BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9631

Length=1769
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP04424.1|  unnamed protein product                                841   0.0      Coffea canephora [robusta coffee]
ref|XP_009629448.1|  PREDICTED: aspartic proteinase-like                839   0.0      Nicotiana tomentosiformis
ref|XP_006348142.1|  PREDICTED: aspartic proteinase-like                833   0.0      Solanum tuberosum [potatoes]
ref|XP_004232695.1|  PREDICTED: aspartic proteinase                     833   0.0      Solanum lycopersicum
ref|XP_009797823.1|  PREDICTED: aspartic proteinase                     833   0.0      Nicotiana sylvestris
ref|XP_009587050.1|  PREDICTED: aspartic proteinase-like                827   0.0      Nicotiana tomentosiformis
ref|XP_003632941.1|  PREDICTED: aspartic proteinase A1                  817   0.0      Vitis vinifera
ref|XP_004231616.1|  PREDICTED: aspartic proteinase                     815   0.0      Solanum lycopersicum
ref|XP_010252464.1|  PREDICTED: aspartic proteinase A1-like             813   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_006350474.1|  PREDICTED: aspartic proteinase-like                810   0.0      Solanum tuberosum [potatoes]
ref|XP_011096039.1|  PREDICTED: aspartic proteinase-like                804   0.0      
ref|XP_007026133.1|  Saposin-like aspartyl protease family protein      800   0.0      
ref|XP_002529926.1|  Aspartic proteinase precursor, putative            799   0.0      Ricinus communis
gb|EYU27762.1|  hypothetical protein MIMGU_mgv1a004712mg                798   0.0      Erythranthe guttata [common monkey flower]
ref|XP_011652603.1|  PREDICTED: aspartic proteinase                     795   0.0      Cucumis sativus [cucumbers]
ref|XP_006449766.1|  hypothetical protein CICLE_v10014941mg             795   0.0      Citrus clementina [clementine]
gb|EYU33885.1|  hypothetical protein MIMGU_mgv1a004716mg                794   0.0      Erythranthe guttata [common monkey flower]
ref|XP_006467405.1|  PREDICTED: aspartic proteinase-like isoform X2     793   0.0      Citrus sinensis [apfelsine]
ref|XP_006467404.1|  PREDICTED: aspartic proteinase-like isoform X1     795   0.0      
emb|CAC86004.1|  aspartic proteinase                                    791   0.0      Theobroma cacao [chocolate]
ref|XP_008440898.1|  PREDICTED: aspartic proteinase                     790   0.0      Cucumis melo [Oriental melon]
ref|XP_010099183.1|  Aspartic proteinase                                790   0.0      Morus notabilis
ref|XP_010244475.1|  PREDICTED: aspartic proteinase A1-like isofo...    789   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_010244477.1|  PREDICTED: aspartic proteinase A1-like isofo...    789   0.0      Nelumbo nucifera [Indian lotus]
gb|KHG11144.1|  Aspartic proteinase                                     789   0.0      Gossypium arboreum [tree cotton]
gb|KJB67244.1|  hypothetical protein B456_010G182400                    786   0.0      Gossypium raimondii
ref|XP_002518445.1|  Aspartic proteinase precursor, putative            785   0.0      Ricinus communis
ref|XP_012070867.1|  PREDICTED: aspartic proteinase A1-like             785   0.0      Jatropha curcas
ref|XP_011046729.1|  PREDICTED: aspartic proteinase A1-like             784   0.0      Populus euphratica
ref|XP_012091315.1|  PREDICTED: aspartic proteinase-like                783   0.0      Jatropha curcas
ref|XP_006452415.1|  hypothetical protein CICLE_v10008027mg             783   0.0      Citrus clementina [clementine]
ref|XP_006475035.1|  PREDICTED: aspartic proteinase-like                783   0.0      Citrus sinensis [apfelsine]
gb|KHG11143.1|  Aspartic proteinase                                     782   0.0      Gossypium arboreum [tree cotton]
ref|XP_002298827.2|  aspartic protease family protein                   781   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007211824.1|  hypothetical protein PRUPE_ppa004375mg             776   0.0      Prunus persica
gb|ACX55829.1|  aspartic proteinase 1                                   776   0.0      Castanea mollissima
ref|XP_010096873.1|  Aspartic proteinase                                775   0.0      Morus notabilis
gb|KCW77002.1|  hypothetical protein EUGRSUZ_D01351                     774   0.0      Eucalyptus grandis [rose gum]
ref|XP_008226860.1|  PREDICTED: aspartic proteinase A1-like             773   0.0      Prunus mume [ume]
ref|XP_010052871.1|  PREDICTED: aspartic proteinase                     774   0.0      Eucalyptus grandis [rose gum]
gb|KJB69259.1|  hypothetical protein B456_011G012800                    773   0.0      Gossypium raimondii
gb|ACX55830.1|  aspartic proteinase 2                                   773   0.0      Castanea mollissima
gb|KJB67247.1|  hypothetical protein B456_010G182400                    772   0.0      Gossypium raimondii
gb|KDO62068.1|  hypothetical protein CISIN_1g010230mg                   771   0.0      Citrus sinensis [apfelsine]
ref|XP_009361022.1|  PREDICTED: aspartic proteinase A1-like             768   0.0      Pyrus x bretschneideri [bai li]
ref|XP_007211538.1|  hypothetical protein PRUPE_ppa003924mg             769   0.0      Prunus persica
ref|XP_010546667.1|  PREDICTED: aspartic proteinase A1-like             767   0.0      Tarenaya hassleriana [spider flower]
ref|XP_010035554.1|  PREDICTED: aspartic proteinase A1-like             767   0.0      Eucalyptus grandis [rose gum]
gb|KJB69260.1|  hypothetical protein B456_011G012800                    766   0.0      Gossypium raimondii
gb|KJB67248.1|  hypothetical protein B456_010G182400                    764   0.0      Gossypium raimondii
ref|XP_008224698.1|  PREDICTED: aspartic proteinase-like                764   0.0      Prunus mume [ume]
ref|XP_010553449.1|  PREDICTED: aspartic proteinase A1                  764   0.0      Tarenaya hassleriana [spider flower]
ref|XP_011086196.1|  PREDICTED: aspartic proteinase A1-like isofo...    765   0.0      Sesamum indicum [beniseed]
ref|XP_008380299.1|  PREDICTED: aspartic proteinase A1-like             763   0.0      
ref|XP_006389579.1|  aspartic endopeptidase family protein              763   0.0      Populus trichocarpa [western balsam poplar]
gb|KDO62069.1|  hypothetical protein CISIN_1g010230mg                   763   0.0      Citrus sinensis [apfelsine]
ref|XP_007020768.1|  Aspartic proteinase A1                             763   0.0      
ref|XP_011086197.1|  PREDICTED: aspartic proteinase A1-like isofo...    763   0.0      Sesamum indicum [beniseed]
ref|XP_002279049.1|  PREDICTED: aspartic proteinase A1                  763   0.0      Vitis vinifera
emb|CAC86003.1|  aspartic proteinase                                    762   0.0      Theobroma cacao [chocolate]
ref|XP_006383885.1|  hypothetical protein POPTR_0004s00900g             764   0.0      
ref|XP_002892661.1|  aspartyl protease family protein                   761   0.0      
ref|XP_010458606.1|  PREDICTED: aspartic proteinase A1                  761   0.0      Camelina sativa [gold-of-pleasure]
ref|NP_172655.1|  aspartic proteinase A1                                760   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010686810.1|  PREDICTED: aspartic proteinase A1-like             761   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010060310.1|  PREDICTED: aspartic proteinase A1-like             760   0.0      Eucalyptus grandis [rose gum]
ref|XP_011046961.1|  PREDICTED: aspartic proteinase-like                760   0.0      Populus euphratica
ref|XP_011008023.1|  PREDICTED: aspartic proteinase-like                759   0.0      Populus euphratica
gb|KJB13718.1|  hypothetical protein B456_002G091100                    759   0.0      Gossypium raimondii
gb|AAC49730.1|  aspartic proteinase                                     758   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010476135.1|  PREDICTED: aspartic proteinase A1-like             759   0.0      Camelina sativa [gold-of-pleasure]
dbj|BAB20971.1|  aspartic proteinase 3                                  758   0.0      Nepenthes alata
ref|XP_011461056.1|  PREDICTED: aspartic proteinase A1-like             758   0.0      Fragaria vesca subsp. vesca
ref|XP_008366439.1|  PREDICTED: aspartic proteinase A1-like isofo...    758   0.0      
ref|XP_008366438.1|  PREDICTED: aspartic proteinase A1-like isofo...    758   0.0      
ref|XP_007049085.1|  Aspartic protease isoform 2                        757   0.0      
ref|XP_010493478.1|  PREDICTED: aspartic proteinase A1-like             756   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_006303952.1|  hypothetical protein CARUB_v10008798mg             755   0.0      
gb|KHG05834.1|  Asparticase                                             753   0.0      Gossypium arboreum [tree cotton]
ref|XP_009118162.1|  PREDICTED: aspartic proteinase A1                  753   0.0      Brassica rapa
gb|AGP76185.1|  aspartic proteinase                                     753   0.0      Brassica rapa subsp. chinensis [bok-choy]
gb|ACN24614.1|  aspartic acid protease                                  753   0.0      Phaseolus vulgaris [French bean]
gb|KJB13723.1|  hypothetical protein B456_002G091100                    751   0.0      Gossypium raimondii
ref|XP_006417290.1|  hypothetical protein EUTSA_v10007418mg             751   0.0      Eutrema salsugineum [saltwater cress]
gb|AAB03108.1|  aspartic protease                                       751   0.0      Brassica napus [oilseed rape]
emb|CDY34819.1|  BnaA09g47450D                                          755   0.0      Brassica napus [oilseed rape]
ref|XP_009110686.1|  PREDICTED: aspartic proteinase A1-like             748   0.0      Brassica rapa
ref|XP_008229973.1|  PREDICTED: aspartic proteinase A1-like             748   0.0      Prunus mume [ume]
emb|CDY21021.1|  BnaA08g25040D                                          748   0.0      Brassica napus [oilseed rape]
ref|XP_007215237.1|  hypothetical protein PRUPE_ppa004349mg             747   0.0      Prunus persica
emb|CDY31221.1|  BnaC08g15160D                                          750   0.0      Brassica napus [oilseed rape]
gb|KJB22150.1|  hypothetical protein B456_004G031800                    746   0.0      Gossypium raimondii
ref|XP_008797519.1|  PREDICTED: aspartic proteinase oryzasin-1-like     745   0.0      Phoenix dactylifera
gb|KHN33009.1|  Aspartic proteinase                                     744   0.0      Glycine soja [wild soybean]
ref|XP_008349314.1|  PREDICTED: aspartic proteinase-like                744   0.0      
ref|NP_176419.2|  aspartic proteinase A2                                744   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_003546159.1|  PREDICTED: aspartic proteinase-like                744   0.0      Glycine max [soybeans]
gb|KHG04193.1|  Asparticase                                             744   0.0      Gossypium arboreum [tree cotton]
gb|AAB03843.2|  aspartic proteinase                                     743   0.0      Vigna unguiculata
ref|XP_008800700.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    742   0.0      Phoenix dactylifera
sp|O04057.1|ASPR_CUCPE  RecName: Full=Aspartic proteinase; Flags:...    742   0.0      Cucurbita pepo
gb|KDO78303.1|  hypothetical protein CISIN_1g010233mg                   741   0.0      Citrus sinensis [apfelsine]
ref|XP_008800699.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    743   0.0      Phoenix dactylifera
ref|XP_009357472.1|  PREDICTED: aspartic proteinase-like                741   0.0      Pyrus x bretschneideri [bai li]
ref|XP_009353298.1|  PREDICTED: aspartic proteinase A1-like             740   0.0      Pyrus x bretschneideri [bai li]
ref|XP_011100273.1|  PREDICTED: cyprosin-like                           739   0.0      Sesamum indicum [beniseed]
dbj|BAB20970.1|  aspartic proteinase 2                                  739   0.0      Nepenthes alata
ref|XP_002886481.1|  aspartyl protease family protein                   737   0.0      
ref|XP_007049084.1|  Aspartic proteinase A1 isoform 1                   738   0.0      
ref|XP_003534602.1|  PREDICTED: aspartic proteinase                     736   0.0      Glycine max [soybeans]
ref|XP_009347130.1|  PREDICTED: aspartic proteinase A1-like             736   0.0      Pyrus x bretschneideri [bai li]
ref|XP_010418210.1|  PREDICTED: aspartic proteinase A2 isoform X1       736   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010430270.1|  PREDICTED: aspartic proteinase A2-like             735   0.0      Camelina sativa [gold-of-pleasure]
gb|KDO62072.1|  hypothetical protein CISIN_1g010230mg                   733   0.0      Citrus sinensis [apfelsine]
ref|XP_008342027.1|  PREDICTED: aspartic proteinase A1-like             735   0.0      Malus domestica [apple tree]
gb|KHN35722.1|  Aspartic proteinase                                     733   0.0      Glycine soja [wild soybean]
ref|XP_003567869.1|  PREDICTED: phytepsin                               732   0.0      Brachypodium distachyon [annual false brome]
ref|XP_006654801.1|  PREDICTED: aspartic proteinase oryzasin-1-like     732   0.0      
ref|XP_010046321.1|  PREDICTED: aspartic proteinase A1-like             732   0.0      Eucalyptus grandis [rose gum]
ref|XP_006391910.1|  hypothetical protein EUTSA_v10023414mg             731   0.0      Eutrema salsugineum [saltwater cress]
emb|CBI23210.3|  unnamed protein product                                728   0.0      Vitis vinifera
ref|XP_003529645.1|  PREDICTED: aspartic proteinase-like isoform X1     731   0.0      Glycine max [soybeans]
ref|XP_009395027.1|  PREDICTED: aspartic proteinase oryzasin-1-like     731   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006600236.1|  PREDICTED: aspartic proteinase 1 isoform X1        730   0.0      
ref|XP_010924299.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    731   0.0      
ref|XP_004507671.1|  PREDICTED: aspartic proteinase-like isoform X1     729   0.0      Cicer arietinum [garbanzo]
emb|CDY08632.1|  BnaC04g19410D                                          729   0.0      Brassica napus [oilseed rape]
ref|XP_009123365.1|  PREDICTED: aspartic proteinase A2 isoform X1       729   0.0      Brassica rapa
ref|XP_009358756.1|  PREDICTED: aspartic proteinase-like                728   0.0      Pyrus x bretschneideri [bai li]
ref|NP_001237064.1|  aspartic proteinase 1 precursor                    728   0.0      
gb|AFH58568.1|  aspartic acid protease                                  727   0.0      Ananas comosus
ref|NP_001056348.1|  Os05g0567100                                       727   0.0      
emb|CDY24888.1|  BnaA03g59920D                                          727   0.0      Brassica napus [oilseed rape]
ref|XP_009410967.1|  PREDICTED: aspartic proteinase oryzasin-1-like     726   0.0      Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAA06876.1|  aspartic protease                                      726   0.0      Oryza sativa [red rice]
dbj|BAB20969.1|  aspartic proteinase 1                                  726   0.0      Nepenthes alata
ref|XP_012087602.1|  PREDICTED: aspartic proteinase A1-like isofo...    725   0.0      Jatropha curcas
ref|XP_003610462.1|  Aspartic proteinase                                725   0.0      Medicago truncatula
ref|XP_008647844.1|  PREDICTED: aspartic proteinase oryzasin-1 is...    723   0.0      Zea mays [maize]
gb|KDO54711.1|  hypothetical protein CISIN_1g009634mg                   724   0.0      Citrus sinensis [apfelsine]
ref|XP_006469663.1|  PREDICTED: aspartic proteinase-like                723   0.0      Citrus sinensis [apfelsine]
ref|XP_010926197.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    723   0.0      Elaeis guineensis
ref|XP_008371074.1|  PREDICTED: aspartic proteinase                     722   0.0      
ref|XP_006364164.1|  PREDICTED: aspartic proteinase-like                721   0.0      Solanum tuberosum [potatoes]
ref|NP_001148782.1|  aspartic proteinase oryzasin-1 precursor           721   0.0      Zea mays [maize]
ref|XP_007147707.1|  hypothetical protein PHAVU_006G147900g             723   0.0      Phaseolus vulgaris [French bean]
ref|XP_009600571.1|  PREDICTED: cyprosin-like                           721   0.0      Nicotiana tomentosiformis
ref|XP_012087600.1|  PREDICTED: aspartic proteinase A1-like isofo...    721   0.0      Jatropha curcas
gb|KGN64503.1|  Aspartic proteinase                                     719   0.0      Cucumis sativus [cucumbers]
ref|XP_004151126.1|  PREDICTED: aspartic proteinase A1-like             720   0.0      Cucumis sativus [cucumbers]
emb|CAA57510.1|  cyprosin                                               720   0.0      Cynara cardunculus [cardoon]
ref|XP_009394234.1|  PREDICTED: aspartic proteinase oryzasin-1-like     720   0.0      Musa acuminata subsp. malaccensis [pisang utan]
gb|ABG37021.1|  aspartic protease                                       719   0.0      Nicotiana tabacum [American tobacco]
ref|XP_006301275.1|  hypothetical protein CARUB_v10021675mg             718   0.0      Capsella rubella
gb|KHN03495.1|  Aspartic proteinase                                     718   0.0      Glycine soja [wild soybean]
ref|XP_004961190.1|  PREDICTED: aspartic proteinase oryzasin-1-like     717   0.0      Setaria italica
gb|AJA72485.1|  arctiumsin                                              717   0.0      Arctium minus
ref|XP_004243484.1|  PREDICTED: cyprosin-like                           716   0.0      Solanum lycopersicum
ref|XP_004293311.1|  PREDICTED: aspartic proteinase A1                  716   0.0      Fragaria vesca subsp. vesca
ref|XP_009415269.1|  PREDICTED: aspartic proteinase oryzasin-1-like     714   0.0      Musa acuminata subsp. malaccensis [pisang utan]
emb|CAA70340.1|  aspartic proteinase                                    713   0.0      Centaurea calcitrapa
ref|XP_004486175.1|  PREDICTED: aspartic proteinase-like isoform X1     713   0.0      Cicer arietinum [garbanzo]
gb|KHG16917.1|  Asparticase                                             713   0.0      Gossypium arboreum [tree cotton]
emb|CAM12780.1|  aspartic proteinase                                    711   0.0      Fagopyrum esculentum
gb|AFB73927.2|  preprocirsin                                            710   0.0      Cirsium vulgare
ref|NP_001150729.1|  aspartic proteinase oryzasin-1 precursor           711   0.0      Zea mays [maize]
gb|KJB13719.1|  hypothetical protein B456_002G091100                    709   0.0      Gossypium raimondii
gb|AAV84085.2|  aspartic proteinase 9                                   709   0.0      Fagopyrum esculentum
gb|AGE15494.1|  preprosilpepsin 1                                       709   0.0      Silybum marianum [holy thistle]
emb|CAA48939.1|  cyprosin                                               707   0.0      Cynara cardunculus [cardoon]
ref|XP_009419881.1|  PREDICTED: aspartic proteinase oryzasin-1-like     708   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006838131.1|  PREDICTED: cyprosin                                707   0.0      Amborella trichopoda
ref|XP_009123370.1|  PREDICTED: aspartic proteinase A2 isoform X2       706   0.0      Brassica rapa
gb|KJB13722.1|  hypothetical protein B456_002G091100                    705   0.0      Gossypium raimondii
emb|CDP10762.1|  unnamed protein product                                704   0.0      Coffea canephora [robusta coffee]
ref|XP_002872693.1|  aspartyl protease family protein                   703   0.0      
gb|AFX73039.1|  preprogaline A                                          702   0.0      Galium verum
dbj|BAA76870.1|  aspartic proteinase                                    700   0.0      Helianthus annuus
ref|XP_010455726.1|  PREDICTED: aspartic proteinase A3 isoform X1       698   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_006840365.1|  PREDICTED: aspartic proteinase A1                  697   0.0      Amborella trichopoda
ref|XP_011006459.1|  PREDICTED: cyprosin-like isoform X2                697   0.0      Populus euphratica
sp|P42210.1|ASPR_HORVU  RecName: Full=Phytepsin; AltName: Full=As...    696   0.0      Hordeum vulgare [barley]
ref|NP_192355.1|  aspartic proteinase A3                                696   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287958.1|  PREDICTED: aspartic proteinase A1-like             696   0.0      Fragaria vesca subsp. vesca
gb|AHB32105.1|  aspartic proteinase                                     695   0.0      Camellia sinensis [black tea]
pdb|1QDM|A  Chain A, Crystal Structure Of Prophytepsin, A Zymogen...    692   0.0      Hordeum vulgare [barley]
ref|XP_010496363.1|  PREDICTED: aspartic proteinase A3-like             693   0.0      
ref|XP_008784384.1|  PREDICTED: aspartic proteinase oryzasin-1-like     693   0.0      Phoenix dactylifera
gb|KEH36904.1|  fungal proteinase A, aspartic proteinase superfam...    693   0.0      Medicago truncatula
dbj|BAE20413.1|  aspartic proteinase                                    692   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_002302872.2|  aspartic endopeptidase family protein              692   0.0      
ref|XP_010432791.1|  PREDICTED: aspartic proteinase A3-like isofo...    691   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_009114571.1|  PREDICTED: aspartic proteinase A3 isoform X1       691   0.0      Brassica rapa
emb|CDY16668.1|  BnaA09g20460D                                          691   0.0      Brassica napus [oilseed rape]
ref|XP_006286432.1|  hypothetical protein CARUB_v10003637mg             690   0.0      
ref|XP_010455729.1|  PREDICTED: aspartic proteinase A3 isoform X2       689   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010667516.1|  PREDICTED: aspartic proteinase A1-like             689   0.0      Beta vulgaris subsp. vulgaris [field beet]
sp|P40782.2|CYPR1_CYNCA  RecName: Full=Cyprosin; Flags: Precursor       686   0.0      Cynara cardunculus [cardoon]
gb|AFK46704.1|  unknown                                                 687   0.0      Medicago truncatula
ref|NP_001190671.1|  aspartic proteinase A3                             687   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396692.1|  hypothetical protein EUTSA_v10028587mg             686   0.0      Eutrema salsugineum [saltwater cress]
emb|CDX94554.1|  BnaC09g22820D                                          686   0.0      
ref|XP_006396693.1|  hypothetical protein EUTSA_v10028587mg             686   0.0      Eutrema salsugineum [saltwater cress]
gb|KDO78302.1|  hypothetical protein CISIN_1g010233mg                   682   0.0      Citrus sinensis [apfelsine]
ref|XP_011006458.1|  PREDICTED: cyprosin-like isoform X1                684   0.0      Populus euphratica
ref|XP_010432806.1|  PREDICTED: aspartic proteinase A3-like isofo...    681   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010529449.1|  PREDICTED: aspartic proteinase A3                  681   0.0      Tarenaya hassleriana [spider flower]
ref|XP_009421489.1|  PREDICTED: aspartic proteinase oryzasin-1-like     681   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009134301.1|  PREDICTED: aspartic proteinase A3-like             679   0.0      Brassica rapa
emb|CDX90864.1|  BnaA03g25440D                                          678   0.0      
gb|KDO62073.1|  hypothetical protein CISIN_1g010230mg                   676   0.0      Citrus sinensis [apfelsine]
ref|XP_010916100.1|  PREDICTED: aspartic proteinase oryzasin-1-like     677   0.0      Elaeis guineensis
ref|XP_009390744.1|  PREDICTED: aspartic proteinase oryzasin-1-like     676   0.0      
ref|NP_001043786.1|  Os01g0663400                                       674   0.0      
gb|KJB67250.1|  hypothetical protein B456_010G182400                    671   0.0      Gossypium raimondii
ref|XP_009114573.1|  PREDICTED: aspartic proteinase A3 isoform X2       670   0.0      Brassica rapa
ref|XP_006644474.1|  PREDICTED: aspartic proteinase oryzasin-1-like     666   0.0      
ref|XP_004134774.1|  PREDICTED: aspartic proteinase-like                665   0.0      Cucumis sativus [cucumbers]
ref|XP_010473444.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    664   0.0      
ref|XP_008440022.1|  PREDICTED: aspartic proteinase-like isoform X2     665   0.0      Cucumis melo [Oriental melon]
ref|XP_008440021.1|  PREDICTED: aspartic proteinase-like isoform X1     664   0.0      Cucumis melo [Oriental melon]
ref|XP_010418214.1|  PREDICTED: aspartic proteinase A2 isoform X2       661   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_004969436.1|  PREDICTED: aspartic proteinase oryzasin-1-like     662   0.0      Setaria italica
ref|XP_010539213.1|  PREDICTED: aspartic proteinase A3-like isofo...    662   0.0      Tarenaya hassleriana [spider flower]
ref|XP_010539208.1|  PREDICTED: aspartic proteinase A3-like isofo...    661   0.0      Tarenaya hassleriana [spider flower]
ref|XP_010926196.1|  PREDICTED: aspartic proteinase oryzasin-1-like     661   0.0      
ref|XP_006428329.1|  hypothetical protein CICLE_v10011525mg             660   0.0      Citrus clementina [clementine]
