DLN+K  S++SRDYT P
Sbjct  170  LDGRSIPRYLLPDHVGSCNLRISYSAHRDLNIKFQSNRSRDYTNP  214



>ref|XP_009382955.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=460

 Score =   265 bits (677),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 158/213 (74%), Gaps = 25/213 (12%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            D+TNPYLPVNP+A+EG +QPV+G DGK KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DFTNPYLPVNPSAIEGTLQPVLGPDGKMKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTATVAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGGTQALIQYPDVTTATVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQ-NPQY-------VSVHSAAPPATMPMQN  328
            YSDKSRDYTV ++G+    Q S++   +   Q NP         V +  A P   MP   
Sbjct  330  YSDKSRDYTVADTGILAAPQGSSVTIVSTGLQANPHVAGTFVSNVGMQQAFPNRQMP---  386

Query  327  PWDPTMQGGRPAFISSPTTFPGQEYASPLVPFG  229
             WDP     +  + S   TFPGQ       PFG
Sbjct  387  SWDPN----KANYASMGGTFPGQ-------PFG  408


 Score = 98.2 bits (243),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            E   NVLL +IE ++   V+++V+H VFSAFG V KIA FEK  G QA IQY D  TA+ 
Sbjct  106  EVVGNVLLVTIEGVEAGDVSIEVIHLVFSAFGYVHKIATFEKAAGFQALIQYTDAATASE  165

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            A++AL+G  I           C L +S+S HTDLN+K  S +SRD+T P
Sbjct  166  ARNALDGRSIPRYLLPEHVTSCHLRISFSAHTDLNIKFQSHRSRDFTNP  214



>ref|XP_009380148.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=459

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 148/226 (65%), Positives = 167/226 (74%), Gaps = 19/226 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QP +G DGK KEPESNVLLA+IENMQYAVTVDVL+TVFSAFG
Sbjct  211  DYTNPYLPVNPSAIEGNLQPALGPDGKIKEPESNVLLAAIENMQYAVTVDVLYTVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            +VQKIAIFEKNGGTQA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  271  SVQKIAIFEKNGGTQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  330

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQ-NPQY--VSVHSAAPPATMPMQN--PWD  319
            YSDKSRDYT+  +G+    Q S++P+ +  WQ NPQ    SV S    A +P+     W 
Sbjct  331  YSDKSRDYTISSTGILSNPQASSVPSASTVWQTNPQVAGTSVGSIGMQAPVPVGQTAAWH  390

Query  318  PTMQGGRPAFISSPTTFPGQEYASPLVP-FGANQPAHQGIPPPGQP  184
            P+    +  F S   TFPGQ    P VP  GA  P   G  PP  P
Sbjct  391  PS----KTTFASPAGTFPGQ----PFVPSAGAPFPTSSG--PPSAP  426


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            E   NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ 
Sbjct  107  EVAGNVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTASE  166

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            A++AL+G  I           C L +S+S HTDLN+K  S +SRDYT P
Sbjct  167  ARNALDGRSIPRYLLPEHVTSCYLRISFSAHTDLNIKFQSHRSRDYTNP  215



>ref|XP_006660154.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
[Oryza brachyantha]
Length=403

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 158/209 (76%), Gaps = 18/209 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG  QP +G DGK KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  154  DYTNPYLPVNPTAIEGISQPTLGPDGKIKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  213

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIA+FEKNGG QA IQYPD+TTA VAK ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  214  TVQKIAMFEKNGGMQALIQYPDITTAAVAKQALEGHCIYDGGYCKLHLSYSRHTDLNVKA  273

Query  474  YSDKSRDYTV--PESGLQQPSALPNTAP--AWQNPQ-----YVSVHSAAPPATMPMQNPW  322
            + ++SRDYTV  P + LQ  + +P   P  AWQN       Y S  +A+P   +   + W
Sbjct  274  HDERSRDYTVSDPSAQLQAAAQVPAATPGAAWQNTAPAASFYASTAAASPVGQV---SAW  330

Query  321  DPTMQGGRPAFISSPTTFPGQEYASPLVP  235
            +P MQ G  A+ S+ + +P Q    P++P
Sbjct  331  NPNMQAG--AYGSASSAYPTQ----PMMP  353


 Score = 94.7 bits (234),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 72/125 (58%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E +Q   +T++V+H VFSAFG V KIA FEK  G QA IQY D  TA  AK++
Sbjct  54   NVLLVTFEGIQPNDITIEVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALEAKNS  113

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQP  421
            L+G  I           C L +++S H DLN+K  S +SRDYT P          G+ QP
Sbjct  114  LDGRSIPRYLLPDHAPTCHLRITFSAHKDLNIKFQSHRSRDYTNPYLPVNPTAIEGISQP  173

Query  420  SALPN  406
            +  P+
Sbjct  174  TLGPD  178



>gb|ACF81680.1| unknown [Zea mays]
 tpg|DAA48992.1| TPA: hypothetical protein ZEAMMB73_491521 [Zea mays]
 tpg|DAA48993.1| TPA: hypothetical protein ZEAMMB73_491521 [Zea mays]
Length=276

 Score =   258 bits (658),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 151/204 (74%), Gaps = 15/204 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TA+EG VQP VG DGK KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  22   DYTNPYLPVNQTAIEGIVQPTVGPDGKVKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  81

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+FEKNGG QA IQYPD+TTA VAK ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  82   AVQKIAMFEKNGGMQALIQYPDITTAAVAKQALEGHCIYDGGYCKLHLSYSRHTDLNVKA  141

Query  474  YSDKSRDYTVPESGLQQPSA-----LPNTAPAWQN-------PQYVSVHSAAPPATMPMQ  331
            + ++SRDYT+ +  +Q  +A     L +   AWQN       P Y S  ++ P     + 
Sbjct  142  HDERSRDYTLSDPNVQLQAAAQTPVLRSPGVAWQNTASVPAAPFYASTATSTPIGVGQVA  201

Query  330  NPWDPTMQGGRPAFISSPTTFPGQ  259
              W+P MQ G  +F S+ T +P Q
Sbjct  202  -AWNPNMQAG--SFASASTAYPNQ  222



>gb|ACG33108.1| hypothetical protein [Zea mays]
Length=276

 Score =   257 bits (657),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 151/204 (74%), Gaps = 15/204 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TA+EG VQP VG DGK KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  22   DYTNPYLPVNQTAIEGIVQPTVGPDGKVKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  81

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+FEKNGG QA IQYPD+TTA VAK ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  82   AVQKIAMFEKNGGMQALIQYPDITTAAVAKQALEGHCIYDGGYCKLHLSYSRHTDLNVKA  141

Query  474  YSDKSRDYTVPESGLQQPSA-----LPNTAPAWQN-------PQYVSVHSAAPPATMPMQ  331
            + ++SRDYT+ +  +Q  +A     L +   AWQN       P Y S  ++ P     + 
Sbjct  142  HDERSRDYTLSDPNVQLQAAAQTPVLRSPGVAWQNTASVPAAPFYASTATSTPIGVGQVA  201

Query  330  NPWDPTMQGGRPAFISSPTTFPGQ  259
              W+P MQ G  +F S+ T +P Q
Sbjct  202  -AWNPNMQAG--SFASASTAYPNQ  222



>ref|XP_004974731.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like, 
partial [Setaria italica]
Length=408

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 154/200 (77%), Gaps = 11/200 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TA+EG VQP VG DGK KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  158  DYTNPYLPVNQTAIEGIVQPTVGPDGKIKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  217

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIA+FEKNGG QA IQYPDVTTA VAK ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  218  TVQKIAMFEKNGGMQALIQYPDVTTAAVAKQALEGHCIYDGGYCKLHLSYSRHTDLNVKA  277

Query  474  YSDKSRDYTVPESGLQQPSALPNTAP--AWQN------PQYVSVHSAAPPATMPMQNPWD  319
            + ++SRDYT+ +   Q  +A    AP  AWQN      P Y S  +A+PPA +     W+
Sbjct  278  HDERSRDYTLSDPNAQLQAAAQAPAPGVAWQNTAAPAAPFYAST-AASPPAGVGQVPAWN  336

Query  318  PTMQGGRPAFISSPTTFPGQ  259
            P MQ G  AF S+ T +P Q
Sbjct  337  PNMQAG--AFASASTPYPSQ  354


 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 66/109 (61%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            +   NVLL + E +Q   VT++V+H VFSAFG V KIA FEK  G QA IQY D  TA  
Sbjct  54   DSSGNVLLVTFEGVQPNDVTIEVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALE  113

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            AK++L+G  I           C + +++S H DLN+K  S +SRDYT P
Sbjct  114  AKNSLDGRSIPKYLLPEHINACHMRITFSAHKDLNIKFQSHRSRDYTNP  162



>ref|XP_009395951.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009395953.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=463

 Score =   258 bits (659),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 159/208 (76%), Gaps = 12/208 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP+LPVNP+A+EG VQP++G DG KKE ESNVLLASIENMQYAVTVDVLHTVFS FG
Sbjct  212  DYTNPFLPVNPSAIEGSVQPLLGPDGVKKETESNVLLASIENMQYAVTVDVLHTVFSTFG  271

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA++AK+ALEGHCIYDGGYCKLHL+YSRHTDL+VK 
Sbjct  272  TVQKIAIFEKNGGMQALIQYPDVTTASIAKEALEGHCIYDGGYCKLHLTYSRHTDLSVKV  331

Query  474  YSDKSRDYTVPESGLQQPSALPN--TAPAWQ-NPQYVSVH-----SAAPPATMP--MQNP  325
            ++D+ RDYTV ++G+   S  P+  T   WQ +PQ  + +     +A    T+P      
Sbjct  332  HNDRGRDYTVQDTGVLMTSQAPSLPTTTGWQVHPQSTTTYIGNDFTATGQVTVPHGQVTT  391

Query  324  WDPTMQGGRPAFISSPTTFPGQEYASPL  241
            W+P++  G  +F S+   FP Q +A+P+
Sbjct  392  WNPSLSSG--SFASASNMFPSQTFATPV  417


 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK+ G QA IQY D  TA  A++A
Sbjct  112  NVLLVTIEGVESGDVSIDVIHLVFSAFGFVHKIATFEKSAGFQALIQYTDAETAASARNA  171

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L ++YS HTDL++K  S +SRDYT P
Sbjct  172  LDGRSIPRYLLLEHITTCHLRITYSAHTDLSIKFQSHRSRDYTNP  216



>ref|XP_008665827.1| PREDICTED: uncharacterized protein LOC100217199 isoform X2 [Zea 
mays]
Length=464

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 151/204 (74%), Gaps = 15/204 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TA+EG VQP VG DGK KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPYLPVNQTAIEGIVQPTVGPDGKVKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+FEKNGG QA IQYPD+TTA VAK ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  AVQKIAMFEKNGGMQALIQYPDITTAAVAKQALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQPSA-----LPNTAPAWQN-------PQYVSVHSAAPPATMPMQ  331
            + ++SRDYT+ +  +Q  +A     L +   AWQN       P Y S  ++ P     + 
Sbjct  330  HDERSRDYTLSDPNVQLQAAAQTPVLRSPGVAWQNTASVPAAPFYASTATSTPIGVGQVA  389

Query  330  NPWDPTMQGGRPAFISSPTTFPGQ  259
              W+P MQ G  +F S+ T +P Q
Sbjct  390  -AWNPNMQAG--SFASASTAYPNQ  410


 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E +Q   VT++V+H VFSAFG V KIA FEK  G QA IQY D  TA  AK++
Sbjct  110  NVLLVTFEGVQPNDVTIEVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALEAKNS  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C + +++S H DLN+K  S +SRDYT P
Sbjct  170  LDGRSIPKYLLPEHIGACHMRITFSAHKDLNIKFQSHRSRDYTNP  214



>gb|AFK33571.1| unknown [Lotus japonicus]
Length=457

 Score =   257 bits (657),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/196 (67%), Positives = 152/196 (78%), Gaps = 8/196 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVN TA++G +QPVVG DGK+ E ESNVLLA+IENMQYAVTV+VLHTVFSAFG
Sbjct  210  DYTNPMLPVNQTAIDGALQPVVGPDGKRTESESNVLLATIENMQYAVTVEVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQYPDVTTA  AK+ALEGHCIYDGGYCKLHL+YSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGQTQALIQYPDVTTAAAAKEALEGHCIYDGGYCKLHLTYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPPA-----TMPMQNPWDPTM  310
            YSDKSRDYTV +  L + + +P T  AW NPQ   ++  + PA     +    + WDP  
Sbjct  330  YSDKSRDYTVLDPSL-RAAQVPAT--AWPNPQAAPMYPGSAPALQGQVSGGQMSSWDPAH  386

Query  309  QGGRPAFISSPTTFPG  262
            Q    ++I +P TFPG
Sbjct  387  QEVSQSYIPAPGTFPG  402


 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 70/105 (67%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E ++   VT+DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA++A++A
Sbjct  110  NVLLVTMEGVEAGDVTIDVIHLVFSAFGFVHKIATFEKTAGFQALIQFTDAETASLARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS H DLN+K  S++SRDYT P
Sbjct  170  LDGRSIPSYLLPQHVGSCNLRISYSAHRDLNIKFQSNRSRDYTNP  214



>ref|NP_001050223.1| Os03g0376900 [Oryza sativa Japonica Group]
 gb|AAL82531.1|AC084766_17 putative polypyrimidine tract-binding protein [Oryza sativa Japonica 
Group]
 gb|ABF96228.1| Polypyrimidine tract-binding protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12137.1| Os03g0376900 [Oryza sativa Japonica Group]
 dbj|BAG88366.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75354.1| hypothetical protein OsI_11790 [Oryza sativa Indica Group]
 gb|EEE59138.1| hypothetical protein OsJ_11035 [Oryza sativa Japonica Group]
Length=464

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 146/252 (58%), Positives = 166/252 (66%), Gaps = 41/252 (16%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN +A++  +QP VG DG+K E E NVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  214  DYTNPYLPVNSSAIDT-LQPAVGADGRKVEAEGNVLLASIENMQYAVTVDVLHTVFSAFG  272

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTA+VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  273  TVQKIAIFEKNGGTQALIQYPDVTTASVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  332

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQ-NPQYVSVHSAAPP-----ATMPMQNPW  322
            +SDKSRDYT+P+  +Q   QP  +P T+  WQ NPQ    ++          T      W
Sbjct  333  HSDKSRDYTIPQGAMQAVPQPPGVPTTSAGWQGNPQAGGAYAPPGAAAPNHGTTGQVPNW  392

Query  321  DPTMQGGRPAFISSPTTFPGQEYASPLVPFGA--------------------------NQ  220
            +P   G  PA    P  +PGQ Y+SP+  +GA                          NQ
Sbjct  393  NPGNSGYAPA----PGAYPGQMYSSPM-QYGASGGFSAPAAPPQELHTSQQMPPPQYGNQ  447

Query  219  PAHQGIPPPGQP  184
            P   G P  GQP
Sbjct  448  PGPAGAPGTGQP  459


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 68/109 (62%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            E   NVLL +IE +Q   VT+DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ 
Sbjct  110  ETAGNVLLVTIEGVQANDVTIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAATASA  169

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            A++AL+G  I           C L +S+S H DLN+K  S +SRDYT P
Sbjct  170  AREALDGRSIPRYLLPEHVTSCCLRISFSAHKDLNIKFQSHRSRDYTNP  218



>ref|XP_002444395.1| hypothetical protein SORBIDRAFT_07g021250 [Sorghum bicolor]
 gb|EES13890.1| hypothetical protein SORBIDRAFT_07g021250 [Sorghum bicolor]
Length=462

 Score =   256 bits (654),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 137/225 (61%), Positives = 157/225 (70%), Gaps = 17/225 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TA+EG VQP VG DGK KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPYLPVNQTAIEGIVQPTVGPDGKVKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            +VQKIA+FEKNGG QA IQYPD+TTA VAK ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  SVQKIAMFEKNGGMQALIQYPDITTAAVAKQALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQPS-----ALPNTAPAWQN-------PQYVSVHSAAPPATMPMQ  331
            + ++SRDYT+ +   Q  +      L +   AWQN       P Y S  ++ P   +P  
Sbjct  330  HDERSRDYTLSDPNAQLQAAAQAPVLSSPGVAWQNTASAPAAPFYASTAASTPVGQVP--  387

Query  330  NPWDPTMQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPP  196
              W+P MQ G   F S+ T +P Q   +  +P      +  G PP
Sbjct  388  -AWNPNMQAG--GFASASTAYPNQPLMTNSMPHYPAIGSSSGAPP  429


 Score = 94.0 bits (232),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E +Q   VT++V+H VFSAFG V KIA FEK  G QA IQY D  TA  AK++
Sbjct  110  NVLLVTFEGVQPNDVTIEVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALEAKNS  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C + +++S H DLN+K  S +SRDYT P
Sbjct  170  LDGRSIPKYLLPEHISACHMRITFSAHKDLNIKFQSHRSRDYTNP  214



>gb|EMS67773.1| Polypyrimidine tract-binding protein-like protein 1 [Triticum 
urartu]
Length=265

 Score =   249 bits (635),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 148/206 (72%), Gaps = 13/206 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN +A++  +QP VG DG++ E E NVLLASIENMQYAV+VDVLHTVFSAFG
Sbjct  8    DYTNPYLPVNSSAIDSTLQPAVGADGRRVEAEGNVLLASIENMQYAVSVDVLHTVFSAFG  67

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPD +TAT+ K+ALEGHCIYDGGYCK+HLSYSRHTDLNVKA
Sbjct  68   TVQKIAIFEKNGGTQALIQYPDASTATIVKEALEGHCIYDGGYCKIHLSYSRHTDLNVKA  127

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNP------W  322
            +SDKS+DYT+PE   Q   QP+ +P T   WQ     +     P      QN       W
Sbjct  128  HSDKSKDYTIPEGAHQAAPQPAGVPPTTAGWQGNSQAAGPYGPPGVAAQNQNTNGQVPNW  187

Query  321  DPTMQGGRPAFISSPTTFPGQEYASP  244
            +P   G  PA    P  +PG  Y++P
Sbjct  188  NPGNSGYPPA----PGQYPGHMYSTP  209



>ref|XP_004984223.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X2 [Setaria italica]
 ref|XP_004984224.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X3 [Setaria italica]
Length=365

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 148/204 (73%), Gaps = 9/204 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DY NPYLP+N +AM+G +QP VG DG+K E + NVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  95   DYNNPYLPINYSAMDGTLQPAVGADGRKVEAQGNVLLASIENMQYAVTVDVLHTVFSAFG  154

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  155  TVQKIAIFEKNGGTQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  214

Query  474  YSDKSRDYTVPES---GLQQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNPWD----P  316
            + DKSRDYT+P     G+ QP     T+  WQ    +    A  P  +P QN       P
Sbjct  215  HGDKSRDYTIPPGVIQGVPQPPGAAATSTGWQG--NIQGAGAYAPPGIPAQNHSANGQVP  272

Query  315  TMQGGRPAFISSPTTFPGQEYASP  244
                G   +  +P  +PGQ Y+SP
Sbjct  273  NWNSGNSGYPPAPGAYPGQMYSSP  296


 Score = 68.9 bits (167),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KIA FEK  G QA IQY D  TA+ A++AL+G  I           C L +
Sbjct  17   VFSAFGYVHKIATFEKAAGFQALIQYSDAATASAAREALDGRSIPSYLLPEHVTSCCLRI  76

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            S+S H DLN+K  S++SRDY  P
Sbjct  77   SFSAHKDLNIKFQSNRSRDYNNP  99



>ref|XP_010926566.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X2 [Elaeis guineensis]
Length=454

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 146/233 (63%), Positives = 162/233 (70%), Gaps = 25/233 (11%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QPVVG DGKKKEPESNVLLASIENMQYAVTVD LHTVFS FG
Sbjct  211  DYTNPYLPVNPSAIEGTLQPVVGPDGKKKEPESNVLLASIENMQYAVTVDALHTVFSTFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK ALEGHCIYDGGYCKLHLSYS HTDLNVKA
Sbjct  271  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKAALEGHCIYDGGYCKLHLSYSHHTDLNVKA  330

Query  474  YSDKSRDYTVPESGLQQP--SALPNTAPAWQNPQYVSVHSAAPPATMP--MQNPWDPTMQ  307
            +SDKSRDYT+P++ +  P  + LP  A  WQ    + V SA   A +P      WDP+  
Sbjct  331  HSDKSRDYTIPDTAMAMPQVATLP-AATGWQQASGMFVGSAGTQAPVPNGQMLGWDPS--  387

Query  306  GGRPAFISSPTTFPGQEYASPLVPF----------------GANQPAHQGIPP  196
              RP + S P  +PGQ +    VP                 G+ Q  H GI P
Sbjct  388  --RPTYASVPGAYPGQTFIPSSVPQYPTSGSLPAAPPDLLPGSRQIIHHGIQP  438


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 67/105 (64%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA  A+DA
Sbjct  111  NVLLVTLEGVEPGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDAATALAARDA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +S+S HTDLN+K  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVTSCHLRISFSAHTDLNIKFQSHRSRDYTNP  215



>dbj|BAJ99105.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=343

 Score =   250 bits (639),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 149/206 (72%), Gaps = 13/206 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN +A++  +QP VG DG++ E E NVLLASIENMQYAV+VDVLHTVFSAFG
Sbjct  87   DYTNPYLPVNSSAIDSTLQPAVGADGRRVEAEGNVLLASIENMQYAVSVDVLHTVFSAFG  146

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPD +TAT+AK+ALEGHCIYDGGYCK+HLSYSRHTDLNVKA
Sbjct  147  TVQKIAIFEKNGGTQALIQYPDASTATIAKEALEGHCIYDGGYCKIHLSYSRHTDLNVKA  206

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNP------W  322
            +SDKS+DYT PE   Q   QP+ +P T   WQ     +     P   +  QN       W
Sbjct  207  HSDKSKDYTTPEGAQQAAPQPAGVPPTTAGWQGNSQAAGPYGPPGVAVQNQNTNRQVPNW  266

Query  321  DPTMQGGRPAFISSPTTFPGQEYASP  244
            +P   G  PA    P  +PG  Y++P
Sbjct  267  NPGNSGYPPA----PGQYPGHMYSAP  288


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KIA FEK  G QA IQY D  TA+ A++AL+G  I           C L +
Sbjct  9    VFSAFGFVHKIATFEKAAGFQALIQYTDPPTASAAREALDGRSIPRYLLPDHVVSCHLRI  68

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            S+S H DLN+K  S +SRDYT P
Sbjct  69   SFSAHKDLNIKFQSHRSRDYTNP  91



>dbj|BAJ94455.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93344.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=447

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/195 (66%), Positives = 149/195 (76%), Gaps = 10/195 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG  QP++G DG  KEPESNVLLASIENMQYAV VDVLHTVFS+FG
Sbjct  209  DYTNPYLPVNPTAIEGITQPILGSDGMIKEPESNVLLASIENMQYAVGVDVLHTVFSSFG  268

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+FEKNGG QA IQYPD+TTA VAK ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  269  AVQKIAMFEKNGGMQALIQYPDITTAGVAKQALEGHCIYDGGYCKLHLSYSRHTDLNVKA  328

Query  474  YSDKSRDYTV--PESGLQQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNP-WDPTMQG  304
            + ++SRDYTV  P + +Q P  +      WQ+      + ++  AT   Q P W+P MQ 
Sbjct  329  HDERSRDYTVLDPSARVQAPPGV-----VWQSTTPAGFYGSSAGATSVGQVPTWNPNMQ-  382

Query  303  GRPAFISSPTTFPGQ  259
             R AF S+ T++P Q
Sbjct  383  -RGAFASASTSYPTQ  396


 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 66/109 (61%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            +   NVLL + E +Q   V++DV+H VFSAFG V KIA FEK  G QA IQY D  TA  
Sbjct  105  DSSGNVLLVTFEGVQPNDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALE  164

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            AK++L+G  I           C L +++S H DLN+K  S +SRDYT P
Sbjct  165  AKNSLDGRSIPRYLLADHVSICHLRITFSAHKDLNIKFQSHRSRDYTNP  213



>ref|NP_001061885.1| Os08g0436000 [Oryza sativa Japonica Group]
 dbj|BAD10638.1| putative polypyrimidine tract-binding protein homolog [Oryza 
sativa Japonica Group]
 dbj|BAF23799.1| Os08g0436000 [Oryza sativa Japonica Group]
 dbj|BAG90469.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68753.1| hypothetical protein OsJ_27445 [Oryza sativa Japonica Group]
Length=461

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 156/211 (74%), Gaps = 20/211 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG  QP +G DGK KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGIAQPTLGPDGKIKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIA+FEKNGG QA IQYPD+TTA VAK ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAMFEKNGGMQALIQYPDITTAAVAKQALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTV---PESGLQQPSALPNTAP---AWQNPQ-----YVSVHSAAPPATMPMQN  328
            + ++SRDYTV   P + +Q  +  P  +    AWQN       Y S  +A P   +P   
Sbjct  330  HDERSRDYTVSSDPSAQMQAAAQAPGPSTPGVAWQNTAPSASFYGSTAAATPVGQVPA--  387

Query  327  PWDPTMQGGRPAFISSPTTFPGQEYASPLVP  235
             W+P MQ G  AF S+ + +P Q    P++P
Sbjct  388  -WNPNMQAG--AFGSASSAYPTQ----PMMP  411


 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 72/125 (58%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E +Q   +++DV+H VFSAFG V KIA FEK  G QA IQY D  TA  AK++
Sbjct  110  NVLLVTFEGVQPNDISIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALEAKNS  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQP  421
            L+G  I           C L +++S H DLN+K  S +SRDYT P          G+ QP
Sbjct  170  LDGRSIPRYLLPEHVPTCHLRITFSAHKDLNIKFQSHRSRDYTNPYLPVNPTAIEGIAQP  229

Query  420  SALPN  406
            +  P+
Sbjct  230  TLGPD  234



>ref|XP_008780489.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X3 [Phoenix dactylifera]
Length=348

 Score =   249 bits (637),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 157/217 (72%), Gaps = 8/217 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QPVVG DGKKKEPESNVLLASIENMQYAVTVD LHTVFS FG
Sbjct  104  DYTNPYLPVNPSAIEGTLQPVVGPDGKKKEPESNVLLASIENMQYAVTVDALHTVFSTFG  163

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK ALEGHCIYDGGYCKLHLSYS HTDLNVK+
Sbjct  164  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKAALEGHCIYDGGYCKLHLSYSHHTDLNVKS  223

Query  474  YSDKSRDYTVPESGLQQP--SALPNTAPAWQNPQYVSVHSAAPPATMP--MQNPWDPTMQ  307
            +SDKSRDYT+P++ L  P  + LP  A  WQ+   + V S    A +P      WDP+  
Sbjct  224  HSDKSRDYTIPDTALAMPQVATLP-AATGWQHASGMFVSSVGTQAPIPNGQMLAWDPSRH  282

Query  306  GGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPP  196
                 + S P  +PGQ +    VP      +H   PP
Sbjct  283  S---TYASVPGAYPGQTFIPSSVPQYPTTGSHPAAPP  316


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KIA FEK  G QA IQ+ D  TAT A+DAL+G  I           C L +
Sbjct  26   VFSAFGFVHKIATFEKAAGFQALIQFSDAATATAARDALDGRSIPRYLLPEHVTSCHLRI  85

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            S+S HTDLN+K  S +SRDYT P
Sbjct  86   SFSAHTDLNIKFQSHRSRDYTNP  108



>gb|EMT31249.1| Polypyrimidine tract-binding protein-1-like protein [Aegilops 
tauschii]
Length=389

 Score =   251 bits (640),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 149/206 (72%), Gaps = 13/206 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN +A++  +QP VG DG++ E E NVLLASIENMQYAV+VDVLHTVFSAFG
Sbjct  88   DYTNPYLPVNSSAIDSTLQPAVGADGRRVEAEGNVLLASIENMQYAVSVDVLHTVFSAFG  147

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPD +TAT+AK+ALEGHCIYDGGYCK+HLSYSRHTDLNVKA
Sbjct  148  TVQKIAIFEKNGGTQALIQYPDASTATIAKEALEGHCIYDGGYCKIHLSYSRHTDLNVKA  207

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNP------W  322
            +SDKS+DYT+PE   Q   QP+ +P T   WQ     +     P      QN       W
Sbjct  208  HSDKSKDYTIPEGAHQAAPQPAGVPPTTAGWQGNSQAAGPYGPPGVAAQNQNANGQVPNW  267

Query  321  DPTMQGGRPAFISSPTTFPGQEYASP  244
            +P   G  PA    P  +PG  Y++P
Sbjct  268  NPGNSGYPPA----PGQYPGHMYSAP  289



>ref|XP_008780492.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X4 [Phoenix dactylifera]
Length=347

 Score =   249 bits (637),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 157/217 (72%), Gaps = 8/217 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QPVVG DGKKKEPESNVLLASIENMQYAVTVD LHTVFS FG
Sbjct  103  DYTNPYLPVNPSAIEGTLQPVVGPDGKKKEPESNVLLASIENMQYAVTVDALHTVFSTFG  162

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK ALEGHCIYDGGYCKLHLSYS HTDLNVK+
Sbjct  163  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKAALEGHCIYDGGYCKLHLSYSHHTDLNVKS  222

Query  474  YSDKSRDYTVPESGLQQP--SALPNTAPAWQNPQYVSVHSAAPPATMP--MQNPWDPTMQ  307
            +SDKSRDYT+P++ L  P  + LP  A  WQ+   + V S    A +P      WDP+  
Sbjct  223  HSDKSRDYTIPDTALAMPQVATLP-AATGWQHASGMFVSSVGTQAPIPNGQMLAWDPSRH  281

Query  306  GGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPP  196
                 + S P  +PGQ +    VP      +H   PP
Sbjct  282  S---TYASVPGAYPGQTFIPSSVPQYPTTGSHPAAPP  315


 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KIA FEK  G QA IQ+ D  TAT A+DAL+G  I           C L +
Sbjct  25   VFSAFGFVHKIATFEKAAGFQALIQFSDAATATAARDALDGRSIPRYLLPEHVTSCHLRI  84

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            S+S HTDLN+K  S +SRDYT P
Sbjct  85   SFSAHTDLNIKFQSHRSRDYTNP  107



>ref|XP_008780497.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X5 [Phoenix dactylifera]
 ref|XP_008780501.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X5 [Phoenix dactylifera]
 ref|XP_008780506.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X5 [Phoenix dactylifera]
Length=330

 Score =   249 bits (635),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 157/217 (72%), Gaps = 8/217 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QPVVG DGKKKEPESNVLLASIENMQYAVTVD LHTVFS FG
Sbjct  86   DYTNPYLPVNPSAIEGTLQPVVGPDGKKKEPESNVLLASIENMQYAVTVDALHTVFSTFG  145

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK ALEGHCIYDGGYCKLHLSYS HTDLNVK+
Sbjct  146  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKAALEGHCIYDGGYCKLHLSYSHHTDLNVKS  205

Query  474  YSDKSRDYTVPESGLQQP--SALPNTAPAWQNPQYVSVHSAAPPATMP--MQNPWDPTMQ  307
            +SDKSRDYT+P++ L  P  + LP  A  WQ+   + V S    A +P      WDP+  
Sbjct  206  HSDKSRDYTIPDTALAMPQVATLP-AATGWQHASGMFVSSVGTQAPIPNGQMLAWDPSRH  264

Query  306  GGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPP  196
                 + S P  +PGQ +    VP      +H   PP
Sbjct  265  S---TYASVPGAYPGQTFIPSSVPQYPTTGSHPAAPP  298


 Score = 68.2 bits (165),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KIA FEK  G QA IQ+ D  TAT A+DAL+G  I           C L +
Sbjct  8    VFSAFGFVHKIATFEKAAGFQALIQFSDAATATAARDALDGRSIPRYLLPEHVTSCHLRI  67

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            S+S HTDLN+K  S +SRDYT P
Sbjct  68   SFSAHTDLNIKFQSHRSRDYTNP  90



>ref|XP_004984222.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Setaria italica]
Length=483

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 134/205 (65%), Positives = 151/205 (74%), Gaps = 11/205 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DY NPYLP+N +AM+G +QP VG DG+K E + NVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  213  DYNNPYLPINYSAMDGTLQPAVGADGRKVEAQGNVLLASIENMQYAVTVDVLHTVFSAFG  272

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  273  TVQKIAIFEKNGGTQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  332

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQ-NPQYVSVHSAAPPATMPMQNPWD----  319
            + DKSRDYT+P   +Q   QP     T+  WQ N Q    +  APP  +P QN       
Sbjct  333  HGDKSRDYTIPPGVIQGVPQPPGAAATSTGWQGNIQGAGAY--APPG-IPAQNHSANGQV  389

Query  318  PTMQGGRPAFISSPTTFPGQEYASP  244
            P    G   +  +P  +PGQ Y+SP
Sbjct  390  PNWNSGNSGYPPAPGAYPGQMYSSP  414


 Score = 92.0 bits (227),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            E   NVLL +IE +Q + VT+DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ 
Sbjct  109  ETAGNVLLVTIEGVQASDVTIDVIHMVFSAFGYVHKIATFEKAAGFQALIQYSDAATASA  168

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            A++AL+G  I           C L +S+S H DLN+K  S++SRDY  P
Sbjct  169  AREALDGRSIPSYLLPEHVTSCCLRISFSAHKDLNIKFQSNRSRDYNNP  217



>ref|XP_008780483.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X2 [Phoenix dactylifera]
Length=385

 Score =   250 bits (638),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 160/233 (69%), Gaps = 24/233 (10%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QPVVG DGKKKEPESNVLLASIENMQYAVTVD LHTVFS FG
Sbjct  141  DYTNPYLPVNPSAIEGTLQPVVGPDGKKKEPESNVLLASIENMQYAVTVDALHTVFSTFG  200

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK ALEGHCIYDGGYCKLHLSYS HTDLNVK+
Sbjct  201  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKAALEGHCIYDGGYCKLHLSYSHHTDLNVKS  260

Query  474  YSDKSRDYTVPESGLQQP--SALPNTAPAWQNPQYVSVHSAAPPATMP--MQNPWDPTMQ  307
            +SDKSRDYT+P++ L  P  + LP  A  WQ+   + V S    A +P      WDP+  
Sbjct  261  HSDKSRDYTIPDTALAMPQVATLP-AATGWQHASGMFVSSVGTQAPIPNGQMLAWDPSRH  319

Query  306  GGRPAFISSPTTFPGQEYASPLVP----------------FGANQPAHQGIPP  196
                 + S P  +PGQ +    VP                 G+ Q  H GI P
Sbjct  320  S---TYASVPGAYPGQTFIPSSVPQYPTTGSHPAAPPDSLAGSRQITHHGIQP  369


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TAT A+DA
Sbjct  41   NVLLVTLEGVEPGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDAATATAARDA  100

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +S+S HTDLN+K  S +SRDYT P
Sbjct  101  LDGRSIPRYLLPEHVTSCHLRISFSAHTDLNIKFQSHRSRDYTNP  145



>ref|XP_008665821.1| PREDICTED: uncharacterized protein LOC100217199 isoform X1 [Zea 
mays]
Length=468

 Score =   252 bits (643),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 151/208 (73%), Gaps = 19/208 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQ----PVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVF  667
            DYTNPYLPVN TA+EG VQ    P VG DGK KEPESNVLLASIENMQYAVTVDVLHTVF
Sbjct  210  DYTNPYLPVNQTAIEGIVQENLQPTVGPDGKVKEPESNVLLASIENMQYAVTVDVLHTVF  269

Query  666  SAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDL  487
            SAFG VQKIA+FEKNGG QA IQYPD+TTA VAK ALEGHCIYDGGYCKLHLSYSRHTDL
Sbjct  270  SAFGAVQKIAMFEKNGGMQALIQYPDITTAAVAKQALEGHCIYDGGYCKLHLSYSRHTDL  329

Query  486  NVKAYSDKSRDYTVPESGLQQPSA-----LPNTAPAWQN-------PQYVSVHSAAPPAT  343
            NVKA+ ++SRDYT+ +  +Q  +A     L +   AWQN       P Y S  ++ P   
Sbjct  330  NVKAHDERSRDYTLSDPNVQLQAAAQTPVLRSPGVAWQNTASVPAAPFYASTATSTPIGV  389

Query  342  MPMQNPWDPTMQGGRPAFISSPTTFPGQ  259
              +   W+P MQ G  +F S+ T +P Q
Sbjct  390  GQVA-AWNPNMQAG--SFASASTAYPNQ  414


 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E +Q   VT++V+H VFSAFG V KIA FEK  G QA IQY D  TA  AK++
Sbjct  110  NVLLVTFEGVQPNDVTIEVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALEAKNS  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C + +++S H DLN+K  S +SRDYT P
Sbjct  170  LDGRSIPKYLLPEHIGACHMRITFSAHKDLNIKFQSHRSRDYTNP  214



>ref|XP_008678588.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X2 [Zea mays]
 gb|AFW62275.1| hypothetical protein ZEAMMB73_137441 [Zea mays]
Length=462

 Score =   251 bits (642),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 150/202 (74%), Gaps = 17/202 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TA+EG VQP VG DGK KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPYLPVNQTAIEGIVQPTVGPDGKIKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+FEKNGG QA IQYPD+TTA VAK ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  AVQKIAMFEKNGGMQALIQYPDITTAAVAKQALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQPS-----ALPNTAPAWQNPQYVSVHSAAP-----PATMPMQNP  325
            + D+SRDYT+ +   Q  +      + +   AWQNP   +   AAP      A+ P+  P
Sbjct  330  HDDRSRDYTLSDPNAQLQAAAQAPVISSPGVAWQNP---ASAPAAPFYGSTAASTPVGQP  386

Query  324  --WDPTMQGGRPAFISSPTTFP  265
              W+P MQ   P F S+ T +P
Sbjct  387  PAWNPNMQA--PGFASASTAYP  406


 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E +Q   VT++V+H VFSAFG V KIA FEK  G QA IQY D  TA  AK++
Sbjct  110  NVLLVTFEGVQPNDVTIEVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALEAKNS  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C + +++S H DLN+K  S +SRDYT P
Sbjct  170  LDGRSIPKYLLPEHISACHMRITFSAHKDLNIKFQSHRSRDYTNP  214



>gb|AFW62276.1| hypothetical protein ZEAMMB73_137441 [Zea mays]
Length=458

 Score =   251 bits (642),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 134/202 (66%), Positives = 150/202 (74%), Gaps = 17/202 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TA+EG VQP VG DGK KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  206  DYTNPYLPVNQTAIEGIVQPTVGPDGKIKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  265

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+FEKNGG QA IQYPD+TTA VAK ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  266  AVQKIAMFEKNGGMQALIQYPDITTAAVAKQALEGHCIYDGGYCKLHLSYSRHTDLNVKA  325

Query  474  YSDKSRDYTVPESGLQQPS-----ALPNTAPAWQNPQYVSVHSAAP-----PATMPMQNP  325
            + D+SRDYT+ +   Q  +      + +   AWQNP   +   AAP      A+ P+  P
Sbjct  326  HDDRSRDYTLSDPNAQLQAAAQAPVISSPGVAWQNP---ASAPAAPFYGSTAASTPVGQP  382

Query  324  --WDPTMQGGRPAFISSPTTFP  265
              W+P MQ   P F S+ T +P
Sbjct  383  PAWNPNMQA--PGFASASTAYP  402


 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 62/105 (59%), Gaps = 11/105 (10%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E +Q   VT++V+H VFSAFG V KIA FEK  G     QY D  TA  AK++
Sbjct  110  NVLLVTFEGVQPNDVTIEVIHLVFSAFGFVHKIATFEKAAG----FQYTDAPTALEAKNS  165

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C + +++S H DLN+K  S +SRDYT P
Sbjct  166  LDGRSIPKYLLPEHISACHMRITFSAHKDLNIKFQSHRSRDYTNP  210



>gb|AES77477.2| polypyrimidine tract-binding-like protein [Medicago truncatula]
Length=493

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 152/216 (70%), Gaps = 26/216 (12%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVN +A+EG  QP +G DGK+ E ESNVLLASIENMQYAVTVDV++TVFSAFG
Sbjct  212  DYTNPMLPVNHSAIEGAAQPAIGPDGKRIETESNVLLASIENMQYAVTVDVINTVFSAFG  271

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIA+FEKNG TQA IQYPDVTTA  A++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  272  TVQKIAMFEKNGQTQALIQYPDVTTAAAAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  331

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPPA---TMPMQNP-------  325
            +SDKSRDYTVP         +P  AP WQNPQ   ++    PA    +P  +P       
Sbjct  332  FSDKSRDYTVP--------LVP--APVWQNPQAAPMYPTNSPAYQTQVPGGSPAYQTQVP  381

Query  324  ------WDPTMQGGRPAFISSPTTFPGQEYASPLVP  235
                  WD T    RP ++  P  +PGQ  A P +P
Sbjct  382  GGQVPSWDLTQHAVRPGYVPVPGAYPGQTGAFPTMP  417


 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA  A+DA
Sbjct  112  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKTAGFQALIQFTDAETAASARDA  171

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS H DLN+K  S++SRDYT P
Sbjct  172  LDGRSIPRYLLPEHVGSCNLRISYSAHRDLNIKFQSNRSRDYTNP  216



>gb|EEC83626.1| hypothetical protein OsI_29352 [Oryza sativa Indica Group]
Length=461

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 155/211 (73%), Gaps = 20/211 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG  QP +G DGK KEPESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGIAQPTLGPDGKIKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIA+FEKNGG QA IQYPD+TTA VAK ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAMFEKNGGMQALIQYPDITTAAVAKQALEGHCIYDGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTV---PESGLQQPSALPNTAP---AWQNPQ-----YVSVHSAAPPATMPMQN  328
            + ++SRDYTV   P + +Q  +  P  +    AWQN       Y S  +A P   +P   
Sbjct  330  HDERSRDYTVSSDPSAQMQAAAQAPGPSTPGVAWQNTAPSASFYGSTAAATPVGQVP---  386

Query  327  PWDPTMQGGRPAFISSPTTFPGQEYASPLVP  235
             W+P MQ G  AF S+ + +  Q    P++P
Sbjct  387  AWNPNMQAG--AFGSASSAYTTQ----PMMP  411


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E +Q   +++DV+H VFSAFG V KIA FEK  G QA IQY D  TA  AK++
Sbjct  110  NVLLVTFEGVQPNDISIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALEAKNS  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +++S H DLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPEHVPTCHLRITFSAHKDLNIKFQSHRSRDYTNP  214



>ref|XP_006650134.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
[Oryza brachyantha]
Length=466

 Score =   251 bits (640),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 135/213 (63%), Positives = 157/213 (74%), Gaps = 16/213 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN +A++  +QP VG DG+K E E NVLLASIENMQY VTVDVLHTVFSAFG
Sbjct  215  DYTNPYLPVNSSAIDT-LQPTVGADGRKVEAEGNVLLASIENMQYVVTVDVLHTVFSAFG  273

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTA+VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  274  TVQKIAIFEKNGGTQALIQYPDVTTASVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  333

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQ-NPQYVSVHSAAPP-----ATMPMQNPW  322
            +SDKSRDYT+P+  +Q   QP  +P T+  WQ NPQ    ++          T      W
Sbjct  334  HSDKSRDYTIPQGAMQAVPQPPGVP-TSTGWQGNPQAAGAYAPPGAAAPNHGTTGQLPNW  392

Query  321  DPTMQGGRPAFISSPTTFPGQEYASPLVPFGAN  223
            +P    G   +  +   +PGQ Y+SP V +GA+
Sbjct  393  NP----GNSGYAQASGAYPGQIYSSP-VQYGAS  420


 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 68/109 (62%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            E   NVLL +IE +Q   VT+DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ 
Sbjct  111  ETAGNVLLVTIEGVQANDVTIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAATASA  170

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            A++AL+G  I           C L +S+S H DLN+K  S +SRDYT P
Sbjct  171  AREALDGRSIPRYLLPEHVTSCCLRISFSAHKDLNIKFQSHRSRDYTNP  219



>ref|XP_004489403.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Cicer arietinum]
Length=448

 Score =   250 bits (639),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 142/190 (75%), Gaps = 9/190 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVN TA++G +QPV+G DGKKKEPESNVLLA+IENMQYAVTVDVLHTVFSAFG
Sbjct  210  DYTNPMLPVNQTAIDGALQPVIGPDGKKKEPESNVLLATIENMQYAVTVDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA +QYPDVTT   A++ALEGHCIYDGGYCKLHL+YSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGQTQALVQYPDVTTGAAAREALEGHCIYDGGYCKLHLTYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPTMQGGRP  295
            +SDKSRDYTV +     PS        WQN Q   ++    P        WDP  Q    
Sbjct  330  FSDKSRDYTVLD-----PSLHATQVSLWQNTQTTPMY----PGLQGQMPSWDPNQQEFTQ  380

Query  294  AFISSPTTFP  265
            + +S+P T P
Sbjct  381  SCLSAPGTLP  390


 Score =   103 bits (257),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKTAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS H DLN+K  S++SRDYT P
Sbjct  170  LDGRSIPRYLLPEHVGSCNLRISYSAHRDLNIKFQSNRSRDYTNP  214



>ref|XP_008669881.1| PREDICTED: uncharacterized protein LOC100275742 isoform X1 [Zea 
mays]
 tpg|DAA45563.1| TPA: hypothetical protein ZEAMMB73_334584 [Zea mays]
Length=504

 Score =   251 bits (642),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 149/208 (72%), Gaps = 17/208 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DY NPYLP+N +AM+G +QP VG DG+K E + NVLLASIENMQYAV+VDVLHTVFS+FG
Sbjct  212  DYNNPYLPINYSAMDGTLQPAVGSDGRKVEAQGNVLLASIENMQYAVSVDVLHTVFSSFG  271

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDV TA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  272  TVQKIAIFEKNGGTQALIQYPDVNTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  331

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQNPQYVSVHSAAPPATMPMQN--------  328
            + DKSRDYT+P   +Q   QP  +  T+P WQ    +       P   P QN        
Sbjct  332  HGDKSRDYTIPAGVIQGAPQPPGIQATSPGWQG--NLQAAGPYAPPGAPPQNHSANGQVP  389

Query  327  PWDPTMQGGRPAFISSPTTFPGQEYASP  244
             W P   G  PA    P T+PGQ Y+SP
Sbjct  390  NWTPGNSGYSPA----PGTYPGQMYSSP  413


 Score =   102 bits (254),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            E   NVLL +IE +Q + VT+DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ 
Sbjct  108  ETAGNVLLVTIEGVQASDVTIDVIHMVFSAFGYVHKIATFEKAAGFQALIQYTDADTASA  167

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            A++AL+G  I           C L +S+S H DLN+K  S++SRDY  P
Sbjct  168  AREALDGRSIPSYLLPEHVTSCCLRISFSAHKDLNIKFQSNRSRDYNNP  216



>ref|XP_008780475.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Phoenix dactylifera]
Length=455

 Score =   250 bits (638),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 160/233 (69%), Gaps = 24/233 (10%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QPVVG DGKKKEPESNVLLASIENMQYAVTVD LHTVFS FG
Sbjct  211  DYTNPYLPVNPSAIEGTLQPVVGPDGKKKEPESNVLLASIENMQYAVTVDALHTVFSTFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK ALEGHCIYDGGYCKLHLSYS HTDLNVK+
Sbjct  271  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKAALEGHCIYDGGYCKLHLSYSHHTDLNVKS  330

Query  474  YSDKSRDYTVPESGLQQP--SALPNTAPAWQNPQYVSVHSAAPPATMP--MQNPWDPTMQ  307
            +SDKSRDYT+P++ L  P  + LP  A  WQ+   + V S    A +P      WDP+  
Sbjct  331  HSDKSRDYTIPDTALAMPQVATLP-AATGWQHASGMFVSSVGTQAPIPNGQMLAWDPSRH  389

Query  306  GGRPAFISSPTTFPGQEYASPLVP----------------FGANQPAHQGIPP  196
                 + S P  +PGQ +    VP                 G+ Q  H GI P
Sbjct  390  S---TYASVPGAYPGQTFIPSSVPQYPTTGSHPAAPPDSLAGSRQITHHGIQP  439


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TAT A+DA
Sbjct  111  NVLLVTLEGVEPGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDAATATAARDA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +S+S HTDLN+K  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVTSCHLRISFSAHTDLNIKFQSHRSRDYTNP  215



>dbj|BAJ92028.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=470

 Score =   250 bits (639),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 127/206 (62%), Positives = 149/206 (72%), Gaps = 13/206 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN +A++  +QP VG DG++ E E NVLLASIENMQYAV+VDVLHTVFSAFG
Sbjct  214  DYTNPYLPVNSSAIDSTLQPAVGADGRRVEAEGNVLLASIENMQYAVSVDVLHTVFSAFG  273

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPD +TAT+ K+ALEGHCIYDGGYCK+HLSYSRHTDLNVKA
Sbjct  274  TVQKIAIFEKNGGTQALIQYPDASTATIVKEALEGHCIYDGGYCKIHLSYSRHTDLNVKA  333

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNP------W  322
            +SDKS+DYT+PE   Q   QP+ +P T   WQ     +     P   +  QN       W
Sbjct  334  HSDKSKDYTIPEGAQQAAPQPAGVPPTTAGWQGNSQAAGPYGPPGVAVQNQNTNRQVPNW  393

Query  321  DPTMQGGRPAFISSPTTFPGQEYASP  244
            +P   G  PA    P  +PG  Y++P
Sbjct  394  NPGNSGYPPA----PGQYPGHMYSAP  415


 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            E   NVLL +IE +Q + VT+DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ 
Sbjct  110  ETAGNVLLVTIEGVQASDVTIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDPPTASA  169

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            A++AL+G  I           C L +S+S H DLN+K  S +SRDYT P
Sbjct  170  AREALDGRSIPRYLLPDHVVSCHLRISFSAHKDLNIKFQSHRSRDYTNP  218



>ref|XP_008802574.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X2 [Phoenix dactylifera]
Length=385

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 136/166 (82%), Gaps = 9/166 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QP +G DGKKKEPESNVLLASIENMQYAVTVDVLH VFS FG
Sbjct  211  DYTNPYLPVNPSAIEGTLQPTLGPDGKKKEPESNVLLASIENMQYAVTVDVLHKVFSTFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGG QA IQYPDVTTA VAK ALEGHCIY+GGYCKLHLSYSRHTDLNVKA
Sbjct  271  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKGALEGHCIYEGGYCKLHLSYSRHTDLNVKA  330

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPPATMP  337
            ++D+SRDYT+P++ +         A + Q  Q +S+    PP  MP
Sbjct  331  HNDRSRDYTIPDTAISHAP-----AESLQASQSMSM----PPYGMP  367


 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ A++A
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAETASNARNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +S+S HTDLN+K  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVASCHLRISFSAHTDLNIKFQSHRSRDYTNP  215



>ref|XP_010463574.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X2 [Camelina sativa]
Length=275

 Score =   243 bits (620),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 131/156 (84%), Gaps = 4/156 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +G DGKK E +SNVLL  IENMQYAVTVDVLHTVFSA+G
Sbjct  85   DYTNPYLPVNHTAMDGSMQPALGADGKKVESQSNVLLGLIENMQYAVTVDVLHTVFSAYG  144

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIAIFEKNG TQA IQY D+ TA +AK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  145  AVQKIAIFEKNGSTQALIQYSDIATAAIAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  204

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPA-WQNPQ  379
            +SDKSRDYT+P+  L   Q+ + +  +APA WQNPQ
Sbjct  205  FSDKSRDYTLPDLSLMVAQKAAGVSASAPAGWQNPQ  240


 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 53/83 (64%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KIA FEK  G QA +Q+ DV TA+ A++AL+   I         G C L +
Sbjct  7    VFSAFGFVHKIATFEKAAGFQALVQFSDVETASAARNALDSRSIPRYLLPEHVGSCNLRM  66

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            SYS HTDLN+K  S +SRDYT P
Sbjct  67   SYSAHTDLNIKFQSHRSRDYTNP  89



>ref|XP_002467789.1| hypothetical protein SORBIDRAFT_01g034060 [Sorghum bicolor]
 gb|EER94787.1| hypothetical protein SORBIDRAFT_01g034060 [Sorghum bicolor]
Length=486

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 149/206 (72%), Gaps = 13/206 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DY NPYLP+N +AM+G +QPVVG DG+K E + NVLLASIENMQYAVTVDVLHTVFS+FG
Sbjct  212  DYNNPYLPINYSAMDGTLQPVVGADGRKVEAQGNVLLASIENMQYAVTVDVLHTVFSSFG  271

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDV TA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  272  TVQKIAIFEKNGGTQALIQYPDVNTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKA  331

Query  474  YSDKSRDYTVPES---GLQQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNP------W  322
            + DKSRDYT+P     G+ QP  +  T+  WQ     +   A P A     N       W
Sbjct  332  HGDKSRDYTIPAGVTQGVPQPPGVQATSFGWQGNLQAAGAYAPPGAPAQSHNANGQMPNW  391

Query  321  DPTMQGGRPAFISSPTTFPGQEYASP  244
            +P    G   +   P T+PGQ Y+SP
Sbjct  392  NP----GNSVYPPGPGTYPGQMYSSP  413


 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            E   NVLL ++E +Q + VT+DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ 
Sbjct  108  ETAGNVLLVTMEGVQASDVTIDVIHMVFSAFGYVHKIATFEKAAGFQALIQYTDAATASA  167

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            A+DAL+G  I           C L +S+S H DLN+K  S++SRDY  P
Sbjct  168  ARDALDGRSIPSYLLPEHVTSCCLRISFSAHQDLNIKFQSNRSRDYNNP  216



>ref|XP_010939820.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X2 [Elaeis guineensis]
Length=449

 Score =   248 bits (633),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 151/193 (78%), Gaps = 15/193 (8%)
 Frame = -2

Query  786  FVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQA  607
            ++QP +G+DGKKKEPESNVLLASIEN+QYAVTVDVLH VFS FGTVQKIAIFEKNGG QA
Sbjct  211  YLQPTLGLDGKKKEPESNVLLASIENLQYAVTVDVLHKVFSTFGTVQKIAIFEKNGGMQA  270

Query  606  FIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPESGL-  430
             IQYPDVTTA VAK +LEGHCIY+GGYCKLHLSYSRHTDLNVKA++D+SRDYT+P+SG+ 
Sbjct  271  LIQYPDVTTAAVAKGSLEGHCIYEGGYCKLHLSYSRHTDLNVKAHNDRSRDYTIPDSGIL  330

Query  429  ---QQPSALPNTAPAWQ-NPQYVSVHSA---APPATMPMQN----PWDPTMQGGRPAFIS  283
               Q P     +A  WQ NPQ  S++     A  A  P+ N     WDP+MQGG  A++ 
Sbjct  331  TMPQAPGMPTTSAAGWQTNPQAASMYVGNEYAVGAQAPVPNGQIATWDPSMQGG--AYV-  387

Query  282  SPTTFPGQEYASP  244
            SP+T+PGQ +A P
Sbjct  388  SPSTYPGQTFAPP  400


 Score = 92.8 bits (229),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 67/109 (61%), Gaps = 8/109 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ A++A
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAQTASTARNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPESGL  430
            L+G  I           C L +S+S HTDLN+K  S +S  Y  P  GL
Sbjct  171  LDGRSIPRYLLPEHVTSCHLRISFSAHTDLNIKFQSHRS-SYLQPTLGL  218



>ref|XP_010228563.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Brachypodium distachyon]
Length=479

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 134/156 (86%), Gaps = 5/156 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN +A++  +QP VG DG++ E E NVLLASIENMQYAV+VDVLHTVFS FG
Sbjct  214  DYTNPYLPVNSSAIDSTLQPAVGADGRRVEAEGNVLLASIENMQYAVSVDVLHTVFSTFG  273

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYPDVTTATVAK+ALEGHCIYDGGYCK+HLSYSRHTDLNVKA
Sbjct  274  TVQKIAIFEKNGGTQALIQYPDVTTATVAKEALEGHCIYDGGYCKIHLSYSRHTDLNVKA  333

Query  474  YSDKSRDYTVPESGLQ---QPSALPNTAPAWQ-NPQ  379
            +SDKSRDYT+PE   Q   QP  LP T+  WQ NPQ
Sbjct  334  HSDKSRDYTIPEGAHQAAPQP-GLPPTSAGWQGNPQ  368


 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            E   NVLL +IE +Q + VT+DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ 
Sbjct  110  ETAGNVLLVTIEGVQASDVTIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTASA  169

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            A++AL+G  I           C L +S+S H DLN+K  S +SRDYT P
Sbjct  170  AREALDGRSIPRYLLPEHVLSCHLRISFSAHKDLNIKFQSHRSRDYTNP  218



>emb|CDY43271.1| BnaC05g48640D [Brassica napus]
Length=387

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/174 (69%), Positives = 135/174 (78%), Gaps = 10/174 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +G DGKK E +SNVLLA IENMQYAVTVDVLHTVFSA+G
Sbjct  207  DYTNPYLPVNHTAMDGSMQPALGADGKKVESQSNVLLALIENMQYAVTVDVLHTVFSAYG  266

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQY D+ TA +AK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  267  TVQKIAIFEKNGSTQALIQYSDIATAAIAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  326

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPA------WQN----PQYVSVHSAAPPAT  343
            +SDKSRDYT+P+  L     +P  A A      WQN     QY   H+ A P++
Sbjct  327  FSDKSRDYTLPDLSLLVGQNVPGVAEASAPTAGWQNGQVQTQYAGYHAGASPSS  380


 Score =   101 bits (251),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E ++ + V++DV+H VFSAFG V KIA FEK  G QA +Q+ DV TA+ A+ A
Sbjct  107  NVLLVTFEGVESHHVSIDVIHLVFSAFGFVHKIATFEKAAGFQALVQFTDVETASAARSA  166

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +SYS HTDLN+K  S +SRDYT P
Sbjct  167  LDGRSIPKYLLPDHVASCNLRMSYSAHTDLNIKFQSHRSRDYTNP  211



>ref|XP_003574527.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
[Brachypodium distachyon]
Length=459

 Score =   247 bits (631),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 147/202 (73%), Gaps = 15/202 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG  Q  +G DGK KEPESNVLLASIENMQYAV VDVLHTVF++FG
Sbjct  209  DYTNPYLPVNPTAIEGIAQLTLGPDGKVKEPESNVLLASIENMQYAVGVDVLHTVFNSFG  268

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIA+FEKNGG QA IQYPD++TA VAK ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  269  TVQKIAMFEKNGGMQALIQYPDISTAAVAKQALEGHCIYDGGYCKLHLSYSRHTDLNVKA  328

Query  474  YSDKSRDYTV--PESGLQ---QPSALPNTAPAWQNPQ-----YVSVHSAAPPATMPMQNP  325
            + ++SRDYT   P + +Q   Q   L     AWQN       Y S     P   +P    
Sbjct  329  HDERSRDYTASNPSAQVQAAGQAPGLSTAGVAWQNTTPAASFYPSSAGGNPVGQVP---A  385

Query  324  WDPTMQGGRPAFISSPTTFPGQ  259
            W+P MQ G  AF S+ T++P Q
Sbjct  386  WNPNMQQG--AFASASTSYPTQ  405


 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E++Q   V++DV+H VFSAFG V KIA FEK  G QA IQY D  TA  AK++
Sbjct  109  NVLLVTFEDVQPNDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALEAKNS  168

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +++S H DLN+K  S +SRDYT P
Sbjct  169  LDGRSIPRYLLPEHVSICHLRITFSAHKDLNIKFQSHRSRDYTNP  213



>gb|KDO72600.1| hypothetical protein CISIN_1g026756mg [Citrus sinensis]
 gb|KDO72601.1| hypothetical protein CISIN_1g026756mg [Citrus sinensis]
 gb|KDO72602.1| hypothetical protein CISIN_1g026756mg [Citrus sinensis]
Length=233