gb|KCW46980.1|  hypothetical protein EUGRSUZ_K00787                     658   0.0      Eucalyptus grandis [rose gum]
ref|XP_006447588.1|  hypothetical protein CICLE_v10017754mg             657   0.0      
ref|XP_009416572.1|  PREDICTED: aspartic proteinase-like isoform X2     654   0.0      
gb|KDO45247.1|  hypothetical protein CISIN_1g010486mg                   654   0.0      Citrus sinensis [apfelsine]
gb|KJB13726.1|  hypothetical protein B456_002G091100                    651   0.0      Gossypium raimondii
ref|XP_009416564.1|  PREDICTED: aspartic proteinase-like isoform X1     654   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008800325.1|  PREDICTED: aspartic proteinase-like isoform X1     653   0.0      Phoenix dactylifera
ref|XP_008800328.1|  PREDICTED: aspartic proteinase-like isoform X2     653   0.0      
dbj|BAG16519.1|  putative aspartic protease                             652   0.0      Capsicum chinense [bonnet pepper]
ref|XP_011039044.1|  PREDICTED: aspartic proteinase-like                650   0.0      Populus euphratica
gb|KGN56078.1|  hypothetical protein Csa_3G066750                       650   0.0      Cucumis sativus [cucumbers]
gb|KDO45246.1|  hypothetical protein CISIN_1g010486mg                   648   0.0      Citrus sinensis [apfelsine]
gb|KDO54710.1|  hypothetical protein CISIN_1g009634mg                   646   0.0      Citrus sinensis [apfelsine]
ref|NP_001275049.1|  Asp precursor                                      645   0.0      Solanum tuberosum [potatoes]
gb|AGE15495.1|  preprosilpepsin 2                                       644   0.0      Silybum marianum [holy thistle]
ref|XP_011023864.1|  PREDICTED: aspartic proteinase-like                645   0.0      Populus euphratica
gb|ABR16259.1|  unknown                                                 643   0.0      Picea sitchensis
ref|XP_002319454.2|  aspartic proteinase 2                              642   0.0      Populus trichocarpa [western balsam poplar]
gb|ADE74632.1|  aspartic protease 1                                     642   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009608676.1|  PREDICTED: cyprosin-like                           642   0.0      Nicotiana tomentosiformis
gb|AAC34854.1|  senescence-associated protein 4                         642   0.0      Hemerocallis hybrid cultivar
ref|NP_001234702.1|  aspartic protease precursor                        641   0.0      Solanum lycopersicum
ref|XP_009801963.1|  PREDICTED: cyprosin-like                           640   0.0      Nicotiana sylvestris
gb|KDP23334.1|  hypothetical protein JCGZ_23167                         637   0.0      Jatropha curcas
gb|EMS54428.1|  Aspartic proteinase oryzasin-1                          636   0.0      Triticum urartu
ref|XP_012088818.1|  PREDICTED: aspartic proteinase-like                638   0.0      Jatropha curcas
ref|XP_010042427.1|  PREDICTED: aspartic proteinase-like isoform X2     635   0.0      Eucalyptus grandis [rose gum]
ref|XP_010042419.1|  PREDICTED: aspartic proteinase-like isoform X1     636   0.0      Eucalyptus grandis [rose gum]
ref|XP_003567538.1|  PREDICTED: aspartic proteinase-like                633   0.0      Brachypodium distachyon [annual false brome]
ref|XP_010909333.1|  PREDICTED: aspartic proteinase-like                632   0.0      Elaeis guineensis
ref|XP_010324003.1|  PREDICTED: aspartic protease precursor isofo...    631   0.0      
ref|XP_008246320.1|  PREDICTED: aspartic proteinase-like                630   0.0      Prunus mume [ume]
gb|KCW66977.1|  hypothetical protein EUGRSUZ_F00741                     625   0.0      Eucalyptus grandis [rose gum]
dbj|BAH20208.1|  AT1G11910                                              623   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009771336.1|  PREDICTED: aspartic proteinase A1-like isofo...    628   0.0      Nicotiana sylvestris
ref|XP_007207363.1|  hypothetical protein PRUPE_ppa004505mg             627   0.0      Prunus persica
ref|XP_009771335.1|  PREDICTED: aspartic proteinase A1-like isofo...    628   0.0      Nicotiana sylvestris
gb|AFX73042.1|  preprofigain C                                          620   0.0      Ficus carica
ref|XP_007031269.1|  Aspartic proteinase                                624   0.0      
ref|XP_009792514.1|  PREDICTED: aspartic proteinase-like                618   0.0      Nicotiana sylvestris
ref|XP_009366025.1|  PREDICTED: aspartic proteinase-like isoform X3     622   0.0      Pyrus x bretschneideri [bai li]
ref|XP_009366023.1|  PREDICTED: aspartic proteinase-like isoform X1     622   0.0      Pyrus x bretschneideri [bai li]
ref|XP_009366024.1|  PREDICTED: aspartic proteinase-like isoform X2     622   0.0      Pyrus x bretschneideri [bai li]
ref|XP_008370344.1|  PREDICTED: aspartic proteinase-like                622   0.0      
gb|AFX73040.1|  preprofigain A                                          621   0.0      Ficus carica
ref|NP_001054586.1|  Os05g0137400                                       620   0.0      
gb|KJB26285.1|  hypothetical protein B456_004G235200                    619   0.0      Gossypium raimondii
gb|KDO54714.1|  hypothetical protein CISIN_1g009634mg                   617   0.0      Citrus sinensis [apfelsine]
dbj|BAA02242.1|  aspartic proteinase                                    617   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CAL07969.1|  aspartic proteinase                                    617   0.0      Cynara cardunculus [cardoon]
ref|XP_003633616.1|  PREDICTED: cyprosin-like isoform X2                617   0.0      Vitis vinifera
ref|XP_010659757.1|  PREDICTED: cyprosin-like isoform X1                618   0.0      Vitis vinifera
ref|XP_004302331.1|  PREDICTED: aspartic proteinase-like                617   0.0      
ref|XP_008348384.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    615   0.0      
ref|XP_010659762.1|  PREDICTED: aspartic proteinase A1 isoform X2       616   0.0      
gb|AAT77954.1|  Asp                                                     615   0.0      
ref|XP_008357943.1|  PREDICTED: aspartic proteinase A1-like             612   0.0      
gb|AFX73041.1|  preprofigain B                                          611   0.0      
ref|XP_002276363.3|  PREDICTED: aspartic proteinase A1 isoform X1       616   0.0      
ref|XP_006654022.1|  PREDICTED: aspartic proteinase-like                614   0.0      
ref|XP_011087560.1|  PREDICTED: aspartic proteinase-like isoform X1     614   0.0      
ref|XP_011087561.1|  PREDICTED: aspartic proteinase-like isoform X2     613   0.0      
ref|NP_001152501.1|  retrotransposon protein SINE subclass precursor    613   0.0      
ref|XP_009619374.1|  PREDICTED: cyprosin-like isoform X1                612   0.0      
ref|XP_010241437.1|  PREDICTED: cyprosin-like                           612   0.0      
ref|XP_009619375.1|  PREDICTED: cyprosin-like isoform X2                612   0.0      
ref|XP_010271040.1|  PREDICTED: aspartic proteinase-like isoform X1     612   0.0      
gb|ACF87177.1|  unknown                                                 611   0.0      
ref|XP_004967621.1|  PREDICTED: aspartic proteinase-like isoform X1     611   0.0      
ref|XP_008655134.1|  PREDICTED: retrotransposon protein SINE subc...    612   0.0      
gb|KHG03187.1|  Asparticase                                             612   0.0      
ref|XP_003568979.1|  PREDICTED: aspartic proteinase                     610   0.0      
ref|XP_001767404.1|  predicted protein                                  610   0.0      
gb|ACL54337.1|  unknown                                                 609   0.0      
ref|XP_002524837.1|  Aspartic proteinase precursor, putative            606   0.0      
ref|XP_010926216.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    605   0.0      
gb|EEC70447.1|  hypothetical protein OsI_01478                          607   0.0      
gb|EYU19381.1|  hypothetical protein MIMGU_mgv1a004925mg                607   0.0      
emb|CAE52913.1|  putative vacuaolar aspartic proteinase                 607   0.0      
gb|EMS45962.1|  Aspartic proteinase                                     606   0.0      
ref|NP_001042785.1|  Os01g0290000                                       605   0.0      
emb|CDP15176.1|  unnamed protein product                                605   0.0      
gb|EEE62252.1|  hypothetical protein OsJ_17039                          605   0.0      
dbj|BAB20972.1|  aspartic proteinase 4                                  605   0.0      
dbj|BAJ85473.1|  predicted protein                                      604   0.0      
gb|EYU34027.1|  hypothetical protein MIMGU_mgv1a024943mg                600   0.0      
ref|XP_010233477.1|  PREDICTED: aspartic proteinase oryzasin-1-like     603   0.0      
ref|XP_010271041.1|  PREDICTED: aspartic proteinase-like isoform X2     603   0.0      
ref|XP_004960420.1|  PREDICTED: aspartic proteinase-like                602   0.0      
ref|XP_002512581.1|  Aspartic proteinase precursor, putative            602   0.0      
ref|XP_010674482.1|  PREDICTED: aspartic proteinase-like                601   0.0      
gb|EPS68187.1|  aspartic protease                                       601   0.0      
gb|ABI78942.1|  aspartic protease                                       601   0.0      
dbj|BAE20414.1|  aspartic proteinase                                    600   0.0      
ref|XP_004969250.1|  PREDICTED: aspartic proteinase oryzasin-1-like     600   0.0      
ref|XP_010549203.1|  PREDICTED: aspartic proteinase A1-like isofo...    596   0.0      
ref|XP_007153977.1|  hypothetical protein PHAVU_003G0808001g            590   0.0      
gb|AAV84086.1|  aspartic proteinase 12                                  590   0.0      
gb|KJB13725.1|  hypothetical protein B456_002G091100                    592   0.0      
ref|XP_010549201.1|  PREDICTED: aspartic proteinase A1-like isofo...    595   0.0      
sp|Q9XFX4.1|CARDB_CYNCA  RecName: Full=Procardosin-B; Contains: R...    594   0.0      
emb|CBI39668.3|  unnamed protein product                                591   0.0      
ref|XP_010232062.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    596   0.0      
ref|XP_006603753.1|  PREDICTED: aspartic proteinase 2 isoform X1        591   0.0      
ref|XP_007145043.1|  hypothetical protein PHAVU_007G205100g             591   0.0      
gb|EPS69682.1|  hypothetical protein M569_05082                         591   0.0      
ref|XP_010232061.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    593   0.0      
gb|KHN43373.1|  Aspartic proteinase                                     591   0.0      
ref|XP_003521645.1|  PREDICTED: aspartic proteinase oryzasin-1 is...    590   0.0      
ref|XP_004494508.1|  PREDICTED: aspartic proteinase-like isoform X1     590   0.0      
ref|NP_001237345.1|  aspartic proteinase 2                              589   0.0      
ref|XP_002891994.1|  hypothetical protein ARALYDRAFT_314946             587   0.0      
gb|KEH43130.1|  fungal proteinase A, aspartic proteinase superfam...    587   0.0      
ref|XP_002307027.2|  hypothetical protein POPTR_0005s00460g             583   0.0      
gb|AGT16815.1|  aspartic proteinase                                     587   0.0      
ref|XP_010511326.1|  PREDICTED: aspartic proteinase A1-like isofo...    585   0.0      
gb|AGT16793.1|  aspartic protease                                       585   0.0      
ref|XP_003626142.1|  Aspartic proteinase                                583   0.0      
ref|XP_010480290.1|  PREDICTED: aspartic proteinase A1-like             582   0.0      
ref|XP_004495808.1|  PREDICTED: aspartic proteinase-like                583   0.0      
gb|AES82362.2|  fungal proteinase A, aspartic proteinase superfam...    582   0.0      
ref|XP_003626143.1|  Aspartic proteinase                                581   0.0      
gb|KJB13720.1|  hypothetical protein B456_002G091100                    576   0.0      
ref|NP_001169605.1|  uncharacterized protein LOC100383486 precursor     583   0.0      
gb|EMT14628.1|  Aspartic proteinase oryzasin-1                          582   0.0      
ref|XP_007163289.1|  hypothetical protein PHAVU_001G222100g             580   0.0      
gb|KDO54713.1|  hypothetical protein CISIN_1g009634mg                   577   0.0      
gb|AAK48494.1|AF259982_1  putative aspartic protease                    579   0.0      
ref|NP_001146573.1|  hypothetical protein                               578   0.0      
ref|XP_008661830.1|  PREDICTED: hypothetical protein isoform X1         578   0.0      
ref|XP_003555776.1|  PREDICTED: aspartic proteinase isoform X1          578   0.0      
sp|Q9XFX3.1|CARDA_CYNCA  RecName: Full=Procardosin-A; Contains: R...    578   0.0      
ref|XP_008673210.1|  PREDICTED: uncharacterized protein LOC100383...    579   0.0      
ref|XP_006302162.1|  hypothetical protein CARUB_v10020172mg             577   0.0      
ref|XP_008673209.1|  PREDICTED: uncharacterized protein LOC100383...    578   0.0      
emb|CDY21302.1|  BnaC03g29860D                                          579   0.0      
gb|KHN26195.1|  Aspartic proteinase                                     575   0.0      
ref|XP_001769293.1|  predicted protein                                  573   0.0      
ref|XP_002456011.1|  hypothetical protein SORBIDRAFT_03g028820          576   0.0      
ref|XP_007036018.1|  Aspartic proteinase, putative isoform 1            573   0.0      
gb|AAB60773.1|  Strong similarity to Brassica aspartic protease (...    570   0.0      
ref|XP_008673208.1|  PREDICTED: uncharacterized protein LOC100383...    575   0.0      
emb|CDM83463.1|  unnamed protein product                                574   0.0      
gb|AFX73038.1|  preprogaline A                                          572   0.0      
gb|AFW79207.1|  hypothetical protein ZEAMMB73_486493                    567   0.0      
ref|XP_003536026.1|  PREDICTED: aspartic proteinase-like isoform X1     572   0.0      
ref|XP_002992068.1|  hypothetical protein SELMODRAFT_186535             566   0.0      
gb|KCW88767.1|  hypothetical protein EUGRSUZ_A01109                     562   0.0      
ref|XP_010094903.1|  Aspartic proteinase                                563   0.0      
ref|XP_006644404.1|  PREDICTED: aspartic proteinase oryzasin-1-like     564   0.0      
ref|XP_002964101.1|  hypothetical protein SELMODRAFT_166719             561   0.0      
gb|EMT27697.1|  Aspartic proteinase oryzasin-1                          554   0.0      
ref|XP_007020767.1|  Aspartic proteinase A1                             551   0.0      
gb|KHG02139.1|  hypothetical protein F383_24995                         550   0.0      
gb|KJB28875.1|  hypothetical protein B456_005G073800                    550   0.0      
ref|XP_004508063.1|  PREDICTED: aspartic proteinase oryzasin-1-like     549   0.0      
ref|XP_002964099.1|  hypothetical protein SELMODRAFT_142401             548   0.0      
ref|XP_010649704.1|  PREDICTED: aspartic proteinase                     548   0.0      
ref|XP_002961603.1|  hypothetical protein SELMODRAFT_230037             544   0.0      
ref|XP_006488712.1|  PREDICTED: aspartic proteinase A2-like             547   0.0      
gb|KJB28874.1|  hypothetical protein B456_005G073800                    551   0.0      
emb|CAN65745.1|  hypothetical protein VITISV_037763                     547   0.0      
ref|XP_006419206.1|  hypothetical protein CICLE_v10004801mg             547   0.0      
gb|KDO72240.1|  hypothetical protein CISIN_1g010195mg                   546   0.0      
ref|XP_007036023.1|  Aspartic proteinase oryzasin-1 isoform 1           546   0.0      
gb|KDO72239.1|  hypothetical protein CISIN_1g010195mg                   546   0.0      
ref|XP_010511323.1|  PREDICTED: aspartic proteinase-like isoform X1     546   0.0      
gb|KEH32400.1|  fungal proteinase A, aspartic proteinase superfam...    545   0.0      
gb|EMT17680.1|  Phytepsin                                               543   0.0      
ref|XP_002971198.1|  hypothetical protein SELMODRAFT_147484             541   0.0      
ref|XP_008390340.1|  PREDICTED: aspartic proteinase-like                543   0.0      
ref|XP_001768042.1|  predicted protein                                  542   0.0      
gb|KHN04670.1|  Aspartic proteinase oryzasin-1                          543   0.0      
ref|XP_008223613.1|  PREDICTED: aspartic proteinase-like                543   0.0      
gb|KDP28021.1|  hypothetical protein JCGZ_19101                         543   0.0      
ref|XP_003546541.1|  PREDICTED: aspartic proteinase A1-like isofo...    542   0.0      
ref|XP_002519342.1|  Aspartic proteinase oryzasin-1 precursor, pu...    541   0.0      
ref|XP_010480288.1|  PREDICTED: aspartic proteinase A1-like isofo...    542   0.0      
ref|XP_012084224.1|  PREDICTED: cyprosin-like                           541   0.0      
gb|AGT17264.1|  aspartic proteinase                                     542   0.0      
gb|KHN19190.1|  Aspartic proteinase oryzasin-1                          540   0.0      
ref|XP_006586640.1|  PREDICTED: uncharacterized protein LOC100500...    540   0.0      
gb|KDO72241.1|  hypothetical protein CISIN_1g010195mg                   540   0.0      
ref|XP_002964100.1|  hypothetical protein SELMODRAFT_438819             539   0.0      
ref|XP_004297063.1|  PREDICTED: cyprosin-like                           539   0.0      
gb|EMS55205.1|  Aspartic proteinase oryzasin-1                          540   0.0      
gb|KJB67251.1|  hypothetical protein B456_010G182400                    534   0.0      
ref|XP_008378421.1|  PREDICTED: aspartic proteinase-like isoform X2     539   0.0      
ref|XP_007138576.1|  hypothetical protein PHAVU_009G220600g             536   0.0      
ref|XP_009353444.1|  PREDICTED: aspartic proteinase oryzasin-1-like     535   0.0      
ref|XP_008378420.1|  PREDICTED: aspartic proteinase-like isoform X1     535   0.0      
ref|XP_009113359.1|  PREDICTED: aspartic proteinase oryzasin-1-like     533   0.0      
ref|XP_007036024.1|  Aspartic proteinase oryzasin-1 isoform 2           532   3e-180   
gb|EMT30433.1|  Aspartic proteinase                                     529   5e-180   
ref|XP_007154514.1|  hypothetical protein PHAVU_003G125000g             530   8e-180   
gb|KDO45249.1|  hypothetical protein CISIN_1g010486mg                   526   1e-179   
gb|EMS45559.1|  Aspartic proteinase                                     526   4e-179   
ref|XP_004488185.1|  PREDICTED: aspartic proteinase-like isoform X2     528   5e-179   
ref|XP_010999327.1|  PREDICTED: aspartic proteinase-like                528   6e-179   
ref|XP_004488184.1|  PREDICTED: aspartic proteinase-like isoform X1     528   6e-179   
ref|XP_010271042.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    526   1e-178   
ref|XP_010415029.1|  PREDICTED: aspartic proteinase-like                527   1e-178   
ref|XP_008378422.1|  PREDICTED: aspartic proteinase-like isoform X3     528   1e-178   
ref|XP_003541325.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    527   1e-178   
gb|KHN45025.1|  Aspartic proteinase oryzasin-1                          527   1e-178   
ref|XP_010038033.1|  PREDICTED: cyprosin-like                           527   2e-178   
gb|AFW79472.1|  hypothetical protein ZEAMMB73_587615                    524   1e-177   
ref|XP_002314336.2|  aspartic proteinase 2                              524   1e-177   
emb|CDO98683.1|  unnamed protein product                                523   3e-177   
ref|XP_006600421.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    521   2e-176   
gb|EPS66177.1|  hypothetical protein M569_08599                         515   6e-176   
dbj|BAJ91748.1|  predicted protein                                      518   1e-175   
ref|XP_010511324.1|  PREDICTED: aspartic proteinase oryzasin-1-li...    519   2e-175   
ref|XP_010024880.1|  PREDICTED: cyprosin-like                           520   5e-175   
gb|AFX67029.1|  aspartic protease                                       511   2e-174   
ref|XP_010098748.1|  Aspartic proteinase                                514   6e-174   
ref|XP_003595434.1|  Aspartic proteinase                                515   8e-174   
gb|EEC78484.1|  hypothetical protein OsI_18377                          509   3e-173   
gb|KJB22152.1|  hypothetical protein B456_004G031800                    510   5e-173   
gb|ABR18322.1|  unknown                                                 511   1e-172   
ref|XP_010271044.1|  PREDICTED: aspartic proteinase A1-like             512   3e-172   
ref|XP_007223268.1|  hypothetical protein PRUPE_ppa004486mg             510   5e-172   
ref|XP_006428328.1|  hypothetical protein CICLE_v10011525mg             504   5e-171   
gb|KDO62074.1|  hypothetical protein CISIN_1g010230mg                   502   5e-171   
ref|XP_009778400.1|  PREDICTED: cyprosin-like isoform X1                508   9e-171   
gb|KJB67249.1|  hypothetical protein B456_010G182400                    503   1e-170   
ref|XP_009778402.1|  PREDICTED: cyprosin-like isoform X2                507   1e-170   
gb|KJB28876.1|  hypothetical protein B456_005G073900                    505   7e-170   
ref|XP_009616098.1|  PREDICTED: cyprosin-like                           504   2e-169   
gb|KEH37701.1|  fungal proteinase A, aspartic proteinase superfam...    501   4e-168   
gb|KEH37702.1|  fungal proteinase A, aspartic proteinase superfam...    501   6e-168   
ref|XP_007036020.1|  Aspartic proteinase, putative isoform 3            494   2e-166   
ref|XP_007036021.1|  Aspartic proteinase, putative isoform 4            494   2e-166   
ref|XP_004234022.1|  PREDICTED: aspartic proteinase A1                  493   2e-165   
gb|AES82361.2|  fungal proteinase A, aspartic proteinase superfam...    489   1e-164   
ref|XP_010694065.1|  PREDICTED: cyprosin-like                           491   2e-164   
ref|XP_003626144.1|  Aspartic proteinase                                488   3e-164   
ref|XP_007036019.1|  Aspartic proteinase A1, putative isoform 2         490   3e-164   
gb|ABD33216.1|  Peptidase A1, pepsin                                    484   3e-163   
emb|CAA54478.1|  aspartic protease                                      478   2e-162   
ref|XP_004247609.1|  PREDICTED: cyprosin                                483   3e-161   
gb|KDO45250.1|  hypothetical protein CISIN_1g010486mg                   476   2e-160   
ref|XP_010480289.1|  PREDICTED: aspartic proteinase A1-like isofo...    479   3e-160   
ref|XP_010271045.1|  PREDICTED: cyprosin-like                           479   3e-159   
ref|XP_010241434.1|  PREDICTED: aspartic proteinase-like isoform X4     479   8e-159   
ref|XP_010241432.1|  PREDICTED: aspartic proteinase-like isoform X2     478   1e-158   
ref|XP_009769839.1|  PREDICTED: aspartic proteinase A1-like             475   1e-158   
ref|XP_006363462.1|  PREDICTED: aspartic proteinase oryzasin-1-like     475   3e-158   
ref|XP_009631812.1|  PREDICTED: cyprosin-like                           474   4e-158   
gb|EEC71139.1|  hypothetical protein OsI_02961                          474   1e-157   
ref|XP_010241436.1|  PREDICTED: cardosin-F-like isoform X5              474   2e-157   
ref|XP_010241433.1|  PREDICTED: aspartic proteinase-like isoform X3     474   3e-157   
ref|XP_010241431.1|  PREDICTED: aspartic proteinase-like isoform X1     474   4e-157   
ref|NP_001043650.1|  Os01g0631900                                       473   4e-157   
ref|XP_009764301.1|  PREDICTED: aspartic proteinase A1-like             466   6e-157   
ref|XP_008664893.1|  PREDICTED: aspartic proteinase oryzasin-1-like     464   7e-157   
ref|XP_008650245.1|  PREDICTED: aspartic proteinase oryzasin-1-like     458   2e-154   
tpg|DAA63137.1|  TPA: hypothetical protein ZEAMMB73_794362              468   5e-154   
gb|AFW74920.1|  hypothetical protein ZEAMMB73_522985                    458   5e-152   
ref|XP_005643881.1|  putative aspartic protease                         459   8e-152   
ref|XP_007036025.1|  Aspartic proteinase oryzasin-1, putative iso...    453   2e-151   
ref|XP_008660718.1|  PREDICTED: aspartic proteinase oryzasin-1-like     449   3e-151   
gb|KDO45248.1|  hypothetical protein CISIN_1g010486mg                   445   4e-148   
ref|XP_007036022.1|  Aspartic proteinase, putative isoform 5            444   2e-147   
ref|XP_005843817.1|  hypothetical protein CHLNCDRAFT_59800              444   1e-145   
ref|XP_001420378.1|  predicted protein                                  438   2e-144   
gb|KDO45252.1|  hypothetical protein CISIN_1g010486mg                   427   8e-143   
dbj|BAA96446.1|  aspartic endopeptidase                                 423   2e-141   
ref|XP_008355757.1|  PREDICTED: aspartic proteinase-like                424   1e-140   
ref|XP_006356104.1|  PREDICTED: aspartic proteinase A1-like             426   1e-139   
ref|XP_006586643.1|  PREDICTED: uncharacterized protein LOC100500...    416   4e-137   
ref|XP_010511325.1|  PREDICTED: aspartic proteinase A1-like isofo...    415   9e-137   
gb|AFW85769.1|  hypothetical protein ZEAMMB73_486102                    410   2e-136   