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 145/187 (78%), Gaps = 10/187 (5%)
 Frame = -2

Query  783  VQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAF  604
            +QP +G DGKKKE ESNVLLASIENMQYAVTVDVL+TVFSAFGTVQK+AIFEKNGGTQA 
Sbjct  1    MQPTIGPDGKKKELESNVLLASIENMQYAVTVDVLNTVFSAFGTVQKVAIFEKNGGTQAL  60

Query  603  IQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPESGL--  430
            IQYPD+TTA VAK++LEGHCIYDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTV +  L  
Sbjct  61   IQYPDITTAAVAKESLEGHCIYDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVQDQTLLA  120

Query  429  -QQPSALPNTAPAWQNPQYVSVHSAAPPAT-MPMQNP------WDPTMQGGRPAFISSPT  274
             QQ  ++P     WQ+ Q   ++S +  AT +P Q P      W+P+ Q G  A++S+  
Sbjct  121  TQQIPSVPAAPSVWQSHQAAPMYSGSEYATAVPGQVPPGQVPSWNPSAQAGPAAYVSASG  180

Query  273  TFPGQEY  253
             FPGQ Y
Sbjct  181  PFPGQTY  187



>ref|XP_008678587.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Zea mays]
Length=466

 Score =   246 bits (627),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 150/206 (73%), Gaps = 21/206 (10%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQ----PVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVF  667
            DYTNPYLPVN TA+EG VQ    P VG DGK KEPESNVLLASIENMQYAVTVDVLHTVF
Sbjct  210  DYTNPYLPVNQTAIEGIVQENLQPTVGPDGKIKEPESNVLLASIENMQYAVTVDVLHTVF  269

Query  666  SAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDL  487
            SAFG VQKIA+FEKNGG QA IQYPD+TTA VAK ALEGHCIYDGGYCKLHLSYSRHTDL
Sbjct  270  SAFGAVQKIAMFEKNGGMQALIQYPDITTAAVAKQALEGHCIYDGGYCKLHLSYSRHTDL  329

Query  486  NVKAYSDKSRDYTVPESGLQQPS-----ALPNTAPAWQNPQYVSVHSAAP-----PATMP  337
            NVKA+ D+SRDYT+ +   Q  +      + +   AWQNP   +   AAP      A+ P
Sbjct  330  NVKAHDDRSRDYTLSDPNAQLQAAAQAPVISSPGVAWQNP---ASAPAAPFYGSTAASTP  386

Query  336  MQNP--WDPTMQGGRPAFISSPTTFP  265
            +  P  W+P MQ   P F S+ T +P
Sbjct  387  VGQPPAWNPNMQA--PGFASASTAYP  410


 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E +Q   VT++V+H VFSAFG V KIA FEK  G QA IQY D  TA  AK++
Sbjct  110  NVLLVTFEGVQPNDVTIEVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALEAKNS  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C + +++S H DLN+K  S +SRDYT P
Sbjct  170  LDGRSIPKYLLPEHISACHMRITFSAHKDLNIKFQSHRSRDYTNP  214



>ref|XP_010463573.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X1 [Camelina sativa]
Length=400

 Score =   243 bits (621),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 131/156 (84%), Gaps = 4/156 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +G DGKK E +SNVLL  IENMQYAVTVDVLHTVFSA+G
Sbjct  210  DYTNPYLPVNHTAMDGSMQPALGADGKKVESQSNVLLGLIENMQYAVTVDVLHTVFSAYG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIAIFEKNG TQA IQY D+ TA +AK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  270  AVQKIAIFEKNGSTQALIQYSDIATAAIAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPA-WQNPQ  379
            +SDKSRDYT+P+  L   Q+ + +  +APA WQNPQ
Sbjct  330  FSDKSRDYTLPDLSLMVAQKAAGVSASAPAGWQNPQ  365


 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E ++ + V++DV+H VFSAFG V KIA FEK  G QA +Q+ DV TA+ A++A
Sbjct  110  NVLLVTFEGVESHEVSIDVIHLVFSAFGFVHKIATFEKAAGFQALVQFSDVETASAARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+   I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDSRSIPRYLLPEHVGSCNLRMSYSAHTDLNIKFQSHRSRDYTNP  214



>gb|EYU34057.1| hypothetical protein MIMGU_mgv1a007431mg [Erythranthe guttata]
Length=408

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 133/195 (68%), Positives = 146/195 (75%), Gaps = 13/195 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEGF+QP VG DGKKKE ESNVLLASIENMQYA+TVDVLHTVFS+FG
Sbjct  210  DYTNPYLPVNPTAMEGFLQPAVGPDGKKKEFESNVLLASIENMQYAITVDVLHTVFSSFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNGGTQA IQYP++ TA  AKDALEGHCIY+GGYCKLHLSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGGTQALIQYPEIATAAAAKDALEGHCIYEGGYCKLHLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESG-LQQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPT---MQ  307
            Y+DKSRDYT+     +QQ S +P          Y S  +A   A +     WD     M 
Sbjct  330  YTDKSRDYTIQVPLPMQQTSGVPGVG-------YASSSAAQGQAPVTPVTSWDRAPAGMG  382

Query  306  GGRPAFISSPTTFPG  262
            G RP  +  P  FPG
Sbjct  383  GARP--LHQPNVFPG  395


 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQY DV TA+ A+D+
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYSDVQTASTARDS  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPSHLNECHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_010926567.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X3 [Elaeis guineensis]
Length=365

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 140/253 (55%), Positives = 161/253 (64%), Gaps = 46/253 (18%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QPVVG DGKKKEPESNVLLASIENMQYAVTVD LHTVFS FG
Sbjct  103  DYTNPYLPVNPSAIEGTLQPVVGPDGKKKEPESNVLLASIENMQYAVTVDALHTVFSTFG  162

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKD-------------------ALEGHCIYDG  532
            TVQKIAIFEKNGG QA IQYP+    +  +                    ALEGHCIYDG
Sbjct  163  TVQKIAIFEKNGGMQALIQYPEQKQKSAQRKLLLLFIVFSDVTTAAVAKAALEGHCIYDG  222

Query  531  GYCKLHLSYSRHTDLNVKAYSDKSRDYTVPESGLQQP--SALPNTAPAWQNPQYVSVHSA  358
            GYCKLHLSYS HTDLNVKA+SDKSRDYT+P++ +  P  + LP  A  WQ    + V SA
Sbjct  223  GYCKLHLSYSHHTDLNVKAHSDKSRDYTIPDTAMAMPQVATLP-AATGWQQASGMFVGSA  281

Query  357  APPATMP--MQNPWDPTMQGGRPAFISSPTTFPGQEY---------------ASP--LVP  235
               A +P      WDP+    RP + S P  +PGQ +               A+P  L+P
Sbjct  282  GTQAPVPNGQMLGWDPS----RPTYASVPGAYPGQTFIPSSVPQYPTSGSLPAAPPDLLP  337

Query  234  FGANQPAHQGIPP  196
             G+ Q  H GI P
Sbjct  338  -GSRQIIHHGIQP  349


 Score = 65.9 bits (159),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KIA FEK  G QA IQ+ D  TA  A+DAL+G  I           C L +
Sbjct  25   VFSAFGFVHKIATFEKAAGFQALIQFSDAATALAARDALDGRSIPRYLLPEHVTSCHLRI  84

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            S+S HTDLN+K  S +SRDYT P
Sbjct  85   SFSAHTDLNIKFQSHRSRDYTNP  107



>gb|KFK37576.1| hypothetical protein AALP_AA3G001300 [Arabis alpina]
Length=401

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 132/157 (84%), Gaps = 5/157 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +G DGKK E +SNVLLA IENMQYAVTVDVLHTVFSA+G
Sbjct  210  DYTNPYLPVNHTAMDGSMQPALGADGKKVESQSNVLLALIENMQYAVTVDVLHTVFSAYG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQY D+ TA +AK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGSTQALIQYSDIATAAIAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPE-SGLQQPSALPNTAPA----WQNPQ  379
            +SDKSRDYT+P+ S L  P A   +APA    WQNPQ
Sbjct  330  FSDKSRDYTLPDLSLLVAPKAPGVSAPAPTGGWQNPQ  366


 Score =   106 bits (264),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 71/105 (68%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E ++ + V++DV+H VFSAFG V KIA FEK  G QA +Q+ DV TA+ A++A
Sbjct  110  NVLLVTFEGVESHEVSIDVIHLVFSAFGYVHKIATFEKAAGFQALVQFTDVATASAARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I       + G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPENVGACNLRMSYSAHTDLNIKFQSHRSRDYTNP  214



>ref|NP_001118547.1| polypyrimidine tract-binding protein 1 [Arabidopsis thaliana]
 gb|AEE73617.1| polypyrimidine tract-binding protein 1 [Arabidopsis thaliana]
Length=370

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 138/177 (78%), Gaps = 7/177 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +G DGKK E +SNVLL  IENMQYAVTVDVLHTVFSA+G
Sbjct  181  DYTNPYLPVNQTAMDGSMQPALGADGKKVESQSNVLLGLIENMQYAVTVDVLHTVFSAYG  240

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQY D+ TA +AK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  241  TVQKIAIFEKNGSTQALIQYSDIPTAAMAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  300

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAP--AWQNPQYVSVHS--AAPPATMPMQNP  325
            +SDKSRDYT+P+  L   Q+  A+  +AP   WQNPQ  S +S     P   P  +P
Sbjct  301  FSDKSRDYTLPDLSLLVAQKGPAVSGSAPPAGWQNPQAQSQYSGYGGSPYMYPSSDP  357


 Score = 61.6 bits (148),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 42/73 (58%), Gaps = 6/73 (8%)
 Frame = -2

Query  642  IAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHLSYSRHTDLNV  481
            +  FE     +A +Q+ DV TA+ A+ AL+G  I         G C L +SYS HTDLN+
Sbjct  113  LVTFEGVESHEALVQFTDVETASAARSALDGRSIPRYLLSAHVGSCSLRMSYSAHTDLNI  172

Query  480  KAYSDKSRDYTVP  442
            K  S +SRDYT P
Sbjct  173  KFQSHRSRDYTNP  185



>ref|XP_006297839.1| hypothetical protein CARUB_v10013877mg [Capsella rubella]
 gb|EOA30737.1| hypothetical protein CARUB_v10013877mg [Capsella rubella]
Length=399

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/156 (75%), Positives = 131/156 (84%), Gaps = 4/156 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +G DGKK E +SNVLL  IENMQYAVTVDVLHTVFSA+G
Sbjct  210  DYTNPYLPVNHTAMDGSMQPALGADGKKVESQSNVLLGLIENMQYAVTVDVLHTVFSAYG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQY D+ TA +AK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGSTQALIQYSDIATAAIAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPA-WQNPQ  379
            +SDKSRDYT+P+  L   Q+   +  +APA WQNPQ
Sbjct  330  FSDKSRDYTLPDLSLLVAQKAPGVSASAPAGWQNPQ  365


 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E ++ + V++DV+H VFSAFG V KIA FEK  G QA +Q+ DV TA+ A++A
Sbjct  110  NVLLVTFEGVESHEVSIDVIHLVFSAFGFVHKIATFEKAAGFQALVQFSDVETASAARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+   I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDSRSIPRYLLPEHVGSCNLRMSYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_003621259.1| Polypyrimidine tract-binding protein-like protein [Medicago truncatula]
Length=780

 Score =   251 bits (641),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/216 (62%), Positives = 152/216 (70%), Gaps = 26/216 (12%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVN +A+EG  QP +G DGK+ E ESNVLLASIENMQYAVTVDV++TVFSAFG
Sbjct  499  DYTNPMLPVNHSAIEGAAQPAIGPDGKRIETESNVLLASIENMQYAVTVDVINTVFSAFG  558

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIA+FEKNG TQA IQYPDVTTA  A++ALEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  559  TVQKIAMFEKNGQTQALIQYPDVTTAAAAREALEGHCIYDGGYCKLHLSYSRHTDLNVKA  618

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPPA---TMPMQNP-------  325
            +SDKSRDYTVP         +P  AP WQNPQ   ++    PA    +P  +P       
Sbjct  619  FSDKSRDYTVP--------LVP--APVWQNPQAAPMYPTNSPAYQTQVPGGSPAYQTQVP  668

Query  324  ------WDPTMQGGRPAFISSPTTFPGQEYASPLVP  235
                  WD T    RP ++  P  +PGQ  A P +P
Sbjct  669  GGQVPSWDLTQHAVRPGYVPVPGAYPGQTGAFPTMP  704


 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 58/125 (46%), Gaps = 8/125 (6%)
 Frame = -2

Query  675  TVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLH  514
             VFSAFG V KIA FEK  G QA IQ+ D  TA  A+DAL+G  I         G C L 
Sbjct  398  VVFSAFGFVHKIATFEKTAGFQALIQFTDAETAASARDALDGRSIPRYLLPEHVGSCNLR  457

Query  513  LSYSRHTDLNVKAYSDKSRDYTVPESGLQQPSALPNTAPAWQ--NPQYVSVHSAAPPATM  340
            +SYS H DLN+K  S++S     P               AW   NP     HSA   A  
Sbjct  458  ISYSAHRDLNIKFQSNRSSLSICPGDDQVLLFYRLGVTEAWDYTNPMLPVNHSAIEGAAQ  517

Query  339  PMQNP  325
            P   P
Sbjct  518  PAIGP  522



>ref|NP_186764.1| polypyrimidine tract-binding protein 1 [Arabidopsis thaliana]
 sp|Q9MAC5.1|PTBP1_ARATH RecName: Full=Polypyrimidine tract-binding protein homolog 1 
[Arabidopsis thaliana]
 gb|AAF26159.1|AC008261_16 putative polypyrimidine tract-binding protein [Arabidopsis thaliana]
 dbj|BAH19604.1| AT3G01150 [Arabidopsis thaliana]
 gb|AEE73616.1| polypyrimidine tract-binding protein 1 [Arabidopsis thaliana]
Length=399

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 138/177 (78%), Gaps = 7/177 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +G DGKK E +SNVLL  IENMQYAVTVDVLHTVFSA+G
Sbjct  210  DYTNPYLPVNQTAMDGSMQPALGADGKKVESQSNVLLGLIENMQYAVTVDVLHTVFSAYG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQY D+ TA +AK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGSTQALIQYSDIPTAAMAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAP--AWQNPQYVSVHS--AAPPATMPMQNP  325
            +SDKSRDYT+P+  L   Q+  A+  +AP   WQNPQ  S +S     P   P  +P
Sbjct  330  FSDKSRDYTLPDLSLLVAQKGPAVSGSAPPAGWQNPQAQSQYSGYGGSPYMYPSSDP  386


 Score =   104 bits (260),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E ++ + V++DV+H VFSAFG V KIA FEK  G QA +Q+ DV TA+ A+ A
Sbjct  110  NVLLVTFEGVESHEVSIDVIHLVFSAFGFVHKIATFEKAAGFQALVQFTDVETASAARSA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLSAHVGSCSLRMSYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_010550047.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X2 [Tarenaya hassleriana]
Length=303

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 140/182 (77%), Gaps = 8/182 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAM+G +Q  VG DGKK E +SNVLLA IENMQYAVTVDVLHTVFSA+G
Sbjct  85   DYTNPYLPVNPTAMDGAMQTAVGPDGKKVEFQSNVLLALIENMQYAVTVDVLHTVFSAYG  144

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            +VQKIAIFEKNG TQA IQYPD+ TA VAK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  145  SVQKIAIFEKNGATQALIQYPDIPTAAVAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  204

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPA----WQNPQYVSVHSAAPPA--TMPMQNP--WD  319
            +SDKSRDYT+P+  L     +P  + A    WQ P    ++S A  A  +MP   P   D
Sbjct  205  FSDKSRDYTLPDLSLLVTQKVPALSAAAQTTWQEPLVQPLNSGAGTAYTSMPGIYPSQMD  264

Query  318  PT  313
            PT
Sbjct  265  PT  266


 Score = 85.1 bits (209),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 53/83 (64%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++AL+G  I         G C L +
Sbjct  7    VFSAFGFVHKIATFEKAAGFQALIQFSDPETASAARNALDGRSIPRYLLPEHFGSCHLRI  66

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            SYS HTDLN+K  S +SRDYT P
Sbjct  67   SYSAHTDLNIKFQSHRSRDYTNP  89



>gb|AAC62015.1| polypyrimidine tract-binding protein homolog [Arabidopsis thaliana]
Length=418

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 134/164 (82%), Gaps = 5/164 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +G DGKK E +SNVLL  IENMQYAVTVDVLHTVFSA+G
Sbjct  210  DYTNPYLPVNQTAMDGSMQPALGADGKKVESQSNVLLGLIENMQYAVTVDVLHTVFSAYG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQY D+ TA +AK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGSTQALIQYSDIPTAAMAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAP--AWQNPQYVSVHSA  358
            +SDKSRDYT+P+  L   Q+  A+  +AP   WQNPQ  S +S 
Sbjct  330  FSDKSRDYTLPDLSLLVAQKGPAVSGSAPPAGWQNPQAQSQYSG  373


 Score =   103 bits (258),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E ++ + V++DV+H VFSAFG V KIA FEK  G QA +Q+ DV TA+ A+ A
Sbjct  110  NVLLVTFEGVESHEVSIDVIHLVFSAFGFVHKIATFEKAAGFQALVQFTDVETASAARSA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLSAHVGSCSLRMSYSAHTDLNIKFQSHRSRDYTNP  214



>ref|NP_001151769.1| polypyrimidine tract-binding protein [Zea mays]
 gb|ACG44261.1| polypyrimidine tract-binding protein [Zea mays]
Length=487

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 151/206 (73%), Gaps = 12/206 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DY NPYLP+N +AM+G +QP VG DG++ E + NVLLASIENMQYAVTVDVLHTVFS+FG
Sbjct  212  DYNNPYLPINYSAMDGTLQPAVGADGRQVEAQGNVLLASIENMQYAVTVDVLHTVFSSFG  271

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            +VQKIAIFEKNGGTQA IQYPDV+TA VAK++LEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  272  SVQKIAIFEKNGGTQALIQYPDVSTAAVAKESLEGHCIYDGGYCKLHLSYSRHTDLNVKA  331

Query  474  YSDKSRDYTVPESGLQQ-PSALPNTAPAWQ-NPQ-------YVSVHSAAPPATMPMQNPW  322
            + DKSRDYT+P   +Q  P  +  T+  WQ N Q            S +  A   +QN W
Sbjct  332  HGDKSRDYTIPAGVIQGVPPGVQATSSGWQGNVQAAGAYAAPPGAPSQSHGANGHVQN-W  390

Query  321  DPTMQGGRPAFISSPTTFPGQEYASP  244
            +P      PA    P T+PGQ Y+SP
Sbjct  391  NPGNSVYPPA--PGPGTYPGQMYSSP  414


 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            E   NVLL +IE +Q + VT+DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ 
Sbjct  108  ETAGNVLLVTIEGVQSSDVTIDVIHMVFSAFGYVHKIATFEKAAGFQALIQYTDAATASA  167

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            AK++L+G  I           C L +S+S H DLN+K  S++SRDY  P
Sbjct  168  AKESLDGRSIPSYLLPEHVTSCCLRISFSAHKDLNIKFQSNRSRDYNNP  216



>gb|EMS55172.1| Polypyrimidine tract-binding protein-like protein 1 [Triticum 
urartu]
Length=526

 Score =   245 bits (625),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 149/210 (71%), Gaps = 20/210 (10%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG  QP++G DGK KEPESNVLLASIENMQYAV VDVLHTVFS+FG
Sbjct  265  DYTNPYLPVNPTAIEGITQPILGSDGKIKEPESNVLLASIENMQYAVGVDVLHTVFSSFG  324

Query  654  TVQKIAIFEKNGGTQAFIQYP------------DVTTATVAKDALEGHCIYDGGYCKLHL  511
             V+KIA+FEKNGG QA IQYP            D+TTA VAK ALEGHCIYDGGYCKLHL
Sbjct  325  AVRKIAMFEKNGGMQALIQYPEVLLELTESVFADITTAGVAKQALEGHCIYDGGYCKLHL  384

Query  510  SYSRHTDLNVKAYSDKSRDYTVPESGLQ-----QPSALPNTAPAWQNPQYVSVH-SAAPP  349
            SYSRHTDLNVKA+ ++SRDYTV +   Q     Q   L     AWQ+    + + S+A P
Sbjct  385  SYSRHTDLNVKAHDERSRDYTVSDPSAQVQAAGQAPGLSTPGAAWQSTTPAAFYGSSAGP  444

Query  348  ATMPMQNPWDPTMQGGRPAFISSPTTFPGQ  259
             ++     W+P MQ  R AF  + T++P Q
Sbjct  445  TSIGQVPAWNPNMQ--RGAFAPASTSYPTQ  472


 Score = 96.7 bits (239),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 66/109 (61%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            +   NVLL + E +Q   V++DV+H VFSAFG V KIA FEK  G QA IQY D  TA  
Sbjct  161  DSSGNVLLVTFEGVQPNDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALE  220

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            AK++L+G  I           C L +++S H DLN+K  S +SRDYT P
Sbjct  221  AKNSLDGRSIPRYLLAEHVSICHLRITFSAHKDLNIKFQSHRSRDYTNP  269



>ref|XP_010926565.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Elaeis guineensis]
Length=473

 Score =   243 bits (620),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 146/252 (58%), Positives = 162/252 (64%), Gaps = 44/252 (17%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +QPVVG DGKKKEPESNVLLASIENMQYAVTVD LHTVFS FG
Sbjct  211  DYTNPYLPVNPSAIEGTLQPVVGPDGKKKEPESNVLLASIENMQYAVTVDALHTVFSTFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYP-------------------DVTTATVAKDALEGHCIYDG  532
            TVQKIAIFEKNGG QA IQYP                   DVTTA VAK ALEGHCIYDG
Sbjct  271  TVQKIAIFEKNGGMQALIQYPEQKQKSAQRKLLLLFIVFSDVTTAAVAKAALEGHCIYDG  330

Query  531  GYCKLHLSYSRHTDLNVKAYSDKSRDYTVPESGLQQP--SALPNTAPAWQNPQYVSVHSA  358
            GYCKLHLSYS HTDLNVKA+SDKSRDYT+P++ +  P  + LP  A  WQ    + V SA
Sbjct  331  GYCKLHLSYSHHTDLNVKAHSDKSRDYTIPDTAMAMPQVATLP-AATGWQQASGMFVGSA  389

Query  357  APPATMP--MQNPWDPTMQGGRPAFISSPTTFPGQEYASPLVPF----------------  232
               A +P      WDP+    RP + S P  +PGQ +    VP                 
Sbjct  390  GTQAPVPNGQMLGWDPS----RPTYASVPGAYPGQTFIPSSVPQYPTSGSLPAAPPDLLP  445

Query  231  GANQPAHQGIPP  196
            G+ Q  H GI P
Sbjct  446  GSRQIIHHGIQP  457


 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 67/105 (64%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA  A+DA
Sbjct  111  NVLLVTLEGVEPGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDAATALAARDA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +S+S HTDLN+K  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVTSCHLRISFSAHTDLNIKFQSHRSRDYTNP  215



>ref|XP_009147401.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 [Brassica 
rapa]
Length=398

 Score =   240 bits (613),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 128/158 (81%), Gaps = 6/158 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +G DGKK E +SNVLLA IENMQYAVTVDVLHTVFSA+G
Sbjct  207  DYTNPYLPVNHTAMDGSMQPALGADGKKVETQSNVLLALIENMQYAVTVDVLHTVFSAYG  266

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQY D+ TA +AK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  267  TVQKIAIFEKNGSTQALIQYSDIATAAIAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  326

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPA------WQNPQ  379
            +SDKSRDYT+P+  L     +P  A A      WQN Q
Sbjct  327  FSDKSRDYTLPDLSLLVGQNVPGVADASAPTAGWQNGQ  364


 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E ++ + V++DV+H VFSAFG V KIA FEK  G QA +Q+ DV TA+ A++A
Sbjct  107  NVLLVTFEGVESHDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALVQFTDVETASAARNA  166

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +SYS HTDLN+K  S +SRDYT P
Sbjct  167  LDGRSIPKYLLPDHVASCNLRMSYSAHTDLNIKFQSHRSRDYTNP  211



>ref|XP_010424077.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X1 [Camelina sativa]
Length=400

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 130/156 (83%), Gaps = 4/156 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +  DGKK E +SNVLL  IENMQYAVTVDVLHTVFSA+G
Sbjct  210  DYTNPYLPVNHTAMDGSMQPALDADGKKVESQSNVLLGLIENMQYAVTVDVLHTVFSAYG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIAIFEKNG TQA IQY D+ TA +AK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  270  AVQKIAIFEKNGSTQALIQYSDIATAAIAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPA-WQNPQ  379
            +SDKSRDYT+P+  L   Q+ + +  +APA WQNPQ
Sbjct  330  FSDKSRDYTLPDLSLMVAQKAAGVSASAPAGWQNPQ  365


 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E ++ + V++DV+H VFSAFG V KIA FEK  G QA +Q+ DV TA+ A++A
Sbjct  110  NVLLVTFEGVESHEVSIDVIHLVFSAFGFVHKIATFEKAAGFQALVQFSDVETASAARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+   I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDSRSIPRYLLPEHVGSCNLRMSYSAHTDLNIKFQSHRSRDYTNP  214



>emb|CDY37541.1| BnaA05g34060D [Brassica napus]
Length=389

 Score =   240 bits (612),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 128/158 (81%), Gaps = 6/158 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +G DGKK E +SNVLLA IENMQYAVTVDVLHTVFSA+G
Sbjct  207  DYTNPYLPVNHTAMDGSMQPALGADGKKVETQSNVLLALIENMQYAVTVDVLHTVFSAYG  266

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            +VQKIAIFEKNG TQA IQY D+ TA +AK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  267  SVQKIAIFEKNGSTQALIQYSDIATAAIAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  326

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPA------WQNPQ  379
            +SDKSRDYT+P+  L     +P  A A      WQN Q
Sbjct  327  FSDKSRDYTLPDLSLLVGQNVPGVADASAPTAGWQNGQ  364


 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E ++ + V++DV+H VFSAFG V KIA FEK  G QA +Q+ DV TA+ A++A
Sbjct  107  NVLLVTFEGVESHDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALVQFTDVETASAARNA  166

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L +SYS HTDLN+K  S +SRDYT P
Sbjct  167  LDGRSIPKYLLPDHVASCNLRMSYSAHTDLNIKFQSHRSRDYTNP  211



>gb|EMT31084.1| Polypyrimidine tract-binding protein-1-like protein [Aegilops 
tauschii]
Length=559

 Score =   244 bits (623),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 148/210 (70%), Gaps = 20/210 (10%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG  QP++G DGK KEPESNVLLASIENMQYAV VDVLHTVFS+FG
Sbjct  298  DYTNPYLPVNPTAIEGIAQPMLGSDGKIKEPESNVLLASIENMQYAVGVDVLHTVFSSFG  357

Query  654  TVQKIAIFEKNGGTQAFIQYP------------DVTTATVAKDALEGHCIYDGGYCKLHL  511
             V+KIA+FEKNGG QA IQYP            D+TTA VAK ALEGHCIYDGGYCKLHL
Sbjct  358  AVRKIAMFEKNGGMQALIQYPEVLLELTESVFADITTAGVAKQALEGHCIYDGGYCKLHL  417

Query  510  SYSRHTDLNVKAYSDKSRDYTVPESGLQ-----QPSALPNTAPAWQNPQYVSVHSAAPPA  346
            SYSRHTDLNVKA+ ++SRDYTV +   Q     Q   L     AWQ+    + + ++  A
Sbjct  418  SYSRHTDLNVKAHDERSRDYTVSDPSAQVQAAGQAPGLSTPGAAWQSTTPAAFYGSSARA  477

Query  345  TMPMQNP-WDPTMQGGRPAFISSPTTFPGQ  259
                Q P W+P MQ  R AF  + T++P Q
Sbjct  478  ASIGQVPAWNPNMQ--RGAFAPASTSYPTQ  505


 Score = 96.3 bits (238),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 66/109 (61%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            +   NVLL + E +Q   V++DV+H VFSAFG V KIA FEK  G QA IQY D  TA  
Sbjct  194  DSSGNVLLVTFEGVQPNDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQYTDAPTALE  253

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            AK++L+G  I           C L +++S H DLN+K  S +SRDYT P
Sbjct  254  AKNSLDGRSIPRYLLAQHVSICHLRITFSAHKDLNIKFQSHRSRDYTNP  302



>ref|XP_008658781.1| PREDICTED: uncharacterized protein LOC100381791 isoform X1 [Zea 
mays]
 gb|ACN30563.1| unknown [Zea mays]
 gb|ACN31073.1| unknown [Zea mays]
Length=487

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 150/206 (73%), Gaps = 12/206 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DY NPYLP+N +AM+G +QP VG DG++ E + NVLLASIENMQYAVTVDVLHTVFS+FG
Sbjct  212  DYNNPYLPINYSAMDGTLQPAVGADGRQVEAQGNVLLASIENMQYAVTVDVLHTVFSSFG  271

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            +VQKIAIFEKNGGTQA IQYPDV+TA VAK++LEGHCIYDGGYCKLHLSYSRHTDLNVKA
Sbjct  272  SVQKIAIFEKNGGTQALIQYPDVSTAAVAKESLEGHCIYDGGYCKLHLSYSRHTDLNVKA  331

Query  474  YSDKSRDYTVPESGLQQ-PSALPNTAPAWQ-NPQ-------YVSVHSAAPPATMPMQNPW  322
            + DKSRDYT+P   +Q  P  +  T+  WQ N Q            S +  A   +QN W
Sbjct  332  HGDKSRDYTIPAGVIQGVPPGVQATSSGWQGNVQAAGAYAAPPGAPSQSHGANGHVQN-W  390

Query  321  DPTMQGGRPAFISSPTTFPGQEYASP  244
            +P      PA    P  +PGQ Y+SP
Sbjct  391  NPGNSVYPPA--PGPGIYPGQMYSSP  414


 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 69/109 (63%), Gaps = 7/109 (6%)
 Frame = -2

Query  747  EPESNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATV  571
            E   NVLL +IE +Q + VT+DV+H VFSAFG V KIA FEK  G QA IQY D  TA+ 
Sbjct  108  ETAGNVLLVTIEGVQSSDVTIDVIHMVFSAFGYVHKIATFEKAAGFQALIQYTDAATASA  167

Query  570  AKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            AK++L+G  I           C L +S+S H DLN+K  S++SRDY  P
Sbjct  168  AKESLDGRSIPSYLLPEHVTSCCLRISFSAHKDLNIKFQSNRSRDYNNP  216



>ref|XP_002884293.1| polypyrimidine tract-binding [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60552.1| polypyrimidine tract-binding [Arabidopsis lyrata subsp. lyrata]
Length=398

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 130/156 (83%), Gaps = 4/156 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +G DGKK E +SNVLL  IENMQYAVTVDVLHTVFSA+G
Sbjct  210  DYTNPYLPVNHTAMDGSMQPALGADGKKVESQSNVLLGLIENMQYAVTVDVLHTVFSAYG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQY D+ TA +AK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  270  TVQKIAIFEKNGSTQALIQYSDIPTAAIAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAP--AWQNPQ  379
            +SDKSRDYT+P+  L  Q+   +  +AP   WQNPQ
Sbjct  330  FSDKSRDYTLPDLSLLAQKGPGVSASAPPTGWQNPQ  365


 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 70/105 (67%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E ++ + V++DV+H VFSAFG V KIA FEK  G QA +Q+ DV TA+ A++A
Sbjct  110  NVLLVTFEGVESHEVSIDVIHLVFSAFGFVHKIATFEKAAGFQALVQFSDVETASAARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPEHVGSCNLRMSYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_010550046.1| PREDICTED: polypyrimidine tract-binding protein homolog 1 isoform 
X1 [Tarenaya hassleriana]
Length=428

 Score =   239 bits (609),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 140/182 (77%), Gaps = 8/182 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAM+G +Q  VG DGKK E +SNVLLA IENMQYAVTVDVLHTVFSA+G
Sbjct  210  DYTNPYLPVNPTAMDGAMQTAVGPDGKKVEFQSNVLLALIENMQYAVTVDVLHTVFSAYG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            +VQKIAIFEKNG TQA IQYPD+ TA VAK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  270  SVQKIAIFEKNGATQALIQYPDIPTAAVAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  329

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPA----WQNPQYVSVHSAAPPA--TMPMQNP--WD  319
            +SDKSRDYT+P+  L     +P  + A    WQ P    ++S A  A  +MP   P   D
Sbjct  330  FSDKSRDYTLPDLSLLVTQKVPALSAAAQTTWQEPLVQPLNSGAGTAYTSMPGIYPSQMD  389

Query  318  PT  313
            PT
Sbjct  390  PT  391


 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDPETASAARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  170  LDGRSIPRYLLPEHFGSCHLRISYSAHTDLNIKFQSHRSRDYTNP  214



>ref|XP_004984227.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X6 [Setaria italica]
Length=258

 Score =   233 bits (595),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 137/191 (72%), Gaps = 9/191 (5%)
 Frame = -2

Query  795  MEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGG  616
            M+G +QP VG DG+K E + NVLLASIENMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGG
Sbjct  1    MDGTLQPAVGADGRKVEAQGNVLLASIENMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGG  60

Query  615  TQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPES  436
            TQA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVKA+ DKSRDYT+P  
Sbjct  61   TQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKAHGDKSRDYTIPPG  120

Query  435  ---GLQQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNPWD----PTMQGGRPAFISSP  277
               G+ QP     T+  WQ    +    A  P  +P QN       P    G   +  +P
Sbjct  121  VIQGVPQPPGAAATSTGWQG--NIQGAGAYAPPGIPAQNHSANGQVPNWNSGNSGYPPAP  178

Query  276  TTFPGQEYASP  244
              +PGQ Y+SP
Sbjct  179  GAYPGQMYSSP  189



>gb|AES74737.2| polypyrimidine tract-binding-like protein [Medicago truncatula]
Length=449

 Score =   239 bits (610),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 153/215 (71%), Gaps = 14/215 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVN  A++  +QP +G DGK+KE +SNVLLA+IENMQYAV +DVLH+VFSAFG
Sbjct  211  DYTNPMLPVNQAAIDSALQPAIGPDGKRKEHKSNVLLATIENMQYAVPLDVLHSVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQK+A+F+KNG T A IQYPD+T A  AK+ LEGHCIYDGGYCKLHL+YSRHTDLNVKA
Sbjct  271  FVQKVAMFDKNGHTHALIQYPDLTIAAAAKETLEGHCIYDGGYCKLHLTYSRHTDLNVKA  330

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPTMQGGRP  295
            +SDKSRDYTV +     PS     APAWQ  Q  +++S     +M     WDP  Q    
Sbjct  331  FSDKSRDYTVLD-----PSLHAAQAPAWQTTQAATMYS----GSMGQMPSWDPNQQEVTQ  381

Query  294  AFISSPTTFPGQEYASPLVPFGANQPAHQGIPPPG  190
            +++S+P TFP  + A+P  PF    PA   +PP G
Sbjct  382  SYLSAPGTFPSGQ-AAP--PFPGYSPA--AVPPAG  411


 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V K+A FEK  G QA IQY D  TA  AKD+
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKLATFEKTAGFQALIQYTDAETAASAKDS  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS H DLN+K  S++SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVGACNLRISYSAHRDLNIKFQSNRSRDYTNP  215



>ref|XP_006408466.1| hypothetical protein EUTSA_v10020700mg [Eutrema salsugineum]
 gb|ESQ49919.1| hypothetical protein EUTSA_v10020700mg [Eutrema salsugineum]
Length=457

 Score =   238 bits (607),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 128/157 (82%), Gaps = 5/157 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +G DGKK E +SNVLLA IENMQYAVTVDVLHTVFSA+G
Sbjct  266  DYTNPYLPVNHTAMDGSLQPALGADGKKVESQSNVLLALIENMQYAVTVDVLHTVFSAYG  325

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQY D+ TA +AK+ALEGHCIYDGGYCKL LSYSRHTDLNVKA
Sbjct  326  TVQKIAIFEKNGSTQALIQYSDIPTAAIAKEALEGHCIYDGGYCKLRLSYSRHTDLNVKA  385

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPA-----WQNPQ  379
            +SDKSRDYT+P+  L     +P  + +     WQN Q
Sbjct  386  FSDKSRDYTLPDLSLLVAQKVPGVSASAPTSGWQNTQ  422


 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 70/105 (67%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E ++ + V++DV+H VFSAFG V KIA FEK  G QA +Q+ DV TA+ A++A
Sbjct  166  NVLLVTFEGVESHEVSIDVIHLVFSAFGFVHKIATFEKAAGFQALVQFSDVETASAARNA  225

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  226  LDGRSIPRYLLPEHVGSCNLRMSYSAHTDLNIKFQSHRSRDYTNP  270



>gb|KJB33520.1| hypothetical protein B456_006G014900 [Gossypium raimondii]
 gb|KJB33522.1| hypothetical protein B456_006G014900 [Gossypium raimondii]
Length=329

 Score =   233 bits (595),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTAMEG +QPVVG DGKK+EP+SNVLLASIENMQYAVTVDVLH+VFSAFG
Sbjct  210  DYTNPYLPVNPTAMEGLMQPVVGPDGKKQEPQSNVLLASIENMQYAVTVDVLHSVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVK  478
            TVQKIAIFEKNGGTQA IQYPDVTTA VAK++LEGHCIY+GGYCKLHLSYSRHTDLNVK
Sbjct  270  TVQKIAIFEKNGGTQALIQYPDVTTAAVAKESLEGHCIYEGGYCKLHLSYSRHTDLNVK  328


 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 62/134 (46%), Positives = 78/134 (58%), Gaps = 17/134 (13%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   VT++ +H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEANDVTIETIHLVFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI---YDGGY---CKLHLSYSRHTDLNVKAYSDKSRDYTVP--------ESGLQQP  421
            L+G  I      G+   C L +SYS HTDLN+K  S +SRDYT P          GL QP
Sbjct  170  LDGRSIPRYLLPGHVTSCHLRISYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAMEGLMQP  229

Query  420  SALPNTAPAWQNPQ  379
               P+     Q PQ
Sbjct  230  VVGPDGKK--QEPQ  241



>emb|CDY55803.1| BnaCnng29130D [Brassica napus]
Length=396

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 133/173 (77%), Gaps = 10/173 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +G DGK+ E +SNVLLA IENMQYAVTVDVLHTVFSA+G
Sbjct  208  DYTNPYLPVNQTAMDGSMQPALGADGKRVETQSNVLLALIENMQYAVTVDVLHTVFSAYG  267

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQY D++TAT+AK+ALEGHCIYDGGYCKL L+YSRHTDLNVKA
Sbjct  268  TVQKIAIFEKNGSTQALIQYSDISTATMAKEALEGHCIYDGGYCKLRLTYSRHTDLNVKA  327

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPA------WQN----PQYVSVHSAAPPA  346
            +SDKSRDYT+P+        +P  A A      W N     QY+      PPA
Sbjct  328  FSDKSRDYTLPDLSQLVGQKVPGVAAASGPTDGWPNGQVQTQYMGSSYMYPPA  380


 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E +Q + V++DV+H VFSA+G V KIA FEK  G QA +Q+ DV TA  A+ A
Sbjct  108  NVLLVTFEGVQSHDVSIDVIHLVFSAYGFVHKIATFEKAAGFQALVQFTDVDTALAARTA  167

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  168  LDGRSIPKYLLPEHVGSCNLRMSYSAHTDLNIKFQSHRSRDYTNP  212



>gb|AIG20415.1| polypyrimidine tract-binding protein 1 [Brassica oleracea var. 
alboglabra]
Length=395

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 117/173 (68%), Positives = 133/173 (77%), Gaps = 10/173 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVN TAM+G +QP +G DGK+ E +SNVLLA IENMQYAVTVDVLHTVFSA+G
Sbjct  207  DYTNPYLPVNQTAMDGSMQPALGADGKRVETQSNVLLALIENMQYAVTVDVLHTVFSAYG  266

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKNG TQA IQY D++TAT+AK+ALEGHCIYDGGYCKL L+YSRHTDLNVKA
Sbjct  267  TVQKIAIFEKNGSTQALIQYSDISTATMAKEALEGHCIYDGGYCKLRLTYSRHTDLNVKA  326

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPA------WQN----PQYVSVHSAAPPA  346
            +SDKSRDYT+P+        +P  A A      W N     QY+      PPA
Sbjct  327  FSDKSRDYTLPDLSQLVGQKVPGVAAASGPTDGWPNGQVQTQYMGSSYMYPPA  379


 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 67/105 (64%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL + E +Q + V +DV+H VFSA+G V KIA FEK  G QA +Q+ DV TA  A+ A
Sbjct  107  NVLLVTFEGVQSHHVCIDVIHLVFSAYGFVHKIATFEKAAGFQALVQFTDVDTALAARTA  166

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P
Sbjct  167  LDGRSIPKYLLPEHVGSCNLRMSYSAHTDLNIKFQSHRSRDYTNP  211



>gb|KCW51898.1| hypothetical protein EUGRSUZ_J013582, partial [Eucalyptus grandis]
Length=276

 Score =   226 bits (576),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG  QP +G DGKK EPESNVLLASIENMQYAVTVD LHTVFSAFG
Sbjct  149  DYTNPYLPVNPTAIEGINQPALGPDGKKTEPESNVLLASIENMQYAVTVDALHTVFSAFG  208

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVK  478
             VQKIAIFEKNGGTQA IQYPD+TTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLN+K
Sbjct  209  PVQKIAIFEKNGGTQALIQYPDITTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNIK  267


 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 91/181 (50%), Gaps = 28/181 (15%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ DV TA+ A+  
Sbjct  49   NVLLVTMEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFSDVETASAARAQ  108

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQP  421
            L+G  I           C L ++YS HTDLN+K  S +SRDYT P          G+ QP
Sbjct  109  LDGRSIPRYLLPEHVKSCNLRITYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAIEGINQP  168

Query  420  SALPN---TAP-------AWQNPQY---VSVHSAAPPATMPMQNPWDPTMQGGRPAFISS  280
            +  P+   T P       + +N QY   V        A  P+Q        GG  A I  
Sbjct  169  ALGPDGKKTEPESNVLLASIENMQYAVTVDALHTVFSAFGPVQKIAIFEKNGGTQALIQY  228

Query  279  P  277
            P
Sbjct  229  P  229



>ref|XP_010521384.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X2 [Tarenaya hassleriana]
Length=319

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 133/171 (78%), Gaps = 9/171 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  +GVDG+K EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  111  DYTNPYLPVAPSAIDSTGQVTMGVDGRKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  170

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  171  LVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  230

Query  474  YSDKSRDYTVPESGL----QQPSALPNTAPAWQNPQYVSVHSAAPPATMPM  334
             +D+SRDYT+P   +    QQP   P++ P     Q+VS     P  +MPM
Sbjct  231  NNDRSRDYTIPNPAVPIPAQQPGMHPSSHPYSSGAQWVS-----PGQSMPM  276


 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGY------CKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ DV TAT AK+AL+G  I           C L +
Sbjct  33   VFSAFGFVHKITTFEKTAGYQALVQFSDVETATSAKNALDGRSIPRYLLPEHVEPCSLKI  92

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS HTDL VK  S +SRDYT P
Sbjct  93   TYSAHTDLTVKFQSHRSRDYTNP  115



>ref|XP_010521385.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X3 [Tarenaya hassleriana]
Length=318

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 133/171 (78%), Gaps = 9/171 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  +GVDG+K EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  110  DYTNPYLPVAPSAIDSTGQVTMGVDGRKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  169

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  170  LVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  229

Query  474  YSDKSRDYTVPESGL----QQPSALPNTAPAWQNPQYVSVHSAAPPATMPM  334
             +D+SRDYT+P   +    QQP   P++ P     Q+VS     P  +MPM
Sbjct  230  NNDRSRDYTIPNPAVPIPAQQPGMHPSSHPYSSGAQWVS-----PGQSMPM  275


 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGY------CKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ DV TAT AK+AL+G  I           C L +
Sbjct  32   VFSAFGFVHKITTFEKTAGYQALVQFSDVETATSAKNALDGRSIPRYLLPEHVEPCSLKI  91

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS HTDL VK  S +SRDYT P
Sbjct  92   TYSAHTDLTVKFQSHRSRDYTNP  114



>ref|XP_006431182.1| hypothetical protein CICLE_v10011680mg [Citrus clementina]
 gb|ESR44422.1| hypothetical protein CICLE_v10011680mg [Citrus clementina]
Length=341

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNPTA+EG +QP +G DGKKKE ESNVLLASIENMQYAVTVDVL+TVFSAFG
Sbjct  210  DYTNPYLPVNPTAIEGVMQPTIGPDGKKKELESNVLLASIENMQYAVTVDVLNTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVK  478
            TVQK+AIFEKNGGTQA IQYPD+TTA VAK++LEGHCIYDGGYCKLHLSYSRHTDLNVK
Sbjct  270  TVQKVAIFEKNGGTQALIQYPDITTAAVAKESLEGHCIYDGGYCKLHLSYSRHTDLNVK  328


 Score =   103 bits (257),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 76/125 (61%), Gaps = 15/125 (12%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V KIA FEK  G QA IQ+ D  TA+ A++A
Sbjct  110  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKIATFEKAAGFQALIQFTDAETASSARNA  169

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE--------SGLQQP  421
            L+G  I         G C L +SYS HTDLN+K  S +SRDYT P          G+ QP
Sbjct  170  LDGRSIPRYLLPEHVGSCHLRISYSAHTDLNIKFQSHRSRDYTNPYLPVNPTAIEGVMQP  229

Query  420  SALPN  406
            +  P+
Sbjct  230  TIGPD  234



>gb|KCW46509.1| hypothetical protein EUGRSUZ_K00333 [Eucalyptus grandis]
Length=344

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 152/230 (66%), Gaps = 21/230 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  VGVDGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  111  DYTNPYLPVAPSAIDGSGQLSVGVDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  170

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  171  PVQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  230

Query  474  YSDKSRDYTVPESGLQ--QPSAL---PNTAPAWQNPQYVSVHSAAPPATMPMQNP----W  322
             +D+SRDYT+P + +   QPS L   P +A      QY  V  A  P    M +P    W
Sbjct  231  NNDRSRDYTIPNTPMMNPQPSILGQQPASAVGAAPQQYGGVQYAQTPTQPTMHHPPPAGW  290

Query  321  DPT-------MQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPP  193
             P        MQG  P       T P Q    P +  GA  P   G+P P
Sbjct  291  GPVPPAQSMPMQGHNPPPYMQQGTVPFQ--MGPGMMHGAGHP---GLPHP  335


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ +  TA+ AK+AL+G CI         G C L +
Sbjct  33   VFSAFGFVHKITTFEKTAGFQALVQFSNAETASSAKNALDGRCIPSYLLPEHMGPCTLRI  92

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS HTDL+VK  S +SRDYT P
Sbjct  93   TYSAHTDLSVKFQSHRSRDYTNP  115



>ref|XP_010035223.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X2 [Eucalyptus grandis]
Length=343

 Score =   227 bits (578),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 152/230 (66%), Gaps = 21/230 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  VGVDGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  110  DYTNPYLPVAPSAIDGSGQLSVGVDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  169

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  170  PVQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  229

Query  474  YSDKSRDYTVPESGLQ--QPSAL---PNTAPAWQNPQYVSVHSAAPPATMPMQNP----W  322
             +D+SRDYT+P + +   QPS L   P +A      QY  V  A  P    M +P    W
Sbjct  230  NNDRSRDYTIPNTPMMNPQPSILGQQPASAVGAAPQQYGGVQYAQTPTQPTMHHPPPAGW  289

Query  321  DPT-------MQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPP  193
             P        MQG  P       T P Q    P +  GA  P   G+P P
Sbjct  290  GPVPPAQSMPMQGHNPPPYMQQGTVPFQ--MGPGMMHGAGHP---GLPHP  334


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ +  TA+ AK+AL+G CI         G C L +
Sbjct  32   VFSAFGFVHKITTFEKTAGFQALVQFSNAETASSAKNALDGRCIPSYLLPEHMGPCTLRI  91

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS HTDL+VK  S +SRDYT P
Sbjct  92   TYSAHTDLSVKFQSHRSRDYTNP  114



>ref|XP_010257901.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X6 [Nelumbo nucifera]
Length=370

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPVNP+A+EG +Q  VG DGKKKE ESNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  251  DYTNPYLPVNPSAIEGTMQSTVGPDGKKKELESNVLLASIENMQYAVTVDVLHTVFSAFG  310

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVK  478
            TVQKIAIFEKNGG QA IQYPDVTTA VAK+ALEGHCIYDGGYCKLHLSYSRHTDLNVK
Sbjct  311  TVQKIAIFEKNGGMQALIQYPDVTTAAVAKEALEGHCIYDGGYCKLHLSYSRHTDLNVK  369


 Score = 86.3 bits (212),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 54/84 (64%), Gaps = 6/84 (7%)
 Frame = -2

Query  675  TVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLH  514
            TVFSAFG V KIA FEK  G QA IQ+ D  TA+ A++AL+G  I         G C L 
Sbjct  172  TVFSAFGFVHKIATFEKAAGFQALIQFSDAETASSARNALDGRSIPRYLLPEHVGSCHLR  231

Query  513  LSYSRHTDLNVKAYSDKSRDYTVP  442
            +S+S HTDLN+K  S +SRDYT P
Sbjct  232  ISFSAHTDLNIKFQSHRSRDYTNP  255



>ref|XP_010035224.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X3 [Eucalyptus grandis]
Length=333

 Score =   226 bits (576),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 152/230 (66%), Gaps = 21/230 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  VGVDGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  100  DYTNPYLPVAPSAIDGSGQLSVGVDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  159

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  160  PVQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  219

Query  474  YSDKSRDYTVPESGLQ--QPSAL---PNTAPAWQNPQYVSVHSAAPPATMPMQNP----W  322
             +D+SRDYT+P + +   QPS L   P +A      QY  V  A  P    M +P    W
Sbjct  220  NNDRSRDYTIPNTPMMNPQPSILGQQPASAVGAAPQQYGGVQYAQTPTQPTMHHPPPAGW  279

Query  321  DPT-------MQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPP  193
             P        MQG  P       T P Q    P +  GA  P   G+P P
Sbjct  280  GPVPPAQSMPMQGHNPPPYMQQGTVPFQ--MGPGMMHGAGHP---GLPHP  324



>ref|XP_010671513.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X3 [Beta vulgaris subsp. vulgaris]
Length=350

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VGVDGKK EPESNVLLASIENMQYAVT+DVL TVFSAFG
Sbjct  111  DYTNPYLPVAPSAIDATGQISVGVDGKKLEPESNVLLASIENMQYAVTLDVLQTVFSAFG  170

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  171  VVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  230

Query  474  YSDKSRDYTVPESGLQQPSAL  412
             +D+SRDYT+P   + QPS++
Sbjct  231  NNDRSRDYTIPIHAVIQPSSI  251


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA IQ+ D  TA+ AK+AL+G  I         G C L +
Sbjct  33   VFSAFGFVHKITTFEKTAGFQALIQFSDTETASSAKNALDGRSIPRYLLPDHVGPCTLRI  92

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS HTDL+VK  S +SRDYT P
Sbjct  93   TYSAHTDLSVKFQSHRSRDYTNP  115



>ref|XP_010521382.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010521383.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X1 [Tarenaya hassleriana]
Length=419

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 133/171 (78%), Gaps = 9/171 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  +GVDG+K EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAIDSTGQVTMGVDGRKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  271  LVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGL----QQPSALPNTAPAWQNPQYVSVHSAAPPATMPM  334
             +D+SRDYT+P   +    QQP   P++ P     Q+VS     P  +MPM
Sbjct  331  NNDRSRDYTIPNPAVPIPAQQPGMHPSSHPYSSGAQWVS-----PGQSMPM  376


 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ DV TAT AK+A
Sbjct  111  NVLLVTIEGQDARIVSIDVLHLVFSAFGFVHKITTFEKTAGYQALVQFSDVETATSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I           C L ++YS HTDL VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVEPCSLKITYSAHTDLTVKFQSHRSRDYTNP  215



>ref|XP_010671512.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=351

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VGVDGKK EPESNVLLASIENMQYAVT+DVL TVFSAFG
Sbjct  112  DYTNPYLPVAPSAIDATGQISVGVDGKKLEPESNVLLASIENMQYAVTLDVLQTVFSAFG  171

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  172  VVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  231

Query  474  YSDKSRDYTVPESGLQQPSAL  412
             +D+SRDYT+P   + QPS++
Sbjct  232  NNDRSRDYTIPIHAVIQPSSI  252


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA IQ+ D  TA+ AK+AL+G  I         G C L +
Sbjct  34   VFSAFGFVHKITTFEKTAGFQALIQFSDTETASSAKNALDGRSIPRYLLPDHVGPCTLRI  93

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS HTDL+VK  S +SRDYT P
Sbjct  94   TYSAHTDLSVKFQSHRSRDYTNP  116



>ref|XP_010035222.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X1 [Eucalyptus grandis]
Length=444

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 152/230 (66%), Gaps = 21/230 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  VGVDGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAIDGSGQLSVGVDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGLQ--QPSAL---PNTAPAWQNPQYVSVHSAAPPATMPMQNP----W  322
             +D+SRDYT+P + +   QPS L   P +A      QY  V  A  P    M +P    W
Sbjct  331  NNDRSRDYTIPNTPMMNPQPSILGQQPASAVGAAPQQYGGVQYAQTPTQPTMHHPPPAGW  390

Query  321  DPT-------MQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPP  193
             P        MQG  P       T P Q    P +  GA  P   G+P P
Sbjct  391  GPVPPAQSMPMQGHNPPPYMQQGTVPFQ--MGPGMMHGAGHP---GLPHP  435


 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 67/105 (64%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ +  TA+ AK+A
Sbjct  111  NVLLVTIEGSDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSNAETASSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G CI         G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRCIPSYLLPEHMGPCTLRITYSAHTDLSVKFQSHRSRDYTNP  215



>ref|XP_006581629.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X7 [Glycine max]
 ref|XP_006581630.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X8 [Glycine max]
Length=318

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 146/211 (69%), Gaps = 16/211 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A+EG  Q +VG+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  97   DYTNPYLPVAPSAVEGSGQAMVGLDGKRLETESNVLLASIENMQYAVTLDVLHMVFSAFG  156

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPD  TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  157  PVQKIAMFDKNGGLQALIQYPDTQTAVVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  216

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSA------APPA---TMPMQ-  331
             +D+SRDYT+P + +   QPS     + +   P     + +      APPA   +MPMQ 
Sbjct  217  NNDRSRDYTIPNTPIVNAQPSIFGQQSVSMMGPSQQPFYGSQAGWGTAPPAAVQSMPMQM  276

Query  330  --NPWDPTMQGGRPAFISSPTTFPGQEYASP  244
              N + P   G  P  ++    FP    A P
Sbjct  277  HNNVYMPP--GTMPQQMAPGMQFPSHNTAQP  305


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G  I         G C L +
Sbjct  19   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPRYLLPEHVGPCTLRI  78

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS H+DL+VK  S +SRDYT P
Sbjct  79   TYSGHSDLSVKFQSHRSRDYTNP  101



>ref|XP_006581626.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X4 [Glycine max]
 ref|XP_006581627.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X5 [Glycine max]
Length=332

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 146/211 (69%), Gaps = 16/211 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A+EG  Q +VG+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  111  DYTNPYLPVAPSAVEGSGQAMVGLDGKRLETESNVLLASIENMQYAVTLDVLHMVFSAFG  170

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPD  TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  171  PVQKIAMFDKNGGLQALIQYPDTQTAVVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  230

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSA------APPA---TMPMQ-  331
             +D+SRDYT+P + +   QPS     + +   P     + +      APPA   +MPMQ 
Sbjct  231  NNDRSRDYTIPNTPIVNAQPSIFGQQSVSMMGPSQQPFYGSQAGWGTAPPAAVQSMPMQM  290

Query  330  --NPWDPTMQGGRPAFISSPTTFPGQEYASP  244
              N + P   G  P  ++    FP    A P
Sbjct  291  HNNVYMPP--GTMPQQMAPGMQFPSHNTAQP  319


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G  I         G C L +
Sbjct  33   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPRYLLPEHVGPCTLRI  92

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS H+DL+VK  S +SRDYT P
Sbjct  93   TYSGHSDLSVKFQSHRSRDYTNP  115



>ref|XP_006581628.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X6 [Glycine max]
Length=331

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 146/211 (69%), Gaps = 16/211 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A+EG  Q +VG+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  110  DYTNPYLPVAPSAVEGSGQAMVGLDGKRLETESNVLLASIENMQYAVTLDVLHMVFSAFG  169

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPD  TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  170  PVQKIAMFDKNGGLQALIQYPDTQTAVVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  229

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSA------APPA---TMPMQ-  331
             +D+SRDYT+P + +   QPS     + +   P     + +      APPA   +MPMQ 
Sbjct  230  NNDRSRDYTIPNTPIVNAQPSIFGQQSVSMMGPSQQPFYGSQAGWGTAPPAAVQSMPMQM  289

Query  330  --NPWDPTMQGGRPAFISSPTTFPGQEYASP  244
              N + P   G  P  ++    FP    A P
Sbjct  290  HNNVYMPP--GTMPQQMAPGMQFPSHNTAQP  318


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G  I         G C L +
Sbjct  32   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPRYLLPEHVGPCTLRI  91

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS H+DL+VK  S +SRDYT P
Sbjct  92   TYSGHSDLSVKFQSHRSRDYTNP  114



>gb|ABK24339.1| unknown [Picea sitchensis]
Length=491

 Score =   228 bits (581),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 128/157 (82%), Gaps = 6/157 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPVNP+A++G  Q  VG DGK++E ESNVLLASIENMQYAVTVDVL+TVFSAFG
Sbjct  211  DYTNPNLPVNPSAIDGAGQFTVGPDGKRRELESNVLLASIENMQYAVTVDVLNTVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIAIFEKNGG QA IQYPD+ TA +AK+ALEGHCIYDGGYCKLHLSYSRHTDLNVK 
Sbjct  271  RVQKIAIFEKNGGFQALIQYPDIATAVLAKEALEGHCIYDGGYCKLHLSYSRHTDLNVKG  330

Query  474  YSDKSRDYTVPESGL--QQPSAL----PNTAPAWQNP  382
             +D+SRDYT+P SG+   QP +L    P     WQ P
Sbjct  331  NNDRSRDYTIPASGMLPAQPPSLAGAAPAAVGGWQGP  367


 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 66/106 (62%), Gaps = 7/106 (7%)
 Frame = -2

Query  738  SNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKD  562
            SNVLL +IE +    V++DVLH VFSAFG V KIA FEK  G QA +Q+ D  TA  A+ 
Sbjct  110  SNVLLVTIEGVDSGDVSIDVLHLVFSAFGFVHKIATFEKTAGFQALVQFSDADTAASARS  169

Query  561  ALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            AL+G  I           C L +S+S HTDLNVK  S +SRDYT P
Sbjct  170  ALDGRSIPRYLLPEHVASCHLRISFSAHTDLNVKFQSHRSRDYTNP  215



>ref|XP_010671511.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=450

 Score =   226 bits (577),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VGVDGKK EPESNVLLASIENMQYAVT+DVL TVFSAFG
Sbjct  211  DYTNPYLPVAPSAIDATGQISVGVDGKKLEPESNVLLASIENMQYAVTLDVLQTVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  271  VVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGLQQPSAL  412
             +D+SRDYT+P   + QPS++
Sbjct  331  NNDRSRDYTIPIHAVIQPSSI  351


 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 67/105 (64%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIE-NMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE N    V+++VLH VFSAFG V KI  FEK  G QA IQ+ D  TA+ AK+A
Sbjct  111  NVLLVTIEGNEARQVSIEVLHLVFSAFGFVHKITTFEKTAGFQALIQFSDTETASSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPDHVGPCTLRITYSAHTDLSVKFQSHRSRDYTNP  215