>emb|CDP04424.1| unnamed protein product [Coffea canephora]
Length=513

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/493 (80%), Positives = 446/493 (90%), Gaps = 1/493 (0%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AFS SNDG VRIGLKK+K D+NNR+A+RLE+K G++LR+S+RKY+   G+ GD  DTDIV
Sbjct  22    AFSSSNDGLVRIGLKKIKFDQNNRLASRLESKDGETLRSSIRKYH-FRGKLGDPADTDIV  80

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKY SSQSST
Sbjct  81    ALKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYKSSQSST  140

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+KNGKSAEIHYGTG+ISGFFSQD+V+VGDLVVK Q FIEAT EP VTFLVAKFDGI+GL
Sbjct  141   YKKNGKSAEIHYGTGAISGFFSQDNVKVGDLVVKDQEFIEATREPSVTFLVAKFDGIMGL  200

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GF+EISVG+A      MV QGLV++P+FSFWLNR  +E+EGGE+VFGGVDP H+KG+HTY
Sbjct  201   GFREISVGNAVPVWYNMVKQGLVKEPVFSFWLNRKTEEEEGGEIVFGGVDPNHFKGKHTY  260

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLIEGKPTG+C GGCSAIADSGTSL+AGP++IITMINHAIGA G+
Sbjct  261   VPVTQKGYWQFDMGDVLIEGKPTGYCEGGCSAIADSGTSLLAGPTTIITMINHAIGASGI  320

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS+ECKAVV+ YGQ+++DLL+ EA+PK ICSQIGLCTF+G +GVSMGIESV DE  G S+
Sbjct  321   VSQECKAVVQQYGQKIVDLLLGEAQPKTICSQIGLCTFDGTQGVSMGIESVADEHAGRSS  380

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L DAMCSACEM VVWMQNQLS+NQTQE IL+Y NELC+RLPSPMGES V+CG +S+MP 
Sbjct  381   GLRDAMCSACEMAVVWMQNQLSQNQTQERILNYANELCDRLPSPMGESSVECGSISSMPK  440

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGKVFDL+P EYILKVGEG+AAQCISGFT LD+PPPRGPLWILGDVFMGRYHTV 
Sbjct  441   VSFTIGGKVFDLAPEEYILKVGEGAAAQCISGFTGLDMPPPRGPLWILGDVFMGRYHTVL  500

Query  205   DYGKMRVGFAEAA  167
             DYGKMRVGFAEAA
Sbjct  501   DYGKMRVGFAEAA  513



>ref|XP_009629448.1| PREDICTED: aspartic proteinase-like [Nicotiana tomentosiformis]
Length=512

 Score =   839 bits (2168),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/493 (79%), Positives = 442/493 (90%), Gaps = 0/493 (0%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S SNDG VRIGLKK+K D+NNR+AAR+E+K G+++RAS+RKY N HG  G  +DTDIV
Sbjct  20    ALSTSNDGLVRIGLKKIKFDQNNRLAARVESKEGEAVRASIRKYNNFHGNLGASEDTDIV  79

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQYFGEIG+G+PPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKY SSQSST
Sbjct  80    ALKNYMDAQYFGEIGIGSPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYKSSQSST  139

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+KNGKSA I YGTG+ISGFFSQDSV+VGDL+V++Q FIEAT EP VTFLVAKFDGILGL
Sbjct  140   YKKNGKSAAIRYGTGAISGFFSQDSVKVGDLIVQNQEFIEATREPSVTFLVAKFDGILGL  199

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      MV QGLV++P+FSFWLNRN +E EGGE+VFGGVDP HYKG+HTY
Sbjct  200   GFQEISVGNAVPVWYNMVKQGLVKEPVFSFWLNRNTKEDEGGEIVFGGVDPNHYKGKHTY  259

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVT+KGYWQFDMG+VLI+G+ TG+C  GCSAIADSGTSL+AGP+++ITMINHAIGA GV
Sbjct  260   VPVTRKGYWQFDMGDVLIDGQATGYCDNGCSAIADSGTSLLAGPTTVITMINHAIGASGV  319

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS++CKAVVE YGQ ++D+L+ EA PKKICSQ+GLCTF+G RG+SMGIESVVDE  G S+
Sbjct  320   VSQQCKAVVEQYGQTIMDMLLAEAHPKKICSQVGLCTFDGTRGISMGIESVVDENAGKSS  379

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              LHDAMCSACEM VVWMQNQL +NQTQE IL+YVNELC RLPSPMG+S VDCGKLS MPS
Sbjct  380   GLHDAMCSACEMAVVWMQNQLRQNQTQERILNYVNELCERLPSPMGQSAVDCGKLSGMPS  439

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGG+ FDLSP EYILKVGEG AAQCISGF ALDVPPPRGPLWILGDVFMGRYHTVF
Sbjct  440   VSFTIGGRTFDLSPEEYILKVGEGPAAQCISGFIALDVPPPRGPLWILGDVFMGRYHTVF  499

Query  205   DYGKMRVGFAEAA  167
             D+GK+RVGFAEAA
Sbjct  500   DFGKLRVGFAEAA  512



>ref|XP_006348142.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=511

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/493 (79%), Positives = 441/493 (89%), Gaps = 1/493 (0%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AFS SNDG VRIGLKK+K D+NNR+AARLE+K  ++LRAS+RKY N  G  G  +DTDIV
Sbjct  20    AFSTSNDGLVRIGLKKIKYDQNNRLAARLESKEAEALRASIRKY-NFRGDLGASEDTDIV  78

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFSVPC FHSKY SSQSST
Sbjct  79    ALKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSVPCLFHSKYKSSQSST  138

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+KNG SA IHYGTG+ISGFFSQD+VQVGDLVVK+Q FIEAT EP VTFLVAKFDGILGL
Sbjct  139   YKKNGTSAAIHYGTGAISGFFSQDNVQVGDLVVKNQEFIEATREPSVTFLVAKFDGILGL  198

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GF+EISVG+A      MV QGLV++P+FSFWLNRN +E++GGE+VFGGVDPKH++G+HTY
Sbjct  199   GFREISVGNAVPVWYNMVKQGLVKEPVFSFWLNRNKEEEKGGEIVFGGVDPKHFRGKHTY  258

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI+G+ TG+C GGCSAIADSGTSL+AGP+++ITMINHAIGA GV
Sbjct  259   VPVTQKGYWQFDMGDVLIDGQATGYCDGGCSAIADSGTSLLAGPTTVITMINHAIGASGV  318

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS++CK VV+ YGQ ++D+L+ EA PKKICSQ+GLCTF+G RGVSMGIESVVDEK G SA
Sbjct  319   VSQQCKTVVQQYGQTIMDMLLTEANPKKICSQVGLCTFDGTRGVSMGIESVVDEKAGKSA  378

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              LHDAMCSACEM VVWMQNQL +NQTQ+ IL+YVNELC RLPSPMG+S VDCGKLS MPS
Sbjct  379   GLHDAMCSACEMAVVWMQNQLRQNQTQDRILNYVNELCERLPSPMGQSAVDCGKLSGMPS  438

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IG K FDL+P EYILKVGEG AAQCISGF ALD+PPPRGPLWILGDVFMGRYHTVF
Sbjct  439   VSFTIGSKKFDLAPEEYILKVGEGRAAQCISGFVALDIPPPRGPLWILGDVFMGRYHTVF  498

Query  205   DYGKMRVGFAEAA  167
             D GK+RVGFAEAA
Sbjct  499   DSGKLRVGFAEAA  511



>ref|XP_004232695.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
 ref|XP_010316578.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
Length=511

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/493 (79%), Positives = 442/493 (90%), Gaps = 1/493 (0%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AFS SNDG VRIGLKK+K D+NNR+AARLE+K  ++LRAS+RKY N  G  G  +DTDIV
Sbjct  20    AFSTSNDGLVRIGLKKIKYDQNNRLAARLESKEAEALRASIRKY-NFRGDLGVSEDTDIV  78

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFSVPC FHSKY SSQSST
Sbjct  79    ALKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSVPCLFHSKYKSSQSST  138

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+KNG SA IHYGTG+ISGFFSQD+V+VGDLVVK+Q FIEAT EP VTFLVAKFDGILGL
Sbjct  139   YKKNGTSAAIHYGTGAISGFFSQDNVKVGDLVVKNQEFIEATREPSVTFLVAKFDGILGL  198

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GF+EISVG+A      MV QGLV++P+FSFWLNRN +E++GGE+VFGGVDPKH++G+HTY
Sbjct  199   GFREISVGNAVPVWYNMVKQGLVKEPVFSFWLNRNKEEEKGGEIVFGGVDPKHFRGKHTY  258

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI+G+ TG+C GGCSAIADSGTSL+AGP+++ITMINHAIGA GV
Sbjct  259   VPVTQKGYWQFDMGDVLIDGQATGYCDGGCSAIADSGTSLLAGPTTVITMINHAIGASGV  318

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS++CK VV+ YGQ ++D+L+ EA PKKICSQ+GLCTF+G RGVSMGIESVVDEK G SA
Sbjct  319   VSQQCKTVVQQYGQTIMDMLLTEANPKKICSQVGLCTFDGTRGVSMGIESVVDEKAGKSA  378

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              LHDAMCSACEM VVWMQNQL +NQTQ+ IL+YVNELC RLPSPMG+S VDCGKLS MPS
Sbjct  379   GLHDAMCSACEMAVVWMQNQLRQNQTQDRILNYVNELCERLPSPMGQSAVDCGKLSGMPS  438

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGK FDL+P EYILKVGEG AAQCISGF ALD+PPPRGPLWILGDVFMGRYHTVF
Sbjct  439   VSFTIGGKKFDLAPEEYILKVGEGRAAQCISGFIALDIPPPRGPLWILGDVFMGRYHTVF  498

Query  205   DYGKMRVGFAEAA  167
             D GK+RVGFAEAA
Sbjct  499   DSGKLRVGFAEAA  511



>ref|XP_009797823.1| PREDICTED: aspartic proteinase [Nicotiana sylvestris]
 ref|XP_009797831.1| PREDICTED: aspartic proteinase [Nicotiana sylvestris]
Length=512

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/489 (80%), Positives = 437/489 (89%), Gaps = 0/489 (0%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             SNDG VRIGLKK+K D+NNR+AAR+E+K G++LRAS RKY NL G  G  +DTDIV LKN
Sbjct  24    SNDGLVRIGLKKIKFDQNNRLAARVESKEGEALRASFRKYNNLRGNLGASEDTDIVALKN  83

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YMDAQYFGEIG+G+PPQKFTVIFDTGSSNLWVPSSKCYFSVPC FHSKY SSQSSTY+KN
Sbjct  84    YMDAQYFGEIGIGSPPQKFTVIFDTGSSNLWVPSSKCYFSVPCLFHSKYKSSQSSTYKKN  143

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKSA I YGTG+ISGFFSQDSV+VGDLVVK+Q FIEAT EP VTFLVAKFDGILGLGFQE
Sbjct  144   GKSAAIRYGTGAISGFFSQDSVKVGDLVVKNQEFIEATREPSVTFLVAKFDGILGLGFQE  203

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG+A      MV QGLV++P+FSFWLNRN +E EGGE+VFGGVDP HYKG+HTYVPVT
Sbjct  204   ISVGNAVPVWYNMVKQGLVKEPVFSFWLNRNTEEDEGGEIVFGGVDPNHYKGKHTYVPVT  263

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             +KGYWQFDMG+VLI+G+ TG+C  GCSAIADSGTSL+AGP++++TMINHAIGA GVVS++
Sbjct  264   RKGYWQFDMGDVLIDGQATGYCDNGCSAIADSGTSLLAGPTTVVTMINHAIGASGVVSQQ  323

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHD  554
             CKAVVE YGQ ++D+L+ EA PKKICSQ+GLCTF+G RGVSMGIESVVDE  G S+ LHD
Sbjct  324   CKAVVEQYGQTIMDMLLAEAHPKKICSQVGLCTFDGTRGVSMGIESVVDENAGKSSGLHD  383

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
             AMCSACEM VVWMQNQL +NQTQE IL+YVNELC RLPSPMG+S VDCGKLS MPSVSF+
Sbjct  384   AMCSACEMAVVWMQNQLRQNQTQERILNYVNELCERLPSPMGQSAVDCGKLSGMPSVSFT  443

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IGG+ FDLSP EYILKVGEG AAQCISGF ALDVPPPRGPLWILGDVFMGRYHTVFD GK
Sbjct  444   IGGRTFDLSPEEYILKVGEGPAAQCISGFIALDVPPPRGPLWILGDVFMGRYHTVFDSGK  503

Query  193   MRVGFAEAA  167
             +RVGFAEAA
Sbjct  504   LRVGFAEAA  512



>ref|XP_009587050.1| PREDICTED: aspartic proteinase-like [Nicotiana tomentosiformis]
Length=510

 Score =   827 bits (2136),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/491 (79%), Positives = 436/491 (89%), Gaps = 1/491 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SNDG +RIGLKKMK D+NNR+AAR+E+K GD LRAS+RKY N  G+ GD +DTDIV L
Sbjct  21    SSSNDGLMRIGLKKMKFDQNNRLAARIESKEGDVLRASIRKY-NFRGKLGDSEDTDIVAL  79

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSK+ SS+SSTY+
Sbjct  80    KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKFKSSESSTYK  139

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGKSA I YG+G+ISGFFSQD+V+VGDLVV  Q FIEAT EP VTFLVAKFDGILGLGF
Sbjct  140   KNGKSAAIQYGSGAISGFFSQDNVKVGDLVVTDQEFIEATREPSVTFLVAKFDGILGLGF  199

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVG+A      MV QGL++DP+FSFWLNRN +E++GGE+VFGGVDP HYKGE TYVP
Sbjct  200   QEISVGNAVPVWYNMVQQGLIKDPVFSFWLNRNTEEEQGGEIVFGGVDPNHYKGEITYVP  259

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VT KGYWQFDMG+VLIEGK TG+C  GCSAIADSGTSL+AGP++IITMIN AIGA GV S
Sbjct  260   VTHKGYWQFDMGDVLIEGKATGYCESGCSAIADSGTSLLAGPTTIITMINQAIGASGVAS  319

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             ++CK+VVE YGQ ++DLL+ EA PKKICSQ+G+CTF+GNRGVSMGIESVVDEK G S  L
Sbjct  320   QQCKSVVEQYGQTIMDLLLAEAHPKKICSQVGVCTFDGNRGVSMGIESVVDEKAGRSTGL  379

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
              D MCSACEM V+WM+NQL +NQTQ+ IL+YVNELC RLPSP+GES VDCGKLS+MP+VS
Sbjct  380   QDGMCSACEMAVIWMENQLRQNQTQDRILNYVNELCERLPSPLGESAVDCGKLSSMPTVS  439

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGKVFDL P EYILKVGEG+ AQCISGFT LD+PPPRGPLWILGDVFMGRYHTVFDY
Sbjct  440   FTIGGKVFDLVPKEYILKVGEGAKAQCISGFTGLDIPPPRGPLWILGDVFMGRYHTVFDY  499

Query  199   GKMRVGFAEAA  167
             GK+RVGFAEAA
Sbjct  500   GKLRVGFAEAA  510



>ref|XP_003632941.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 ref|XP_002262915.2| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 ref|XP_010655376.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
Length=514

 Score =   817 bits (2111),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/490 (78%), Positives = 438/490 (89%), Gaps = 2/490 (0%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             + DG  RIGLKKMK+D+N+++AARLE+K G+SLRAS+RKY+  HG  GD QDTDIVGLKN
Sbjct  26    TTDGLFRIGLKKMKLDQNDQLAARLESKEGESLRASIRKYFR-HGNLGDSQDTDIVGLKN  84

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFSVPC+FHSKY SSQSSTY KN
Sbjct  85    YMDAQYFGEIGIGTPPQTFTVIFDTGSSNLWVPSSKCYFSVPCYFHSKYKSSQSSTYRKN  144

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKSA+IHYGTG+ISGFFS+D+V+VGDLVVK+Q FIEAT EP VTFLVAKFDGILGLGFQE
Sbjct  145   GKSADIHYGTGAISGFFSEDNVKVGDLVVKNQEFIEATREPSVTFLVAKFDGILGLGFQE  204

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG+A      MV QGLV++P+FSFWLNR   + EGGELVFGGVDP H+KGEHTYVPVT
Sbjct  205   ISVGNAVPVWYNMVKQGLVKEPVFSFWLNRKTDDDEGGELVFGGVDPDHFKGEHTYVPVT  264

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQFDMGEVLI+G+ TG+C+GGC+AIADSGTSL+AGP++++ MINHAIGA GVVS+E
Sbjct  265   QKGYWQFDMGEVLIDGETTGYCAGGCAAIADSGTSLLAGPTAVVAMINHAIGATGVVSQE  324

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLH  557
             CK VV  YG+ ++DLL+ EA P+KICSQIGLCTF+G RGV MGIESVVDEKNG  S+ +H
Sbjct  325   CKTVVAQYGETIMDLLLSEASPQKICSQIGLCTFDGTRGVGMGIESVVDEKNGDKSSGVH  384

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             DA CSACEM VVWMQ+QL +NQT+E IL YVNELC+RLPSPMGES VDC +LS+MP+VS 
Sbjct  385   DAGCSACEMAVVWMQSQLRQNQTKERILEYVNELCDRLPSPMGESAVDCLQLSSMPNVSL  444

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGKVFDLS NEY+LKVGEG+AAQCISGF A+DVPPPRGPLWILGDVFMGRYHTVFDYG
Sbjct  445   TIGGKVFDLSANEYVLKVGEGAAAQCISGFIAMDVPPPRGPLWILGDVFMGRYHTVFDYG  504

Query  196   KMRVGFAEAA  167
              MRVGFAEAA
Sbjct  505   NMRVGFAEAA  514



>ref|XP_004231616.1| PREDICTED: aspartic proteinase [Solanum lycopersicum]
Length=510

 Score =   815 bits (2104),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/491 (77%), Positives = 434/491 (88%), Gaps = 1/491 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SNDGFVRIGLKKMK D+NNR+AARLE+K  D +R S+RKY N  G+ GD +DTDIV L
Sbjct  21    SSSNDGFVRIGLKKMKFDQNNRLAARLESKERDLMRPSIRKY-NFRGKLGDSEDTDIVAL  79

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFH+KY SS SSTY+
Sbjct  80    KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHAKYKSSLSSTYK  139

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNG+SA I YG+G+ISGFFS+D+V+VGDLVV  Q FIEAT EP VTFLVAKFDGILGLGF
Sbjct  140   KNGESAAIQYGSGAISGFFSEDNVKVGDLVVTDQEFIEATREPSVTFLVAKFDGILGLGF  199

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVG+A      MV QGL+++P+FSFWLNRN +E++GGE+VFGGVDP H+KGE TYVP
Sbjct  200   QEISVGNAVPVWYNMVKQGLIKEPVFSFWLNRNTEEEQGGEIVFGGVDPNHFKGEITYVP  259

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VT+KGYWQFDMG+VLI+GK TG+C  GCSAIADSGTSL+AGP+++ITMIN AIGA GV S
Sbjct  260   VTRKGYWQFDMGDVLIDGKATGYCKSGCSAIADSGTSLLAGPTTVITMINQAIGASGVAS  319

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             ++CKAV++ YGQ ++DLL+ EA PKK+CSQ+G+CTF+G  GVSMGIESVV+EK G SA L
Sbjct  320   QQCKAVIQQYGQTIMDLLLAEAHPKKVCSQVGVCTFDGTHGVSMGIESVVNEKAGRSAGL  379

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
             HD MCSACEM VVWM+NQL +NQTQ+ IL Y+NELC RLPSPMGES VDCGKLS+MP+VS
Sbjct  380   HDGMCSACEMAVVWMENQLRQNQTQDRILDYLNELCERLPSPMGESAVDCGKLSSMPTVS  439

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGKVFDLSPNEYILKVGEG  AQCISGF  LDVPPPRGPLWILGD+FMGRYHTVFDY
Sbjct  440   FTIGGKVFDLSPNEYILKVGEGDQAQCISGFIGLDVPPPRGPLWILGDIFMGRYHTVFDY  499

Query  199   GKMRVGFAEAA  167
             GK+RVGFAEAA
Sbjct  500   GKLRVGFAEAA  510



>ref|XP_010252464.1| PREDICTED: aspartic proteinase A1-like [Nelumbo nucifera]
 ref|XP_010252465.1| PREDICTED: aspartic proteinase A1-like [Nelumbo nucifera]
Length=514

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/492 (78%), Positives = 433/492 (88%), Gaps = 2/492 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SNDG +RIGLKK K D+NN +AARLE++ G+ L+AS+RKY  L G  GD  DTD+V L
Sbjct  24    SASNDGLLRIGLKKRKFDQNNLLAARLESEGGEPLKASIRKY-RLRGNLGDSGDTDMVSL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFSV C+FHSKY SSQS+TY+
Sbjct  83    KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSVACYFHSKYKSSQSTTYK  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGKSAEIHYGTG+I+GFFS+D+V+VGDL+VK+Q FIEAT EP +TFLVAKFDGILGLGF
Sbjct  143   KNGKSAEIHYGTGAIAGFFSEDTVKVGDLIVKNQEFIEATREPSITFLVAKFDGILGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVG+A      MVNQGLV++PIFSFW NRN QE+EGGELVFGGVDP H+KG HT+VP
Sbjct  203   QEISVGNAVPVWYNMVNQGLVKEPIFSFWFNRNAQEEEGGELVFGGVDPNHFKGTHTFVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQFDMG+VLI GK TGFC+GGCSAIADSGTSL+AGP++IIT INH IGA GVVS
Sbjct  263   VTQKGYWQFDMGDVLIGGKTTGFCAGGCSAIADSGTSLLAGPTTIITQINHGIGATGVVS  322

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-  563
             +ECKAVV  YG+ +++LL+ E +P K+CSQIGLCTF+G RGVS GIESVVDEKNG S+  
Sbjct  323   QECKAVVAQYGETILELLLAETQPMKVCSQIGLCTFDGTRGVSTGIESVVDEKNGKSSGF  382

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             LHDAMCSACEM VVWMQNQL +NQTQ+ ILSY NELC+RLPSPMGES VDC KLS+MP V
Sbjct  383   LHDAMCSACEMAVVWMQNQLRQNQTQDRILSYANELCDRLPSPMGESAVDCDKLSSMPVV  442

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             S +IGGKVFDL+P EYILKVGEG   QCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD
Sbjct  443   SITIGGKVFDLTPEEYILKVGEGPVTQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  502

Query  202   YGKMRVGFAEAA  167
             YG MRVGFAEAA
Sbjct  503   YGNMRVGFAEAA  514



>ref|XP_006350474.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=510

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/491 (77%), Positives = 432/491 (88%), Gaps = 1/491 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SNDGFVRIGLKKMK D NNR+AARLE+K GD LR S+RKY N  G+ GD +DTDIV L
Sbjct  21    SSSNDGFVRIGLKKMKFDHNNRLAARLESKEGDLLRPSIRKY-NFRGKLGDSEDTDIVAL  79

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFH+KY SS SSTY+
Sbjct  80    KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHAKYKSSLSSTYK  139

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNG+SA I YG+G+ISGFFS+D+V+VGDLVV  Q FIEAT EP VTFLVAKFDGILGLGF
Sbjct  140   KNGESAAIQYGSGAISGFFSEDNVKVGDLVVIDQEFIEATREPSVTFLVAKFDGILGLGF  199

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVG+A      MV QGL+++P+FSFWLNRN +E++GGE+VFGGVDP H+KGE TY P
Sbjct  200   QEISVGNAVPVWYNMVKQGLIKEPVFSFWLNRNTEEEQGGEIVFGGVDPNHFKGEITYAP  259

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VT+KGYWQFDMG+VLI+GK TG+C  GCSAIADSGTSL+AGP+++ITMIN AIGA GV S
Sbjct  260   VTRKGYWQFDMGDVLIDGKATGYCKSGCSAIADSGTSLLAGPTTVITMINQAIGASGVAS  319

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             ++CKAV++ YGQ ++DLL+ EA PKK+CSQ+G+CTF+G  GVSMGIESVV+EK G SA  
Sbjct  320   QQCKAVIQQYGQTIMDLLLAEAHPKKVCSQVGVCTFDGTHGVSMGIESVVNEKAGRSAGP  379

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
             HD +CSACEM V+WM+NQL +NQTQ+ IL YVNELC RLPSPMGES VDCGKLS+MP+VS
Sbjct  380   HDGVCSACEMAVIWMENQLRQNQTQDRILDYVNELCERLPSPMGESAVDCGKLSSMPTVS  439