>gb|KDO56120.1| hypothetical protein CISIN_1g013150mg [Citrus sinensis]
Length=264

 Score =   221 bits (562),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 131/174 (75%), Gaps = 5/174 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  27   DYTNPYLPVAPSAIDASGQLSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  86

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  87   PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  146

Query  474  YSDKSRDYTVPESGL--QQPSAL---PNTAPAWQNPQYVSVHSAAPPATMPMQN  328
             +D+SRDYT+P + +   QPS L   P         QY     A PP   PM +
Sbjct  147  NNDRSRDYTLPSTPMVNSQPSILGQQPVPMVGATANQYNGAQFAPPPPEQPMMH  200



>ref|XP_004308003.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 [Fragaria 
vesca subsp. vesca]
Length=443

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 145/210 (69%), Gaps = 14/210 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  VG+DGKK+EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAIDGNGQISVGLDGKKQEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHVSYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQN---PQYVSVHSAAPPATMPMQNP---WD  319
             +D+SRDYT+P   +   QPS L        N   PQY      AP     M  P   W 
Sbjct  331  NNDRSRDYTLPTVPMVNSQPSILGQQPVHMMNPAAPQYSGGAQFAPTGQAMMPQPSAGWV  390

Query  318  PTMQGGRPAFISSPTTFPGQEYASPLVPFG  229
            PT+    PA  S P   P Q    P +P G
Sbjct  391  PTV----PAVPSQP--MPMQMPNQPYMPSG  414


 Score = 95.9 bits (237),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D   AT AK++
Sbjct  111  NVLLVTIEGEDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAQIATDAKNS  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I       + G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRNIPSYLLPDNLGPCSLRITYSGHTDLSVKFQSHRSRDYTNP  215



>ref|XP_003526695.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X1 [Glycine max]
 ref|XP_006581625.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X3 [Glycine max]
 gb|KHN23393.1| Polypyrimidine tract-binding protein like 2 [Glycine soja]
Length=432

 Score =   224 bits (571),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 146/211 (69%), Gaps = 16/211 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A+EG  Q +VG+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAVEGSGQAMVGLDGKRLETESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPD  TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGGLQALIQYPDTQTAVVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSA------APPA---TMPMQ-  331
             +D+SRDYT+P + +   QPS     + +   P     + +      APPA   +MPMQ 
Sbjct  331  NNDRSRDYTIPNTPIVNAQPSIFGQQSVSMMGPSQQPFYGSQAGWGTAPPAAVQSMPMQM  390

Query  330  --NPWDPTMQGGRPAFISSPTTFPGQEYASP  244
              N + P   G  P  ++    FP    A P
Sbjct  391  HNNVYMPP--GTMPQQMAPGMQFPSHNTAQP  419


 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDA
Sbjct  111  NVLLVTIEGADARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS H+DL+VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVGPCTLRITYSGHSDLSVKFQSHRSRDYTNP  215



>ref|XP_006578932.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X6 [Glycine max]
 ref|XP_006578933.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X7 [Glycine max]
Length=319

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 148/212 (70%), Gaps = 17/212 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A+EG  Q +VG+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  97   DYTNPYLPVAPSAVEGSGQAMVGLDGKRLEAESNVLLASIENMQYAVTLDVLHMVFSAFG  156

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQ+PD  TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  157  PVQKIAMFDKNGGLQALIQFPDTQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  216

Query  474  YSDKSRDYTVPESGL--QQPSAL-PNTAPAWQNPQ--YVSVHSA---APPAT----MPMQ  331
             +D+SRDYT+P +     QPS L   + P    PQ  Y    +    APPAT    MPMQ
Sbjct  217  NNDRSRDYTIPNTPAVNVQPSILGQQSVPMMGPPQQPYNGSQAGWGTAPPATTVQSMPMQ  276

Query  330  ---NPWDPTMQGGRPAFISSPTTFPGQEYASP  244
               N + P+  G  P  ++    FP    A P
Sbjct  277  MHNNVYMPS--GTMPQQMAPGMQFPSYNTAQP  306


 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G  I         G C L +
Sbjct  19   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPRYLLPEHMGPCTLRI  78

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS H+DL+VK  S +SRDYT P
Sbjct  79   TYSGHSDLSVKFQSHRSRDYTNP  101



>ref|XP_010485537.1| PREDICTED: polypyrimidine tract-binding protein homolog 1-like 
isoform X1 [Camelina sativa]
Length=178

 Score =   216 bits (550),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 118/143 (83%), Gaps = 4/143 (3%)
 Frame = -2

Query  795  MEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGG  616
            M+G +QP +G DGKK E +SNVLL  IENMQYAVTVDVLHTVFSA+G VQKIAIFEKNG 
Sbjct  1    MDGSMQPALGADGKKVESQSNVLLGLIENMQYAVTVDVLHTVFSAYGAVQKIAIFEKNGS  60

Query  615  TQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPES  436
            TQA IQY D+ TA +AK ALEGHCIYDGGYCKL LSYSRHTDLNVKA+SDKSRDYT+P+ 
Sbjct  61   TQALIQYSDIATAAIAKGALEGHCIYDGGYCKLRLSYSRHTDLNVKAFSDKSRDYTLPDL  120

Query  435  GL---QQPSALPNTAPA-WQNPQ  379
             L   Q+ + +  +APA WQNPQ
Sbjct  121  SLMVAQKAAGVSASAPAGWQNPQ  143



>ref|XP_006578930.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X4 [Glycine max]
Length=333

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 148/212 (70%), Gaps = 17/212 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A+EG  Q +VG+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  111  DYTNPYLPVAPSAVEGSGQAMVGLDGKRLEAESNVLLASIENMQYAVTLDVLHMVFSAFG  170

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQ+PD  TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  171  PVQKIAMFDKNGGLQALIQFPDTQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  230

Query  474  YSDKSRDYTVPESGL--QQPSAL-PNTAPAWQNPQ--YVSVHSA---APPAT----MPMQ  331
             +D+SRDYT+P +     QPS L   + P    PQ  Y    +    APPAT    MPMQ
Sbjct  231  NNDRSRDYTIPNTPAVNVQPSILGQQSVPMMGPPQQPYNGSQAGWGTAPPATTVQSMPMQ  290

Query  330  ---NPWDPTMQGGRPAFISSPTTFPGQEYASP  244
               N + P+  G  P  ++    FP    A P
Sbjct  291  MHNNVYMPS--GTMPQQMAPGMQFPSYNTAQP  320


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G  I         G C L +
Sbjct  33   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPRYLLPEHMGPCTLRI  92

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS H+DL+VK  S +SRDYT P
Sbjct  93   TYSGHSDLSVKFQSHRSRDYTNP  115



>gb|KHG26309.1| hypothetical protein F383_06939 [Gossypium arboreum]
Length=452

 Score =   224 bits (572),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 123/226 (54%), Positives = 144/226 (64%), Gaps = 46/226 (20%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  +G+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAIDGSGQFSLGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA +AK  LEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGGLQALIQYPDVQTAVLAKGTLEGHCIYDGGFCKLHLSYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPE---------------------------------SGLQQPSALPNTAPA  394
             +D+SRDYT+P                                  SGLQQP+ LP  +  
Sbjct  331  NNDRSRDYTIPNPAMVNPQPSTLGQQPVQAMGGPAAHQYNGAPYASGLQQPTMLPQPSGG  390

Query  393  WQN----------PQYVSVHS-AAPPATMPMQNPWDPTM--QGGRP  295
            W +          P  +S H    PP++MP  NP    M  QGG P
Sbjct  391  WTSTVPAVAQQSMPVQMSNHYPYIPPSSMPQTNPGMMRMPGQGGVP  436


 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AK A
Sbjct  111  NVLLVTIEGQDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKSA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I       +   C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRIIPRYLLSENISPCTLRITYSAHTDLSVKFQSHRSRDYTNP  215



>gb|KDO56119.1| hypothetical protein CISIN_1g013150mg [Citrus sinensis]
Length=331

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 131/174 (75%), Gaps = 5/174 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  94   DYTNPYLPVAPSAIDASGQLSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  153

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  154  PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  213

Query  474  YSDKSRDYTVPESGL--QQPSAL---PNTAPAWQNPQYVSVHSAAPPATMPMQN  328
             +D+SRDYT+P + +   QPS L   P         QY     A PP   PM +
Sbjct  214  NNDRSRDYTLPSTPMVNSQPSILGQQPVPMVGATANQYNGAQFAPPPPEQPMMH  267


 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 56/91 (62%), Gaps = 6/91 (7%)
 Frame = -2

Query  696  VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YD  535
            + V  +  VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+AL+G  I       +
Sbjct  8    LKVIFILQVFSAFGFVHKITTFEKTAGFQALVQFSDTETASSAKNALDGRSIPRYLLPEN  67

Query  534  GGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
             G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  68   MGPCTLRITYSAHTDLSVKFQSHRSRDYTNP  98



>ref|XP_006578929.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X3 [Glycine max]
Length=363

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 148/212 (70%), Gaps = 17/212 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A+EG  Q +VG+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  141  DYTNPYLPVAPSAVEGSGQAMVGLDGKRLEAESNVLLASIENMQYAVTLDVLHMVFSAFG  200

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQ+PD  TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  201  PVQKIAMFDKNGGLQALIQFPDTQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  260

Query  474  YSDKSRDYTVPESGL--QQPSAL-PNTAPAWQNPQ--YVSVHSA---APPAT----MPMQ  331
             +D+SRDYT+P +     QPS L   + P    PQ  Y    +    APPAT    MPMQ
Sbjct  261  NNDRSRDYTIPNTPAVNVQPSILGQQSVPMMGPPQQPYNGSQAGWGTAPPATTVQSMPMQ  320

Query  330  ---NPWDPTMQGGRPAFISSPTTFPGQEYASP  244
               N + P+  G  P  ++    FP    A P
Sbjct  321  MHNNVYMPS--GTMPQQMAPGMQFPSYNTAQP  350


 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDA
Sbjct  41   NVLLVTIEGADARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDA  100

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS H+DL+VK  S +SRDYT P
Sbjct  101  LDGRSIPRYLLPEHMGPCTLRITYSGHSDLSVKFQSHRSRDYTNP  145



>ref|XP_006578931.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X5 [Glycine max]
Length=332

 Score =   221 bits (563),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 148/212 (70%), Gaps = 17/212 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A+EG  Q +VG+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  110  DYTNPYLPVAPSAVEGSGQAMVGLDGKRLEAESNVLLASIENMQYAVTLDVLHMVFSAFG  169

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQ+PD  TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  170  PVQKIAMFDKNGGLQALIQFPDTQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  229

Query  474  YSDKSRDYTVPESGL--QQPSAL-PNTAPAWQNPQ--YVSVHSA---APPAT----MPMQ  331
             +D+SRDYT+P +     QPS L   + P    PQ  Y    +    APPAT    MPMQ
Sbjct  230  NNDRSRDYTIPNTPAVNVQPSILGQQSVPMMGPPQQPYNGSQAGWGTAPPATTVQSMPMQ  289

Query  330  ---NPWDPTMQGGRPAFISSPTTFPGQEYASP  244
               N + P+  G  P  ++    FP    A P
Sbjct  290  MHNNVYMPS--GTMPQQMAPGMQFPSYNTAQP  319


 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G  I         G C L +
Sbjct  32   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPRYLLPEHMGPCTLRI  91

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS H+DL+VK  S +SRDYT P
Sbjct  92   TYSGHSDLSVKFQSHRSRDYTNP  114



>gb|ADE77057.1| unknown [Picea sitchensis]
Length=528

 Score =   226 bits (575),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 129/168 (77%), Gaps = 12/168 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  +G DGK++EPESNVLLASIENMQYAVT+DVL +VF+AFG
Sbjct  211  DYTNPYLPVAPSAIDGTGQFGIGPDGKRREPESNVLLASIENMQYAVTLDVLRSVFTAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIAIFEKN G QA IQYPDV TA  AK+ALEGHCIYDGG+CKLHLSYSRHTDLNVK 
Sbjct  271  TVQKIAIFEKNAGFQALIQYPDVATAVTAKEALEGHCIYDGGFCKLHLSYSRHTDLNVKV  330

Query  474  YSDKSRDYTVPESGL---------QQPSALPNTAPA---WQNPQYVSV  367
             +D+SRDYT P  GL         QQPSA   T  A    Q PQ  S+
Sbjct  331  NNDRSRDYTSPNPGLLPNQLSILGQQPSAFQTTVSAVGGMQVPQSSSL  378


 Score =   105 bits (262),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 70/106 (66%), Gaps = 7/106 (7%)
 Frame = -2

Query  738  SNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKD  562
            SNVLL +IE ++   V++DVLH VFSAFG V KIA FEK+ G QA +Q+ D  TAT AK+
Sbjct  110  SNVLLVTIEGVEAGDVSIDVLHLVFSAFGFVHKIATFEKSAGFQALVQFSDPNTATSAKN  169

Query  561  ALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            AL+G  I         G C L +++S H DLNVK  S +SRDYT P
Sbjct  170  ALDGRSIPRYLLPEHVGLCSLRITFSAHNDLNVKFQSHRSRDYTNP  215



>ref|XP_006490561.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X4 [Citrus sinensis]
 gb|KDO56118.1| hypothetical protein CISIN_1g013150mg [Citrus sinensis]
Length=341

 Score =   221 bits (562),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 134/182 (74%), Gaps = 7/182 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  104  DYTNPYLPVAPSAIDASGQLSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  163

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  164  PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  223

Query  474  YSDKSRDYTVPESGL--QQPSAL---PNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPTM  310
             +D+SRDYT+P + +   QPS L   P         QY     A PP   PM +   PT 
Sbjct  224  NNDRSRDYTLPSTPMVNSQPSILGQQPVPMVGATANQYNGAQFAPPPPEQPMMH--QPTA  281

Query  309  QG  304
             G
Sbjct  282  AG  283


 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+AL+G  I       + G C L +
Sbjct  26   VFSAFGFVHKITTFEKTAGFQALVQFSDTETASSAKNALDGRSIPRYLLPENMGPCTLRI  85

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS HTDL+VK  S +SRDYT P
Sbjct  86   TYSAHTDLSVKFQSHRSRDYTNP  108



>ref|XP_006490562.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X5 [Citrus sinensis]
 gb|KDO56117.1| hypothetical protein CISIN_1g013150mg [Citrus sinensis]
Length=340

 Score =   220 bits (561),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 134/182 (74%), Gaps = 7/182 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  103  DYTNPYLPVAPSAIDASGQLSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  162

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  163  PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  222

Query  474  YSDKSRDYTVPESGL--QQPSAL---PNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPTM  310
             +D+SRDYT+P + +   QPS L   P         QY     A PP   PM +   PT 
Sbjct  223  NNDRSRDYTLPSTPMVNSQPSILGQQPVPMVGATANQYNGAQFAPPPPEQPMMH--QPTA  280

Query  309  QG  304
             G
Sbjct  281  AG  282


 Score = 83.2 bits (204),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+AL+G  I       + G C L +
Sbjct  25   VFSAFGFVHKITTFEKTAGFQALVQFSDTETASSAKNALDGRSIPRYLLPENMGPCTLRI  84

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS HTDL+VK  S +SRDYT P
Sbjct  85   TYSAHTDLSVKFQSHRSRDYTNP  107



>ref|XP_007218008.1| hypothetical protein PRUPE_ppa005791mg [Prunus persica]
 gb|EMJ19207.1| hypothetical protein PRUPE_ppa005791mg [Prunus persica]
Length=443

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/209 (59%), Positives = 145/209 (69%), Gaps = 14/209 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAIDGSGQISVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKI  330

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSA--APPATMPMQNP---WDP  316
             +D+SRDYT+P   +   QPS L        +P     + A  AP     M  P   W P
Sbjct  331  NNDRSRDYTIPNIPIVNSQPSILGQQPVQMMSPAVPQFNGAQFAPTDQAVMPQPSAGWGP  390

Query  315  TMQGGRPAFISSPTTFPGQEYASPLVPFG  229
            T+    PA    P + P Q +  P +P G
Sbjct  391  TV----PAV---PQSVPLQMHNQPYMPPG  412


 Score = 95.5 bits (236),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIE-NMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE +    V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AK A
Sbjct  111  NVLLVTIEGDDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKTA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+   I         G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDSRSIPRYLLPDHVGPCTLRITYSGHTDLSVKFQSHRSRDYTNP  215



>ref|XP_006581624.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X2 [Glycine max]
Length=463

 Score =   224 bits (570),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 145/209 (69%), Gaps = 12/209 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A+EG  Q +VG+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  242  DYTNPYLPVAPSAVEGSGQAMVGLDGKRLETESNVLLASIENMQYAVTLDVLHMVFSAFG  301

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPD  TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  302  PVQKIAMFDKNGGLQALIQYPDTQTAVVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  361

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSA------APPA---TMPMQN  328
             +D+SRDYT+P + +   QPS     + +   P     + +      APPA   +MPMQ 
Sbjct  362  NNDRSRDYTIPNTPIVNAQPSIFGQQSVSMMGPSQQPFYGSQAGWGTAPPAAVQSMPMQM  421

Query  327  PWDPTM-QGGRPAFISSPTTFPGQEYASP  244
              +  M  G  P  ++    FP    A P
Sbjct  422  HNNVYMPPGTMPQQMAPGMQFPSHNTAQP  450


 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDA
Sbjct  142  NVLLVTIEGADARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDA  201

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS H+DL+VK  S +SRDYT P
Sbjct  202  LDGRSIPRYLLPEHVGPCTLRITYSGHSDLSVKFQSHRSRDYTNP  246



>ref|XP_007038965.1| Polypyrimidine tract-binding protein isoform 2 [Theobroma cacao]
 gb|EOY23466.1| Polypyrimidine tract-binding protein isoform 2 [Theobroma cacao]
Length=442

 Score =   223 bits (568),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 152/236 (64%), Gaps = 35/236 (15%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  +G+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAIDGSGQFSLGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGH IYDGG+CKLH+SYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHSIYDGGFCKLHISYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGLQ--QPSALPNT---------APAWQNPQYVSVHSAAPPATMPMQN  328
             +D+SRDYT+P   +   QPS L            A  +   QY      APP   P   
Sbjct  331  NNDRSRDYTIPNPAMVNPQPSILGQQPVQTVGAPGAHQYNGTQY------APPHLQPSAG  384

Query  327  PWDPTMQGGRPAFISSPTTFPGQEYASP---------LVPFGANQ-PAHQGIPPPG  190
             W      G PA    P + PGQ  + P         + P G  Q PAH G+PP G
Sbjct  385  -W----ASGVPAV---PQSAPGQMTSYPYMPPASMPQMTPAGMMQMPAHSGVPPAG  432


 Score = 99.8 bits (247),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AK+A
Sbjct  111  NVLLVTIEGQDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I       +   C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRIIPRYLLSENIAPCTLRITYSAHTDLSVKFQSHRSRDYTNP  215



>ref|XP_006595613.1| PREDICTED: uncharacterized protein LOC100810102 isoform X1 [Glycine 
max]
 gb|KHN17832.1| Polypyrimidine tract-binding protein like 2 [Glycine soja]
Length=428

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 145/215 (67%), Gaps = 19/215 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV  +AMEG  QP+VG+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAQSAMEGSGQPMVGLDGKRLEAESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPD+ TA VAK+ALEGHCIYDGG+CKLH+SYSRH+DL++K 
Sbjct  271  PVQKIAMFDKNGGLQALIQYPDIQTAVVAKEALEGHCIYDGGFCKLHISYSRHSDLSIKV  330

Query  474  YSDKSRDYTVPE----SGLQQPSAL-----PNTAP---AWQNPQYVSV-------HSAAP  352
             +D+SRDYT+P         QPS L     P T P    +   QY SV        S A 
Sbjct  331  NNDRSRDYTIPNVPPPVVNAQPSILGQHPVPMTGPPPQQYNGAQYASVTEQTLMPQSQAG  390

Query  351  PATMPMQNPWDPTMQGGRPAFISSPTTFPGQEYAS  247
              T P Q+          P+ +  P T PG ++ S
Sbjct  391  WGTAPSQSMLQMHNNPYTPSAMVPPQTAPGMQFPS  425


 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDA
Sbjct  111  NVLLVTIEGEDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS H+DL+VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHMGPCSLKITYSGHSDLSVKFQSHRSRDYTNP  215



>ref|NP_001242348.1| uncharacterized protein LOC100810102 [Glycine max]
 gb|ACU23122.1| unknown [Glycine max]
Length=428

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/215 (57%), Positives = 145/215 (67%), Gaps = 19/215 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV  +AMEG  QP+VG+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAQSAMEGSGQPMVGLDGKRLEAESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPD+ TA VAK+ALEGHCIYDGG+CKLH+SYSRH+DL++K 
Sbjct  271  PVQKIAMFDKNGGLQALIQYPDIQTAVVAKEALEGHCIYDGGFCKLHISYSRHSDLSIKV  330

Query  474  YSDKSRDYTVPE----SGLQQPSAL-----PNTAP---AWQNPQYVSV-------HSAAP  352
             +D+SRDYT+P         QPS L     P T P    +   QY SV        S A 
Sbjct  331  NNDRSRDYTIPNVPPPVVNAQPSILGQHPVPMTGPPPQQYNGAQYASVTEQTLMPQSQAG  390

Query  351  PATMPMQNPWDPTMQGGRPAFISSPTTFPGQEYAS  247
              T P Q+          P+ +  P T PG ++ S
Sbjct  391  WGTAPSQSMLQMHNNPYTPSAMVPPQTAPGMQFPS  425


 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDA
Sbjct  111  NVLLVTIEGEDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS H+DL+VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHMGPCSLKITYSGHSDLSVKFQSHRSRDYTNP  215



>gb|KJB23809.1| hypothetical protein B456_004G115700 [Gossypium raimondii]
 gb|KJB23815.1| hypothetical protein B456_004G115700 [Gossypium raimondii]
Length=452

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 141/226 (62%), Gaps = 46/226 (20%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  +G+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAIDGSGQFNLGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA +AKD LEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGGLQALIQYPDVQTAVLAKDTLEGHCIYDGGFCKLHLSYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPES---------------------------------GLQQPSALPNTAPA  394
             +D+SRDYT+P                                   GLQQP+  P  +  
Sbjct  331  NNDRSRDYTIPNLAMVNPQPSTLGQQPVQAMGGPAAHQYNGTPYAPGLQQPTMPPQPSGG  390

Query  393  WQNP-----------QYVSVHSAAPPATMPMQNPWDPTM--QGGRP  295
            W +            Q  + H   PP +MP  NP    M  QGG P
Sbjct  391  WTSSVPAMAQQSMPVQMSNHHPYIPPTSMPQTNPGMMRMPGQGGVP  436


 Score = 98.6 bits (244),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AK A
Sbjct  111  NVLLVTIEGQDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKGA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I       +   C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRIIPRYLLSENISPCTLRITYSAHTDLSVKFQSHRSRDYTNP  215



>ref|XP_007038964.1| Polypyrimidine tract-binding protein isoform 1 [Theobroma cacao]
 gb|EOY23465.1| Polypyrimidine tract-binding protein isoform 1 [Theobroma cacao]
Length=463

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 130/236 (55%), Positives = 152/236 (64%), Gaps = 35/236 (15%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  +G+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  232  DYTNPYLPVAPSAIDGSGQFSLGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  291

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGH IYDGG+CKLH+SYSRHTDL++K 
Sbjct  292  PVQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHSIYDGGFCKLHISYSRHTDLSIKV  351

Query  474  YSDKSRDYTVPESGLQ--QPSALPNT---------APAWQNPQYVSVHSAAPPATMPMQN  328
             +D+SRDYT+P   +   QPS L            A  +   QY      APP   P   
Sbjct  352  NNDRSRDYTIPNPAMVNPQPSILGQQPVQTVGAPGAHQYNGTQY------APPHLQPSAG  405

Query  327  PWDPTMQGGRPAFISSPTTFPGQEYASP---------LVPFGANQ-PAHQGIPPPG  190
             W      G PA    P + PGQ  + P         + P G  Q PAH G+PP G
Sbjct  406  -W----ASGVPAV---PQSAPGQMTSYPYMPPASMPQMTPAGMMQMPAHSGVPPAG  453


 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 66/126 (52%), Gaps = 28/126 (22%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLH---------------------TVFSAFGTVQKIAIFEKN  622
            NVLL +IE      V++DVLH                      VFSAFG V KI  FEK 
Sbjct  111  NVLLVTIEGQDARLVSIDVLHLDHVKGNISNGSLVHREKEHTCVFSAFGFVHKITTFEKT  170

Query  621  GGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKS  460
             G QA +Q+ D  TAT AK+AL+G  I       +   C L ++YS HTDL+VK  S +S
Sbjct  171  AGFQALVQFSDAETATSAKNALDGRIIPRYLLSENIAPCTLRITYSAHTDLSVKFQSHRS  230

Query  459  RDYTVP  442
            RDYT P
Sbjct  231  RDYTNP  236



>ref|XP_011654625.1| PREDICTED: LOW QUALITY PROTEIN: polypyrimidine tract-binding 
protein homolog 2 [Cucumis sativus]
Length=353

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  VG+DGKK EPESNVLLASIENMQYAVT++VLH VFSAFG
Sbjct  111  DYTNPYLPVAPSAIDGSGQFTVGLDGKKLEPESNVLLASIENMQYAVTLEVLHMVFSAFG  170

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  171  PVQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  230

Query  474  YSDKSRDYTVPES  436
             +D+SRDYT+P +
Sbjct  231  NNDRSRDYTIPNN  243


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+AL+G  I         G C L +
Sbjct  33   VFSAFGFVHKITTFEKTAGFQALVQFSDAETASSAKNALDGRSIPRYLLPDHVGPCSLRI  92

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS HTDL VK  S +SRDYT P
Sbjct  93   TYSAHTDLTVKFQSHRSRDYTNP  115



>gb|KJB23812.1| hypothetical protein B456_004G115700 [Gossypium raimondii]
Length=448

 Score =   223 bits (567),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/226 (54%), Positives = 141/226 (62%), Gaps = 46/226 (20%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  +G+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  207  DYTNPYLPVAPSAIDGSGQFNLGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  266

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA +AKD LEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  267  PVQKIAMFDKNGGLQALIQYPDVQTAVLAKDTLEGHCIYDGGFCKLHLSYSRHTDLSIKV  326

Query  474  YSDKSRDYTVPES---------------------------------GLQQPSALPNTAPA  394
             +D+SRDYT+P                                   GLQQP+  P  +  
Sbjct  327  NNDRSRDYTIPNLAMVNPQPSTLGQQPVQAMGGPAAHQYNGTPYAPGLQQPTMPPQPSGG  386

Query  393  WQNP-----------QYVSVHSAAPPATMPMQNPWDPTM--QGGRP  295
            W +            Q  + H   PP +MP  NP    M  QGG P
Sbjct  387  WTSSVPAMAQQSMPVQMSNHHPYIPPTSMPQTNPGMMRMPGQGGVP  432



>ref|XP_006401736.1| hypothetical protein EUTSA_v10016110mg [Eutrema salsugineum]
 gb|ESQ43189.1| hypothetical protein EUTSA_v10016110mg [Eutrema salsugineum]
Length=310

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 124/155 (80%), Gaps = 6/155 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VGVDGKK EPESNVLLASIENMQYAVT+DVLH VF+AFG
Sbjct  97   DYTNPYLPVAPSAIDSTGQVAVGVDGKKMEPESNVLLASIENMQYAVTLDVLHMVFAAFG  156

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  157  AVQKIAMFDKNGGLQALIQYPDVQTAVVAKGALEGHCIYDGGFCKLHITYSRHTDLSIKV  216

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQ  379
             +D+SRDYT+P   +   QQP   P    A  NPQ
Sbjct  217  NNDRSRDYTMPNPAVAMAQQPGQNPY---AGGNPQ  248


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AK+AL+G  I       +   C L +
Sbjct  19   VFSAFGFVHKITTFEKTAGYQALVQFTDADTATSAKNALDGRSIPRYLLPEEVDQCSLKI  78

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS HTDL VK  S +SRDYT P
Sbjct  79   TYSAHTDLTVKFQSHRSRDYTNP  101



>ref|XP_003523383.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X1 [Glycine max]
 ref|XP_006578928.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X2 [Glycine max]
 gb|KHN44229.1| Polypyrimidine tract-binding protein like 2 [Glycine soja]
Length=433

 Score =   222 bits (565),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 148/212 (70%), Gaps = 17/212 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A+EG  Q +VG+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAVEGSGQAMVGLDGKRLEAESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQ+PD  TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGGLQALIQFPDTQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGL--QQPSAL-PNTAPAWQNPQ--YVSVHSA---APPAT----MPMQ  331
             +D+SRDYT+P +     QPS L   + P    PQ  Y    +    APPAT    MPMQ
Sbjct  331  NNDRSRDYTIPNTPAVNVQPSILGQQSVPMMGPPQQPYNGSQAGWGTAPPATTVQSMPMQ  390

Query  330  ---NPWDPTMQGGRPAFISSPTTFPGQEYASP  244
               N + P+  G  P  ++    FP    A P
Sbjct  391  MHNNVYMPS--GTMPQQMAPGMQFPSYNTAQP  420


 Score =   100 bits (250),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDA
Sbjct  111  NVLLVTIEGADARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS H+DL+VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHMGPCTLRITYSGHSDLSVKFQSHRSRDYTNP  215



>emb|CDY61491.1| BnaCnng37910D [Brassica napus]
Length=354

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q +VGVDGKK EPESNVLLASIENMQYAVT+DVLHTVF+ FG
Sbjct  211  DYTNPYLPVAPSAIDSTGQVIVGVDGKKMEPESNVLLASIENMQYAVTLDVLHTVFATFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA +AK ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  271  AVQKIAMFDKNGGMQALIQYPDVQTAVMAKGALEGHCIYDGGFCKLHITYSRHTDLSIKV  330