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGKVFDLSPNEYILKVGEG  AQCISGF  LD+PPPRGPLWILGD+FMGRYHTVFDY
Sbjct  440   FTIGGKVFDLSPNEYILKVGEGDKAQCISGFIGLDIPPPRGPLWILGDIFMGRYHTVFDY  499

Query  199   GKMRVGFAEAA  167
             GK+RVGFAEAA
Sbjct  500   GKLRVGFAEAA  510



>ref|XP_011096039.1| PREDICTED: aspartic proteinase-like [Sesamum indicum]
Length=511

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/489 (78%), Positives = 441/489 (90%), Gaps = 3/489 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             SNDG VRIGLK++K+D+NNR+A RLE+K  ++LRAS+RKY NL G+ GD  DTDIV LKN
Sbjct  26    SNDGLVRIGLKRLKLDQNNRVATRLESK--EALRASIRKY-NLRGKLGDAVDTDIVALKN  82

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSVPCFFHSKY SSQSST++KN
Sbjct  83    YMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSAKCYFSVPCFFHSKYKSSQSSTHKKN  142

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GK A IHYGTG+ISGFFS+D+V+VGDLVVK+Q FIEAT EP VTFLVAKFDGILGLGFQE
Sbjct  143   GKPAAIHYGTGAISGFFSEDNVKVGDLVVKNQEFIEATREPSVTFLVAKFDGILGLGFQE  202

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG+A      MV QGLV++P+FSFWLNRN +E+EGGELVFGGVDP H+KG+HTYVPVT
Sbjct  203   ISVGNATPVWYNMVRQGLVKEPVFSFWLNRNVEEEEGGELVFGGVDPNHFKGKHTYVPVT  262

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQFDMG+VLI+GK +G+CSGGCSAIADSGTSLIAGP++++ MINHAIGA GVVS++
Sbjct  263   QKGYWQFDMGDVLIDGKESGYCSGGCSAIADSGTSLIAGPTTVVAMINHAIGASGVVSQQ  322

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHD  554
             CKAVVE YGQ ++DLL+ EA+PKKICSQ+GLCTF+G  GVS GI+SVVDEK+G S+ L D
Sbjct  323   CKAVVEQYGQTIMDLLLAEAQPKKICSQVGLCTFDGTHGVSAGIQSVVDEKDGRSSGLGD  382

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
              MCSACEM VVWMQNQL +NQTQE IL+YVNELC RLPSPMGES VDC  +S+MP++SF+
Sbjct  383   GMCSACEMAVVWMQNQLRQNQTQERILNYVNELCERLPSPMGESAVDCASISSMPTISFT  442

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IGGK FDLSP +YILKVGEG+AAQCISGFT LD+PPPRGPLWILGD+FMGRYHTVFD+GK
Sbjct  443   IGGKPFDLSPEQYILKVGEGAAAQCISGFTGLDIPPPRGPLWILGDMFMGRYHTVFDFGK  502

Query  193   MRVGFAEAA  167
             +RVGFAEAA
Sbjct  503   LRVGFAEAA  511



>ref|XP_007026133.1| Saposin-like aspartyl protease family protein [Theobroma cacao]
 gb|EOY28755.1| Saposin-like aspartyl protease family protein [Theobroma cacao]
Length=514

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/491 (76%), Positives = 433/491 (88%), Gaps = 6/491 (1%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRN--GDLQDTDIVGLK  1457
             NDG VRIGLKKMK+D NNR+AARL++K G++LRAS++KY   H RN  GD ++TDIV LK
Sbjct  27    NDGLVRIGLKKMKLDPNNRLAARLDSKDGEALRASIKKY---HFRNNLGDSEETDIVALK  83

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NYMDAQY+GEIG+GTP QKFTVIFDTGSSNLWVPS+KCYFSV C+FH KY +S SSTY+K
Sbjct  84    NYMDAQYYGEIGIGTPTQKFTVIFDTGSSNLWVPSTKCYFSVACYFHEKYKASDSSTYKK  143

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             +GK A I YGTG+ISGFFS D VQVGDLVVK Q FIEAT EPG+TF+VAKFDGILGLGF+
Sbjct  144   DGKPASIQYGTGAISGFFSYDHVQVGDLVVKDQEFIEATKEPGLTFMVAKFDGILGLGFK  203

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVGDA      M+ QGL+++P+FSFWLNRN  E+ GGE+VFGGVDP HYKG+HTYVPV
Sbjct  204   EISVGDAVPVWYNMIKQGLIKEPVFSFWLNRNVDEEAGGEIVFGGVDPNHYKGKHTYVPV  263

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             TQKGYWQFDMG+VLI  KPTG+C+G C+AIADSGTSL+AGPS++ITMINHAIGA GVVS+
Sbjct  264   TQKGYWQFDMGDVLIADKPTGYCAGSCAAIADSGTSLLAGPSTVITMINHAIGATGVVSQ  323

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-L  560
             ECKAVV+ YGQ +IDLL+ EA+P+KICSQIGLCTFNG  GVS GIESVVDE NG S+  L
Sbjct  324   ECKAVVQQYGQTIIDLLIAEAQPQKICSQIGLCTFNGAHGVSTGIESVVDESNGKSSGVL  383

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
              DAMC ACEM VVWMQNQ+ +NQTQ+ ILSYVNELC+R+P+PMGES VDCG LS+MP++S
Sbjct  384   RDAMCPACEMAVVWMQNQVRQNQTQDRILSYVNELCDRVPNPMGESAVDCGSLSSMPTIS  443

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGKVFDL+P EYILKVGEGS AQCISGFTALD+PPPRGPLWILGD+FMGRYHTVFD+
Sbjct  444   FTIGGKVFDLTPEEYILKVGEGSDAQCISGFTALDIPPPRGPLWILGDIFMGRYHTVFDF  503

Query  199   GKMRVGFAEAA  167
             GK+RVGFAEAA
Sbjct  504   GKLRVGFAEAA  514



>ref|XP_002529926.1| Aspartic proteinase precursor, putative [Ricinus communis]
 gb|EEF32480.1| Aspartic proteinase precursor, putative [Ricinus communis]
Length=514

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/492 (76%), Positives = 433/492 (88%), Gaps = 2/492 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SNDG VRIGLKK K D+NNR+AA+ E+K G++ RAS++KY+ + G  GD +D DIV L
Sbjct  24    SSSNDGLVRIGLKKRKFDQNNRVAAQFESKEGEAFRASIKKYH-IRGNLGDAEDIDIVSL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV C+FHSKY S QSSTY+
Sbjct  83    KNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSGQSSTYK  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGKSA+IHYGTG+ISGFFSQD+V+VG+LV+K+Q FIEAT EP +TFLVAKFDGILGLGF
Sbjct  143   KNGKSADIHYGTGAISGFFSQDNVKVGELVIKNQEFIEATREPSITFLVAKFDGILGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVG+A      MVNQGLV++P+FSFW NRN  E EGGE+VFGG+DP HYKGEHTYVP
Sbjct  203   QEISVGNAVPVWYNMVNQGLVKEPVFSFWFNRNADEDEGGEIVFGGMDPNHYKGEHTYVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQFDMG+VLI+GK TG CS GC+AIADSGTSL+AGP++IIT +NHAIGA GVVS
Sbjct  263   VTQKGYWQFDMGDVLIDGKTTGICSSGCAAIADSGTSLLAGPTTIITEVNHAIGATGVVS  322

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSAD  563
             +ECKAVV  YG+ +I +L+ + +P+KICSQIGLCTF+G+RGVSMGIESVV+EK   V+  
Sbjct  323   QECKAVVAQYGETIIAMLLAKDQPQKICSQIGLCTFDGSRGVSMGIESVVNEKIQEVAGG  382

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             LHDAMCS CEM VVWMQNQL +NQTQE+IL+YVNELC RLPSPMGES VDCG LSTMP+V
Sbjct  383   LHDAMCSTCEMAVVWMQNQLKQNQTQEHILNYVNELCERLPSPMGESAVDCGSLSTMPNV  442

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IGG+VFDL+P +Y+LKVG+G AAQCISGFTALDVPPPRGPLWILGDVFMG +HTVFD
Sbjct  443   SFTIGGRVFDLAPEQYVLKVGDGEAAQCISGFTALDVPPPRGPLWILGDVFMGPFHTVFD  502

Query  202   YGKMRVGFAEAA  167
             YG  RVGFAE A
Sbjct  503   YGNKRVGFAEVA  514



>gb|EYU27762.1| hypothetical protein MIMGU_mgv1a004712mg [Erythranthe guttata]
Length=513

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/489 (78%), Positives = 438/489 (90%), Gaps = 1/489 (0%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             SNDG +RIGLKK+K+D NN +AARLE+K    LRAS+RKY N  G+ GD  DTDIV LKN
Sbjct  26    SNDGLLRIGLKKLKLDHNNGLAARLESKEAKDLRASIRKY-NFRGKLGDGSDTDIVALKN  84

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFSVPC+FHSKY SS+SSTY+KN
Sbjct  85    YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSTKCYFSVPCYFHSKYKSSESSTYKKN  144

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GK+A I YGTG+ISGFFS+D+V++GD+VVK Q FIEAT EP VTFLVAKFDGILGLGF+E
Sbjct  145   GKTAAIRYGTGAISGFFSEDNVKIGDIVVKRQEFIEATREPSVTFLVAKFDGILGLGFKE  204

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG+A      MV QGLV++P+FSFWLNRN +E+EGGELVFGG+DP H+KG+HTYVPVT
Sbjct  205   ISVGNATPVWYNMVKQGLVKEPVFSFWLNRNVEEEEGGELVFGGMDPNHFKGKHTYVPVT  264

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQFDMG+VLI+GK +G+C+GGCSAIADSGTSL+AGP++++TMINHAIGA GVVS+E
Sbjct  265   QKGYWQFDMGDVLIDGKESGYCNGGCSAIADSGTSLLAGPTTVVTMINHAIGAVGVVSQE  324

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHD  554
             CKAVVE YGQ ++DLL+ EA PKKICSQ+GLCTF+G RGVS GIESVVDEK+G S+ L D
Sbjct  325   CKAVVEQYGQTIMDLLLTEAHPKKICSQVGLCTFDGTRGVSAGIESVVDEKDGRSSGLGD  384

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
             AMCSACEM VVWMQNQL  NQTQ+ IL+YVNELC RLPSPMG+S V+CG +S+MPSVSF+
Sbjct  385   AMCSACEMAVVWMQNQLRRNQTQDRILNYVNELCERLPSPMGQSAVECGSISSMPSVSFT  444

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IGGK+FDLSP+EYILKVGEG+AAQCISGF  LD+PPPRGPLWILGD+FMGRYHTVFD GK
Sbjct  445   IGGKIFDLSPHEYILKVGEGAAAQCISGFMGLDIPPPRGPLWILGDMFMGRYHTVFDSGK  504

Query  193   MRVGFAEAA  167
             +RVGFAEAA
Sbjct  505   LRVGFAEAA  513



>ref|XP_011652603.1| PREDICTED: aspartic proteinase [Cucumis sativus]
Length=514

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/492 (75%), Positives = 434/492 (88%), Gaps = 2/492 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SNDG +R+GLKK+ +D  NR+AARLE+K  + L+A+ RKY N +G  G+  DTDIV L
Sbjct  24    SVSNDGLLRVGLKKINLDPENRLAARLESKDAEILKAAFRKY-NPNGNLGESSDTDIVAL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS+KC FSV C FH++Y SS+SSTY+
Sbjct  83    KNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSAKCLFSVACHFHARYKSSRSSTYK  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNG SA I YGTG++SGFFS D+V+VGDLVVK+Q FIEAT EPG+TFLVAKFDG+LGLGF
Sbjct  143   KNGTSASIRYGTGAVSGFFSYDNVKVGDLVVKNQLFIEATREPGLTFLVAKFDGLLGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEI+VG A      MV QGLV++P+FSFWLNRN +E+EGGE+VFGGVDPKHYKG+HTYVP
Sbjct  203   QEIAVGSAVPVWYNMVEQGLVKEPVFSFWLNRNAEEEEGGEIVFGGVDPKHYKGKHTYVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQFDMG+VLI+GKPTG+C GGCSAIADSGTSL+AGP++I+TMINHAIGA GV+S
Sbjct  263   VTQKGYWQFDMGDVLIDGKPTGYCEGGCSAIADSGTSLLAGPTTIVTMINHAIGAKGVMS  322

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-  563
             +ECKAVV+ YGQ ++DLL+ EA PKKICSQI LCTF+G RGVSMGIESVVDE  G S+D 
Sbjct  323   QECKAVVQQYGQTIMDLLLSEADPKKICSQIKLCTFDGTRGVSMGIESVVDENAGKSSDG  382

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             L D MCS CEMTVVWMQNQL +NQT+E I++Y+NELC+R+PSPMG+S VDCG LS+MPSV
Sbjct  383   LRDGMCSVCEMTVVWMQNQLRQNQTKERIINYINELCDRMPSPMGQSAVDCGTLSSMPSV  442

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IG KVFDL+P EYILKVGEG+AAQCISGFTA D+PPPRGPLWILGDVFMGRYHTVFD
Sbjct  443   SFTIGDKVFDLAPEEYILKVGEGAAAQCISGFTAFDIPPPRGPLWILGDVFMGRYHTVFD  502

Query  202   YGKMRVGFAEAA  167
             +GK+RVGFAEAA
Sbjct  503   FGKLRVGFAEAA  514



>ref|XP_006449766.1| hypothetical protein CICLE_v10014941mg [Citrus clementina]
 gb|ESR63006.1| hypothetical protein CICLE_v10014941mg [Citrus clementina]
Length=514

 Score =   795 bits (2053),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/493 (80%), Positives = 440/493 (89%), Gaps = 8/493 (2%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY---YNLHGRNGDLQDTDIVG  1463
             SNDG VRIGLKKMK+D NNR+AARLE+K G++LRASV+KY    NL     D +DTDIV 
Sbjct  26    SNDGLVRIGLKKMKLDPNNRLAARLESKHGEALRASVKKYGFPNNLR----DSEDTDIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV C+FHSKY SSQSSTY
Sbjct  82    LKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACYFHSKYKSSQSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNG+SA I YGTG+I+GFFS DSV+VGDLVVK Q FIEAT EPGVTF+VAKFDGILGLG
Sbjct  142   KKNGESASIQYGTGAIAGFFSYDSVKVGDLVVKDQEFIEATREPGVTFMVAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MV QGL+QDP+FSFWLNRN QE EGGE+VFGGVDP HYKG+HTYV
Sbjct  202   FQEISVGNAVPVWYNMVKQGLIQDPVFSFWLNRNQQEDEGGEIVFGGVDPSHYKGKHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQF+MG+VLI GKPTG+C+G CSAIADSGTSL+AGP+++ITMINHAIGA GVV
Sbjct  262   PVTQKGYWQFNMGDVLIGGKPTGYCAGDCSAIADSGTSLLAGPTTVITMINHAIGASGVV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S++CKAVVE YGQ ++DLL+ EA PKKICSQ+GLCTF+G RGVS GIESVVDE NG S+ 
Sbjct  322   SQQCKAVVEQYGQTILDLLLSEAHPKKICSQMGLCTFDGKRGVSTGIESVVDESNGKSSG  381

Query  562   -LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L++AMCSACEM VVWMQNQL +NQTQENIL YVNELC+R+PSPMGES VDCGKLS+MP 
Sbjct  382   VLNNAMCSACEMAVVWMQNQLQQNQTQENILQYVNELCDRMPSPMGESAVDCGKLSSMPI  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGKVFDLSP EYILKVGEG  AQCISGFTA+DVPPPRGPLWILGDVFMGRYHTVF
Sbjct  442   VSFTIGGKVFDLSPEEYILKVGEGPEAQCISGFTAMDVPPPRGPLWILGDVFMGRYHTVF  501

Query  205   DYGKMRVGFAEAA  167
             D+GK+RVGFAEAA
Sbjct  502   DFGKLRVGFAEAA  514



>gb|EYU33885.1| hypothetical protein MIMGU_mgv1a004716mg [Erythranthe guttata]
Length=513

 Score =   794 bits (2050),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/493 (74%), Positives = 436/493 (88%), Gaps = 1/493 (0%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S+ +DG +RIGLKK+ +D+NNR+AARLE+K G+ LRAS+R+Y +  G+  +  +TDIV
Sbjct  22    AISEPDDGLIRIGLKKLNLDQNNRLAARLESKEGEELRASIRRY-SPRGKTVNNAETDIV  80

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFSV CFFH+KY SSQSST
Sbjct  81    ALKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSTKCYFSVSCFFHTKYKSSQSST  140

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+KNGKSA I YGTG+ISGF S+DSV++G LVVK Q FIEATSEPGVTFLVAKFDGILGL
Sbjct  141   YKKNGKSAAIQYGTGAISGFVSEDSVKIGGLVVKDQEFIEATSEPGVTFLVAKFDGILGL  200

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GF+EISVG++      M+ QGL+++P+FSFWLNRN  +++GGE+VFGG DP HYKG+HTY
Sbjct  201   GFKEISVGNSTPVWYNMLKQGLIKEPVFSFWLNRNVGDEQGGEIVFGGSDPNHYKGQHTY  260

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQF+MG+VLI+GK +G+CSGGCSAIADSGTSL+AGP+++ITMINHAIGA GV
Sbjct  261   VPVTQKGYWQFEMGDVLIDGKESGYCSGGCSAIADSGTSLLAGPTTVITMINHAIGASGV  320

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VSKECK+VV+ YGQ ++DLL+ EA+PKKICSQIGLCTF+G RGVS  IESVVDEK G S+
Sbjct  321   VSKECKSVVDKYGQTIMDLLLAEAKPKKICSQIGLCTFDGTRGVSGAIESVVDEKEGRSS  380

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              + +AMC ACEM VVWMQNQL +N+TQ++IL+YVNELC +LPSPMG+S VDC  +S+MPS
Sbjct  381   GMSEAMCPACEMAVVWMQNQLKQNKTQDHILNYVNELCEKLPSPMGQSAVDCASISSMPS  440

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VS +IGGK FDL+P EYILKVGEG+ AQCISGFT LD+PPPRGPLWILGD+FMGRYHTVF
Sbjct  441   VSLTIGGKKFDLAPKEYILKVGEGAQAQCISGFTGLDIPPPRGPLWILGDIFMGRYHTVF  500

Query  205   DYGKMRVGFAEAA  167
             DYGK+RVGFAEAA
Sbjct  501   DYGKLRVGFAEAA  513



>ref|XP_006467405.1| PREDICTED: aspartic proteinase-like isoform X2 [Citrus sinensis]
 ref|XP_006467406.1| PREDICTED: aspartic proteinase-like isoform X3 [Citrus sinensis]
 gb|KDO78299.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
 gb|KDO78300.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
 gb|KDO78301.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
Length=514

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/492 (79%), Positives = 439/492 (89%), Gaps = 2/492 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SNDG VRIGLKKMK+D NNR+AARLE++ G++LRASV+KY        D +DTDIV L
Sbjct  24    SVSNDGLVRIGLKKMKLDPNNRLAARLESEHGEALRASVKKY-GFPNNLRDSEDTDIVAL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+ CYFSV C+FHSKY SSQSSTY+
Sbjct  83    KNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTNCYFSVACYFHSKYKSSQSSTYK  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNG+SA I YGTG+I+GFFS DSV+VGDLVVK Q FIEAT EPGVTF+VAKFDGILGLGF
Sbjct  143   KNGESASIQYGTGAIAGFFSYDSVKVGDLVVKDQEFIEATREPGVTFMVAKFDGILGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVG+A      MV QGL+QDP+FSFWLNRN QE EGGE+VFGGVDP HYKG+HTYVP
Sbjct  203   QEISVGNAVPVWYNMVKQGLIQDPVFSFWLNRNQQEDEGGEIVFGGVDPNHYKGKHTYVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQF+MG+VLI GKPTG+C+GGCSAIADSGTSL+AGP+++ITMINHAIGA GVVS
Sbjct  263   VTQKGYWQFNMGDVLIGGKPTGYCAGGCSAIADSGTSLLAGPTTVITMINHAIGASGVVS  322

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-  563
             ++CKAVVE YGQ ++DLL+ EA PKKICSQ+GLCTF+G RGVSMGIESVVDE N  S+  
Sbjct  323   QQCKAVVEQYGQTILDLLLFEAHPKKICSQMGLCTFDGKRGVSMGIESVVDESNDKSSGV  382

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             L++AMCSACEM VVWMQNQL +NQTQENIL YVNELC+R+PSPMGES VDCGKLS+MP V
Sbjct  383   LNNAMCSACEMAVVWMQNQLQQNQTQENILQYVNELCDRMPSPMGESAVDCGKLSSMPIV  442

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IGGKVFDLSP EYILKVGEG  AQCISGFTA+DVPPPRGPLWILGDVFMGRYHTVFD
Sbjct  443   SFTIGGKVFDLSPEEYILKVGEGPEAQCISGFTAMDVPPPRGPLWILGDVFMGRYHTVFD  502

Query  202   YGKMRVGFAEAA  167
             +G++RVGFAEAA
Sbjct  503   FGELRVGFAEAA  514



>ref|XP_006467404.1| PREDICTED: aspartic proteinase-like isoform X1 [Citrus sinensis]
Length=598

 Score =   795 bits (2054),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/495 (79%), Positives = 441/495 (89%), Gaps = 8/495 (2%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY---YNLHGRNGDLQDTDI  1469
             S SNDG VRIGLKKMK+D NNR+AARLE++ G++LRASV+KY    NL     D +DTDI
Sbjct  108   SVSNDGLVRIGLKKMKLDPNNRLAARLESEHGEALRASVKKYGFPNNLR----DSEDTDI  163

Query  1468  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSS  1289
             V LKNYMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+ CYFSV C+FHSKY SSQSS
Sbjct  164   VALKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTNCYFSVACYFHSKYKSSQSS  223

Query  1288  TYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILG  1109
             TY+KNG+SA I YGTG+I+GFFS DSV+VGDLVVK Q FIEAT EPGVTF+VAKFDGILG
Sbjct  224   TYKKNGESASIQYGTGAIAGFFSYDSVKVGDLVVKDQEFIEATREPGVTFMVAKFDGILG  283

Query  1108  LGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHT  929
             LGFQEISVG+A      MV QGL+QDP+FSFWLNRN QE EGGE+VFGGVDP HYKG+HT
Sbjct  284   LGFQEISVGNAVPVWYNMVKQGLIQDPVFSFWLNRNQQEDEGGEIVFGGVDPNHYKGKHT  343

Query  928   YVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADG  749
             YVPVTQKGYWQF+MG+VLI GKPTG+C+GGCSAIADSGTSL+AGP+++ITMINHAIGA G
Sbjct  344   YVPVTQKGYWQFNMGDVLIGGKPTGYCAGGCSAIADSGTSLLAGPTTVITMINHAIGASG  403

Query  748   VVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS  569
             VVS++CKAVVE YGQ ++DLL+ EA PKKICSQ+GLCTF+G RGVSMGIESVVDE N  S
Sbjct  404   VVSQQCKAVVEQYGQTILDLLLFEAHPKKICSQMGLCTFDGKRGVSMGIESVVDESNDKS  463

Query  568   AD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             +  L++AMCSACEM VVWMQNQL +NQTQENIL YVNELC+R+PSPMGES VDCGKLS+M
Sbjct  464   SGVLNNAMCSACEMAVVWMQNQLQQNQTQENILQYVNELCDRMPSPMGESAVDCGKLSSM  523

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P VSF+IGGKVFDLSP EYILKVGEG  AQCISGFTA+DVPPPRGPLWILGDVFMGRYHT
Sbjct  524   PIVSFTIGGKVFDLSPEEYILKVGEGPEAQCISGFTAMDVPPPRGPLWILGDVFMGRYHT  583

Query  211   VFDYGKMRVGFAEAA  167
             VFD+G++RVGFAEAA
Sbjct  584   VFDFGELRVGFAEAA  598



>emb|CAC86004.1| aspartic proteinase [Theobroma cacao]
Length=514

 Score =   791 bits (2043),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/489 (75%), Positives = 428/489 (88%), Gaps = 2/489 (0%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  1451
             NDG VRIGLKKMK+D NNR+AARL++K G++LRA ++KY       GD ++TDIV LKNY
Sbjct  27    NDGLVRIGLKKMKLDPNNRLAARLDSKDGEALRAFIKKY-RFRNNLGDSEETDIVALKNY  85

Query  1450  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNG  1271
             MDAQY+GEIG+GTP QKFTVIFDTGSSNLWV S+KCYFSV C+FH KY +S SSTY+K+G
Sbjct  86    MDAQYYGEIGIGTPTQKFTVIFDTGSSNLWVSSTKCYFSVACYFHEKYKASDSSTYKKDG  145

Query  1270  KSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEI  1091
             K A I YGTG+ISGFFS D VQVGDLVVK Q FIEAT EPG+TF+VAKFDGILGLGF+EI
Sbjct  146   KPASIQYGTGAISGFFSYDHVQVGDLVVKDQEFIEATKEPGLTFMVAKFDGILGLGFKEI  205

Query  1090  SVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQ  911
             SVGDA      M+ QGL+++P+FSFWLNRN  E+ GGE+VFGGVDP HYKG+HTYVPVTQ
Sbjct  206   SVGDAVPVWYNMIKQGLIKEPVFSFWLNRNVDEEAGGEIVFGGVDPNHYKGKHTYVPVTQ  265

Query  910   KGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKEC  731
             KGYWQFDMG+VLI  KPTG+C+G C+AIADSGTSL+AGPS++ITMINHAIGA GVVS+EC
Sbjct  266   KGYWQFDMGDVLIADKPTGYCAGSCAAIADSGTSLLAGPSTVITMINHAIGATGVVSQEC  325

Query  730   KAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHD  554
             KAVV+ YG+ +IDLL+ EA+P+KICSQIGLCTFNG  GVS GIESVVDE NG S+  L D
Sbjct  326   KAVVQQYGRTIIDLLIAEAQPQKICSQIGLCTFNGAHGVSTGIESVVDESNGKSSGVLRD  385

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
             AMC ACEM VVWMQNQ+ +NQTQ+ ILSYVNELC+R+P+PMGES VDCG LS+MP++SF+
Sbjct  386   AMCPACEMAVVWMQNQVRQNQTQDRILSYVNELCDRVPNPMGESAVDCGSLSSMPTISFT  445

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IGGKVFDL+P EYILKVGEGS AQCISGFTALD+PPPRGPLWILGD+FMGRYHTVFD+GK
Sbjct  446   IGGKVFDLTPEEYILKVGEGSEAQCISGFTALDIPPPRGPLWILGDIFMGRYHTVFDFGK  505

Query  193   MRVGFAEAA  167
             +RVGFAEAA
Sbjct  506   LRVGFAEAA  514



>ref|XP_008440898.1| PREDICTED: aspartic proteinase [Cucumis melo]
Length=514

 Score =   790 bits (2040),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/492 (75%), Positives = 433/492 (88%), Gaps = 2/492 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SNDG +R+GLKK+K+D  NR+AARLE+K  + L+A+ RKY N +G   +  DTDIV L
Sbjct  24    SVSNDGLLRVGLKKIKLDPENRLAARLESKDAEILKAAFRKY-NPNGNLEESSDTDIVAL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS+KC FSV C FH++Y SS+SSTY+
Sbjct  83    KNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSAKCLFSVACHFHARYKSSRSSTYK  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNG SA I YGTG++SGFFS D+V+VGDLVVK+Q FIEAT EP +TFLVAKFDG+LGLGF
Sbjct  143   KNGTSASIRYGTGAVSGFFSYDNVKVGDLVVKNQLFIEATREPSLTFLVAKFDGLLGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEI+VG A      MV QGLV++P+FSFWLNRN +E+EGGE+VFGGVDPKHYKG+HTYVP
Sbjct  203   QEIAVGSAVPVWYNMVEQGLVKEPVFSFWLNRNAEEEEGGEIVFGGVDPKHYKGKHTYVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQFDMG+VLI+G+PTG+C GGCSAIADSGTSL+AGP++IITMINHAIGA GVVS
Sbjct  263   VTQKGYWQFDMGDVLIDGEPTGYCEGGCSAIADSGTSLLAGPTTIITMINHAIGAKGVVS  322

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-  563
             +ECKAVV+ YGQ ++DLL+ EA PKKICSQI LCTF+G +GVSMGIESV+DE  G S+D 
Sbjct  323   QECKAVVQQYGQTIMDLLLSEADPKKICSQIKLCTFDGTQGVSMGIESVLDENAGKSSDG  382

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             L D MCS CEMTVVWMQNQL +NQT+E I++Y+NELC+R+PSPMG+S VDCGKLS+MPSV
Sbjct  383   LRDGMCSVCEMTVVWMQNQLRQNQTKERIINYINELCDRMPSPMGQSAVDCGKLSSMPSV  442

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IG KVFDL+P EYILKVGEG AAQCISGFTA D+PPPRGPLWILGDVFMGRYHTVFD
Sbjct  443   SFTIGDKVFDLAPEEYILKVGEGVAAQCISGFTAFDIPPPRGPLWILGDVFMGRYHTVFD  502

Query  202   YGKMRVGFAEAA  167
             +GK+RVGFAEAA
Sbjct  503   FGKLRVGFAEAA  514



>ref|XP_010099183.1| Aspartic proteinase [Morus notabilis]
 gb|EXB77055.1| Aspartic proteinase [Morus notabilis]
Length=513

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/491 (76%), Positives = 428/491 (87%), Gaps = 1/491 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S + D  +RIGLKK+K D N+RIAA+L+ K G+SLR S+RKY    GR GD  +TDIV L
Sbjct  24    SATGDSLLRIGLKKVKRDPNDRIAAQLDFKKGESLRDSIRKY-RPRGRLGDAPETDIVAL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV C+FH+KY + QS TY+
Sbjct  83    KNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVSCYFHAKYKAGQSKTYK  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNG +A I YGTGSI GFFS+D+V+VGDLVVK Q FIEATSEPGVTFLVAKFDGILGLGF
Sbjct  143   KNGTAAAIQYGTGSIEGFFSKDNVKVGDLVVKDQEFIEATSEPGVTFLVAKFDGILGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVG+A      MV QGLV++P+FSFWLNR   E EGGELVFGGVDPKH+KG+H YVP
Sbjct  203   QEISVGNAVPVWYNMVVQGLVKEPVFSFWLNRKAGEAEGGELVFGGVDPKHFKGKHLYVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VT+KGYWQFDMG+VLI GKPTG+C GGCSAIADSGTSL+AGPS++I MIN AIGA GVVS
Sbjct  263   VTRKGYWQFDMGDVLIGGKPTGYCDGGCSAIADSGTSLLAGPSTVIAMINSAIGASGVVS  322

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             KECK+VV+ YGQ ++DLL+ +  PKK+CSQIGLCTF+G R VS+GIESVVD+ NG S  L
Sbjct  323   KECKSVVQQYGQNILDLLMAQVHPKKVCSQIGLCTFDGTRVVSIGIESVVDKNNGKSGVL  382

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
             HDAMCSACEMTVVWMQNQL++NQT+E+IL YVNELC+R+P+PMGES VDCG+LS MP V+
Sbjct  383   HDAMCSACEMTVVWMQNQLTQNQTREHILDYVNELCDRVPNPMGESSVDCGRLSLMPKVA  442

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGK+F+LSP EYILKVGEG  AQCISGFT LDVPPPRGPLWILGDVFMGRYHTVFDY
Sbjct  443   FTIGGKIFELSPQEYILKVGEGPQAQCISGFTGLDVPPPRGPLWILGDVFMGRYHTVFDY  502

Query  199   GKMRVGFAEAA  167
             GK+RVGFAEAA
Sbjct  503   GKLRVGFAEAA  513



>ref|XP_010244475.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Nelumbo nucifera]
 ref|XP_010244476.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Nelumbo nucifera]
Length=517

 Score =   789 bits (2038),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/489 (77%), Positives = 424/489 (87%), Gaps = 2/489 (0%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  1451
             NDG  RIGLKKMK+D+NNR+AA L+ +  + LRAS RKY+ L G + D   TDI+ LKNY
Sbjct  30    NDGLFRIGLKKMKLDQNNRLAALLKPEGEEPLRASTRKYH-LGGNHEDSGATDIISLKNY  88

Query  1450  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNG  1271
             MDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV C+FHSKY SS SSTY+KNG
Sbjct  89    MDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSLSSTYKKNG  148

Query  1270  KSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEI  1091
             KSAEI YGTG+I+GFFS+D   VGDLVVK Q FIEAT EPG+TFL AKFDGILGLGFQEI
Sbjct  149   KSAEIQYGTGAIAGFFSEDDANVGDLVVKDQEFIEATREPGLTFLAAKFDGILGLGFQEI  208

Query  1090  SVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQ  911
             SVG+A      MVNQGL+++PIFSFW NRNPQE+EGGE+VFGGVDP HYKG+HTYVPVT+
Sbjct  209   SVGNAVPVWYNMVNQGLIKEPIFSFWFNRNPQEEEGGEIVFGGVDPNHYKGQHTYVPVTR  268

Query  910   KGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKEC  731
             KGYWQFDMG+VLI GK TGFCSGGC+AIADSGTSL+AGPS+IIT INH IGA GVVS+EC
Sbjct  269   KGYWQFDMGDVLIGGKTTGFCSGGCAAIADSGTSLLAGPSTIITEINHEIGASGVVSQEC  328

Query  730   KAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA-DLHD  554
             K VV  YGQ ++++L+ EA PKKICSQIGLCTF+G RGVS GI+SVVDE N  S+  LHD
Sbjct  329   KTVVAQYGQVILEMLLAEAPPKKICSQIGLCTFDGTRGVSTGIKSVVDESNDKSSGGLHD  388

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
              MCSACEMTVVWMQNQL +NQTQ+ IL+YVNELC+RLPSPMG+S VDC KLS+MP VSF+
Sbjct  389   TMCSACEMTVVWMQNQLRQNQTQDRILNYVNELCDRLPSPMGQSSVDCDKLSSMPIVSFT  448

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IGGKVFDL+P EYILKVGEG  AQCISGFTALD+PPPRGPLWILGDVFMG YHTVFDYG 
Sbjct  449   IGGKVFDLTPQEYILKVGEGPEAQCISGFTALDIPPPRGPLWILGDVFMGSYHTVFDYGN  508

Query  193   MRVGFAEAA  167
             +RVGFA AA
Sbjct  509   LRVGFAAAA  517



>ref|XP_010244477.1| PREDICTED: aspartic proteinase A1-like isoform X3 [Nelumbo nucifera]
Length=514

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/489 (77%), Positives = 424/489 (87%), Gaps = 2/489 (0%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  1451
             NDG  RIGLKKMK+D+NNR+AA L+ +  + LRAS RKY+ L G + D   TDI+ LKNY
Sbjct  27    NDGLFRIGLKKMKLDQNNRLAALLKPEGEEPLRASTRKYH-LGGNHEDSGATDIISLKNY  85

Query  1450  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNG  1271
             MDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV C+FHSKY SS SSTY+KNG
Sbjct  86    MDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSLSSTYKKNG  145

Query  1270  KSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEI  1091
             KSAEI YGTG+I+GFFS+D   VGDLVVK Q FIEAT EPG+TFL AKFDGILGLGFQEI
Sbjct  146   KSAEIQYGTGAIAGFFSEDDANVGDLVVKDQEFIEATREPGLTFLAAKFDGILGLGFQEI  205

Query  1090  SVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQ  911
             SVG+A      MVNQGL+++PIFSFW NRNPQE+EGGE+VFGGVDP HYKG+HTYVPVT+
Sbjct  206   SVGNAVPVWYNMVNQGLIKEPIFSFWFNRNPQEEEGGEIVFGGVDPNHYKGQHTYVPVTR  265

Query  910   KGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKEC  731
             KGYWQFDMG+VLI GK TGFCSGGC+AIADSGTSL+AGPS+IIT INH IGA GVVS+EC
Sbjct  266   KGYWQFDMGDVLIGGKTTGFCSGGCAAIADSGTSLLAGPSTIITEINHEIGASGVVSQEC  325

Query  730   KAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA-DLHD  554
             K VV  YGQ ++++L+ EA PKKICSQIGLCTF+G RGVS GI+SVVDE N  S+  LHD
Sbjct  326   KTVVAQYGQVILEMLLAEAPPKKICSQIGLCTFDGTRGVSTGIKSVVDESNDKSSGGLHD  385

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
              MCSACEMTVVWMQNQL +NQTQ+ IL+YVNELC+RLPSPMG+S VDC KLS+MP VSF+
Sbjct  386   TMCSACEMTVVWMQNQLRQNQTQDRILNYVNELCDRLPSPMGQSSVDCDKLSSMPIVSFT  445

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IGGKVFDL+P EYILKVGEG  AQCISGFTALD+PPPRGPLWILGDVFMG YHTVFDYG 
Sbjct  446   IGGKVFDLTPQEYILKVGEGPEAQCISGFTALDIPPPRGPLWILGDVFMGSYHTVFDYGN  505

Query  193   MRVGFAEAA  167
             +RVGFA AA
Sbjct  506   LRVGFAAAA  514



>gb|KHG11144.1| Aspartic proteinase [Gossypium arboreum]
Length=514

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/490 (75%), Positives = 426/490 (87%), Gaps = 1/490 (0%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             SNDG VRIGLKKMK+D NNR+AA+L++K  ++LRAS+ K Y      GD ++TDIV LKN
Sbjct  25    SNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIAKKYRFRNDLGDSEETDIVALKN  84

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV CFFHSKY SS+SSTY+KN
Sbjct  85    YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSKYKSSESSTYKKN  144

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKSA I YGTG+ISGFFS DSV+VG+LV K Q FIEAT EPGVTF+ AKFDGILGLGF+E
Sbjct  145   GKSASIQYGTGAISGFFSNDSVKVGNLVAKDQEFIEATKEPGVTFIAAKFDGILGLGFKE  204

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVGDA      MV QGL++D +FSFWLNRN  E+ GGE+VFGG+DP HYKG+HTYVP+T
Sbjct  205   ISVGDAVPVWYNMVEQGLIKDQVFSFWLNRNVGEEMGGEIVFGGIDPNHYKGKHTYVPIT  264

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQFDMG+VLI  KPTG+C+GGC+AIADSGTSL+AGP+++ITMIN AIGA GV S+E
Sbjct  265   QKGYWQFDMGDVLIGDKPTGYCAGGCAAIADSGTSLLAGPTTVITMINQAIGASGVASQE  324

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LH  557
             CKAVV+ YGQ +IDLLV +A P KICS+IGLC F+G+ GVSMGIE+VVDE NG S+  LH
Sbjct  325   CKAVVQQYGQTIIDLLVSQAEPMKICSRIGLCAFDGSHGVSMGIENVVDESNGKSSGILH  384

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
              AMC ACEM VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGES VDCG LS+MP++SF
Sbjct  385   SAMCPACEMAVVWMQNQLIENQTQDRILDYANQLCDRVPNPMGESTVDCGSLSSMPTISF  444

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK FDL+P EYILKVGEG+ AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD+G
Sbjct  445   TIGGKAFDLTPEEYILKVGEGAEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDFG  504

Query  196   KMRVGFAEAA  167
             K+RVGFAEAA
Sbjct  505   KLRVGFAEAA  514



>gb|KJB67244.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
 gb|KJB67245.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
 gb|KJB67246.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=514

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/490 (75%), Positives = 426/490 (87%), Gaps = 1/490 (0%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             SNDG VRIGLKKMK+D NNR+AA+L++K  ++LRAS+ + Y      GD ++TDIV LKN
Sbjct  25    SNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIARKYRFRNDLGDSEETDIVALKN  84

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV CFFHSKY +S+SSTY+KN
Sbjct  85    YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSKYKASESSTYKKN  144

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKSA I YGTG+ISGFFS D+V+VG+LVVK Q FIEAT EPGVTF+ AKFDGILGLGF+E
Sbjct  145   GKSASIQYGTGAISGFFSNDNVKVGNLVVKDQEFIEATKEPGVTFMAAKFDGILGLGFKE  204

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVGDA      MV QGL++D  FSFWLNRN  E+ GGE+VFGGVDP HYKG+HTYVP+T
Sbjct  205   ISVGDAVPVWYNMVEQGLIKDQEFSFWLNRNVGEEMGGEIVFGGVDPNHYKGKHTYVPIT  264

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQFDMG+VLI  KPTG+C+GGC+AIADSGTSL+AGP+++ITMIN AIGA GV S+E
Sbjct  265   QKGYWQFDMGDVLIGDKPTGYCAGGCAAIADSGTSLLAGPTTVITMINQAIGASGVASQE  324

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LH  557
             CKAVV+ YGQ +IDLLV +A P KICSQIGLC F+G+ GVSMGIE+VVDE NG S+  LH
Sbjct  325   CKAVVQQYGQTIIDLLVSQAEPMKICSQIGLCAFDGSHGVSMGIENVVDESNGKSSGILH  384

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
              AMC ACEM VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGES VDCG LS+MP++SF
Sbjct  385   SAMCPACEMAVVWMQNQLMENQTQDRILDYANQLCDRVPNPMGESTVDCGSLSSMPTISF  444

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK F+L+P EYILKVGEG+ AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD+G
Sbjct  445   TIGGKAFELTPEEYILKVGEGAEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDFG  504

Query  196   KMRVGFAEAA  167
             K+RVGFAEAA
Sbjct  505   KLRVGFAEAA  514



>ref|XP_002518445.1| Aspartic proteinase precursor, putative [Ricinus communis]
 gb|EEF43832.1| Aspartic proteinase precursor, putative [Ricinus communis]
Length=511

 Score =   785 bits (2028),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/489 (75%), Positives = 430/489 (88%), Gaps = 5/489 (1%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  1451
             NDG VR+GLKKMK+D+N+R+AARLE+K  ++LRASVRKY    G  GD +DTDIV LKNY
Sbjct  27    NDGLVRLGLKKMKLDENSRLAARLESKNAEALRASVRKY----GLRGDSKDTDIVALKNY  82

Query  1450  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNG  1271
             +DAQY+GEIG+GTPPQKFTV+FDTGSSNLWVPSSKC FSV CFFHS+Y S QSSTY+KNG
Sbjct  83    LDAQYYGEIGIGTPPQKFTVVFDTGSSNLWVPSSKCIFSVACFFHSRYKSGQSSTYKKNG  142

Query  1270  KSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEI  1091
             KSAEIHYG+G+ISGFFS D+V VG+LVVK Q FIEAT EPGVTF+ AKFDGILGLGFQEI
Sbjct  143   KSAEIHYGSGAISGFFSSDNVVVGNLVVKDQEFIEATKEPGVTFVAAKFDGILGLGFQEI  202

Query  1090  SVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQ  911
             SVG+A      M+ QGL+++P+FSFWLNRN Q +EGGE+VFGGVD  HYKG+HTYVPVTQ
Sbjct  203   SVGNAVPVWYNMIKQGLIKEPVFSFWLNRNTQGEEGGEIVFGGVDLNHYKGKHTYVPVTQ  262

Query  910   KGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKEC  731
             KGYWQF+MG+VLI  KPT +C+GGCSAIADSGTSL+AGP++++T+IN AIGA GV S+EC
Sbjct  263   KGYWQFEMGDVLIGHKPTEYCAGGCSAIADSGTSLLAGPTTVVTLINEAIGATGVASQEC  322

Query  730   KAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL-HD  554
             K V+  YG+ ++DLL+ EA+PKKICSQIGLCTF+G RGVSMGI+SVVD+ N  S+ +  D
Sbjct  323   KTVIAQYGETIMDLLIAEAQPKKICSQIGLCTFDGTRGVSMGIQSVVDDNNDKSSGIVRD  382

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
             AMCSACEMTVVWMQNQL ENQTQ+ IL+YVNELC+R+P+P+GES VDCG +S+MP VSF+
Sbjct  383   AMCSACEMTVVWMQNQLRENQTQDRILNYVNELCDRIPNPLGESIVDCGSISSMPVVSFT  442

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IGGKVFDLSP EYILKVGEG+ AQCISGF ALDVPPPRGPLWILGD+FMGRYHTVFDYG 
Sbjct  443   IGGKVFDLSPQEYILKVGEGAQAQCISGFMALDVPPPRGPLWILGDIFMGRYHTVFDYGN  502

Query  193   MRVGFAEAA  167
             +RVGFAEAA
Sbjct  503   LRVGFAEAA  511



>ref|XP_012070867.1| PREDICTED: aspartic proteinase A1-like [Jatropha curcas]
 gb|KDP39159.1| hypothetical protein JCGZ_00916 [Jatropha curcas]
Length=514

 Score =   785 bits (2026),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/493 (75%), Positives = 429/493 (87%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             F+ SNDG VRIGLKK K D+NNR+AA+ E+K G++LRAS+RKY+ LHG  GD +D DIV 
Sbjct  23    FAASNDGLVRIGLKKRKFDQNNRVAAQFESKEGEALRASIRKYH-LHGNLGDEEDIDIVS  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV C+FHSKY +  SSTY
Sbjct  82    LKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKAGHSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGK A+I YGTG+ISGFFSQD V+VGDLVVK+Q FIEAT EP +TFLVAKFDGILGLG
Sbjct  142   KKNGKPADIRYGTGAISGFFSQDHVKVGDLVVKNQEFIEATREPSITFLVAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      M NQGLV++P+FSFW NRN  E EGGE+VFGGVDP H+KGEHTYV
Sbjct  202   FQEISVGKAVPVWYNMFNQGLVKEPVFSFWFNRNADEDEGGEIVFGGVDPNHFKGEHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+VL++GK TG C  GC+AIADSGTSL+AGP++II  +NHAIGA GVV
Sbjct  262   PVTQKGYWQFDMGDVLVDGKTTGICGSGCAAIADSGTSLLAGPTAIIAEVNHAIGATGVV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA-  566
             S+ECKAVV  YG+ +I++L+ + +P+KICSQIGLCTF+G+RGVSMGIESVV+E +  +A 
Sbjct  322   SQECKAVVAQYGETIIEMLLAKDQPEKICSQIGLCTFDGSRGVSMGIESVVNENDHEAAG  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L D MCSACEM VVWMQN+L +N TQE+IL+YVN+LC +LPSPMGES VDCG +ST+P+
Sbjct  382   GLRDTMCSACEMAVVWMQNKLKQNITQESILNYVNDLCEKLPSPMGESAVDCGSVSTLPN  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGKVFDL+P +Y+LKVGEG AAQCISGFTA+DVPPPRGPLWILGDVFMG +HTVF
Sbjct  442   VSFTIGGKVFDLAPEQYVLKVGEGEAAQCISGFTAIDVPPPRGPLWILGDVFMGPFHTVF  501

Query  205   DYGKMRVGFAEAA  167
             DYG MRVGFAEAA
Sbjct  502   DYGNMRVGFAEAA  514



>ref|XP_011046729.1| PREDICTED: aspartic proteinase A1-like [Populus euphratica]
 ref|XP_011046731.1| PREDICTED: aspartic proteinase A1-like [Populus euphratica]
Length=515

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/494 (75%), Positives = 424/494 (86%), Gaps = 5/494 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
               S  NDG +RIGLKK K ++NNR+AA+LE+K GDS    ++KY+ L    GD +DTDIV
Sbjct  26    TLSPPNDGLIRIGLKKRKYERNNRLAAKLESKEGDS----IKKYHLLRNLGGDAEDTDIV  81

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV C+FHSKY SS S T
Sbjct  82    SLKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSHSRT  141

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y++NGKSAEIHYGTG+ISGFFSQD V+VGDLVVK+Q FIEAT EP VTFLVAKFDGILGL
Sbjct  142   YKENGKSAEIHYGTGAISGFFSQDHVKVGDLVVKNQEFIEATREPSVTFLVAKFDGILGL  201

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG A      MV+QGLV++P+FSFW NRN  E+EGGE+VFGGVDP HYKGEHTY
Sbjct  202   GFQEISVGKAVPVWYNMVDQGLVKEPVFSFWFNRNADEKEGGEIVFGGVDPDHYKGEHTY  261

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI G+ +GFC+ GC+AIADSGTSL+AGP++IIT +NHAIGA GV
Sbjct  262   VPVTQKGYWQFDMGDVLIGGQTSGFCASGCAAIADSGTSLLAGPTTIITEVNHAIGATGV  321

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS+ECK VV  YG  +I++L+ + +P+KICSQIGLCTF+G RGVS+GIESVV+E    ++
Sbjct  322   VSQECKEVVAQYGDTIIEMLLAKDQPQKICSQIGLCTFDGTRGVSVGIESVVNEHAQKAS  381

Query  565   D-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
             D  HDAMCS CEM VVWMQNQL +NQTQE IL YVNELC RLPSPMGES VDC  LS+MP
Sbjct  382   DGFHDAMCSTCEMAVVWMQNQLKQNQTQERILDYVNELCERLPSPMGESAVDCDGLSSMP  441

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VSF+IGG+VFDLSP +Y+LKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGR+HTV
Sbjct  442   NVSFTIGGRVFDLSPEQYVLKVGEGDVAQCISGFTALDVPPPRGPLWILGDVFMGRFHTV  501

Query  208   FDYGKMRVGFAEAA  167
             FDYG MRVGFAEA+
Sbjct  502   FDYGNMRVGFAEAS  515



>ref|XP_012091315.1| PREDICTED: aspartic proteinase-like [Jatropha curcas]
 gb|KDP20718.1| hypothetical protein JCGZ_21189 [Jatropha curcas]
Length=512

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/493 (74%), Positives = 434/493 (88%), Gaps = 4/493 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             +S  NDG VRIGLKK+K+D+N+RIAA+LE+K  ++ RASVRKY  L G  GD +D DIV 
Sbjct  23    YSVPNDGLVRIGLKKIKLDQNSRIAAQLESK--EASRASVRKY-GLRGNLGDSEDLDIVA  79

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQY+GEI VGTPPQKFTVIFDTGSSNLWVPSSKC+ S+ C+FHSKY SSQSSTY
Sbjct  80    LKNYMDAQYYGEIDVGTPPQKFTVIFDTGSSNLWVPSSKCFLSIACYFHSKYKSSQSSTY  139