Query  474  YSDKSRDYTVP  442
             +D+SRDYT+P
Sbjct  331  NNDRSRDYTLP  341


 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIE-NMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E +    V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AK A
Sbjct  111  NVLLVTVEGDDARMVSIDVLHLVFSAFGFVHKITFFEKTAGYQALVQFSDADTATSAKTA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I       + G C L ++YS HTDL VK  S +SRDYT P
Sbjct  171  LDGRNIPSYLLPEEVGQCSLKITYSAHTDLTVKFQSHRSRDYTNP  215



>ref|XP_006401734.1| hypothetical protein EUTSA_v10016110mg [Eutrema salsugineum]
 gb|ESQ43187.1| hypothetical protein EUTSA_v10016110mg [Eutrema salsugineum]
Length=324

 Score =   218 bits (556),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 124/155 (80%), Gaps = 6/155 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VGVDGKK EPESNVLLASIENMQYAVT+DVLH VF+AFG
Sbjct  111  DYTNPYLPVAPSAIDSTGQVAVGVDGKKMEPESNVLLASIENMQYAVTLDVLHMVFAAFG  170

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  171  AVQKIAMFDKNGGLQALIQYPDVQTAVVAKGALEGHCIYDGGFCKLHITYSRHTDLSIKV  230

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQ  379
             +D+SRDYT+P   +   QQP   P    A  NPQ
Sbjct  231  NNDRSRDYTMPNPAVAMAQQPGQNPY---AGGNPQ  262


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AK+AL+G  I       +   C L +
Sbjct  33   VFSAFGFVHKITTFEKTAGYQALVQFTDADTATSAKNALDGRSIPRYLLPEEVDQCSLKI  92

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS HTDL VK  S +SRDYT P
Sbjct  93   TYSAHTDLTVKFQSHRSRDYTNP  115



>ref|XP_006490558.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X1 [Citrus sinensis]
 ref|XP_006490559.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X2 [Citrus sinensis]
 ref|XP_006490560.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X3 [Citrus sinensis]
 gb|KDO56113.1| hypothetical protein CISIN_1g013150mg [Citrus sinensis]
 gb|KDO56114.1| hypothetical protein CISIN_1g013150mg [Citrus sinensis]
 gb|KDO56115.1| hypothetical protein CISIN_1g013150mg [Citrus sinensis]
 gb|KDO56116.1| hypothetical protein CISIN_1g013150mg [Citrus sinensis]
Length=448

 Score =   221 bits (563),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 134/182 (74%), Gaps = 7/182 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAIDASGQLSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGL--QQPSAL---PNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPTM  310
             +D+SRDYT+P + +   QPS L   P         QY     A PP   PM +   PT 
Sbjct  331  NNDRSRDYTLPSTPMVNSQPSILGQQPVPMVGATANQYNGAQFAPPPPEQPMMH--QPTA  388

Query  309  QG  304
             G
Sbjct  389  AG  390


 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 67/105 (64%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+A
Sbjct  111  NVLLVTIEGTDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDTETASSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I       + G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPENMGPCTLRITYSAHTDLSVKFQSHRSRDYTNP  215



>ref|XP_009132497.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 [Brassica 
rapa]
Length=422

 Score =   221 bits (562),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 123/145 (85%), Gaps = 3/145 (2%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q +VGVDG+K EPESNVLLASIENMQYAVT+DVLHTVF AFG
Sbjct  211  DYTNPYLPVAPSAIDSTGQVIVGVDGRKMEPESNVLLASIENMQYAVTLDVLHTVFVAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK ALEGHCIY+GG+CKLH++YSRHTDL++K 
Sbjct  271  AVQKIAMFDKNGGVQALIQYPDVQTAVVAKGALEGHCIYEGGFCKLHITYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGLQ---QPSALP  409
             +D+SRDYT+P++ +    QPS  P
Sbjct  331  NNDRSRDYTMPDAAVAMAPQPSHNP  355


 Score = 95.1 bits (235),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 64/105 (61%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT A+ +
Sbjct  111  NVLLVTVEGEDARMVSIDVLHLVFSAFGFVHKITTFEKTAGYQALVQFSDAETATSARTS  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I       +   C L ++YS HTDL VK  S +SRDYT P
Sbjct  171  LDGRSIPSYLLPEEVSQCSLKITYSAHTDLTVKFQSHRSRDYTNP  215



>ref|XP_008343787.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
[Malus domestica]
Length=438

 Score =   221 bits (562),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 146/207 (71%), Gaps = 13/207 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++G  Q +VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPTLPVAPSAIDGSGQLIVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             +QKIA+F+KNGG QA IQYPDV TA VAK+ALEGH IYDGG+CKLH+SYSRHTDL++K 
Sbjct  271  PIQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHSIYDGGFCKLHISYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQY--VSVHSAAPPATMPMQNP-WDPTM  310
             +D+SRDYT+P   +   QPS L    P  Q+P     S    A  A MP  +  W PT+
Sbjct  331  NNDRSRDYTIPTIPIVAAQPSIL-GQQPVHQSPAVPPYSXXQYADQAVMPQPSAGWGPTV  389

Query  309  QGGRPAFISSPTTFPGQEYASPLVPFG  229
                PA    P + P Q +  P +P G
Sbjct  390  ----PAV---PQSLPFQMHNQPYMPPG  409


 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 63/105 (60%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++D+ H VFSAFG V KI  FEK  G QA +Q+ D  TAT AK A
Sbjct  111  NVLLVTIEGADARLVSIDIXHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKTA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+   I         G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDSRIIPRYLLPEHVGPCTLRITYSGHTDLSVKFQSHRSRDYTNP  215



>emb|CDY38731.1| BnaC03g15180D [Brassica napus]
Length=465

 Score =   221 bits (564),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 124/145 (86%), Gaps = 3/145 (2%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q +VGVDG+K EPESNVLLASIENMQYAVT+DVLHTVF+AFG
Sbjct  258  DYTNPYLPVAPSAIDSTGQVIVGVDGRKMEPESNVLLASIENMQYAVTLDVLHTVFAAFG  317

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK ALEGHCIY+GG+CKLH++YSRHTDL++K 
Sbjct  318  AVQKIAMFDKNGGVQALIQYPDVQTAVVAKGALEGHCIYEGGFCKLHITYSRHTDLSIKV  377

Query  474  YSDKSRDYTVPESGLQ---QPSALP  409
             +D+SRDYT+P++ +    QPS  P
Sbjct  378  NNDRSRDYTMPDAAVAMAPQPSHNP  402


 Score = 95.5 bits (236),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 64/105 (61%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT A+ +
Sbjct  158  NVLLVTVEGEDARMVSIDVLHLVFSAFGFVHKITTFEKTAGYQALVQFSDAETATSARTS  217

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I       +   C L ++YS HTDL VK  S +SRDYT P
Sbjct  218  LDGRSIPSYLLPEEVSQCSLKITYSAHTDLTVKFQSHRSRDYTNP  262



>gb|ABY59992.1| polypyrimidine tract-binding protein-like protein [Robinia pseudoacacia]
Length=240

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 130/170 (76%), Gaps = 10/170 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV  +A+EG  Q +VG+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  4    DYTNPYLPVAQSAVEGSGQVMVGLDGKRLETESNVLLASIENMQYAVTLDVLHMVFSAFG  63

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPD+ TA VAK+ALEGHCIYDGG+CK H+SYSRHTDL++K 
Sbjct  64   PVQKIAMFDKNGGLQALIQYPDIQTAVVAKEALEGHCIYDGGFCKPHISYSRHTDLSIKV  123

Query  474  YSDKSRDYTVPESGL--QQPS-----ALPNTAPAWQN---PQYVSVHSAA  355
             +D+SRDYT+P + +   QPS     A+P   P  Q     QY  +  AA
Sbjct  124  NNDRSRDYTIPNTPVVNAQPSISGQHAVPMMGPPAQQYNGSQYTPISEAA  173



>gb|KJB52616.1| hypothetical protein B456_008G270300 [Gossypium raimondii]
 gb|KJB52617.1| hypothetical protein B456_008G270300 [Gossypium raimondii]
Length=437

 Score =   220 bits (561),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 121/143 (85%), Gaps = 2/143 (1%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  +G+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAIDGSNQFNLGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNG  QA IQYPDV TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGALQALIQYPDVQTAIVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGLQ--QPSAL  412
             +D+SRDYT+P   +   QPS L
Sbjct  331  NNDRSRDYTIPNPAMVNPQPSVL  353


 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AK+A
Sbjct  111  NVLLVTIEGQDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I       +   C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRIIPRYLLSENISPCTLRITYSAHTDLSVKFQSHRSRDYTNP  215



>ref|XP_008380607.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
[Malus domestica]
Length=438

 Score =   220 bits (560),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 146/207 (71%), Gaps = 13/207 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++G  Q +VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPTLPVAPSAIDGSGQLIVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             +QKIA+F+KNGG QA IQYPDV TA VAK+ALEGH IYDGG+CKLH+SYSRHTDL++K 
Sbjct  271  PIQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHSIYDGGFCKLHISYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQY--VSVHSAAPPATMPMQNP-WDPTM  310
             +D+SRDYT+P   +   QPS L    P  Q+P     S    A  A MP  +  W PT+
Sbjct  331  NNDRSRDYTIPTIPIVAAQPSIL-GQQPVHQSPAVPPYSGXQYADQAVMPQPSAGWGPTV  389

Query  309  QGGRPAFISSPTTFPGQEYASPLVPFG  229
                PA    P + P Q +  P +P G
Sbjct  390  ----PAV---PQSLPFQMHNQPYMPPG  409


 Score = 95.5 bits (236),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 64/105 (61%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++D+LH VFSAFG V KI  FEK  G QA +Q+ D  TAT AK A
Sbjct  111  NVLLVTIEGADARLVSIDILHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKTA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+   I         G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDSRIIPRYLLPEHVGPCTLRITYSGHTDLSVKFQSHRSRDYTNP  215



>ref|XP_010537119.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X3 [Tarenaya hassleriana]
Length=343

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 4/145 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VGVDGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  110  DYTNPYLPVAPSAIDSTGQVSVGVDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  169

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KN G QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  170  PVQKIAMFDKNSGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  229

Query  474  YSDKSRDYTVPESGL----QQPSAL  412
             +D+SRDYT+P   +    QQP  +
Sbjct  230  NNDRSRDYTIPNPAMPMVSQQPGVM  254


 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AK+AL+G  I         G C L +
Sbjct  32   VFSAFGFVHKITTFEKTAGYQALVQFSDAETATSAKNALDGRSIPRYLLPEHMGPCTLKI  91

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS HTDL VK  S +SRDYT P
Sbjct  92   TYSAHTDLTVKFQSHRSRDYTNP  114



>ref|XP_010537118.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X2 [Tarenaya hassleriana]
Length=344

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 4/145 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VGVDGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  111  DYTNPYLPVAPSAIDSTGQVSVGVDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  170

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KN G QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  171  PVQKIAMFDKNSGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  230

Query  474  YSDKSRDYTVPESGL----QQPSAL  412
             +D+SRDYT+P   +    QQP  +
Sbjct  231  NNDRSRDYTIPNPAMPMVSQQPGVM  255


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AK+AL+G  I         G C L +
Sbjct  33   VFSAFGFVHKITTFEKTAGYQALVQFSDAETATSAKNALDGRSIPRYLLPEHMGPCTLKI  92

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS HTDL VK  S +SRDYT P
Sbjct  93   TYSAHTDLTVKFQSHRSRDYTNP  115



>emb|CDY64347.1| BnaA03g12420D [Brassica napus]
Length=468

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 123/145 (85%), Gaps = 3/145 (2%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q +VGVDG+K EPESNVLLASIENMQYAVT+DVLHTVF AFG
Sbjct  256  DYTNPYLPVAPSAIDSTGQVIVGVDGRKMEPESNVLLASIENMQYAVTLDVLHTVFVAFG  315

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK ALEGHCIY+GG+CKLH++YSRHTDL++K 
Sbjct  316  AVQKIAMFDKNGGVQALIQYPDVQTAVVAKGALEGHCIYEGGFCKLHITYSRHTDLSIKV  375

Query  474  YSDKSRDYTVPESGLQ---QPSALP  409
             +D+SRDYT+P++ +    QPS  P
Sbjct  376  NNDRSRDYTMPDAAVAMAPQPSHNP  400


 Score = 95.1 bits (235),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 64/105 (61%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT A+ +
Sbjct  156  NVLLVTVEGEDARMVSIDVLHLVFSAFGFVHKITTFEKTAGYQALVQFSDAETATSARTS  215

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I       +   C L ++YS HTDL VK  S +SRDYT P
Sbjct  216  LDGRSIPSYLLPEEVSQCSLKITYSAHTDLTVKFQSHRSRDYTNP  260



>ref|XP_007136549.1| hypothetical protein PHAVU_009G0542001g, partial [Phaseolus vulgaris]
 gb|ESW08543.1| hypothetical protein PHAVU_009G0542001g, partial [Phaseolus vulgaris]
Length=693

 Score =   225 bits (573),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A+EG  Q +VG+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAVEGSGQAMVGLDGKRLETESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPD  TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGGLQALIQYPDTQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGLQQPSAL  412
             +D+SRDYT+P +   QPS L
Sbjct  331  NNDRSRDYTIPNAPNAQPSIL  351


 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDA
Sbjct  111  NVLLVTIEGADARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS H+DL+VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHMGPCTLRITYSGHSDLSVKFQSHRSRDYTNP  215



>gb|KGN49879.1| hypothetical protein Csa_5G139570 [Cucumis sativus]
Length=453

 Score =   220 bits (560),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  VG+DGKK EPESNVLLASIENMQYAVT++VLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAIDGSGQFTVGLDGKKLEPESNVLLASIENMQYAVTLEVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPES  436
             +D+SRDYT+P +
Sbjct  331  NNDRSRDYTIPNN  343


 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+A
Sbjct  111  NVLLVTIEGTDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETASSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS HTDL VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPDHVGPCSLRITYSAHTDLTVKFQSHRSRDYTNP  215



>ref|XP_011084492.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X2 [Sesamum indicum]
Length=328

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++   Q  +GVDGKK EPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  96   DYTNPLLPVAPSAIDASGQFSLGVDGKKLEPESNVLLASIENMQYAVTLDVLHTVFSAFG  155

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGGYCKLH+SYSRHTDL++K 
Sbjct  156  PVLKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGYCKLHISYSRHTDLSIKV  215

Query  474  YSDKSRDYTVPES  436
             +D+SRDYT+P +
Sbjct  216  NNDRSRDYTIPNT  228


 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEG-----HCIYDGGYCKLHLS  508
            VFSAFG V KI  FEK  G QA +Q+ D  TA+ AKDAL+G     + I + G C L ++
Sbjct  19   VFSAFGFVHKITTFEKTAGFQALVQFSDSETASAAKDALDGRSIPRYLIPELGPCSLRIT  78

Query  507  YSRHTDLNVKAYSDKSRDYTVP  442
            YS HTDL+VK  S +SRDYT P
Sbjct  79   YSAHTDLSVKFQSHRSRDYTNP  100



>ref|XP_006401735.1| hypothetical protein EUTSA_v10016110mg [Eutrema salsugineum]
 gb|ESQ43188.1| hypothetical protein EUTSA_v10016110mg [Eutrema salsugineum]
Length=424

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 124/155 (80%), Gaps = 6/155 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VGVDGKK EPESNVLLASIENMQYAVT+DVLH VF+AFG
Sbjct  211  DYTNPYLPVAPSAIDSTGQVAVGVDGKKMEPESNVLLASIENMQYAVTLDVLHMVFAAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  271  AVQKIAMFDKNGGLQALIQYPDVQTAVVAKGALEGHCIYDGGFCKLHITYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQ  379
             +D+SRDYT+P   +   QQP   P    A  NPQ
Sbjct  331  NNDRSRDYTMPNPAVAMAQQPGQNPY---AGGNPQ  362


 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AK+A
Sbjct  111  NVLLVTVEGEDARMVSIDVLHLVFSAFGFVHKITTFEKTAGYQALVQFTDADTATSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I       +   C L ++YS HTDL VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEEVDQCSLKITYSAHTDLTVKFQSHRSRDYTNP  215



>ref|XP_010442874.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X2 [Camelina sativa]
Length=335

 Score =   216 bits (549),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 146/222 (66%), Gaps = 16/222 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTN YLPV P+A++   Q +VGVDGKK EPESNVLLASIENMQYAVT+DVLH VF+AFG
Sbjct  120  DYTNMYLPVAPSAIDSTGQVIVGVDGKKMEPESNVLLASIENMQYAVTLDVLHMVFAAFG  179

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQY DV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  180  EVQKIAMFDKNGGLQALIQYQDVQTAMVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  239

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYV-----SVHSAAPPATMPMQNPWD  319
             +D+SRDYT+P   +   QQP   PN      NPQ       S H    P          
Sbjct  240  NNDRSRDYTMPNPPVPMPQQPGQNPNAG----NPQQYHAAGGSHHQQQQPPPQGGWGQGS  295

Query  318  PTMQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPP  193
              M GG   +++ P++ P   +  P  P G   P H G P P
Sbjct  296  MGMDGGHNPYMAPPSSGP--MHQGP--PGGHMPPQHYGGPGP  333



>ref|XP_010097853.1| Polypyrimidine tract-binding protein-2-like protein [Morus notabilis]
 gb|EXB72450.1| Polypyrimidine tract-binding protein-2-like protein [Morus notabilis]
Length=444

 Score =   219 bits (557),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 128/160 (80%), Gaps = 10/160 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q VVG+DGKK EPESNVLLASIENMQYAVT+DVL+ VFS+FG
Sbjct  211  DYTNPYLPVAPSAIDGSGQFVVGLDGKKLEPESNVLLASIENMQYAVTLDVLYMVFSSFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGL--QQPSAL-----PNTAPAWQNPQY  376
             +D+SRDYT+    +   QPS L     P  A    NPQY
Sbjct  331  NNDRSRDYTLSNVPMVNAQPSILGQQPVPMMA---SNPQY  367


 Score =   100 bits (250),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AK+A
Sbjct  111  NVLLVTIEGEDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVGSCTLRITYSGHTDLSVKFQSHRSRDYTNP  215



>ref|XP_012090109.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X2 [Jatropha curcas]
 ref|XP_012090110.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X2 [Jatropha curcas]
Length=379

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 122/234 (52%), Positives = 145/234 (62%), Gaps = 25/234 (11%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++G     VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  141  DYTNPNLPVAPSAIDGSGLFSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  200

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRH DL++K 
Sbjct  201  PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHNDLSIKV  260

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPTMQ----  307
             +D+SRDYT P       +A+ N  P+    Q   VHS  PP        + P  +    
Sbjct  261  NNDRSRDYTAPS------TAMLNPQPSILGQQPPPVHSVGPPPHPYTGGQFAPHTEHPAM  314

Query  306  -----GGRPAFISSPTTFPGQEYASPLVPFGA----------NQPAHQGIPPPG  190
                 G     ++ P + P Q    P +P G             P H GIP  G
Sbjct  315  PQPSAGWGAGVLAGPHSMPAQMNNHPYLPPGTMPPQMGPGMMQMPGHSGIPHSG  368


 Score = 96.7 bits (239),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIEN-MQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK A
Sbjct  41   NVLLVTIEGPDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDTETASSAKTA  100

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  101  LDGRNIPRYLLSEHIGPCTLRITYSAHTDLSVKFQSHRSRDYTNP  145



>ref|XP_004498399.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
[Cicer arietinum]
Length=432

 Score =   218 bits (556),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV  +AMEG  Q V+G+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAQSAMEGNGQSVMGLDGKRLEAESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             +QKIA+F+KNGG QA IQYPD+ TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  271  PIQKIAMFDKNGGLQALIQYPDIQTAIVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  330

Query  474  YSDKSRDYTV  445
             +D+SRDYT+
Sbjct  331  NNDRSRDYTI  340


 Score = 99.8 bits (247),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDA
Sbjct  111  NVLLVTIEGADARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS H+DL+VK  S +SRDYT P
Sbjct  171  LDGRSIPSYLLAGHVGPCTLKITYSGHSDLSVKFQSHRSRDYTNP  215



>ref|XP_010442875.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X3 [Camelina sativa]
Length=327

 Score =   215 bits (548),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 146/222 (66%), Gaps = 16/222 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTN YLPV P+A++   Q +VGVDGKK EPESNVLLASIENMQYAVT+DVLH VF+AFG
Sbjct  112  DYTNMYLPVAPSAIDSTGQVIVGVDGKKMEPESNVLLASIENMQYAVTLDVLHMVFAAFG  171

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQY DV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  172  EVQKIAMFDKNGGLQALIQYQDVQTAMVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  231

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYV-----SVHSAAPPATMPMQNPWD  319
             +D+SRDYT+P   +   QQP   PN      NPQ       S H    P          
Sbjct  232  NNDRSRDYTMPNPPVPMPQQPGQNPNAG----NPQQYHAAGGSHHQQQQPPPQGGWGQGS  287

Query  318  PTMQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPP  193
              M GG   +++ P++ P  +   P  P G   P H G P P
Sbjct  288  MGMDGGHNPYMAPPSSGPMHQ--GP--PGGHMPPQHYGGPGP  325


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = -2

Query  675  TVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLH  514
             VFSAFG V KI  FEK  G QA +Q+ D  TAT +K+AL+G  I         G C L 
Sbjct  33   CVFSAFGFVHKITTFEKTAGYQALVQFSDAETATSSKNALDGRSIPRYLLPEQVGQCSLK  92

Query  513  LSYSRHTDLNVKAYSDKSRDYT  448
            ++YS HTDL VK  S +SRDYT
Sbjct  93   ITYSAHTDLTVKFQSHRSRDYT  114



>ref|XP_011076026.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X2 [Sesamum indicum]
Length=343

 Score =   216 bits (549),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 137/193 (71%), Gaps = 25/193 (13%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++   Q  +GVDGKK EPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  111  DYTNPLLPVAPSAIDASGQFNLGVDGKKLEPESNVLLASIENMQYAVTLDVLHTVFSAFG  170

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGGYCKLH+SYSRHTDL++K 
Sbjct  171  PVLKIAMFDKNGGLQALIQYPDVPTAVVAKEALEGHCIYDGGYCKLHISYSRHTDLSIKV  230

Query  474  YSDKSRDYTVPE--SGLQQPSAL-----PNTAP---AWQNPQYVSV-------------H  364
             +D+SRDYT+P   +   QPS L     P   P   A+   QY  V             +
Sbjct  231  NNDRSRDYTIPSIPAMSAQPSILGQQPYPMGGPGAHAYNGTQYAPVPDPRGVPPPSAGWN  290

Query  363  SAAP--PATMPMQ  331
            SA P  P +MPMQ
Sbjct  291  SAVPSIPQSMPMQ  303


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEG-----HCIYDGGYCKLHLS  508
            VFSAFG V KI  FEK  G QA +Q+ D  TA+ AKDAL+G     + I + G C L ++
Sbjct  34   VFSAFGFVHKITTFEKTAGFQALVQFSDSETASAAKDALDGRSIPSYLIPELGPCSLRIT  93

Query  507  YSRHTDLNVKAYSDKSRDYTVP  442
            YS HTDL+VK  S +SRDYT P
Sbjct  94   YSAHTDLSVKFQSHRSRDYTNP  115



>gb|KEH40410.1| polypyrimidine tract-binding-like protein [Medicago truncatula]
Length=430

 Score =   218 bits (555),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV  +AMEG  Q V+G+DGK+ E ESNVLLASIENMQYAVT+DVLH VFS+FG
Sbjct  211  DYTNPYLPVAQSAMEGSGQSVMGLDGKRLEAESNVLLASIENMQYAVTLDVLHMVFSSFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             +QKIA+F+KNGG QA +QYPDV TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  271  PIQKIAMFDKNGGLQALVQYPDVQTAIVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  330

Query  474  YSDKSRDYTVP  442
             +D+SRDYT+P
Sbjct  331  NNDRSRDYTMP  341


 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDA
Sbjct  111  NVLLVTIEGEDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDQETATSAKDA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS H+DL+VK  S +SRDYT P
Sbjct  171  LDGRSIPSYLLAGHVGPCTLKITYSGHSDLSVKFQSHRSRDYTNP  215



>ref|XP_011076027.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X3 [Sesamum indicum]
Length=342

 Score =   215 bits (548),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 137/193 (71%), Gaps = 25/193 (13%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++   Q  +GVDGKK EPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  110  DYTNPLLPVAPSAIDASGQFNLGVDGKKLEPESNVLLASIENMQYAVTLDVLHTVFSAFG  169

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGGYCKLH+SYSRHTDL++K 
Sbjct  170  PVLKIAMFDKNGGLQALIQYPDVPTAVVAKEALEGHCIYDGGYCKLHISYSRHTDLSIKV  229

Query  474  YSDKSRDYTVPE--SGLQQPSAL-----PNTAP---AWQNPQYVSV-------------H  364
             +D+SRDYT+P   +   QPS L     P   P   A+   QY  V             +
Sbjct  230  NNDRSRDYTIPSIPAMSAQPSILGQQPYPMGGPGAHAYNGTQYAPVPDPRGVPPPSAGWN  289

Query  363  SAAP--PATMPMQ  331
            SA P  P +MPMQ
Sbjct  290  SAVPSIPQSMPMQ  302


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEG-----HCIYDGGYCKLHLS  508
            VFSAFG V KI  FEK  G QA +Q+ D  TA+ AKDAL+G     + I + G C L ++
Sbjct  33   VFSAFGFVHKITTFEKTAGFQALVQFSDSETASAAKDALDGRSIPSYLIPELGPCSLRIT  92

Query  507  YSRHTDLNVKAYSDKSRDYTVP  442
            YS HTDL+VK  S +SRDYT P
Sbjct  93   YSAHTDLSVKFQSHRSRDYTNP  114



>ref|XP_001782305.1| predicted protein [Physcomitrella patens]
 gb|EDQ52895.1| predicted protein, partial [Physcomitrella patens]
Length=348

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  VG DGK++EPESNVLL SIENMQYAVT+DV+HTVFSAFG
Sbjct  211  DYTNPYLPVAPSAIDGSGQFSVGPDGKRREPESNVLLVSIENMQYAVTIDVIHTVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIAIFEK+ G QA +QYPD+ TA  AK+ALEGHCIYDGG+CKLHLSYSRHTDLNVK 
Sbjct  271  FVQKIAIFEKSAGFQALVQYPDIPTAVGAKEALEGHCIYDGGFCKLHLSYSRHTDLNVKV  330

Query  474  YSDKSRDYTVP  442
             +D+SRDYT P
Sbjct  331  NNDRSRDYTNP  341


 Score =   104 bits (260),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 69/106 (65%), Gaps = 7/106 (7%)
 Frame = -2

Query  738  SNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKD  562
            SNVLL +IE ++   V++DVLH VFSAFG V KIA FEK+ G QA +Q+ D  TA+ AK 
Sbjct  110  SNVLLVTIEGVEAGDVSIDVLHLVFSAFGFVHKIATFEKSAGFQALVQFSDANTASAAKS  169

Query  561  ALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            ALEG  I         G C L +S+S H DLNVK  S +SRDYT P
Sbjct  170  ALEGRSIPRYLLPDHVGPCHLRISFSAHNDLNVKFQSHRSRDYTNP  215



>gb|KEH35445.1| polypyrimidine tract-binding-like protein [Medicago truncatula]
Length=374

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV  +A+EG  Q ++G+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  81   DYTNPYLPVAQSAIEGGGQVMIGLDGKRLEAESNVLLASIENMQYAVTLDVLHMVFSAFG  140

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             +QKIA+F+KNGG QA IQYPD  TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  141  PIQKIAMFDKNGGLQALIQYPDTQTAVVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  200

Query  474  YSDKSRDYTVP  442
             +D+SRDYT+P
Sbjct  201  NNDRSRDYTIP  211


 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 51/83 (61%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G  I         G C L +
Sbjct  3    VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPRYLLSEHVGPCTLKI  62

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS H+DL VK  S +SRDYT P
Sbjct  63   TYSGHSDLTVKFQSHRSRDYTNP  85



>ref|XP_003541515.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
[Glycine max]
 gb|KHN16450.1| Polypyrimidine tract-binding protein like 2 [Glycine soja]
Length=428

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV  +AMEG  QP+VG+DGK+ E ESNVLLASIENMQY VT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAQSAMEGSGQPMVGLDGKRLEAESNVLLASIENMQYTVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPD+ TA VAK+ LEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGGLQALIQYPDIQTAVVAKETLEGHCIYDGGFCKLHISYSRHTDLSIKV  330

Query  474  YSDKSRDYTVP  442
             +++SRDYT+P
Sbjct  331  NNERSRDYTIP  341


 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDA
Sbjct  111  NVLLVTIEGEDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS H+DL+VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHIGPCGLKITYSGHSDLSVKFQSHRSRDYTNP  215



>ref|XP_002865956.1| hypothetical protein ARALYDRAFT_495390 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42215.1| hypothetical protein ARALYDRAFT_495390 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 107/155 (69%), Positives = 125/155 (81%), Gaps = 7/155 (5%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLP+ P+A++   Q  VGVDGKK EPESNVLLASIENMQYAVT+DVLH VF+AFG
Sbjct  211  DYTNPYLPIAPSAIDSTGQVAVGVDGKKMEPESNVLLASIENMQYAVTLDVLHMVFAAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQY DV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  271  DVQKIAMFDKNGGLQALIQYKDVQTAVVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQ  379
             +D+SRDYT+P   +   QQPS  P T     NPQ
Sbjct  331  NNDRSRDYTMPNPPVPMPQQPSQNPYTG----NPQ  361


 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AK+A
Sbjct  111  NVLLVTVEGEDARMVSIDVLHLVFSAFGFVHKITTFEKTAGYQALVQFSDEETATSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS HTDL VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLAEQVGQCSLKITYSAHTDLTVKFQSHRSRDYTNP  215