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
              +NGKSAEI YG+G+ISGFFS D+V+VG+LVVK Q FIEATSEPGVTFL AKFDGILGLG
Sbjct  140   RQNGKSAEIQYGSGAISGFFSYDNVRVGNLVVKDQEFIEATSEPGVTFLAAKFDGILGLG  199

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             F+EISVG+A      M+ QGL+++P+FSFWLNRN +E+EGGE+VFGGVDP HYKG+HTYV
Sbjct  200   FREISVGNAVPVWYNMIKQGLIKEPVFSFWLNRNTEEEEGGEIVFGGVDPNHYKGKHTYV  259

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQF+MG++LI  KPTG+C+G CSAIADSGTSL+AGP++++TMIN AIGA GVV
Sbjct  260   PVTQKGYWQFEMGDILIGDKPTGYCAGSCSAIADSGTSLLAGPTTVVTMINQAIGATGVV  319

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+ECKAVV  YGQ ++DLL+ME +PKKICSQ+GLCTF+G  GVSMGI+SVVDE+N  S+ 
Sbjct  320   SQECKAVVAQYGQTIMDLLLMEVQPKKICSQVGLCTFDGTHGVSMGIQSVVDERNDKSSG  379

Query  562   L-HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
             +  DAMCSACEMTVVWMQNQL +NQTQ+ IL+YVNELC+R+PSP+G+S VDCG LS+MP 
Sbjct  380   IARDAMCSACEMTVVWMQNQLRQNQTQDRILNYVNELCDRIPSPLGQSAVDCGSLSSMPI  439

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             +SF+I GK+F+L+P EYILKVGEGSAAQCISGFT LDVPPPRGPLWILGD+FMGRYHTVF
Sbjct  440   ISFTIAGKLFELTPEEYILKVGEGSAAQCISGFTGLDVPPPRGPLWILGDIFMGRYHTVF  499

Query  205   DYGKMRVGFAEAA  167
             D+G  RVGFAEAA
Sbjct  500   DFGNNRVGFAEAA  512



>ref|XP_006452415.1| hypothetical protein CICLE_v10008027mg [Citrus clementina]
 gb|ESR65655.1| hypothetical protein CICLE_v10008027mg [Citrus clementina]
Length=514

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/493 (74%), Positives = 424/493 (86%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS  N G  RIGLKK K D NNR+AARL++K G+S R S+RKY +L G  G+  D DIV 
Sbjct  23    FSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKY-SLRGNLGESGDADIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHSKY S +SSTY
Sbjct  82    LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSA+IHYGTG+ISGFFS+D V++GDLVVK Q FIEAT EP +TFL+AKFDGILGLG
Sbjct  142   KKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      MVNQGLV +P+FSFW NRN  E+EGGE+VFGG+DP HYKGEHTYV
Sbjct  202   FQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEEEGGEIVFGGMDPDHYKGEHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+V+I+G+ TGFC+GGC+AIADSGTSL+AGP++IIT +NHAIGA G+V
Sbjct  262   PVTQKGYWQFDMGDVMIDGQTTGFCAGGCAAIADSGTSLLAGPTTIITQVNHAIGATGIV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S+ECKAVV  YG+ +I++L+ +  P+KICSQIGLCTF+G+RGVSMGIESVV E N   S 
Sbjct  322   SQECKAVVSQYGEEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGIESVVPENNHRASG  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
               HDAMCS CEM VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGES VDC +LS++P 
Sbjct  382   GFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGESAVDCSRLSSLPI  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGK+FDL+P++YILKVGEG AAQCISGF+ALDV PPRGPLWILGDVFMG YHTVF
Sbjct  442   VSFTIGGKIFDLTPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWILGDVFMGPYHTVF  501

Query  205   DYGKMRVGFAEAA  167
             DY  MRVGFAEAA
Sbjct  502   DYSNMRVGFAEAA  514



>ref|XP_006475035.1| PREDICTED: aspartic proteinase-like [Citrus sinensis]
 gb|KDO62070.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
 gb|KDO62071.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=514

 Score =   783 bits (2021),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/493 (74%), Positives = 424/493 (86%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS  N G  RIGLKK K D NNR+AARL++K G+S R S+RKY +L G  G+  D DIV 
Sbjct  23    FSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKY-SLRGNLGESGDADIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHSKY S +SSTY
Sbjct  82    LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSA+IHYGTG+ISGFFS+D V++GDLVVK Q FIEAT EP +TFL+AKFDGILGLG
Sbjct  142   KKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      MVNQGLV +P+FSFW NRN  E+EGGE+VFGG+DP HYKGEHTYV
Sbjct  202   FQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEEEGGEIVFGGMDPDHYKGEHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+V+I+G+ TGFC+GGC+AIADSGTSL+AGP++IIT +NHAIGA G+V
Sbjct  262   PVTQKGYWQFDMGDVMIDGQTTGFCAGGCAAIADSGTSLLAGPTTIITQVNHAIGATGIV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S+ECKAVV  YG+ +I++L+ +  P+KICSQIGLCTF+G+RGVSMGIESVV E N   S 
Sbjct  322   SQECKAVVSQYGEEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGIESVVPENNHRASG  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
               HDAMCS CEM VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGES VDC +LS++P 
Sbjct  382   GFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGESAVDCSRLSSLPI  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGK+FDL+P++YILKVGEG AAQCISGF+ALDV PPRGPLWILGDVFMG YHTVF
Sbjct  442   VSFTIGGKIFDLTPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWILGDVFMGPYHTVF  501

Query  205   DYGKMRVGFAEAA  167
             DY  MRVGFAEAA
Sbjct  502   DYSNMRVGFAEAA  514



>gb|KHG11143.1| Aspartic proteinase [Gossypium arboreum]
Length=520

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/496 (74%), Positives = 426/496 (86%), Gaps = 7/496 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             SNDG VRIGLKKMK+D NNR+AA+L++K  ++LRAS+ K Y      GD ++TDIV LKN
Sbjct  25    SNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIAKKYRFRNDLGDSEETDIVALKN  84

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV CFFHSKY SS+SSTY+KN
Sbjct  85    YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSKYKSSESSTYKKN  144

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKSA I YGTG+ISGFFS DSV+VG+LV K Q FIEAT EPGVTF+ AKFDGILGLGF+E
Sbjct  145   GKSASIQYGTGAISGFFSNDSVKVGNLVAKDQEFIEATKEPGVTFIAAKFDGILGLGFKE  204

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVGDA      MV QGL++D +FSFWLNRN  E+ GGE+VFGG+DP HYKG+HTYVP+T
Sbjct  205   ISVGDAVPVWYNMVEQGLIKDQVFSFWLNRNVGEEMGGEIVFGGIDPNHYKGKHTYVPIT  264

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQFDMG+VLI  KPTG+C+GGC+AIADSGTSL+AGP+++ITMIN AIGA GV S+E
Sbjct  265   QKGYWQFDMGDVLIGDKPTGYCAGGCAAIADSGTSLLAGPTTVITMINQAIGASGVASQE  324

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LH  557
             CKAVV+ YGQ +IDLLV +A P KICS+IGLC F+G+ GVSMGIE+VVDE NG S+  LH
Sbjct  325   CKAVVQQYGQTIIDLLVSQAEPMKICSRIGLCAFDGSHGVSMGIENVVDESNGKSSGILH  384

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
              AMC ACEM VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGES VDCG LS+MP++SF
Sbjct  385   SAMCPACEMAVVWMQNQLIENQTQDRILDYANQLCDRVPNPMGESTVDCGSLSSMPTISF  444

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW------ILGDVFMGRYH  215
             +IGGK FDL+P EYILKVGEG+ AQCISGFTALDVPPPRGPLW      ILGDVFMGRYH
Sbjct  445   TIGGKAFDLTPEEYILKVGEGAEAQCISGFTALDVPPPRGPLWYFIFALILGDVFMGRYH  504

Query  214   TVFDYGKMRVGFAEAA  167
             TVFD+GK+RVGFAEAA
Sbjct  505   TVFDFGKLRVGFAEAA  520



>ref|XP_002298827.2| aspartic protease family protein [Populus trichocarpa]
 gb|EEE83632.2| aspartic protease family protein [Populus trichocarpa]
Length=515

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/493 (75%), Positives = 423/493 (86%), Gaps = 5/493 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S  NDG +RIGLKK K ++NNR+AA+LE+K G+S    ++KY+ L    GD +DTDIV
Sbjct  26    ALSPPNDGLIRIGLKKRKYERNNRLAAKLESKEGES----IKKYHLLRNLGGDAEDTDIV  81

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV C+FHSKY SS S T
Sbjct  82    SLKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSHSRT  141

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y++NGKSAEIHYGTG+ISGFFSQD V+VGDLVVK+Q FIEAT EP VTFLVAKFDGILGL
Sbjct  142   YKENGKSAEIHYGTGAISGFFSQDHVKVGDLVVKNQEFIEATREPSVTFLVAKFDGILGL  201

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG A      MV QGLV++P+FSFW NRN  E+EGGE+VFGGVDP HYKGEHTY
Sbjct  202   GFQEISVGKAVPVWYNMVEQGLVKEPVFSFWFNRNADEKEGGEIVFGGVDPDHYKGEHTY  261

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI G+ +GFC+ GC+AIADSGTSL+AGP++IIT +NHAIGA GV
Sbjct  262   VPVTQKGYWQFDMGDVLIGGQTSGFCASGCAAIADSGTSLLAGPTTIITEVNHAIGATGV  321

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS+ECKAVV  YG  ++++L+ + +P+KIC+QIGLCTF+G RGVSMGIESVV+E    ++
Sbjct  322   VSQECKAVVAQYGDTIMEMLLAKDQPQKICAQIGLCTFDGTRGVSMGIESVVNEHAQKAS  381

Query  565   D-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
             D  HDAMCS CEM VVWMQNQL +NQTQE IL YVNELC RLPSPMGES VDC  LS+MP
Sbjct  382   DGFHDAMCSTCEMAVVWMQNQLKQNQTQERILDYVNELCERLPSPMGESAVDCDGLSSMP  441

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VSF+IGG+VF+LSP +Y+LKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMG +HTV
Sbjct  442   NVSFTIGGRVFELSPEQYVLKVGEGDVAQCISGFTALDVPPPRGPLWILGDVFMGSFHTV  501

Query  208   FDYGKMRVGFAEA  170
             FDYG MRVGFAEA
Sbjct  502   FDYGNMRVGFAEA  514



>ref|XP_007211824.1| hypothetical protein PRUPE_ppa004375mg [Prunus persica]
 gb|EMJ13023.1| hypothetical protein PRUPE_ppa004375mg [Prunus persica]
Length=514

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/492 (75%), Positives = 422/492 (86%), Gaps = 2/492 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S+SNDG VR+GLKK K D+NNR+AA++E+K G++LRAS+ KY  L G   D QDTDIV L
Sbjct  24    SESNDGLVRVGLKKRKFDQNNRVAAQIESKEGEALRASLLKY-RLRGNLADSQDTDIVSL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFS+ C+ H KY SS SSTY 
Sbjct  83    KNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHPKYKSSSSSTYN  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A IHYGTG+ISGFFS+D V +GDLVVK Q FIEAT EPGVTFLVAKFDGILGLGF
Sbjct  143   KNGKPAAIHYGTGAISGFFSEDHVTIGDLVVKDQEFIEATKEPGVTFLVAKFDGILGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVG+A      MVNQGL+++P+FSFW NRN  E+EGGE+VFGGVDP HYKGEHTYVP
Sbjct  203   QEISVGNAVPVWYNMVNQGLLKEPVFSFWFNRNADEEEGGEIVFGGVDPNHYKGEHTYVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQFDMG+V+I+GK TGFC+GGCSAIADSGTSL+ GP++IIT +NHAIGA G+VS
Sbjct  263   VTQKGYWQFDMGDVMIDGKTTGFCAGGCSAIADSGTSLLVGPTTIITELNHAIGASGIVS  322

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSAD  563
             +ECK VV  YG+ +I+ ++ + +P+KICSQIGLCTF+G  GVS  I+SVV+E  + VS  
Sbjct  323   QECKTVVAQYGETIIERILAKDQPQKICSQIGLCTFDGTHGVSTEIKSVVEENTHKVSGG  382

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             L DA CSACEMTVVWMQNQL +NQTQE IL YVN+LC RLPSPMGES VDC  LS+MPSV
Sbjct  383   LSDASCSACEMTVVWMQNQLKQNQTQERILEYVNQLCERLPSPMGESAVDCSGLSSMPSV  442

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IGG+ FDL+P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD
Sbjct  443   SFTIGGRTFDLTPEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  502

Query  202   YGKMRVGFAEAA  167
             YG  R+GFAEAA
Sbjct  503   YGNERIGFAEAA  514



>gb|ACX55829.1| aspartic proteinase 1 [Castanea mollissima]
Length=513

 Score =   776 bits (2003),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/491 (77%), Positives = 428/491 (87%), Gaps = 1/491 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SN G VRIGLKKMK+DKNNR+AA+LE+K G+   AS+RKYY L G +GD +D DIV L
Sbjct  24    SASNGGLVRIGLKKMKLDKNNRVAAQLESKDGEVRSASIRKYY-LRGNSGDPEDIDIVSL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV C+FHSKY SS SSTY+
Sbjct  83    KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSSSSTYK  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A+IHYGTG+ISG+FSQD V+VGDLVVK+Q FIEAT EP +TFLVAKFDGILGLGF
Sbjct  143   KNGKPADIHYGTGAISGYFSQDHVKVGDLVVKNQEFIEATREPSITFLVAKFDGILGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVG+A      MV QGLV++P+FSFW NRN  E+EGGE+VFGGVDP HYKG+HTYVP
Sbjct  203   KEISVGNAVPVWYNMVKQGLVKEPVFSFWFNRNTDEEEGGEIVFGGVDPNHYKGKHTYVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQFDMG+VLI+G+ TGFC+ GCSAIADSGTSL+AGP++IIT +NHAIGA GVVS
Sbjct  263   VTQKGYWQFDMGDVLIDGQTTGFCARGCSAIADSGTSLLAGPTTIITEVNHAIGATGVVS  322

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECKAVV  YG+ +I +L+ + +P KICSQIGLCTF+G RGVSM IESVVD     S  L
Sbjct  323   QECKAVVAEYGETIIKMLLEKDQPMKICSQIGLCTFDGVRGVSMDIESVVDNTRKASNGL  382

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
              DAMCS CEMTVVWMQNQL +NQTQ+ IL+YVNELC+RLPSPMGES VDCG LS++P+VS
Sbjct  383   RDAMCSTCEMTVVWMQNQLKQNQTQDRILTYVNELCDRLPSPMGESAVDCGSLSSLPNVS  442

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
              +IGG+VFDLSP +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY
Sbjct  443   LTIGGRVFDLSPEQYVLKVGEGEAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  502

Query  199   GKMRVGFAEAA  167
             G  RVGFAEAA
Sbjct  503   GNQRVGFAEAA  513



>ref|XP_010096873.1| Aspartic proteinase [Morus notabilis]
 gb|EXB66327.1| Aspartic proteinase [Morus notabilis]
Length=514

 Score =   775 bits (2002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/493 (76%), Positives = 428/493 (87%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS SNDG VRIGLKK K D+NNR+AA++E+K G++ +AS+RKY  L G  GD +DTDIV 
Sbjct  23    FSASNDGLVRIGLKKRKFDQNNRVAAQIESKEGEAFKASIRKY-RLRGNLGDPEDTDIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV C+FHSKY S  SS+Y
Sbjct  82    LKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSAKCYFSVACYFHSKYKSRSSSSY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSA I YGTG+ISGFFS+D V+VGDLVVK Q FIEAT EP +TFLVAKFDGILGLG
Sbjct  142   KKNGKSASIQYGTGAISGFFSEDYVKVGDLVVKDQEFIEATREPSITFLVAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MVNQGL+++PIFSFW NRN  E EGGE+VFGGVDP HYKGEHTYV
Sbjct  202   FQEISVGNAVPVWYNMVNQGLLKEPIFSFWFNRNADEDEGGEIVFGGVDPDHYKGEHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+VL++GK TGFC+ GCSAIADSGTSL+AGP++IIT +NHAIGA GVV
Sbjct  262   PVTRKGYWQFDMGDVLVDGKSTGFCADGCSAIADSGTSLLAGPTTIITELNHAIGATGVV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S+ECKA+VE YGQ +I+ L+ + +PKKIC+QIGLC+F+G RGVSMGI+SVVDE  G  S 
Sbjct  322   SEECKAIVEQYGQTIIESLLAKDQPKKICAQIGLCSFDGTRGVSMGIKSVVDENVGKASG  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
             DL D MCSACEM VVWMQNQ+ +NQTQ+ IL+YVN+LC RLPSPMGES VDCG LS++P 
Sbjct  382   DLRDGMCSACEMAVVWMQNQIKQNQTQDQILNYVNQLCERLPSPMGESAVDCGSLSSLPD  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGK F+L P EYILKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF
Sbjct  442   VSFTIGGKKFELKPEEYILKVGEGDVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  501

Query  205   DYGKMRVGFAEAA  167
             DYG MR+GFAEAA
Sbjct  502   DYGNMRIGFAEAA  514



>gb|KCW77002.1| hypothetical protein EUGRSUZ_D01351 [Eucalyptus grandis]
Length=514

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/488 (75%), Positives = 423/488 (87%), Gaps = 2/488 (0%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNYM  1448
             DG +R+GLKK K D N R+AARLE++ G  LR+S+R Y+ L+G  GD Q  DIVGLKNY+
Sbjct  28    DGLLRVGLKKFKPDPNKRVAARLESQGGGLLRSSIRPYH-LNGWRGDAQLPDIVGLKNYL  86

Query  1447  DAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNGK  1268
             DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKCY SV CFFHSKY +SQSSTY++NGK
Sbjct  87    DAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYLSVACFFHSKYQASQSSTYKRNGK  146

Query  1267  SAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEIS  1088
             SA I YGTG+ISGFFS D+VQV +LVVK Q FIEAT EPGVTF+ AKFDGILGLGFQEIS
Sbjct  147   SASIQYGTGAISGFFSNDNVQVSNLVVKDQEFIEATREPGVTFMAAKFDGILGLGFQEIS  206

Query  1087  VGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQK  908
             VGDA      MV Q LV++P+FSFWLN NP E+EGGELVFGGVD KH+KG+HTYVPVTQK
Sbjct  207   VGDAVPLWYNMVKQRLVKEPVFSFWLNSNPDEEEGGELVFGGVDQKHFKGKHTYVPVTQK  266

Query  907   GYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKECK  728
             GYWQF MG+VLI+GKPTG+C GGC+AIADSGTSL+AGP+++ITMIN+AIGA GV S+ECK
Sbjct  267   GYWQFAMGDVLIDGKPTGYCGGGCAAIADSGTSLLAGPTTVITMINNAIGASGVASQECK  326

Query  727   AVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDA  551
             AVV  YGQ ++DLL+ EA PKKICSQ+G+CTF+GNRGVSMGIESVVD+  G S+  +HDA
Sbjct  327   AVVAQYGQTIMDLLLAEASPKKICSQVGVCTFDGNRGVSMGIESVVDKTKGRSSGFMHDA  386

Query  550   MCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSI  371
             MCSACEM VVWMQ+QL +NQTQ+ +L+YVNELC+R+PSP GES VDC KLS+MP VSF++
Sbjct  387   MCSACEMAVVWMQSQLEQNQTQKRVLNYVNELCDRVPSPNGESSVDCEKLSSMPVVSFTL  446

Query  370   GGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKM  191
             GGKVFDLSPNEY+LKVG+    QCISGFT LDVPPPRGPLWILGDVFM RYHTVFDYG +
Sbjct  447   GGKVFDLSPNEYVLKVGQEPNTQCISGFTGLDVPPPRGPLWILGDVFMRRYHTVFDYGNI  506

Query  190   RVGFAEAA  167
             RVGFAEAA
Sbjct  507   RVGFAEAA  514



>ref|XP_008226860.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
 ref|XP_008226861.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
Length=514

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/492 (74%), Positives = 421/492 (86%), Gaps = 2/492 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S+SNDG VR+GLKK K D+NNR+AA++E+K G++LRAS+ KY  L G   D QD DIV L
Sbjct  24    SESNDGLVRVGLKKRKFDQNNRVAAQIESKEGEALRASLLKY-RLRGNLADSQDIDIVSL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFS+ C+ H KY SS SSTY 
Sbjct  83    KNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHPKYKSSSSSTYN  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A IHYGTG+ISGFFS+D V +GDLVVK Q FIEAT EPGVTFLVAKFDGILGLGF
Sbjct  143   KNGKPAAIHYGTGAISGFFSEDHVTIGDLVVKDQEFIEATKEPGVTFLVAKFDGILGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVG+A      MVNQGL+++P+FSFW NRN  E+EGGE+VFGGVDP HYKGEHTYVP
Sbjct  203   QEISVGNAVPVWYNMVNQGLLKEPVFSFWFNRNADEEEGGEIVFGGVDPNHYKGEHTYVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQFDMG+V+I+GK TGFC+GGCSAIADSGTSL+ GP++IIT +NHAIGA G+VS
Sbjct  263   VTQKGYWQFDMGDVMIDGKTTGFCAGGCSAIADSGTSLLVGPTTIITELNHAIGASGIVS  322

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSAD  563
             +ECK VV  YG+ +I+ ++ + +P+KICSQIGLCTF+G  GVS  I+SVV+E  + VS  
Sbjct  323   QECKTVVAQYGETIIERILAKDQPQKICSQIGLCTFDGTHGVSTEIKSVVEENTHKVSGG  382

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             L DA CSACEMTVVWMQNQL +NQTQE IL YVN+LC RLPSPMGES VDC  LS+MPSV
Sbjct  383   LSDASCSACEMTVVWMQNQLKQNQTQERILEYVNQLCERLPSPMGESAVDCSGLSSMPSV  442

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IGG+ FDL+P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD
Sbjct  443   SFTIGGRTFDLTPEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  502

Query  202   YGKMRVGFAEAA  167
             YG  R+GFAEAA
Sbjct  503   YGNERIGFAEAA  514



>ref|XP_010052871.1| PREDICTED: aspartic proteinase [Eucalyptus grandis]
Length=522

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/488 (75%), Positives = 423/488 (87%), Gaps = 2/488 (0%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNYM  1448
             DG +R+GLKK K D N R+AARLE++ G  LR+S+R Y+ L+G  GD Q  DIVGLKNY+
Sbjct  36    DGLLRVGLKKFKPDPNKRVAARLESQGGGLLRSSIRPYH-LNGWRGDAQLPDIVGLKNYL  94

Query  1447  DAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNGK  1268
             DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKCY SV CFFHSKY +SQSSTY++NGK
Sbjct  95    DAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYLSVACFFHSKYQASQSSTYKRNGK  154

Query  1267  SAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEIS  1088
             SA I YGTG+ISGFFS D+VQV +LVVK Q FIEAT EPGVTF+ AKFDGILGLGFQEIS
Sbjct  155   SASIQYGTGAISGFFSNDNVQVSNLVVKDQEFIEATREPGVTFMAAKFDGILGLGFQEIS  214

Query  1087  VGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQK  908
             VGDA      MV Q LV++P+FSFWLN NP E+EGGELVFGGVD KH+KG+HTYVPVTQK
Sbjct  215   VGDAVPLWYNMVKQRLVKEPVFSFWLNSNPDEEEGGELVFGGVDQKHFKGKHTYVPVTQK  274

Query  907   GYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKECK  728
             GYWQF MG+VLI+GKPTG+C GGC+AIADSGTSL+AGP+++ITMIN+AIGA GV S+ECK
Sbjct  275   GYWQFAMGDVLIDGKPTGYCGGGCAAIADSGTSLLAGPTTVITMINNAIGASGVASQECK  334

Query  727   AVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDA  551
             AVV  YGQ ++DLL+ EA PKKICSQ+G+CTF+GNRGVSMGIESVVD+  G S+  +HDA
Sbjct  335   AVVAQYGQTIMDLLLAEASPKKICSQVGVCTFDGNRGVSMGIESVVDKTKGRSSGFMHDA  394

Query  550   MCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSI  371
             MCSACEM VVWMQ+QL +NQTQ+ +L+YVNELC+R+PSP GES VDC KLS+MP VSF++
Sbjct  395   MCSACEMAVVWMQSQLEQNQTQKRVLNYVNELCDRVPSPNGESSVDCEKLSSMPVVSFTL  454

Query  370   GGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKM  191
             GGKVFDLSPNEY+LKVG+    QCISGFT LDVPPPRGPLWILGDVFM RYHTVFDYG +
Sbjct  455   GGKVFDLSPNEYVLKVGQEPNTQCISGFTGLDVPPPRGPLWILGDVFMRRYHTVFDYGNI  514

Query  190   RVGFAEAA  167
             RVGFAEAA
Sbjct  515   RVGFAEAA  522



>gb|KJB69259.1| hypothetical protein B456_011G012800 [Gossypium raimondii]
Length=514

 Score =   773 bits (1997),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/492 (74%), Positives = 425/492 (86%), Gaps = 1/492 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             + S+DG VRIGLKK K D NNR+A+RLE++   +L AS+++ Y LH   GD +DTDIV L
Sbjct  23    TASDDGLVRIGLKKKKFDPNNRLASRLESEDRQALIASMQEKYGLHNNLGDHEDTDIVAL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQY+GEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV C+FHSKY +S+S TY+
Sbjct  83    KNYMDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKASESKTYK  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A I YGTG+ISGFFS D+VQVG+LVV+ Q FIE T EPG+ FL AKFDGILGLGF
Sbjct  143   KNGKPASIQYGTGAISGFFSYDNVQVGNLVVEDQEFIETTKEPGLIFLAAKFDGILGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVG A      M+ QGL+++P+FSFWLNRN  E+ GGE+VFGGVDP HYKG+HTYVP
Sbjct  203   KEISVGKAVPVWYNMLKQGLIKEPVFSFWLNRNVGEEVGGEIVFGGVDPDHYKGKHTYVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQFDMG+VLI  KPTGFC+GGC+AIADSGTSL+AGP++++TMINHAIGA GVVS
Sbjct  263   VTQKGYWQFDMGDVLIGDKPTGFCAGGCAAIADSGTSLLAGPTTVVTMINHAIGATGVVS  322

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECKAVV+ YGQ +IDLL+ E +P+KICSQIGLCTF+G  GVSMGIESVV+E NG S+ +
Sbjct  323   QECKAVVQQYGQTIIDLLLAETQPQKICSQIGLCTFDGAHGVSMGIESVVEEGNGKSSGV  382

Query  559   H-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
               +AMC ACEM VVWMQNQL +NQT + IL+YVN+LC+R+PSPMGES V+CG LS+MP+V
Sbjct  383   QFNAMCPACEMAVVWMQNQLKQNQTLDVILNYVNQLCDRMPSPMGESAVECGSLSSMPTV  442

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IG KVFDLSP EYILKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD
Sbjct  443   SFTIGDKVFDLSPEEYILKVGEGPQAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  502

Query  202   YGKMRVGFAEAA  167
             +GK RVGFAEAA
Sbjct  503   FGKERVGFAEAA  514



>gb|ACX55830.1| aspartic proteinase 2 [Castanea mollissima]
Length=513

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/491 (76%), Positives = 427/491 (87%), Gaps = 1/491 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SN G VRIGLKKMK+DKNNR+AA+LE+K G+   AS+RKYY L G +GD +D DIV L
Sbjct  24    SASNGGLVRIGLKKMKLDKNNRVAAQLESKDGEVRSASIRKYY-LRGNSGDPEDIDIVSL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV C+FHSKY SS SSTY+
Sbjct  83    KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSSSSTYK  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A+IHYGTG+ISG+FSQD V+VGDLVVK+Q FIEAT EP +TFLVAKFDGILGLGF
Sbjct  143   KNGKPADIHYGTGAISGYFSQDHVKVGDLVVKNQEFIEATREPSITFLVAKFDGILGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVG+A      MV QGLV++P+FSFW NRN  E+EGGE+VFGGVDP HYKG+HTYVP
Sbjct  203   KEISVGNAVPVWYNMVKQGLVKEPVFSFWFNRNTDEEEGGEIVFGGVDPNHYKGKHTYVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQFDMG+VLI+G+ TGFC   CSAIADSGTSL+AGP++IIT +NHAIGA GVVS
Sbjct  263   VTQKGYWQFDMGDVLIDGQTTGFCVTTCSAIADSGTSLLAGPTTIITEVNHAIGATGVVS  322

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECKAVV  YG+ +I +L+ + +P KICSQIGLCTF+G +GVSM IESVVD  +  S  L
Sbjct  323   QECKAVVAEYGETIIKMLLEKDQPMKICSQIGLCTFDGTQGVSMDIESVVDNTHKASNGL  382

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
              DAMCS CEMTVVWMQNQL +NQTQ+ IL+YVNELC+RLPSPMGES VDCG LS++P+VS
Sbjct  383   RDAMCSTCEMTVVWMQNQLKQNQTQDRILTYVNELCDRLPSPMGESAVDCGSLSSLPNVS  442

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
              +IGG+VFDLSP +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY
Sbjct  443   LTIGGRVFDLSPEQYVLKVGEGEAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  502

Query  199   GKMRVGFAEAA  167
             G  RVGFAEAA
Sbjct  503   GNQRVGFAEAA  513



>gb|KJB67247.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=510

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/490 (74%), Positives = 422/490 (86%), Gaps = 5/490 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             SNDG VRIGLKKMK+D NNR+AA+L++K  ++LRAS+ + Y      GD ++TDIV LKN
Sbjct  25    SNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIARKYRFRNDLGDSEETDIVALKN  84

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV CFFHSKY +S+SSTY+KN
Sbjct  85    YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSKYKASESSTYKKN  144

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKSA I YGTG+ISGFFS D+V+VG+LVVK Q FIEAT EPGVTF+ AKFDGILGLGF+E
Sbjct  145   GKSASIQYGTGAISGFFSNDNVKVGNLVVKDQEFIEATKEPGVTFMAAKFDGILGLGFKE  204

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVGDA      MV QGL++D  FSFWLNRN  E+ GGE+VFGGVDP HYKG+HTYVP+T
Sbjct  205   ISVGDAVPVWYNMVEQGLIKDQEFSFWLNRNVGEEMGGEIVFGGVDPNHYKGKHTYVPIT  264

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQFDMG+VLI  KPTG+C+GGC+AIADSGTSL+AGP+++ITMIN AIGA GV S+E
Sbjct  265   QKGYWQFDMGDVLIGDKPTGYCAGGCAAIADSGTSLLAGPTTVITMINQAIGASGVASQE  324

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LH  557
             CKAVV+ YGQ +IDLLV +A P KICSQIGLC F+G+ GVSMGIE+VVDE NG S+  LH
Sbjct  325   CKAVVQQYGQTIIDLLVSQAEPMKICSQIGLCAFDGSHGVSMGIENVVDESNGKSSGILH  384

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
              AMC ACEM VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGES VDCG LS+MP++SF
Sbjct  385   SAMCPACEMAVVWMQNQLMENQTQDRILDYANQLCDRVPNPMGESTVDCGSLSSMPTISF  444

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK F+L+P E    VGEG+ AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD+G
Sbjct  445   TIGGKAFELTPEE----VGEGAEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDFG  500

Query  196   KMRVGFAEAA  167
             K+RVGFAEAA
Sbjct  501   KLRVGFAEAA  510



>gb|KDO62068.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=510

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/493 (74%), Positives = 421/493 (85%), Gaps = 6/493 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS  N G  RIGLKK K D NNR+AARL++K G+S R S+RKY +L G  G+  D DIV 
Sbjct  23    FSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKY-SLRGNLGESGDADIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHSKY S +SSTY
Sbjct  82    LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSA+IHYGTG+ISGFFS+D V++GDLVVK QA    T EP +TFL+AKFDGILGLG
Sbjct  142   KKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQA----TREPSLTFLLAKFDGILGLG  197

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      MVNQGLV +P+FSFW NRN  E+EGGE+VFGG+DP HYKGEHTYV
Sbjct  198   FQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEEEGGEIVFGGMDPDHYKGEHTYV  257

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+V+I+G+ TGFC+GGC+AIADSGTSL+AGP++IIT +NHAIGA G+V
Sbjct  258   PVTQKGYWQFDMGDVMIDGQTTGFCAGGCAAIADSGTSLLAGPTTIITQVNHAIGATGIV  317

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S+ECKAVV  YG+ +I++L+ +  P+KICSQIGLCTF+G+RGVSMGIESVV E N   S 
Sbjct  318   SQECKAVVSQYGEEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGIESVVPENNHRASG  377

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
               HDAMCS CEM VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGES VDC +LS++P 
Sbjct  378   GFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGESAVDCSRLSSLPI  437

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGK+FDL+P++YILKVGEG AAQCISGF+ALDV PPRGPLWILGDVFMG YHTVF
Sbjct  438   VSFTIGGKIFDLTPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWILGDVFMGPYHTVF  497

Query  205   DYGKMRVGFAEAA  167
             DY  MRVGFAEAA
Sbjct  498   DYSNMRVGFAEAA  510



>ref|XP_009361022.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=513

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/490 (73%), Positives = 421/490 (86%), Gaps = 1/490 (0%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             +SNDG +RIGLKK K+D+NNR+AA++++K G+SLRA ++KY  L G   D QD DIV LK
Sbjct  25    ESNDGLLRIGLKKRKLDQNNRVAAQIDSKEGESLRAVLQKY-RLGGNLADSQDIDIVSLK  83

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NYMDAQYFGEIG+GTPPQKFTVIFDTGS+NLWVPSSKCYFS+ C+ H KY SS SSTY K
Sbjct  84    NYMDAQYFGEIGIGTPPQKFTVIFDTGSANLWVPSSKCYFSIACYLHPKYKSSSSSTYNK  143

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISGFFS+D V VGDLVVK Q FIEAT EPGVTF+VAKFDGILGLGFQ
Sbjct  144   NGKPAAIQYGTGAISGFFSEDHVTVGDLVVKDQEFIEATKEPGVTFVVAKFDGILGLGFQ  203

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG+A      MVNQGL+++P+FSFW NRN  E+EGGE+VFGGVDP HYKGEHTYVPV
Sbjct  204   EISVGNAVPVWYNMVNQGLLKEPVFSFWFNRNADEEEGGEIVFGGVDPNHYKGEHTYVPV  263

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             TQKGYWQFDMG+V+I+G+ TGFC+ GCSAIADSGTSL+ GP++IIT +NHAIGA G+VS+
Sbjct  264   TQKGYWQFDMGDVMIDGQTTGFCASGCSAIADSGTSLLVGPTTIITELNHAIGASGIVSQ  323

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             ECK VV  YG+ +I+ ++ + +P KICSQIGLC+F+G  GVS+GI+SVV+  + VS DL 
Sbjct  324   ECKTVVAEYGETIIERILAKDQPAKICSQIGLCSFDGTHGVSIGIKSVVENTHKVSGDLS  383

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             DA CSACEMTVVWMQNQL +NQTQE IL YVN+LC+RLPSPMGES VDC  LS+MP+VSF
Sbjct  384   DATCSACEMTVVWMQNQLKQNQTQERILDYVNQLCDRLPSPMGESAVDCAGLSSMPNVSF  443

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGG+ FDL+P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG
Sbjct  444   TIGGRTFDLTPEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  503

Query  196   KMRVGFAEAA  167
               R+GFAEAA
Sbjct  504   NERIGFAEAA  513



>ref|XP_007211538.1| hypothetical protein PRUPE_ppa003924mg [Prunus persica]
 gb|EMJ12737.1| hypothetical protein PRUPE_ppa003924mg [Prunus persica]
Length=539

 Score =   769 bits (1986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/489 (73%), Positives = 427/489 (87%), Gaps = 2/489 (0%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  1451
             NDG  RIGLKK+K+D NNR+AA+LE+K  ++LRAS+RKY+ L     D  D DI+ LKNY
Sbjct  52    NDGLFRIGLKKVKLDPNNRVAAQLESKNVEALRASMRKYH-LPANLEDSGDIDILPLKNY  110

Query  1450  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNG  1271
             +DAQY+GEI +GTPPQ FTVIFDTGS+NLWVPSSKC+FSV C+FH+ Y S +SSTY+KNG
Sbjct  111   LDAQYYGEIAIGTPPQTFTVIFDTGSANLWVPSSKCHFSVACYFHANYKSGKSSTYKKNG  170

Query  1270  KSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEI  1091
              SA I YGTG+ISGF+S D+VQVGD+VV++Q FIEATSEPG+TFL AKFDG+LGLGFQEI
Sbjct  171   TSASIQYGTGAISGFYSNDNVQVGDIVVENQDFIEATSEPGLTFLAAKFDGLLGLGFQEI  230

Query  1090  SVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQ  911
             SVG+A      M+ QGL+++P+FSFWLNRN QE+EGGE+VFGGVDP H+KG+HTYVPVT+
Sbjct  231   SVGNAVPVWYNMIEQGLIKEPLFSFWLNRNAQEEEGGEIVFGGVDPNHFKGKHTYVPVTK  290

Query  910   KGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKEC  731
             KGYWQFDMG+VLI GKPTG+CSGGC A+ADSGTSL+AGP+++ITMIN AIGA+GVVS+EC
Sbjct  291   KGYWQFDMGDVLIGGKPTGYCSGGCFAVADSGTSLLAGPTTVITMINQAIGAEGVVSQEC  350

Query  730   KAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHD  554
             KAV + YGQ +++LL+ EARP K+CSQIGLCTF+G R VSMGIESVVD+ NG S+  LHD
Sbjct  351   KAVAQQYGQTIMNLLLAEARPDKVCSQIGLCTFDGTRSVSMGIESVVDKSNGKSSGILHD  410

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
             A CSACEM VVWM+NQL +NQTQ+ IL+YVNELC R+PSPMG+S VDCG+LS+MPSVSF+
Sbjct  411   ASCSACEMAVVWMKNQLGQNQTQDRILNYVNELCERMPSPMGQSAVDCGRLSSMPSVSFT  470

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IGGKVF+L+PNEYILKVGEG  AQCISGF  +D+PPPRGPLWILGD+FMGRYHTVFD G 
Sbjct  471   IGGKVFELTPNEYILKVGEGPQAQCISGFINIDIPPPRGPLWILGDIFMGRYHTVFDSGN  530

Query  193   MRVGFAEAA  167
             MRVGFAEAA
Sbjct  531   MRVGFAEAA  539



>ref|XP_010546667.1| PREDICTED: aspartic proteinase A1-like [Tarenaya hassleriana]
 ref|XP_010546675.1| PREDICTED: aspartic proteinase A1-like [Tarenaya hassleriana]
Length=508

 Score =   767 bits (1981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/494 (73%), Positives = 423/494 (86%), Gaps = 6/494 (1%)
 Frame = -2

Query  1645  AFSKSNDGFV-RIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDI  1469
             A S SNDG   RIGLKK+K+D N R A R+ ++  D+LRAS+++++ L    GD  DTDI
Sbjct  20    AASVSNDGRTFRIGLKKLKLDPNKRFAERIGSRQEDALRASLKEFH-LQKNLGDSGDTDI  78

Query  1468  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSS  1289
             V LKNY+DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKCY SV CFFHSKY SS+SS
Sbjct  79    VALKNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYLSVACFFHSKYKSSRSS  138

Query  1288  TYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILG  1109
             TY KNGKSA IHYGTG+ISGFFS D+V VGDLVV++Q FIEAT EP +TFLVAKFDGILG
Sbjct  139   TYRKNGKSASIHYGTGAISGFFSNDAVTVGDLVVQNQEFIEATREPSITFLVAKFDGILG  198

Query  1108  LGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHT  929
             LGFQEISVG+A      M+ QGL+++P+FSFWLNRNP ++EGGELVFGGVDP H+KGEHT
Sbjct  199   LGFQEISVGNATPVWYNMIKQGLIKEPVFSFWLNRNPNDEEGGELVFGGVDPNHFKGEHT  258

Query  928   YVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADG  749
             +VPVTQKGYWQF MG+VLI G PTGFC  GCSAIADSGTSL+AGP+++I MIN AIGA G
Sbjct  259   FVPVTQKGYWQFAMGDVLIGGAPTGFCGSGCSAIADSGTSLLAGPTTVIAMINKAIGASG  318

Query  748   VVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS  569
             VVS++CKAVV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G  GVSMGI+SVV+ +NGV 
Sbjct  319   VVSQQCKAVVDQYGQTILDLLLAETQPKKICSQIGLCTFDGAHGVSMGIKSVVERENGV-  377

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
                +D  CSACEM VVW+QNQL +N TQ+ IL+Y+NELC R+PSPMGES VDCG+LS+MP
Sbjct  378   ---NDGACSACEMAVVWIQNQLRQNMTQDRILNYINELCERMPSPMGESAVDCGQLSSMP  434

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VSFSIGGKVF+L+P EY+LKVGEG  AQCISGF ALDVPPPRGPLWILGDVFMG+YHTV
Sbjct  435   TVSFSIGGKVFELAPEEYVLKVGEGPVAQCISGFIALDVPPPRGPLWILGDVFMGKYHTV  494

Query  208   FDYGKMRVGFAEAA  167
             FD+G MRVGFAEAA
Sbjct  495   FDFGNMRVGFAEAA  508



>ref|XP_010035554.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010035555.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW46979.1| hypothetical protein EUGRSUZ_K00787 [Eucalyptus grandis]
Length=514

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/493 (73%), Positives = 416/493 (84%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
              S S+DG VRIGLKK K+D  NR+A +  +K G + R  +RKYY LH   GD +D DIV 
Sbjct  23    ISSSSDGMVRIGLKKRKLDHVNRVAEQGNSKEGGTPRGPLRKYY-LHNNLGDSEDIDIVS  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTP QKFTVIFDTGSSNLWVPSSKCY SV C+FHSK+ SS SSTY
Sbjct  82    LKNYMDAQYFGEIGIGTPSQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSKFKSSDSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSAEIHYGTG+ISGFFSQD V+VGDLVVK Q FIEAT EP +TFL AKFDGILGLG
Sbjct  142   KKNGKSAEIHYGTGAISGFFSQDHVKVGDLVVKGQEFIEATREPSITFLAAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             F+EISVGDA      MVNQGL+++P+FSFWLNRN + +EGGE+VFGG D  HYKGEHTYV
Sbjct  202   FKEISVGDATPVWYNMVNQGLIKEPVFSFWLNRNTEGEEGGEIVFGGADSSHYKGEHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQF M +VLI  + TGFC+ GCSAIADSGTSL+AGP+++IT INHAIGA GVV
Sbjct  262   PVTQKGYWQFKMADVLIGNETTGFCASGCSAIADSGTSLLAGPTTVITQINHAIGASGVV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA-  566
             S+ECK +V  YG+ ++++L+ EA+P+KICSQIG CTF+G  GV MGIESVVDE  G S+ 
Sbjct  322   SQECKTIVGQYGKTILEMLMTEAKPQKICSQIGFCTFDGTHGVRMGIESVVDETKGKSSG  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              LHDAMCSACEM VVWMQNQL+ NQT++ IL+YVNELC+R+PSPMGES VDC  LS+MP 
Sbjct  382   GLHDAMCSACEMAVVWMQNQLTRNQTEDQILNYVNELCDRIPSPMGESAVDCNSLSSMPR  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGKVFDL+P +Y+LKVGEG A+QCISGFTALDV PPRGPLWILGD+FMG+YHTVF
Sbjct  442   VSFTIGGKVFDLAPEQYVLKVGEGGASQCISGFTALDVAPPRGPLWILGDIFMGKYHTVF  501

Query  205   DYGKMRVGFAEAA  167
             DYG  RVGFAEAA
Sbjct  502   DYGNQRVGFAEAA  514



>gb|KJB69260.1| hypothetical protein B456_011G012800 [Gossypium raimondii]
Length=521

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/499 (73%), Positives = 425/499 (85%), Gaps = 8/499 (2%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             + S+DG VRIGLKK K D NNR+A+RLE++   +L AS+++ Y LH   GD +DTDIV L
Sbjct  23    TASDDGLVRIGLKKKKFDPNNRLASRLESEDRQALIASMQEKYGLHNNLGDHEDTDIVAL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQY+GEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV C+FHSKY +S+S TY+
Sbjct  83    KNYMDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKASESKTYK  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A I YGTG+ISGFFS D+VQVG+LVV+ Q FIE T EPG+ FL AKFDGILGLGF
Sbjct  143   KNGKPASIQYGTGAISGFFSYDNVQVGNLVVEDQEFIETTKEPGLIFLAAKFDGILGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVG A      M+ QGL+++P+FSFWLNRN  E+ GGE+VFGGVDP HYKG+HTYVP
Sbjct  203   KEISVGKAVPVWYNMLKQGLIKEPVFSFWLNRNVGEEVGGEIVFGGVDPDHYKGKHTYVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTG-------FCSGGCSAIADSGTSLIAGPSSIITMINHAI  761
             VTQKGYWQFDMG+VLI  KPTG       FC+GGC+AIADSGTSL+AGP++++TMINHAI
Sbjct  263   VTQKGYWQFDMGDVLIGDKPTGMFLPMPRFCAGGCAAIADSGTSLLAGPTTVVTMINHAI  322

Query  760   GADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK  581
             GA GVVS+ECKAVV+ YGQ +IDLL+ E +P+KICSQIGLCTF+G  GVSMGIESVV+E 
Sbjct  323   GATGVVSQECKAVVQQYGQTIIDLLLAETQPQKICSQIGLCTFDGAHGVSMGIESVVEEG  382

Query  580   NGVSADLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGK  404
             NG S+ +  +AMC ACEM VVWMQNQL +NQT + IL+YVN+LC+R+PSPMGES V+CG 
Sbjct  383   NGKSSGVQFNAMCPACEMAVVWMQNQLKQNQTLDVILNYVNQLCDRMPSPMGESAVECGS  442

Query  403   LSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMG  224
             LS+MP+VSF+IG KVFDLSP EYILKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMG
Sbjct  443   LSSMPTVSFTIGDKVFDLSPEEYILKVGEGPQAQCISGFTALDVPPPRGPLWILGDVFMG  502

Query  223   RYHTVFDYGKMRVGFAEAA  167
             RYHTVFD+GK RVGFAEAA
Sbjct  503   RYHTVFDFGKERVGFAEAA  521



>gb|KJB67248.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=506

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/490 (74%), Positives = 418/490 (85%), Gaps = 9/490 (2%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             SNDG VRIGLKKMK+D NNR+AA+L++K  ++LRAS+ + Y      GD ++TDIV LKN
Sbjct  25    SNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIARKYRFRNDLGDSEETDIVALKN  84

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV CFFHSKY +S+SSTY+KN
Sbjct  85    YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSKYKASESSTYKKN  144

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKSA I YGTG+ISGFFS D+V+VG+LVVK Q FIEAT EPGVTF+ AKFDGILGLGF+E
Sbjct  145   GKSASIQYGTGAISGFFSNDNVKVGNLVVKDQEFIEATKEPGVTFMAAKFDGILGLGFKE  204

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVGDA      MV QGL++D  FSFWLNRN  E+ GGE+VFGGVDP HYKG+HTYVP+T
Sbjct  205   ISVGDAVPVWYNMVEQGLIKDQEFSFWLNRNVGEEMGGEIVFGGVDPNHYKGKHTYVPIT  264

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQFDMG+VLI  KPT        AIADSGTSL+AGP+++ITMIN AIGA GV S+E
Sbjct  265   QKGYWQFDMGDVLIGDKPT--------AIADSGTSLLAGPTTVITMINQAIGASGVASQE  316

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LH  557
             CKAVV+ YGQ +IDLLV +A P KICSQIGLC F+G+ GVSMGIE+VVDE NG S+  LH
Sbjct  317   CKAVVQQYGQTIIDLLVSQAEPMKICSQIGLCAFDGSHGVSMGIENVVDESNGKSSGILH  376

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
              AMC ACEM VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGES VDCG LS+MP++SF
Sbjct  377   SAMCPACEMAVVWMQNQLMENQTQDRILDYANQLCDRVPNPMGESTVDCGSLSSMPTISF  436

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK F+L+P EYILKVGEG+ AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD+G
Sbjct  437   TIGGKAFELTPEEYILKVGEGAEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDFG  496

Query  196   KMRVGFAEAA  167
             K+RVGFAEAA
Sbjct  497   KLRVGFAEAA  506



>ref|XP_008224698.1| PREDICTED: aspartic proteinase-like [Prunus mume]
Length=514

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/488 (73%), Positives = 425/488 (87%), Gaps = 2/488 (0%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  1451
             NDG  RIGLKK+K+D NNR+AA+LE+K  ++LRAS+RKY+ L     D  D DIV LKNY
Sbjct  27    NDGLFRIGLKKVKLDPNNRVAAQLESKNVEALRASMRKYH-LPANLEDSGDIDIVSLKNY  85

Query  1450  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNG  1271
             +DAQY+GEI +GTPPQ FTVIFDTGS+NLWVPSSKC+FSV C+FH+ Y S +SSTY+KNG
Sbjct  86    LDAQYYGEIAIGTPPQTFTVIFDTGSANLWVPSSKCHFSVACYFHANYKSGKSSTYKKNG  145

Query  1270  KSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEI  1091
              SA I YGTG+ISGF+S D+VQVGD+VV++Q FIEATSEPG+ FL AKFDG+LGLGFQEI
Sbjct  146   TSASIQYGTGAISGFYSNDNVQVGDIVVENQDFIEATSEPGLIFLAAKFDGLLGLGFQEI  205

Query  1090  SVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQ  911
             SVG+A      M+ QGL+++P+FSFWLNRN QE+EGGE+VFGGVDP H+KG+HTYVPV +
Sbjct  206   SVGNAVPVWYNMIEQGLIKEPLFSFWLNRNAQEEEGGEIVFGGVDPNHFKGKHTYVPVMK  265

Query  910   KGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKEC  731
             KGYWQFDMG+VLI GKPTG+CS GC A+ADSGTSL+AGP+++ITMIN AIGA+GVVS+EC
Sbjct  266   KGYWQFDMGDVLIGGKPTGYCSRGCFAVADSGTSLLAGPTTVITMINQAIGAEGVVSQEC  325