>ref|XP_002976368.1| hypothetical protein SELMODRAFT_104811 [Selaginella moellendorffii]
 ref|XP_002987211.1| hypothetical protein SELMODRAFT_125500 [Selaginella moellendorffii]
 gb|EFJ11787.1| hypothetical protein SELMODRAFT_125500 [Selaginella moellendorffii]
 gb|EFJ22628.1| hypothetical protein SELMODRAFT_104811 [Selaginella moellendorffii]
Length=440

 Score =   218 bits (554),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 129/176 (73%), Gaps = 17/176 (10%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQP-VVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAF  658
            DYTNPYLPV P+A+ G  Q    G DGK+KEPESNVLLASIENMQY+VT+DVLHTVF+AF
Sbjct  211  DYTNPYLPVAPSAINGISQEYTTGPDGKRKEPESNVLLASIENMQYSVTIDVLHTVFAAF  270

Query  657  GTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVK  478
            G +QKIAIFEKN G QA IQY DVTTA  AK+ALEGHCIY+GGYCKLHLSYSRHTDLNVK
Sbjct  271  GPIQKIAIFEKNAGFQALIQYADVTTAVAAKEALEGHCIYEGGYCKLHLSYSRHTDLNVK  330

Query  477  AYSDKSRDYTVPESGLQQPSAL---PNTAP---------AWQNPQYVSVHSAAPPA  346
              +D+SRDYT  +S    PS L   P T+P         AW + Q V    A  PA
Sbjct  331  VNNDRSRDYTSSQS----PSVLGKAPATSPGGAEYTAYAAWDHTQGVPEMQAMMPA  382


 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 69/106 (65%), Gaps = 7/106 (7%)
 Frame = -2

Query  738  SNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKD  562
            SNVLL +IE ++   V++DVLH VFSAFG V KIA FEK  G QA +Q+ D  TA+ A+ 
Sbjct  110  SNVLLVTIEGVEAGDVSIDVLHLVFSAFGFVHKIATFEKTAGFQALVQFSDANTASAARQ  169

Query  561  ALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            AL+G  I         G C L +S+S HTDLNVK  S +SRDYT P
Sbjct  170  ALDGRSIPRYLLPEHVGSCHLRISFSAHTDLNVKFQSHRSRDYTNP  215



>ref|XP_010537117.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X1 [Tarenaya hassleriana]
Length=444

 Score =   218 bits (554),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 4/145 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VGVDGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAIDSTGQVSVGVDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KN G QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  271  PVQKIAMFDKNSGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGL----QQPSAL  412
             +D+SRDYT+P   +    QQP  +
Sbjct  331  NNDRSRDYTIPNPAMPMVSQQPGVM  355


 Score = 99.4 bits (246),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AK+A
Sbjct  111  NVLLVTVEGQDARMVSIDVLHLVFSAFGFVHKITTFEKTAGYQALVQFSDAETATSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS HTDL VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHMGPCTLKITYSAHTDLTVKFQSHRSRDYTNP  215



>ref|XP_003618519.1| Polypyrimidine tract-binding protein-like protein [Medicago truncatula]
Length=483

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 126/249 (51%), Positives = 153/249 (61%), Gaps = 48/249 (19%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGF-------------------------VQPVVGVDGKKKEPESNV  730
            DYTNP LPVN  A++                           VQP +G DGK+KE +SNV
Sbjct  211  DYTNPMLPVNQAAIDSALQVYCSYFLPLYMFCIFLNVLTTLDVQPAIGPDGKRKEHKSNV  270

Query  729  LLASIENMQYAVTVDVLHTV---------FSAFGTVQKIAIFEKNGGTQAFIQYPDVTTA  577
            LLA+IENMQYAV +DVLH+V         FSAFG VQK+A+F+KNG T A IQYPD+T A
Sbjct  271  LLATIENMQYAVPLDVLHSVRILFLIKRVFSAFGFVQKVAMFDKNGHTHALIQYPDLTIA  330

Query  576  TVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPESGLQQPSALPNTAP  397
              AK+ LEGHCIYDGGYCKLHL+YSRHTDLNVKA+SDKSRDYTV +     PS     AP
Sbjct  331  AAAKETLEGHCIYDGGYCKLHLTYSRHTDLNVKAFSDKSRDYTVLD-----PSLHAAQAP  385

Query  396  AWQNPQYVSVHSAAPPATMPMQNPWDPTMQGGRPAFISSPTTFPGQEYASPLVPFGANQP  217
            AWQ  Q  +++S     +M     WDP  Q    +++S+P TFP  + A+P  PF    P
Sbjct  386  AWQTTQAATMYS----GSMGQMPSWDPNQQEVTQSYLSAPGTFPSGQ-AAP--PFPGYSP  438

Query  216  AHQGIPPPG  190
            A   +PP G
Sbjct  439  A--AVPPAG  445


 Score =   104 bits (259),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 68/105 (65%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE ++   V++DV+H VFSAFG V K+A FEK  G QA IQY D  TA  AKD+
Sbjct  111  NVLLVTIEGVEAGDVSIDVIHLVFSAFGFVHKLATFEKTAGFQALIQYTDAETAASAKDS  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +SYS H DLN+K  S++SRDYT P
Sbjct  171  LDGRSIPRYLLPEHVGACNLRISYSAHRDLNIKFQSNRSRDYTNP  215



>ref|NP_001078750.1| polypyrimidine tract-binding protein 2 [Arabidopsis thaliana]
 dbj|BAF00751.1| polypyrimidine tract-binding RNA transport protein-like [Arabidopsis 
thaliana]
 gb|AED96319.1| polypyrimidine tract-binding protein 2 [Arabidopsis thaliana]
Length=329

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VGVDGKK EPESNVLLASIENMQYAVT+DVLH VF+AFG
Sbjct  111  DYTNPYLPVAPSAIDSTGQVAVGVDGKKMEPESNVLLASIENMQYAVTLDVLHMVFAAFG  170

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQY DV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  171  EVQKIAMFDKNGGVQALIQYSDVQTAVVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  230

Query  474  YSDKSRDYT  448
             +D+SRDYT
Sbjct  231  NNDRSRDYT  239


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 50/83 (60%), Gaps = 6/83 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AK AL+G  I         G C L +
Sbjct  33   VFSAFGFVHKITTFEKTAGYQALVQFTDAETATAAKLALDGRSIPRYLLAETVGQCSLKI  92

Query  510  SYSRHTDLNVKAYSDKSRDYTVP  442
            +YS HTDL VK  S +SRDYT P
Sbjct  93   TYSAHTDLTVKFQSHRSRDYTNP  115



>ref|XP_010445605.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X2 [Camelina sativa]
Length=330

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTN YLPV P+A++   Q +VGVDGKK EPESNVLLASIENMQYAVT+DVLH VF+AFG
Sbjct  112  DYTNMYLPVAPSAIDSTGQVIVGVDGKKMEPESNVLLASIENMQYAVTLDVLHMVFAAFG  171

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQY DV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  172  EVQKIAMFDKNGGLQALIQYQDVQTAMVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  231

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQ  379
             +D+SRDYT+P   +  P   P+  P   NPQ
Sbjct  232  NNDRSRDYTMPNPPVPMPQQ-PSQNPYAGNPQ  262


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = -2

Query  675  TVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLH  514
             VFSAFG V KI  FEK  G QA +Q+ D  TAT +K+AL+G  I         G C L 
Sbjct  33   CVFSAFGFVHKITTFEKTAGYQALVQFSDAETATSSKNALDGRSIPRYLLPEQVGQCSLK  92

Query  513  LSYSRHTDLNVKAYSDKSRDYT  448
            ++YS HTDL VK  S +SRDYT
Sbjct  93   ITYSAHTDLTVKFQSHRSRDYT  114



>ref|XP_008437579.1| PREDICTED: LOW QUALITY PROTEIN: polypyrimidine tract-binding 
protein homolog 2 [Cucumis melo]
Length=750

 Score =   223 bits (569),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/200 (60%), Positives = 142/200 (71%), Gaps = 30/200 (15%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  VG+DGKK EPESNVLLASIENMQYAVT++VLH VFSAFG
Sbjct  516  DYTNPYLPVAPSAIDGSGQFTVGLDGKKLEPESNVLLASIENMQYAVTLEVLHMVFSAFG  575

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  576  PVQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  635

Query  474  YSDKSRDYTVPES-----------GLQQPSAL--PNT--------------APAWQNPQ-  379
             +D+SRDYT+P +           G QQP  +  P+T               P  Q PQ 
Sbjct  636  NNDRSRDYTIPNNPPMVNSQPPVVGQQQPHQMMGPSTHQYNGNQYGPSGEQQPGVQPPQS  695

Query  378  --YVSVHSAAPPATMPMQNP  325
              + S   AAP ++MPM NP
Sbjct  696  SGWGSGGPAAPYSSMPMHNP  715


 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+A
Sbjct  416  NVLLVTIEGTDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETASSAKNA  475

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS HTDL VK  S +SRDYT P
Sbjct  476  LDGRSIPRYLLPDHVGPCSLRITYSAHTDLTVKFQSHRSRDYTNP  520



>ref|XP_010482705.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X2 [Camelina sativa]
Length=329

 Score =   214 bits (544),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTN YLPV P+A++   Q +VGVDGKK EPESNVLLASIENMQYAVT+DVLH VF+AFG
Sbjct  112  DYTNMYLPVAPSAIDSTGQVIVGVDGKKMEPESNVLLASIENMQYAVTLDVLHMVFAAFG  171

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQY DV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  172  EVQKIAMFDKNGGLQALIQYQDVQTAMVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  231

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQ  379
             +D+SRDYT+P   +  P   P   P   NPQ
Sbjct  232  NNDRSRDYTMPNPPVPMPQQ-PGQNPYAGNPQ  262


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/82 (51%), Positives = 50/82 (61%), Gaps = 6/82 (7%)
 Frame = -2

Query  675  TVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLH  514
             VFSAFG V KI  FEK  G QA +Q+ D  TAT +K+AL+G  I         G C L 
Sbjct  33   CVFSAFGFVHKITTFEKTAGYQALVQFSDAETATSSKNALDGRSIPRYLLPEQVGQCSLK  92

Query  513  LSYSRHTDLNVKAYSDKSRDYT  448
            ++YS HTDL VK  S +SRDYT
Sbjct  93   ITYSAHTDLTVKFQSHRSRDYT  114



>ref|XP_012090107.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X1 [Jatropha curcas]
 ref|XP_012090108.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X1 [Jatropha curcas]
 gb|KDP22166.1| hypothetical protein JCGZ_25997 [Jatropha curcas]
Length=449

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 146/234 (62%), Gaps = 25/234 (11%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++G     VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPNLPVAPSAIDGSGLFSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRH DL++K 
Sbjct  271  PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHNDLSIKV  330

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPP--------ATMPMQNPWD  319
             +D+SRDYT P + +  P       P+    Q   VHS  PP             ++P  
Sbjct  331  NNDRSRDYTAPSTAMLNPQ------PSILGQQPPPVHSVGPPPHPYTGGQFAPHTEHPAM  384

Query  318  PTMQGGRPA-FISSPTTFPGQEYASPLVPFGA----------NQPAHQGIPPPG  190
            P    G  A  ++ P + P Q    P +P G             P H GIP  G
Sbjct  385  PQPSAGWGAGVLAGPHSMPAQMNNHPYLPPGTMPPQMGPGMMQMPGHSGIPHSG  438


 Score = 96.7 bits (239),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIEN-MQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK A
Sbjct  111  NVLLVTIEGPDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDTETASSAKTA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRNIPRYLLSEHIGPCTLRITYSAHTDLSVKFQSHRSRDYTNP  215



>ref|XP_011001850.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X4 [Populus euphratica]
Length=334

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 145/228 (64%), Gaps = 20/228 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTN  LPV P+A++      VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFS+FG
Sbjct  97   DYTNANLPVAPSAIDANGMFSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSSFG  156

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLHLSYSRH+DL++K 
Sbjct  157  PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHLSYSRHSDLSIKV  216

Query  474  YSDKSRDYTVPESGLQ--QPSALPNTAPAWQNP---QYVSVHSAAPPATMPMQ-NPWDPT  313
             +D+SRDYT+P + +   QPS L     A   P    Y   H A      PM   P    
Sbjct  217  NNDRSRDYTIPNTVMMNPQPSILGQQPVATHGPPAHTYTGAHFAPTTEHHPMMPQPSIGW  276

Query  312  MQGGRPAFISSPTTFPGQEYASPLVPFGA----------NQPAHQGIP  199
              GG P     P + P Q   +P +P G             P+H G+P
Sbjct  277  ATGGPPV----PHSMPAQMNNNPYLPPGTMPPQMGHGMMQMPSHGGLP  320


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 51/81 (63%), Gaps = 6/81 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+AL+G  I         G C L +
Sbjct  19   VFSAFGFVHKITTFEKTAGFQALVQFSDAETASSAKNALDGRNIPSYLLPEHLGPCTLRI  78

Query  510  SYSRHTDLNVKAYSDKSRDYT  448
            +YS HTDL+VK  S +SRDYT
Sbjct  79   TYSAHTDLSVKFQSHRSRDYT  99



>ref|XP_010442873.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X1 [Camelina sativa]
Length=426

 Score =   216 bits (550),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 122/222 (55%), Positives = 146/222 (66%), Gaps = 16/222 (7%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTN YLPV P+A++   Q +VGVDGKK EPESNVLLASIENMQYAVT+DVLH VF+AFG
Sbjct  211  DYTNMYLPVAPSAIDSTGQVIVGVDGKKMEPESNVLLASIENMQYAVTLDVLHMVFAAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQY DV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  271  EVQKIAMFDKNGGLQALIQYQDVQTAMVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGL---QQPSALPNTAPAWQNPQYV-----SVHSAAPPATMPMQNPWD  319
             +D+SRDYT+P   +   QQP   PN      NPQ       S H    P          
Sbjct  331  NNDRSRDYTMPNPPVPMPQQPGQNPNAG----NPQQYHAAGGSHHQQQQPPPQGGWGQGS  386

Query  318  PTMQGGRPAFISSPTTFPGQEYASPLVPFGANQPAHQGIPPP  193
              M GG   +++ P++ P  +   P  P G   P H G P P
Sbjct  387  MGMDGGHNPYMAPPSSGPMHQ--GP--PGGHMPPQHYGGPGP  424


 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 7/103 (7%)
 Frame = -2

Query  735  NVLLASIE-NMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE +    V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT +K+A
Sbjct  111  NVLLVTIEGDDARMVSIDVLHVVFSAFGFVHKITTFEKTAGYQALVQFSDAETATSSKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYT  448
            L+G  I         G C L ++YS HTDL VK  S +SRDYT
Sbjct  171  LDGRSIPRYLLPEQVGQCSLKITYSAHTDLTVKFQSHRSRDYT  213



>ref|XP_011084489.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X1 [Sesamum indicum]
 ref|XP_011084490.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X1 [Sesamum indicum]
Length=442

 Score =   216 bits (551),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++   Q  +GVDGKK EPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  210  DYTNPLLPVAPSAIDASGQFSLGVDGKKLEPESNVLLASIENMQYAVTLDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGGYCKLH+SYSRHTDL++K 
Sbjct  270  PVLKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGYCKLHISYSRHTDLSIKV  329

Query  474  YSDKSRDYTVPES  436
             +D+SRDYT+P +
Sbjct  330  NNDRSRDYTIPNT  342


 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 69/104 (66%), Gaps = 6/104 (6%)
 Frame = -2

Query  735  NVLLASIE-NMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE N    V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA+ AKDA
Sbjct  111  NVLLVTIEGNDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDSETASAAKDA  170

Query  558  LEG-----HCIYDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G     + I + G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLIPELGPCSLRITYSAHTDLSVKFQSHRSRDYTNP  214



>ref|XP_002513582.1| polypyrimidine tract binding protein, putative [Ricinus communis]
 gb|EEF48985.1| polypyrimidine tract binding protein, putative [Ricinus communis]
Length=447

 Score =   216 bits (550),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++G     VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPNLPVAPSAIDGSGMFTVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRH+DL++K 
Sbjct  271  PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHSDLSIKV  330

Query  474  YSDKSRDYTVPESGLQQP  421
             +D+SRDYT+P   +  P
Sbjct  331  NNDRSRDYTIPNPAMVNP  348


 Score = 99.0 bits (245),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+A
Sbjct  111  NVLLVTIEGADARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETASSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRNIPRYLLPEHIGPCTLRITYSAHTDLSVKFQSHRSRDYTNP  215



>ref|XP_011076025.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X1 [Sesamum indicum]
Length=442

 Score =   216 bits (549),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 129/232 (56%), Positives = 152/232 (66%), Gaps = 33/232 (14%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++   Q  +GVDGKK EPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  210  DYTNPLLPVAPSAIDASGQFNLGVDGKKLEPESNVLLASIENMQYAVTLDVLHTVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGGYCKLH+SYSRHTDL++K 
Sbjct  270  PVLKIAMFDKNGGLQALIQYPDVPTAVVAKEALEGHCIYDGGYCKLHISYSRHTDLSIKV  329

Query  474  YSDKSRDYTVPE--SGLQQPSAL-----PNTAP---AWQNPQYVSV-------------H  364
             +D+SRDYT+P   +   QPS L     P   P   A+   QY  V             +
Sbjct  330  NNDRSRDYTIPSIPAMSAQPSILGQQPYPMGGPGAHAYNGTQYAPVPDPRGVPPPSAGWN  389

Query  363  SAAP--PATMPMQN---PWDPTMQGGRPAFISSPTTFPGQE---YASPLVPF  232
            SA P  P +MPMQ    P+ P   G  PA         GQ    ++SP+ P+
Sbjct  390  SAVPSIPQSMPMQMHNYPYGPPTGG--PAMGHGLMATHGQNGVPHSSPMPPY  439


 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 69/104 (66%), Gaps = 6/104 (6%)
 Frame = -2

Query  735  NVLLASIE-NMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE N    V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA+ AKDA
Sbjct  111  NVLLVTIEGNDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDSETASAAKDA  170

Query  558  LEG-----HCIYDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G     + I + G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRSIPSYLIPELGPCSLRITYSAHTDLSVKFQSHRSRDYTNP  214



>ref|XP_011001848.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X2 [Populus euphratica]
Length=362

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 145/228 (64%), Gaps = 20/228 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTN  LPV P+A++      VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFS+FG
Sbjct  125  DYTNANLPVAPSAIDANGMFSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSSFG  184

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLHLSYSRH+DL++K 
Sbjct  185  PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHLSYSRHSDLSIKV  244

Query  474  YSDKSRDYTVPESGLQ--QPSALPNTAPAWQNP---QYVSVHSAAPPATMPMQ-NPWDPT  313
             +D+SRDYT+P + +   QPS L     A   P    Y   H A      PM   P    
Sbjct  245  NNDRSRDYTIPNTVMMNPQPSILGQQPVATHGPPAHTYTGAHFAPTTEHHPMMPQPSIGW  304

Query  312  MQGGRPAFISSPTTFPGQEYASPLVPFGA----------NQPAHQGIP  199
              GG P     P + P Q   +P +P G             P+H G+P
Sbjct  305  ATGGPPV----PHSMPAQMNNNPYLPPGTMPPQMGHGMMQMPSHGGLP  348


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 51/81 (63%), Gaps = 6/81 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+AL+G  I         G C L +
Sbjct  47   VFSAFGFVHKITTFEKTAGFQALVQFSDAETASSAKNALDGRNIPSYLLPEHLGPCTLRI  106

Query  510  SYSRHTDLNVKAYSDKSRDYT  448
            +YS HTDL+VK  S +SRDYT
Sbjct  107  TYSAHTDLSVKFQSHRSRDYT  127



>ref|XP_010445601.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X1 [Camelina sativa]
Length=429

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTN YLPV P+A++   Q +VGVDGKK EPESNVLLASIENMQYAVT+DVLH VF+AFG
Sbjct  211  DYTNMYLPVAPSAIDSTGQVIVGVDGKKMEPESNVLLASIENMQYAVTLDVLHMVFAAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQY DV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  271  EVQKIAMFDKNGGLQALIQYQDVQTAMVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQ  379
             +D+SRDYT+P   +  P   P+  P   NPQ
Sbjct  331  NNDRSRDYTMPNPPVPMPQQ-PSQNPYAGNPQ  361


 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 7/103 (7%)
 Frame = -2

Query  735  NVLLASIE-NMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE +    V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT +K+A
Sbjct  111  NVLLVTIEGDDARMVSIDVLHVVFSAFGFVHKITTFEKTAGYQALVQFSDAETATSSKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYT  448
            L+G  I         G C L ++YS HTDL VK  S +SRDYT
Sbjct  171  LDGRSIPRYLLPEQVGQCSLKITYSAHTDLTVKFQSHRSRDYT  213



>ref|XP_006422128.1| hypothetical protein CICLE_v10006435mg [Citrus clementina]
 gb|ESR35368.1| hypothetical protein CICLE_v10006435mg [Citrus clementina]
Length=1208

 Score =   224 bits (572),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 134/182 (74%), Gaps = 7/182 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAPSAIDASGQLSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  271  PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGL--QQPSAL---PNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPTM  310
             +D+SRDYT+P + +   QPS L   P         QY     A PP   PM +   PT 
Sbjct  331  NNDRSRDYTLPSTPMVNSQPSILGQQPVPMVGATANQYNGAQFAPPPPEQPMMH--QPTA  388

Query  309  QG  304
             G
Sbjct  389  AG  390


 Score =   100 bits (249),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 67/105 (64%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+A
Sbjct  111  NVLLVTIEGTDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDTETASSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I       + G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPENMGPCTLRITYSAHTDLSVKFQSHRSRDYTNP  215



>ref|XP_011001849.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X3 [Populus euphratica]
Length=361

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 145/228 (64%), Gaps = 20/228 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTN  LPV P+A++      VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFS+FG
Sbjct  124  DYTNANLPVAPSAIDANGMFSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSSFG  183

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLHLSYSRH+DL++K 
Sbjct  184  PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHLSYSRHSDLSIKV  243

Query  474  YSDKSRDYTVPESGLQ--QPSALPNTAPAWQNP---QYVSVHSAAPPATMPMQ-NPWDPT  313
             +D+SRDYT+P + +   QPS L     A   P    Y   H A      PM   P    
Sbjct  244  NNDRSRDYTIPNTVMMNPQPSILGQQPVATHGPPAHTYTGAHFAPTTEHHPMMPQPSIGW  303

Query  312  MQGGRPAFISSPTTFPGQEYASPLVPFGA----------NQPAHQGIP  199
              GG P     P + P Q   +P +P G             P+H G+P
Sbjct  304  ATGGPPV----PHSMPAQMNNNPYLPPGTMPPQMGHGMMQMPSHGGLP  347


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 51/81 (63%), Gaps = 6/81 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+AL+G  I         G C L +
Sbjct  46   VFSAFGFVHKITTFEKTAGFQALVQFSDAETASSAKNALDGRNIPSYLLPEHLGPCTLRI  105

Query  510  SYSRHTDLNVKAYSDKSRDYT  448
            +YS HTDL+VK  S +SRDYT
Sbjct  106  TYSAHTDLSVKFQSHRSRDYT  126



>ref|XP_010482704.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X1 [Camelina sativa]
Length=428

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 122/152 (80%), Gaps = 1/152 (1%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTN YLPV P+A++   Q +VGVDGKK EPESNVLLASIENMQYAVT+DVLH VF+AFG
Sbjct  211  DYTNMYLPVAPSAIDSTGQVIVGVDGKKMEPESNVLLASIENMQYAVTLDVLHMVFAAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQY DV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  271  EVQKIAMFDKNGGLQALIQYQDVQTAMVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQ  379
             +D+SRDYT+P   +  P   P   P   NPQ
Sbjct  331  NNDRSRDYTMPNPPVPMPQQ-PGQNPYAGNPQ  361


 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 7/103 (7%)
 Frame = -2

Query  735  NVLLASIE-NMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE +    V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT +K+A
Sbjct  111  NVLLVTIEGDDARMVSIDVLHVVFSAFGFVHKITTFEKTAGYQALVQFSDAETATSSKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYT  448
            L+G  I         G C L ++YS HTDL VK  S +SRDYT
Sbjct  171  LDGRSIPRYLLPEQVGQCSLKITYSAHTDLTVKFQSHRSRDYT  213



>gb|AES72454.2| polypyrimidine tract-binding-like protein [Medicago truncatula]
Length=504

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV  +A+EG  Q ++G+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVAQSAIEGGGQVMIGLDGKRLEAESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             +QKIA+F+KNGG QA IQYPD  TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  271  PIQKIAMFDKNGGLQALIQYPDTQTAVVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  330

Query  474  YSDKSRDYTVP  442
             +D+SRDYT+P
Sbjct  331  NNDRSRDYTIP  341


 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDA
Sbjct  111  NVLLVTVEGEDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS H+DL VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLSEHVGPCTLKITYSGHSDLTVKFQSHRSRDYTNP  215



>ref|NP_200130.1| polypyrimidine tract-binding protein 2 [Arabidopsis thaliana]
 sp|Q9FGL9.1|PTBP2_ARATH RecName: Full=Polypyrimidine tract-binding protein homolog 2 
[Arabidopsis thaliana]
 dbj|BAB08421.1| polypyrimidine tract-binding RNA transport protein-like [Arabidopsis 
thaliana]
 gb|AAU90050.1| At5g53180 [Arabidopsis thaliana]
 gb|AAV59265.1| At5g53180 [Arabidopsis thaliana]
 gb|AED96318.1| polypyrimidine tract-binding protein 2 [Arabidopsis thaliana]
Length=429

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 113/129 (88%), Gaps = 0/129 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++   Q  VGVDGKK EPESNVLLASIENMQYAVT+DVLH VF+AFG
Sbjct  211  DYTNPYLPVAPSAIDSTGQVAVGVDGKKMEPESNVLLASIENMQYAVTLDVLHMVFAAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQY DV TA VAK+ALEGHCIYDGG+CKLH++YSRHTDL++K 
Sbjct  271  EVQKIAMFDKNGGVQALIQYSDVQTAVVAKEALEGHCIYDGGFCKLHITYSRHTDLSIKV  330

Query  474  YSDKSRDYT  448
             +D+SRDYT
Sbjct  331  NNDRSRDYT  339


 Score = 98.2 bits (243),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIE-NMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE +    V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AK A
Sbjct  111  NVLLVTIEGDDARMVSIDVLHLVFSAFGFVHKITTFEKTAGYQALVQFTDAETATAAKLA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS HTDL VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLAETVGQCSLKITYSAHTDLTVKFQSHRSRDYTNP  215



>emb|CDP05088.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 120/143 (84%), Gaps = 2/143 (1%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++   Q  +G+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  210  DYTNPNLPVAPSAIDASGQLSLGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  270  PVLKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  329

Query  474  YSDKSRDYTVPESGLQ--QPSAL  412
             +D+SRDYT+P + +   QPS L
Sbjct  330  NNDRSRDYTIPNAPMMSSQPSIL  352


 Score =   102 bits (254),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = -2

Query  735  NVLLASIE-NMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE N    V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA+ AKDA
Sbjct  111  NVLLVTIEGNDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAQTASSAKDA  170

Query  558  LEG-----HCIYDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G     + I   G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLIPQLGPCTLRITYSAHTDLSVKFQSHRSRDYTNP  214



>ref|XP_003634092.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 [Vitis 
vinifera]
Length=446

 Score =   214 bits (546),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV  +A++G  Q  +G DG+K EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  211  DYTNPYLPVASSAIDGSGQFSMGFDGRKVEPESNVLLASIENMQYAVTLDVLHMVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             +QKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  271  PIQKIAMFDKNGGVQALIQYPDVQTAIVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  330

Query  474  YSDKSRDYTVPESGLQQPSAL  412
             +D+SRDYT P     QPS L
Sbjct  331  NNDRSRDYTSPVLS-SQPSVL  350


 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+A
Sbjct  111  NVLLVTIEGADARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDSETASAAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L +++S HTDL+VK  S +SRDYT P
Sbjct  171  LDGRSIPRYLLPEHLGPCTLRITFSAHTDLSVKFQSHRSRDYTNP  215



>ref|XP_001766117.1| predicted protein [Physcomitrella patens]
 gb|EDQ69176.1| predicted protein [Physcomitrella patens]
Length=488

 Score =   215 bits (548),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 121/204 (59%), Positives = 139/204 (68%), Gaps = 27/204 (13%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  VG DGK++EPESNVLL SIENMQYAVT+DV+HTVFSAFG
Sbjct  211  DYTNPYLPVAPSAIDGSGQFSVGPDGKRREPESNVLLVSIENMQYAVTIDVIHTVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIAIFEK+ G QA +QYPD+ TA  AK+ALEGHCIYDGG+CKLHLSYSRHTDLNVKA
Sbjct  271  FVQKIAIFEKSAGFQALVQYPDIPTAVGAKEALEGHCIYDGGFCKLHLSYSRHTDLNVKA  330

Query  474  YS------DKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPT  313
             S      D+SRDYT P         LP T P         V S AP   +  Q  WD T
Sbjct  331  LSLLYVNNDRSRDYTNP--------GLPATQPP--------VLSQAP--GVAQQQSWD-T  371

Query  312  MQGGRPAFISSPTTFPGQEYASPL  241
               G+   +S P   PGQ  + P+
Sbjct  372  EGSGKAQQVSGP--MPGQPMSGPM  393


 Score =   105 bits (263),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 69/106 (65%), Gaps = 7/106 (7%)
 Frame = -2

Query  738  SNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKD  562
            SNVLL +IE ++   V++DVLH VFSAFG V KIA FEK+ G QA +Q+ D  TA+ AK 
Sbjct  110  SNVLLVTIEGVEAGDVSIDVLHLVFSAFGFVHKIATFEKSAGFQALVQFSDANTASAAKS  169

Query  561  ALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            ALEG  I         G C L +S+S H DLNVK  S +SRDYT P
Sbjct  170  ALEGRSIPRYLLPDHVGPCHLRISFSAHNDLNVKFQSHRSRDYTNP  215



>ref|XP_008376696.1| PREDICTED: LOW QUALITY PROTEIN: polypyrimidine tract-binding 
protein homolog 2 [Malus domestica]
Length=747

 Score =   220 bits (560),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 123/222 (55%), Positives = 145/222 (65%), Gaps = 27/222 (12%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++G  Q +VG+DGKK E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  517  DYTNPNLPVAPSAIDGSGQLIVGLDGKKLESESNVLLASIENMQYAVTLDVLHMVFSAFG  576

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             +QKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLH+SYSRHTDL++K 
Sbjct  577  PIQKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHISYSRHTDLSIKV  636

Query  474  YSDKSRDYTVPESGL--QQPSALPN--------TAPAWQNPQYVSVHSA-----------  358
             +D+SRDYT+P   +   QPS L            P +   QY     A           
Sbjct  637  NNDRSRDYTIPTIPIVTAQPSILGQQPVHQMSPAVPPYNGAQYAPTDQAVMPQPSAGWGP  696

Query  357  ---APPATMPMQNPWDPTM-QGGRPAFISSPTTFPGQEYASP  244
               A P +MP+Q    P M  G  P  ISSP   PG   + P
Sbjct  697  TVPAVPQSMPIQMHNQPYMPPGTMP--ISSPQMGPGMMQSGP  736


 Score = 92.8 bits (229),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 64/106 (60%), Gaps = 9/106 (8%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++D+ H VFSAFG V KI  FEK  G QA +Q+ D  TAT AK A
Sbjct  417  NVLLVTIEGADARLVSIDIFHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKTA  476

Query  558  LEGHCI-------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+   I       Y G  C L ++YS HTDL+VK  S +SRDYT P
Sbjct  477  LDSRIIPRYLLPEYVGP-CTLRITYSGHTDLSVKFQSHRSRDYTNP  521



>ref|XP_011001846.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X1 [Populus euphratica]
 ref|XP_011001847.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X1 [Populus euphratica]
Length=448

 Score =   214 bits (545),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 122/228 (54%), Positives = 145/228 (64%), Gaps = 20/228 (9%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTN  LPV P+A++      VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFS+FG
Sbjct  211  DYTNANLPVAPSAIDANGMFSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSSFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLHLSYSRH+DL++K 
Sbjct  271  PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHLSYSRHSDLSIKV  330

Query  474  YSDKSRDYTVPESGLQ--QPSALPNTAPAWQNP---QYVSVHSAAPPATMPMQ-NPWDPT  313
             +D+SRDYT+P + +   QPS L     A   P    Y   H A      PM   P    
Sbjct  331  NNDRSRDYTIPNTVMMNPQPSILGQQPVATHGPPAHTYTGAHFAPTTEHHPMMPQPSIGW  390

Query  312  MQGGRPAFISSPTTFPGQEYASPLVPFGA----------NQPAHQGIP  199
              GG P     P + P Q   +P +P G             P+H G+P
Sbjct  391  ATGGPPV----PHSMPAQMNNNPYLPPGTMPPQMGHGMMQMPSHGGLP  434


 Score = 97.4 bits (241),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 7/103 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+A
Sbjct  111  NVLLVTIEGADARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETASSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYT  448
            L+G  I         G C L ++YS HTDL+VK  S +SRDYT
Sbjct  171  LDGRNIPSYLLPEHLGPCTLRITYSAHTDLSVKFQSHRSRDYT  213



>ref|XP_009788719.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X5 [Nicotiana sylvestris]
Length=336

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 126/165 (76%), Gaps = 5/165 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP+LPV P+A++   Q  +G+DGKK EPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  103  DYTNPHLPVAPSAIDASGQFSLGLDGKKLEPESNVLLASIENMQYAVTLDVLHTVFSAFG  162

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK ALEGH IY+GGYCKLH++YSRHTDL++K 
Sbjct  163  PVLKIAMFDKNGGVQALIQYPDVRTAVVAKGALEGHSIYEGGYCKLHITYSRHTDLSIKV  222

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSAAPPA  346
             +D+SRDYT+P + +   QPS      P    P    VH  + PA
Sbjct  223  NNDRSRDYTIPNTPMLNSQPSIFGQQPPQIGGP---GVHPYSAPA  264


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEG-----HCIYDGGYCKLHLS  508
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G     + I + G C L ++
Sbjct  26   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPSYLIPELGPCTLKIT  85

Query  507  YSRHTDLNVKAYSDKSRDYTVPE  439
            YS HTDL+VK  S +SRDYT P 
Sbjct  86   YSAHTDLSVKFQSHRSRDYTNPH  108



>ref|XP_009788720.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X6 [Nicotiana sylvestris]
Length=335

 Score =   210 bits (534),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 126/165 (76%), Gaps = 5/165 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP+LPV P+A++   Q  +G+DGKK EPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  102  DYTNPHLPVAPSAIDASGQFSLGLDGKKLEPESNVLLASIENMQYAVTLDVLHTVFSAFG  161

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK ALEGH IY+GGYCKLH++YSRHTDL++K 
Sbjct  162  PVLKIAMFDKNGGVQALIQYPDVRTAVVAKGALEGHSIYEGGYCKLHITYSRHTDLSIKV  221

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSAAPPA  346
             +D+SRDYT+P + +   QPS      P    P    VH  + PA
Sbjct  222  NNDRSRDYTIPNTPMLNSQPSIFGQQPPQIGGP---GVHPYSAPA  263


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEG-----HCIYDGGYCKLHLS  508
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G     + I + G C L ++
Sbjct  25   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPSYLIPELGPCTLKIT  84

Query  507  YSRHTDLNVKAYSDKSRDYTVPE  439
            YS HTDL+VK  S +SRDYT P 
Sbjct  85   YSAHTDLSVKFQSHRSRDYTNPH  107



>gb|ADE76380.1| unknown [Picea sitchensis]
Length=511

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 122/151 (81%), Gaps = 9/151 (6%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++G  Q  +G DG+++EP SNVLLASIENMQYAVTVDVLHTVFSAFG
Sbjct  211  DYTNPNLPVAPSAIDGTGQFGIGPDGQRREPASNVLLASIENMQYAVTVDVLHTVFSAFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+FEKN G QA IQY D+ TA +AK+ALEGH IY GGYCKLHLSYSRHTDLNVK 
Sbjct  271  IVQKIAMFEKNAGWQALIQYADIPTAVIAKEALEGHFIYAGGYCKLHLSYSRHTDLNVKV  330

Query  474  YSDKSRDYTVPESGL---------QQPSALP  409
             +D+SRDYT+P+ G+         QQPS+LP
Sbjct  331  NNDRSRDYTLPKVGILQNQLSILGQQPSSLP  361


 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 75/116 (65%), Gaps = 8/116 (7%)
 Frame = -2

Query  765  VDGKKKEPE-SNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYP  592
            V+ K    E SNVLL +IE ++   V++DVLH VFSAFG V KIA FEK+ G QA +Q+ 
Sbjct  100  VNSKNSGDEASNVLLVTIEGVEAGDVSIDVLHLVFSAFGFVHKIATFEKSAGFQALVQFS  159

Query  591  DVTTATVAKDALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            DV TA+ A+ AL+G  I         G C L +S+S HTDLNVK  S +SRDYT P
Sbjct  160  DVDTASSARSALDGRSIPRYLLAEHVGPCHLRISFSAHTDLNVKFQSHRSRDYTNP  215



>ref|XP_009788715.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X2 [Nicotiana sylvestris]
Length=373

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 126/165 (76%), Gaps = 5/165 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP+LPV P+A++   Q  +G+DGKK EPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  140  DYTNPHLPVAPSAIDASGQFSLGLDGKKLEPESNVLLASIENMQYAVTLDVLHTVFSAFG  199

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK ALEGH IY+GGYCKLH++YSRHTDL++K 
Sbjct  200  PVLKIAMFDKNGGVQALIQYPDVRTAVVAKGALEGHSIYEGGYCKLHITYSRHTDLSIKV  259

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSAAPPA  346
             +D+SRDYT+P + +   QPS      P    P    VH  + PA
Sbjct  260  NNDRSRDYTIPNTPMLNSQPSIFGQQPPQIGGP---GVHPYSAPA  301


 Score =   103 bits (257),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 69/105 (66%), Gaps = 6/105 (6%)
 Frame = -2

Query  735  NVLLASIE-NMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE N    V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDA
Sbjct  41   NVLLVTIEGNDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDA  100

Query  558  LEG-----HCIYDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVPE  439
            L+G     + I + G C L ++YS HTDL+VK  S +SRDYT P 
Sbjct  101  LDGRSIPSYLIPELGPCTLKITYSAHTDLSVKFQSHRSRDYTNPH  145



>ref|XP_008810837.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 [Phoenix 
dactylifera]
Length=796

 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 125/162 (77%), Gaps = 6/162 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV P+A++G  Q  +  DGKK+EPESNVLLAS+ENMQYA+T+DVLH VFSAFG
Sbjct  501  DYTNPYLPVAPSAIDGSGQLGIDQDGKKQEPESNVLLASVENMQYAITIDVLHMVFSAFG  560

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
            TVQKIA+FEKN G QA IQYPD+ TA +A++ALEGHCIY+GG+CKLHL+YSRHTDLNVK 
Sbjct  561  TVQKIAVFEKNAGLQALIQYPDIQTARIAREALEGHCIYEGGFCKLHLTYSRHTDLNVKI  620

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPP  349
             +D+ RDYT         +AL N  P+   PQ V +    PP
Sbjct  621  NNDRGRDYTGGN------TALLNQQPSILGPQPVQMLGGTPP  656


 Score =   103 bits (256),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 70/106 (66%), Gaps = 7/106 (7%)
 Frame = -2

Query  738  SNVLLASIENMQYA-VTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKD  562
            SN+LL ++E ++   V++DVLH VFSAFG V KIA FEK  G QA +Q+ D  TA+ AK+
Sbjct  400  SNILLVTVEGVEAGDVSIDVLHLVFSAFGFVHKIATFEKTAGFQALVQFSDSETASTAKN  459

Query  561  ALEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            AL+G  I         G C L +++S HTDLNVK  S +SRDYT P
Sbjct  460  ALDGRSIPRYLLQEHVGPCTLRITFSAHTDLNVKFQSHRSRDYTNP  505



>ref|XP_006360176.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X3 [Solanum tuberosum]
Length=354

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++   Q  VG+DGKK EPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  110  DYTNPLLPVAPSAIDANGQISVGLDGKKLEPESNVLLASIENMQYAVTLDVLHTVFSAFG  169

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK+ALEGH IY+GG+CKLH+SYSRHTDL++K 
Sbjct  170  PVLKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHSIYEGGFCKLHISYSRHTDLSIKV  229

Query  474  YSDKSRDYTVPE  439
             +D+SRDYT+P 
Sbjct  230  NNDRSRDYTIPN  241


 Score = 85.9 bits (211),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEG-----HCIYDGGYCKLHLS  508
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G     + I + G C L ++
Sbjct  33   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPRYLIPELGPCSLKIT  92

Query  507  YSRHTDLNVKAYSDKSRDYTVP  442
            YS HTDL+VK  S +SRDYT P
Sbjct  93   YSAHTDLSVKFQSHRSRDYTNP  114



>gb|EYU19625.1| hypothetical protein MIMGU_mgv1a006329mg [Erythranthe guttata]
Length=448

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/209 (57%), Positives = 143/209 (68%), Gaps = 28/209 (13%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++   Q  +G DGKK EPESNVLLASIENMQY+VT+DVL+TVFS+FG
Sbjct  210  DYTNPMLPVAPSAIDASGQVSLGADGKKLEPESNVLLASIENMQYSVTLDVLNTVFSSFG  269

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQY DV TA VAK+ALEGHCIYDGGYCKLH+SYSRHTDL++K 
Sbjct  270  PVQKIAMFDKNGGLQALIQYADVQTAVVAKEALEGHCIYDGGYCKLHISYSRHTDLSIKV  329

Query  474  YSDKSRDYTVPESGL----QQPSALPNTAP--------AWQNPQY--------VSVHSA-  358
             +D+SRDYT+P + +     QPS L             A+  PQY        +  HSA 
Sbjct  330  NNDRSRDYTIPIAPVPVVNTQPSILGQQPYQGGGPGGHAYSGPQYPVGPDPRAMPPHSAG  389

Query  357  ---APPATMPMQN---PWDPTMQGGRPAF  289
               A P +MPMQ    P+ P   GG PA 
Sbjct  390  WNPAIPQSMPMQMHNYPYAPP-PGGNPAM  417


 Score =   102 bits (255),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = -2

Query  735  NVLLASIE-NMQYAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE N    V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA  AKDA
Sbjct  111  NVLLVTIEGNDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDSETACAAKDA  170

Query  558  LEG-----HCIYDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G     + I + G C L ++YS HTDL+VK  S +SRDYT P
Sbjct  171  LDGRSIPSYLIPELGPCSLRITYSAHTDLSVKFQSHRSRDYTNP  214



>ref|XP_006374127.1| hypothetical protein POPTR_0015s02250g [Populus trichocarpa]
 gb|ERP51924.1| hypothetical protein POPTR_0015s02250g [Populus trichocarpa]
Length=317

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 141/215 (66%), Gaps = 17/215 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV  +A++      +G+DGKK EPESNVLLASIENMQYAVT+DVLH VFS+FG
Sbjct  81   DYTNPNLPVAQSAIDANGMFSMGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSSFG  140

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KN G QA IQYPDV TA VAK+ALEGHCIYDGG+CKLHLSYSRH DL++K 
Sbjct  141  PVQKIAMFDKNSGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHLSYSRHNDLSIKV  200

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPTMQ----  307
             +D+SRDYT+P + +  P       P+    Q V+ H   PP+ +     + PT +    
Sbjct  201  NNDRSRDYTIPNNVMVNPQ------PSILGQQPVATH--GPPSHLYTGAQFAPTTEHSMI  252

Query  306  -----GGRPAFISSPTTFPGQEYASPLVPFGANQP  217
                 G    F   P + PGQ   +P +P G   P
Sbjct  253  PQPSSGWATGFPPVPNSMPGQMNNNPYLPPGTMPP  287


 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 52/84 (62%), Gaps = 6/84 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK    QA +Q+ DV TA+ AK+AL+G  I         G C L +
Sbjct  3    VFSAFGFVHKITTFEKMDRFQALVQFSDVETASSAKNALDGRNIPSYLLPEHLGPCTLRI  62

Query  510  SYSRHTDLNVKAYSDKSRDYTVPE  439
            +YS HTDL+VK  S +SRDYT P 
Sbjct  63   AYSGHTDLSVKFQSHRSRDYTNPN  86



>ref|XP_006360175.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X2 [Solanum tuberosum]
Length=355

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++   Q  VG+DGKK EPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  111  DYTNPLLPVAPSAIDANGQISVGLDGKKLEPESNVLLASIENMQYAVTLDVLHTVFSAFG  170

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK+ALEGH IY+GG+CKLH+SYSRHTDL++K 
Sbjct  171  PVLKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHSIYEGGFCKLHISYSRHTDLSIKV  230

Query  474  YSDKSRDYTVPE  439
             +D+SRDYT+P 
Sbjct  231  NNDRSRDYTIPN  242


 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEG-----HCIYDGGYCKLHLS  508
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G     + I + G C L ++
Sbjct  34   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPRYLIPELGPCSLKIT  93

Query  507  YSRHTDLNVKAYSDKSRDYTVP  442
            YS HTDL+VK  S +SRDYT P
Sbjct  94   YSAHTDLSVKFQSHRSRDYTNP  115



>ref|XP_009614815.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X2 [Nicotiana tomentosiformis]
Length=345

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 119/143 (83%), Gaps = 2/143 (1%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++   Q  VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  111  DYTNPLLPVAPSAIDASGQISVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  170

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV T+ VAK+ALEGH IY+GG+CKLH+SYSRHTDL++K 
Sbjct  171  PVLKIAMFDKNGGVQALIQYPDVQTSVVAKEALEGHSIYEGGFCKLHISYSRHTDLSIKV  230

Query  474  YSDKSRDYTVPESGL--QQPSAL  412
             +D+SRDYT+P + +   QPS L
Sbjct  231  NNDRSRDYTIPNAPMLNSQPSVL  253


 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEG-----HCIYDGGYCKLHLS  508
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G     + I + G C L ++
Sbjct  34   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPRYLIPELGPCSLKIT  93

Query  507  YSRHTDLNVKAYSDKSRDYTVP  442
            YS HTDL+VK  S +SRDYT P
Sbjct  94   YSAHTDLSVKFQSHRSRDYTNP  115



>ref|XP_009614816.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X3 [Nicotiana tomentosiformis]
Length=344

 Score =   209 bits (532),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 119/143 (83%), Gaps = 2/143 (1%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV P+A++   Q  VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  110  DYTNPLLPVAPSAIDASGQISVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  169

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV T+ VAK+ALEGH IY+GG+CKLH+SYSRHTDL++K 
Sbjct  170  PVLKIAMFDKNGGVQALIQYPDVQTSVVAKEALEGHSIYEGGFCKLHISYSRHTDLSIKV  229

Query  474  YSDKSRDYTVPESGL--QQPSAL  412
             +D+SRDYT+P + +   QPS L
Sbjct  230  NNDRSRDYTIPNAPMLNSQPSVL  252


 Score = 85.9 bits (211),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEG-----HCIYDGGYCKLHLS  508
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G     + I + G C L ++
Sbjct  33   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPRYLIPELGPCSLKIT  92

Query  507  YSRHTDLNVKAYSDKSRDYTVP  442
            YS HTDL+VK  S +SRDYT P
Sbjct  93   YSAHTDLSVKFQSHRSRDYTNP  114



>ref|XP_002317750.2| hypothetical protein POPTR_0012s01530g [Populus trichocarpa]
 gb|EEE95970.2| hypothetical protein POPTR_0012s01530g [Populus trichocarpa]
Length=443

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTN  LPV P+A++      VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFS+FG
Sbjct  212  DYTNANLPVAPSAIDANGMFSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSSFG  271

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLHLSYSRH+DL++K 
Sbjct  272  PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHLSYSRHSDLSIKV  331

Query  474  YSDKSRDYTVPESGLQQP  421
             +D+SRDYT+P + +  P
Sbjct  332  NNDRSRDYTIPNTVMMNP  349


 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 7/103 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+A
Sbjct  112  NVLLVTIEGADARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETASSAKNA  171

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYT  448
            L+G  I         G C L ++YS HTDL+VK  S +SRDYT
Sbjct  172  LDGRNIPSYLLPEHLGPCTLRITYSAHTDLSVKFQSHRSRDYT  214



>gb|ABK95840.1| unknown [Populus trichocarpa]
Length=442

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTN  LPV P+A++      VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFS+FG
Sbjct  211  DYTNANLPVAPSAIDANGMFSVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSSFG  270

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KNGG QA IQYPDV TA VAK+ALEGHCIYDGG+CKLHLSYSRH+DL++K 
Sbjct  271  PVQKIAMFDKNGGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHLSYSRHSDLSIKV  330

Query  474  YSDKSRDYTVPESGLQQP  421
             +D+SRDYT+P + +  P
Sbjct  331  NNDRSRDYTIPNTVMMNP  348


 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 7/103 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL +IE      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TA+ AK+A
Sbjct  111  NVLLVTIEGADARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETASSAKNA  170

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYT  448
            L+G  I         G C L ++YS HTDL+VK  S +SRDYT
Sbjct  171  LDGRNIPSYLLPEHLGPCTLRITYSAHTDLSVKFQSHRSRDYT  213



>ref|XP_009788550.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X2 [Nicotiana sylvestris]
Length=345

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP +PV P+A++   Q  VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  111  DYTNPLIPVAPSAIDASGQISVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  170

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK+ALEGH IY+GG+CKLH+SYSRHTDL++K 
Sbjct  171  PVLKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHSIYEGGFCKLHISYSRHTDLSIKV  230

Query  474  YSDKSRDYTVPESGL--QQPSAL  412
             +D+SRDYT+P   +   QPS L
Sbjct  231  NNDRSRDYTIPNVPMLNSQPSVL  253


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEG-----HCIYDGGYCKLHLS  508
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AK+AL+G     + I + G C L ++
Sbjct  34   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKNALDGRSIPRYLIPELGPCSLKIT  93

Query  507  YSRHTDLNVKAYSDKSRDYTVP  442
            YS HTDL+VK  S +SRDYT P
Sbjct  94   YSAHTDLSVKFQSHRSRDYTNP  115



>ref|XP_009788716.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009788717.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X3 [Nicotiana sylvestris]
Length=348

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 126/165 (76%), Gaps = 5/165 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP+LPV P+A++   Q  +G+DGKK EPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  115  DYTNPHLPVAPSAIDASGQFSLGLDGKKLEPESNVLLASIENMQYAVTLDVLHTVFSAFG  174

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK ALEGH IY+GGYCKLH++YSRHTDL++K 
Sbjct  175  PVLKIAMFDKNGGVQALIQYPDVRTAVVAKGALEGHSIYEGGYCKLHITYSRHTDLSIKV  234

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSAAPPA  346
             +D+SRDYT+P + +   QPS      P    P    VH  + PA
Sbjct  235  NNDRSRDYTIPNTPMLNSQPSIFGQQPPQIGGP---GVHPYSAPA  276



>ref|XP_009788551.1| PREDICTED: polypyrimidine tract-binding protein homolog 2 isoform 
X3 [Nicotiana sylvestris]
Length=344

 Score =   208 bits (530),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP +PV P+A++   Q  VG+DGKK EPESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  110  DYTNPLIPVAPSAIDASGQISVGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSAFG  169

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK+ALEGH IY+GG+CKLH+SYSRHTDL++K 
Sbjct  170  PVLKIAMFDKNGGVQALIQYPDVQTAVVAKEALEGHSIYEGGFCKLHISYSRHTDLSIKV  229

Query  474  YSDKSRDYTVPESGL--QQPSAL  412
             +D+SRDYT+P   +   QPS L
Sbjct  230  NNDRSRDYTIPNVPMLNSQPSVL  252


 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 54/82 (66%), Gaps = 5/82 (6%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEG-----HCIYDGGYCKLHLS  508
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AK+AL+G     + I + G C L ++
Sbjct  33   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKNALDGRSIPRYLIPELGPCSLKIT  92

Query  507  YSRHTDLNVKAYSDKSRDYTVP  442
            YS HTDL+VK  S +SRDYT P
Sbjct  93   YSAHTDLSVKFQSHRSRDYTNP  114



>ref|XP_003602203.1| Polypyrimidine tract-binding protein-like protein [Medicago truncatula]
Length=828

 Score =   217 bits (553),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 133/182 (73%), Gaps = 7/182 (4%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNPYLPV  +A+EG  Q ++G+DGK+ E ESNVLLASIENMQYAVT+DVLH VFSAFG
Sbjct  535  DYTNPYLPVAQSAIEGGGQVMIGLDGKRLEAESNVLLASIENMQYAVTLDVLHMVFSAFG  594

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             +QKIA+F+KNGG QA IQYPD  TA VAK+ALEGHCIYDGG+CKLHLSYSRHTDL++K 
Sbjct  595  PIQKIAMFDKNGGLQALIQYPDTQTAVVAKEALEGHCIYDGGFCKLHLSYSRHTDLSIKV  654

Query  474  YSDKSRDYTVPESGL--QQPSAL----PNTAPAWQNPQYVSVHSAAPPATMPM-QNPWDP  316
             +D+SRDYT+P   +   QPS L    P T P  Q          + PA +P  Q  W  
Sbjct  655  NNDRSRDYTIPMIPVVNTQPSILGQPVPMTVPPAQQYNGSQYTPISDPAMIPQSQAGWGT  714

Query  315  TM  310
            T+
Sbjct  715  TL  716


 Score = 98.2 bits (243),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 65/105 (62%), Gaps = 7/105 (7%)
 Frame = -2

Query  735  NVLLASIENMQ-YAVTVDVLHTVFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDA  559
            NVLL ++E      V++DVLH VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDA
Sbjct  435  NVLLVTVEGEDARLVSIDVLHLVFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDA  494

Query  558  LEGHCI------YDGGYCKLHLSYSRHTDLNVKAYSDKSRDYTVP  442
            L+G  I         G C L ++YS H+DL VK  S +SRDYT P
Sbjct  495  LDGRSIPRYLLSEHVGPCTLKITYSGHSDLTVKFQSHRSRDYTNP  539



>ref|XP_009589653.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X4 [Nicotiana tomentosiformis]
Length=334

 Score =   207 bits (528),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP+LP+ P+A++   Q  +G+DGKK EPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  102  DYTNPHLPIAPSAIDASGQFSLGLDGKKLEPESNVLLASIENMQYAVTLDVLHTVFSAFG  161

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK ALEGH IY+GGYCKLH++YSRHTDL++K 
Sbjct  162  PVLKIAMFDKNGGVQALIQYPDVRTAVVAKGALEGHSIYEGGYCKLHVTYSRHTDLSIKV  221

Query  474  YSDKSRDYTVPES  436
             +D+SRDYT+P +
Sbjct  222  NNDRSRDYTIPNT  234


 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEG-----HCIYDGGYCKLHLS  508
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G     + I + G C L ++
Sbjct  25   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPSYLIPELGPCTLKIT  84

Query  507  YSRHTDLNVKAYSDKSRDYTVPE  439
            YS HTDL+VK  S +SRDYT P 
Sbjct  85   YSAHTDLSVKFQSHRSRDYTNPH  107



>ref|XP_009589652.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X3 [Nicotiana tomentosiformis]
Length=335

 Score =   207 bits (528),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP+LP+ P+A++   Q  +G+DGKK EPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  103  DYTNPHLPIAPSAIDASGQFSLGLDGKKLEPESNVLLASIENMQYAVTLDVLHTVFSAFG  162

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK ALEGH IY+GGYCKLH++YSRHTDL++K 
Sbjct  163  PVLKIAMFDKNGGVQALIQYPDVRTAVVAKGALEGHSIYEGGYCKLHVTYSRHTDLSIKV  222

Query  474  YSDKSRDYTVPES  436
             +D+SRDYT+P +
Sbjct  223  NNDRSRDYTIPNT  235


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/83 (54%), Positives = 54/83 (65%), Gaps = 5/83 (6%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEG-----HCIYDGGYCKLHLS  508
            VFSAFG V KI  FEK  G QA +Q+ D  TAT AKDAL+G     + I + G C L ++
Sbjct  26   VFSAFGFVHKITTFEKTAGFQALVQFSDAETATSAKDALDGRSIPSYLIPELGPCTLKIT  85

Query  507  YSRHTDLNVKAYSDKSRDYTVPE  439
            YS HTDL+VK  S +SRDYT P 
Sbjct  86   YSAHTDLSVKFQSHRSRDYTNPH  108



>ref|XP_009788718.1| PREDICTED: polypyrimidine tract-binding protein homolog 2-like 
isoform X4 [Nicotiana sylvestris]
Length=352

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 126/165 (76%), Gaps = 5/165 (3%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP+LPV P+A++   Q  +G+DGKK EPESNVLLASIENMQYAVT+DVLHTVFSAFG
Sbjct  119  DYTNPHLPVAPSAIDASGQFSLGLDGKKLEPESNVLLASIENMQYAVTLDVLHTVFSAFG  178

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             V KIA+F+KNGG QA IQYPDV TA VAK ALEGH IY+GGYCKLH++YSRHTDL++K 
Sbjct  179  PVLKIAMFDKNGGVQALIQYPDVRTAVVAKGALEGHSIYEGGYCKLHITYSRHTDLSIKV  238

Query  474  YSDKSRDYTVPESGL--QQPSALPNTAPAWQNPQYVSVHSAAPPA  346
             +D+SRDYT+P + +   QPS      P    P    VH  + PA
Sbjct  239  NNDRSRDYTIPNTPMLNSQPSIFGQQPPQIGGP---GVHPYSAPA  280



>ref|XP_006374128.1| hypothetical protein POPTR_0015s02250g [Populus trichocarpa]
 gb|ERP51925.1| hypothetical protein POPTR_0015s02250g [Populus trichocarpa]
Length=347

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 114/215 (53%), Positives = 141/215 (66%), Gaps = 17/215 (8%)
 Frame = -2

Query  834  DYTNPYLPVNPTAMEGFVQPVVGVDGKKKEPESNVLLASIENMQYAVTVDVLHTVFSAFG  655
            DYTNP LPV  +A++      +G+DGKK EPESNVLLASIENMQYAVT+DVLH VFS+FG
Sbjct  111  DYTNPNLPVAQSAIDANGMFSMGLDGKKLEPESNVLLASIENMQYAVTLDVLHMVFSSFG  170

Query  654  TVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCIYDGGYCKLHLSYSRHTDLNVKA  475
             VQKIA+F+KN G QA IQYPDV TA VAK+ALEGHCIYDGG+CKLHLSYSRH DL++K 
Sbjct  171  PVQKIAMFDKNSGLQALIQYPDVQTAVVAKEALEGHCIYDGGFCKLHLSYSRHNDLSIKV  230

Query  474  YSDKSRDYTVPESGLQQPSALPNTAPAWQNPQYVSVHSAAPPATMPMQNPWDPTMQ----  307
             +D+SRDYT+P + +  P       P+    Q V+ H   PP+ +     + PT +    
Sbjct  231  NNDRSRDYTIPNNVMVNPQ------PSILGQQPVATH--GPPSHLYTGAQFAPTTEHSMI  282

Query  306  -----GGRPAFISSPTTFPGQEYASPLVPFGANQP  217
                 G    F   P + PGQ   +P +P G   P
Sbjct  283  PQPSSGWATGFPPVPNSMPGQMNNNPYLPPGTMPP  317


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 52/84 (62%), Gaps = 6/84 (7%)
 Frame = -2

Query  672  VFSAFGTVQKIAIFEKNGGTQAFIQYPDVTTATVAKDALEGHCI------YDGGYCKLHL  511
            VFSAFG V KI  FEK    QA +Q+ DV TA+ AK+AL+G  I         G C L +
Sbjct  33   VFSAFGFVHKITTFEKMDRFQALVQFSDVETASSAKNALDGRNIPSYLLPEHLGPCTLRI  92

Query  510  SYSRHTDLNVKAYSDKSRDYTVPE  439
            +YS HTDL+VK  S +SRDYT P 
Sbjct  93   AYSGHTDLSVKFQSHRSRDYTNPN  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1908683925587