Query  730   KAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHD  554
             KAV + YGQ +++LL+ EARP K+CSQIGLCTF+G R VS+GIESVVD+ NG S+  LHD
Sbjct  326   KAVAQQYGQTIMNLLLAEARPDKVCSQIGLCTFDGTRSVSVGIESVVDKSNGKSSGILHD  385

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
             A CSACEM VVWM+NQL +NQTQ+ IL+YVNELC R+PSPMG+S VDCGKLS+MPSVSF+
Sbjct  386   ASCSACEMAVVWMKNQLGQNQTQDRILNYVNELCERMPSPMGQSAVDCGKLSSMPSVSFT  445

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IGGKVF+L+PNEYILKVGEG  AQCISGFT +D+PPPRGPLWILGD+FMGRYHTVFD G+
Sbjct  446   IGGKVFELTPNEYILKVGEGPQAQCISGFTNIDIPPPRGPLWILGDIFMGRYHTVFDSGR  505

Query  193   MRVGFAEA  170
             MRVGFAEA
Sbjct  506   MRVGFAEA  513



>ref|XP_010553449.1| PREDICTED: aspartic proteinase A1 [Tarenaya hassleriana]
Length=518

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/490 (73%), Positives = 421/490 (86%), Gaps = 2/490 (0%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S+ +DG  RIGLKK+K+D NNR+A+RL +K  ++LRAS++++   H   GD  DTD+V
Sbjct  22    ASSERSDGTFRIGLKKLKLDPNNRLASRLGSKQEEALRASLKEF-RFHNNLGDSGDTDVV  80

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEIG+GTPPQKFTVIFDTGSSNLW+PSSKCY SV CFFH+KY SS+S+T
Sbjct  81    ALKNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWIPSSKCYLSVACFFHNKYKSSRSTT  140

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+KNGKSA IHYGTG+ISGFFS D+V VGDLVV+ Q FIEAT EP +TFLVAKFDGILGL
Sbjct  141   YKKNGKSASIHYGTGAISGFFSYDAVTVGDLVVQGQEFIEATREPSITFLVAKFDGILGL  200

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      M+NQGL+++PIFSFWLNRNP+++EGGELVFGGVDP H+KGEHT+
Sbjct  201   GFQEISVGNATPVWYNMINQGLIKEPIFSFWLNRNPEDEEGGELVFGGVDPNHFKGEHTF  260

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI G+PTG+C  GCSAIADSGTSL+AGP+++I MIN AIGA GV
Sbjct  261   VPVTQKGYWQFDMGDVLIGGEPTGYCESGCSAIADSGTSLLAGPTTVIAMINKAIGASGV  320

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGV-S  569
             VS++CKAVVE YGQ ++DLL+ E +PKKICSQIGLCTF+G  GVSM IESVVD +N   S
Sbjct  321   VSQQCKAVVEQYGQTILDLLLAETQPKKICSQIGLCTFDGAHGVSMDIESVVDRENAKPS  380

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               L DA CSACEM VVW+QNQL +N TQ+ IL+Y+NELC R+PSPMGES VDC +LSTMP
Sbjct  381   GALGDAACSACEMAVVWIQNQLRQNMTQDRILNYINELCERMPSPMGESAVDCAQLSTMP  440

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VS +IGGKVFDL+P EYILK+GEG  AQCISGF ALDVPPPRGPLWILGDVFMG+YHTV
Sbjct  441   TVSLTIGGKVFDLAPEEYILKMGEGPVAQCISGFIALDVPPPRGPLWILGDVFMGKYHTV  500

Query  208   FDYGKMRVGF  179
             FD+G  RVGF
Sbjct  501   FDFGNERVGF  510



>ref|XP_011086196.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Sesamum indicum]
Length=561

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/488 (74%), Positives = 422/488 (86%), Gaps = 4/488 (1%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  1451
             +D  +RI +KK+K+D N+R+AARLE+K G   R  VRKY  L G+  +  D+DIV L+NY
Sbjct  78    DDALIRIRVKKLKLDGNSRLAARLESKEG---RVPVRKYSPL-GKVVNNADSDIVELENY  133

Query  1450  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNG  1271
             MDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFS+PC+ HSKY SSQSSTY+ NG
Sbjct  134   MDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSLPCYVHSKYKSSQSSTYKMNG  193

Query  1270  KSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEI  1091
             KSA I YGTG+ISGFFS+D+V +G LVVK Q FIEATSEPG+TFLVAKFDGILGLGFQEI
Sbjct  194   KSAAIQYGTGAISGFFSEDNVNIGHLVVKYQEFIEATSEPGLTFLVAKFDGILGLGFQEI  253

Query  1090  SVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQ  911
             SVG+A      MV QGLV++P+FSFWLNRN  E++GGELVFGGVDP HYKG+HTYVPVTQ
Sbjct  254   SVGNATPVWYNMVKQGLVKEPVFSFWLNRNENEEKGGELVFGGVDPNHYKGQHTYVPVTQ  313

Query  910   KGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKEC  731
             KGYWQF+MG+ LI+GK TG+CSG CSAIADSGTSLIAGP+++I MIN AIGA GVVS+EC
Sbjct  314   KGYWQFEMGDFLIDGKKTGYCSGRCSAIADSGTSLIAGPTTVIAMINRAIGASGVVSQEC  373

Query  730   KAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDA  551
             K+VVE YGQ ++DLL+ EA+P+KICSQ+GLCTF+G RGVS GIESVVDE+ G S+ LHDA
Sbjct  374   KSVVEQYGQTILDLLLAEAKPEKICSQVGLCTFDGTRGVSGGIESVVDEQGGRSSSLHDA  433

Query  550   MCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSI  371
             MC ACEM +VWM+NQL +N+TQ+ ILSY NELC RLPSP+GES VDCG++ +MPSVSF+I
Sbjct  434   MCPACEMAIVWMKNQLEQNKTQDRILSYANELCERLPSPLGESAVDCGRIPSMPSVSFTI  493

Query  370   GGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKM  191
             GGK F LS  +YILKVGEG+ AQCISGF+ LD+PPPRGPLWILGD+FMG YHTVFDYGK+
Sbjct  494   GGKEFKLSAEQYILKVGEGAEAQCISGFSGLDIPPPRGPLWILGDIFMGPYHTVFDYGKL  553

Query  190   RVGFAEAA  167
             RVGFAEAA
Sbjct  554   RVGFAEAA  561



>ref|XP_008380299.1| PREDICTED: aspartic proteinase A1-like [Malus domestica]
Length=513

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/492 (73%), Positives = 420/492 (85%), Gaps = 1/492 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             F +SNDG +RIGLKK K+D+NN +A+++++K G+SLRA+++KY  L G   D QD DIV 
Sbjct  23    FCESNDGLLRIGLKKRKLDQNNXVASQIDSKEGESLRATLQKY-RLGGNLADSQDIDIVS  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQKFTVIFDTGS+NLWVPSSKC+FS+ C+ H KY SS SSTY
Sbjct  82    LKNYMDAQYFGEIGIGTPPQKFTVIFDTGSANLWVPSSKCFFSIACYLHPKYKSSSSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
              KNGK A I YGTG+ISGFFS+D V VGDLVVK Q FIEAT EPGVTF+VAKFDGILGLG
Sbjct  142   NKNGKPAAIQYGTGAISGFFSEDHVTVGDLVVKDQEFIEATKEPGVTFVVAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MVNQGL+++P+FSFW NRN  E+EGGE+VFGGVDP HYKGEHTYV
Sbjct  202   FQEISVGNAVPVWYNMVNQGLLKEPVFSFWFNRNADEEEGGEIVFGGVDPNHYKGEHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+V+I+G+ TGFC+ GCSAIADSGTSL+ GP++IIT +NHAIGA G+V
Sbjct  262   PVTQKGYWQFDMGDVMIDGQTTGFCASGCSAIADSGTSLLVGPTTIITELNHAIGASGIV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+ECK VV  YG+ +I+ ++ + +P KICSQIGLC+F+G  GVS+GI+SVV   + VS D
Sbjct  322   SQECKTVVAEYGETIIERILAKDQPAKICSQIGLCSFDGTHGVSIGIKSVVXNTHKVSGD  381

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             L DA CSACEMTVVWMQNQL + QTQE IL YVN+LC+RLPSPMGES VDC  LS+MPSV
Sbjct  382   LSDATCSACEMTVVWMQNQLKQXQTQERILDYVNQLCDRLPSPMGESAVDCAGLSSMPSV  441

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IGG+ FDL+P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD
Sbjct  442   SFTIGGRTFDLTPEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  501

Query  202   YGKMRVGFAEAA  167
             YG  R+GFAEAA
Sbjct  502   YGNERIGFAEAA  513



>ref|XP_006389579.1| aspartic endopeptidase family protein [Populus trichocarpa]
 gb|ERP48493.1| aspartic endopeptidase family protein [Populus trichocarpa]
Length=512

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/493 (72%), Positives = 428/493 (87%), Gaps = 4/493 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
              S+SNDG +RIGLKK+K DKNNRIAARL+++  ++LRAS+RKY NL G  G+ +DTDIV 
Sbjct  23    LSESNDGLLRIGLKKVKFDKNNRIAARLDSQ--EALRASIRKY-NLLGNLGESEDTDIVA  79

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY DAQY+GEIGVGTPPQKFTVIFDTGSSNLWVPSSKCY SV C+FHSKY S +SS+Y
Sbjct  80    LKNYFDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSKYNSGKSSSY  139

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSAEI YG+GSISGFFS D+V+VG+LVVK Q FIEAT EP +TFLV KFDGILGLG
Sbjct  140   KKNGKSAEIQYGSGSISGFFSIDAVEVGNLVVKDQEFIEATKEPSITFLVGKFDGILGLG  199

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             F+EI+VG A      M+ QGL+++P+FSFWLNRN  ++EGGE+VFGG+DP HYKG+HTYV
Sbjct  200   FKEIAVGGAVPVWDNMIKQGLIKEPVFSFWLNRNADDEEGGEIVFGGMDPNHYKGKHTYV  259

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+V++  K TG+C+GGC+AIADSGTSL+AGP++IITMINHAIGA GVV
Sbjct  260   PVTQKGYWQFDMGDVIVGDKSTGYCAGGCAAIADSGTSLLAGPTAIITMINHAIGASGVV  319

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S++CKAVV  YG+ ++DLL+ E +PKKICSQIGLCTF+G RG+SMGI+SVVDE N  S+ 
Sbjct  320   SQQCKAVVSQYGEVIMDLLLSEVQPKKICSQIGLCTFDGTRGISMGIQSVVDEGNDKSSG  379

Query  562   -LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L DAMCSACEM V WM++QL +NQTQ+ +L Y N+LC R+P+P G+S VDCG + +MP 
Sbjct  380   VLGDAMCSACEMAVFWMRSQLQQNQTQDRVLDYANQLCERVPNPTGQSTVDCGSVLSMPR  439

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             ++F+IGGK F+L+P EYILKVG+GSAAQCISGFTALD+PPPRGPLWILGDVFMGRYHTVF
Sbjct  440   IAFTIGGKEFELAPEEYILKVGQGSAAQCISGFTALDIPPPRGPLWILGDVFMGRYHTVF  499

Query  205   DYGKMRVGFAEAA  167
             D GK+RVGFAEAA
Sbjct  500   DSGKLRVGFAEAA  512



>gb|KDO62069.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=505

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/493 (73%), Positives = 418/493 (85%), Gaps = 11/493 (2%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS  N G  RIGLKK K D NNR+AARL++K G+S R S+RKY +L G  G+  D DIV 
Sbjct  23    FSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKY-SLRGNLGESGDADIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHSKY S +SSTY
Sbjct  82    LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSA+IHYGTG+ISGFFS+D V++GDLVVK Q FIEAT EP +TFL+AKFDGILGLG
Sbjct  142   KKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      MVNQGLV +P+FSFW NRN  E+EGGE+VFGG+DP HYKGEHTYV
Sbjct  202   FQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEEEGGEIVFGGMDPDHYKGEHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+V+I+G+ TGFC+GGC+AIADSGTSL+AGP++IIT +NHAIGA G+V
Sbjct  262   PVTQKGYWQFDMGDVMIDGQTTGFCAGGCAAIADSGTSLLAGPTTIITQVNHAIGATGIV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S+ECKAVV  YG+ +I++L+         ++IGLCTF+G+RGVSMGIESVV E N   S 
Sbjct  322   SQECKAVVSQYGEEIINMLL---------AKIGLCTFDGSRGVSMGIESVVPENNHRASG  372

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
               HDAMCS CEM VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGES VDC +LS++P 
Sbjct  373   GFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGESAVDCSRLSSLPI  432

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGK+FDL+P++YILKVGEG AAQCISGF+ALDV PPRGPLWILGDVFMG YHTVF
Sbjct  433   VSFTIGGKIFDLTPDQYILKVGEGDAAQCISGFSALDVAPPRGPLWILGDVFMGPYHTVF  492

Query  205   DYGKMRVGFAEAA  167
             DY  MRVGFAEAA
Sbjct  493   DYSNMRVGFAEAA  505



>ref|XP_007020768.1| Aspartic proteinase A1 [Theobroma cacao]
 gb|EOY12293.1| Aspartic proteinase A1 [Theobroma cacao]
Length=514

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/494 (72%), Positives = 421/494 (85%), Gaps = 2/494 (0%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
              FS SN+  VRIGLKK K D+N R+AA L++K  ++ RAS++KY  L G   + +D DIV
Sbjct  22    VFSISNERLVRIGLKKRKFDQNYRLAAHLDSKEREAFRASLKKY-RLQGNLQESEDIDIV  80

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+ HS+Y SS+SST
Sbjct  81    ALKNYLDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYLHSRYKSSRSST  140

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+ NGK A+I YGTG+ISGFFS+D+VQVGDLVVK+Q FIEAT EP +TFLVAKFDGILGL
Sbjct  141   YKANGKPADIQYGTGAISGFFSEDNVQVGDLVVKNQEFIEATREPSITFLVAKFDGILGL  200

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      MVNQGLV++P+FSFW NR+P++  GGE+VFGG+DPKH+KG+HTY
Sbjct  201   GFQEISVGNAVPVWYNMVNQGLVKEPVFSFWFNRDPEDDIGGEVVFGGMDPKHFKGDHTY  260

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VP+T+KGYWQFDMG+VLI  + TG C+GGCSAIADSGTSLI GP++II  +NHAIGA GV
Sbjct  261   VPITRKGYWQFDMGDVLIGNQTTGLCAGGCSAIADSGTSLITGPTAIIAQVNHAIGASGV  320

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VS  569
             VS+ECK VV  YG+ +ID+L+ + +P KICSQIGLCTF+G RGVS GIESVV E  G  +
Sbjct  321   VSQECKTVVSQYGETIIDMLLSKDQPLKICSQIGLCTFDGTRGVSTGIESVVHENAGKAT  380

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
              DLHDAMCS CEMTV+WMQNQL +NQTQE IL Y+NELC+RLPSPMGES VDC  LSTMP
Sbjct  381   GDLHDAMCSTCEMTVIWMQNQLKQNQTQERILEYINELCDRLPSPMGESAVDCSSLSTMP  440

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VSF+IGGK+F+LSP +Y+LKVGEG  AQC+SGFTALDVPPPRGPLWILGDVFMG++HTV
Sbjct  441   NVSFTIGGKIFELSPEQYVLKVGEGDVAQCLSGFTALDVPPPRGPLWILGDVFMGQFHTV  500

Query  208   FDYGKMRVGFAEAA  167
             FDYG ++VGFAEAA
Sbjct  501   FDYGNLQVGFAEAA  514



>ref|XP_011086197.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Sesamum indicum]
Length=510

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/488 (74%), Positives = 422/488 (86%), Gaps = 4/488 (1%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  1451
             +D  +RI +KK+K+D N+R+AARLE+K G   R  VRKY  L G+  +  D+DIV L+NY
Sbjct  27    DDALIRIRVKKLKLDGNSRLAARLESKEG---RVPVRKYSPL-GKVVNNADSDIVELENY  82

Query  1450  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNG  1271
             MDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFS+PC+ HSKY SSQSSTY+ NG
Sbjct  83    MDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSLPCYVHSKYKSSQSSTYKMNG  142

Query  1270  KSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEI  1091
             KSA I YGTG+ISGFFS+D+V +G LVVK Q FIEATSEPG+TFLVAKFDGILGLGFQEI
Sbjct  143   KSAAIQYGTGAISGFFSEDNVNIGHLVVKYQEFIEATSEPGLTFLVAKFDGILGLGFQEI  202

Query  1090  SVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQ  911
             SVG+A      MV QGLV++P+FSFWLNRN  E++GGELVFGGVDP HYKG+HTYVPVTQ
Sbjct  203   SVGNATPVWYNMVKQGLVKEPVFSFWLNRNENEEKGGELVFGGVDPNHYKGQHTYVPVTQ  262

Query  910   KGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKEC  731
             KGYWQF+MG+ LI+GK TG+CSG CSAIADSGTSLIAGP+++I MIN AIGA GVVS+EC
Sbjct  263   KGYWQFEMGDFLIDGKKTGYCSGRCSAIADSGTSLIAGPTTVIAMINRAIGASGVVSQEC  322

Query  730   KAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDA  551
             K+VVE YGQ ++DLL+ EA+P+KICSQ+GLCTF+G RGVS GIESVVDE+ G S+ LHDA
Sbjct  323   KSVVEQYGQTILDLLLAEAKPEKICSQVGLCTFDGTRGVSGGIESVVDEQGGRSSSLHDA  382

Query  550   MCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSI  371
             MC ACEM +VWM+NQL +N+TQ+ ILSY NELC RLPSP+GES VDCG++ +MPSVSF+I
Sbjct  383   MCPACEMAIVWMKNQLEQNKTQDRILSYANELCERLPSPLGESAVDCGRIPSMPSVSFTI  442

Query  370   GGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKM  191
             GGK F LS  +YILKVGEG+ AQCISGF+ LD+PPPRGPLWILGD+FMG YHTVFDYGK+
Sbjct  443   GGKEFKLSAEQYILKVGEGAEAQCISGFSGLDIPPPRGPLWILGDIFMGPYHTVFDYGKL  502

Query  190   RVGFAEAA  167
             RVGFAEAA
Sbjct  503   RVGFAEAA  510



>ref|XP_002279049.1| PREDICTED: aspartic proteinase A1 [Vitis vinifera]
 emb|CBI26663.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   763 bits (1969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/493 (72%), Positives = 418/493 (85%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS S+ G VRIGLKK   D+ NR+AAR+E+K G++L  S+RKY NLHG     + T +V 
Sbjct  23    FSASDGGLVRIGLKKRAFDQTNRLAARIESKQGEALGTSIRKY-NLHGNAAGSKHTYVVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             L NYMDAQYFGEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFSV C+FHSKY SSQSSTY
Sbjct  82    LHNYMDAQYFGEISIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSQSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNG SA+IHYGTG+ISGFFS+D V+VGDL V +Q FIEAT EP +TF +AKFDGILGLG
Sbjct  142   KKNGTSADIHYGTGAISGFFSKDDVKVGDLAVINQEFIEATKEPSITFALAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      M+NQ L+++PIFSFW NRN  E+ GGE+VFGG+D  HYKG+HTYV
Sbjct  202   FQEISVGNAVPVWYNMINQELIKEPIFSFWFNRNSNEEVGGEIVFGGIDSDHYKGKHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFD+G+V+I GK TGFC+ GCSAIADSGTSL+AGP++IIT +NHAIGA G V
Sbjct  262   PVTKKGYWQFDLGDVMIGGKTTGFCASGCSAIADSGTSLLAGPTTIITEVNHAIGASGFV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+EC+AVV+ YGQ +ID+L+ + +P+KICSQIGLC FNG RGVSMGIESVVDE N  ++D
Sbjct  322   SQECRAVVQQYGQIIIDMLLTKEQPQKICSQIGLCAFNGIRGVSMGIESVVDENNSKASD  381

Query  562   -LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              LHD MCSAC M VVW+QN+L +N+T + IL YVNELC+RLPSPMGES VDCG LS+MP+
Sbjct  382   GLHDTMCSACSMAVVWIQNKLGQNETIDRILKYVNELCDRLPSPMGESAVDCGSLSSMPN  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VS +IGGKVFDLSP +YILKVGEG  AQCISGFTALDVPPP GPLWILGDVFMG+YHTVF
Sbjct  442   VSLTIGGKVFDLSPKQYILKVGEGEIAQCISGFTALDVPPPHGPLWILGDVFMGQYHTVF  501

Query  205   DYGKMRVGFAEAA  167
             DYG M+VGFAEAA
Sbjct  502   DYGNMKVGFAEAA  514



>emb|CAC86003.1| aspartic proteinase [Theobroma cacao]
Length=514

 Score =   762 bits (1968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/494 (72%), Positives = 421/494 (85%), Gaps = 2/494 (0%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
              FS SN+  VRIGLKK K D+N R+AA L++K  ++ RAS++KY  L G   + +D DIV
Sbjct  22    VFSISNERLVRIGLKKRKFDQNYRLAAHLDSKEREAFRASLKKY-RLQGNLQESEDIDIV  80

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+ HS+Y SS+SST
Sbjct  81    ALKNYLDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYLHSRYKSSRSST  140

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+ NGK A+I YGTG+ISGFFS+D+VQVGDLVVK+Q FIEAT EP +TFLVAKFDGILGL
Sbjct  141   YKANGKPADIQYGTGAISGFFSEDNVQVGDLVVKNQEFIEATREPSITFLVAKFDGILGL  200

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      MVNQGLV++P+FSFW NR+P++  GGE+VFGG+DPKH+KG+HTY
Sbjct  201   GFQEISVGNAVPVWYNMVNQGLVKEPVFSFWFNRDPEDDIGGEVVFGGMDPKHFKGDHTY  260

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VP+T+KGYWQFDMG+VLI  + TG C+GGCSAIADSGTSLI GP++II  +NHAIGA GV
Sbjct  261   VPITRKGYWQFDMGDVLIGNQTTGLCAGGCSAIADSGTSLITGPTAIIAQVNHAIGASGV  320

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VS  569
             VS+ECK VV  YG+ +ID+L+ + +P KICSQIGLCTF+G RGVS GIESVV E  G  +
Sbjct  321   VSQECKTVVSQYGETIIDMLLSKDQPLKICSQIGLCTFDGTRGVSTGIESVVHENVGKAT  380

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
              DLHDAMCS CEMTV+WMQNQL +NQTQE IL Y+NELC+RLPSPMGES VDC  LSTMP
Sbjct  381   GDLHDAMCSTCEMTVIWMQNQLKQNQTQERILEYINELCDRLPSPMGESAVDCSSLSTMP  440

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VSF+IGGK+F+LSP +Y+LKVGEG  AQC+SGFTALDVPPPRGPLWILGDVFMG++HTV
Sbjct  441   NVSFTIGGKIFELSPEQYVLKVGEGDVAQCLSGFTALDVPPPRGPLWILGDVFMGQFHTV  500

Query  208   FDYGKMRVGFAEAA  167
             FDYG ++VGFAEAA
Sbjct  501   FDYGNLQVGFAEAA  514



>ref|XP_006383885.1| hypothetical protein POPTR_0004s00900g [Populus trichocarpa]
 gb|ERP61682.1| hypothetical protein POPTR_0004s00900g [Populus trichocarpa]
Length=552

 Score =   764 bits (1972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/492 (72%), Positives = 431/492 (88%), Gaps = 4/492 (1%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SNDG +RIGLKK+K+DKNNRIAARL++K  ++LRAS+RKY NL G  G+ +DTDIV L
Sbjct  64    SASNDGLLRIGLKKVKLDKNNRIAARLDSK--ETLRASIRKY-NLCGNLGESEDTDIVAL  120

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+D+QY+GEIGVG+PPQKFTVIFDTGSSNLWVPSSKCY SV C+FHSKY S +SSTY+
Sbjct  121   KNYLDSQYYGEIGVGSPPQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSKYDSGKSSTYK  180

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGKSAEI YG+GSISGFFS D+V+VG LVVK Q FIEAT EP +TFLVAKFDGILGLGF
Sbjct  181   KNGKSAEIRYGSGSISGFFSNDAVEVGGLVVKDQEFIEATKEPSITFLVAKFDGILGLGF  240

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVGDA      M+  GL+++P+FSFWLNRN +++EGGE+VFGG+DP HYKG+HT+VP
Sbjct  241   KEISVGDAVPVWDNMIKHGLIKEPVFSFWLNRNAEDEEGGEIVFGGMDPNHYKGKHTFVP  300

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VT+KGYWQF+MG+V I  KPTG+C+ GC+AIADSGTSL+AGP++IITMIN AIGA GVVS
Sbjct  301   VTRKGYWQFNMGDVHIGDKPTGYCASGCAAIADSGTSLLAGPTTIITMINQAIGASGVVS  360

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-  563
             ++CKAVV  YG+ ++DLL+ +A+PK+ICSQIGLCTF+G RG+S+GI+SVVDE N  S+  
Sbjct  361   QQCKAVVSQYGEAIMDLLLSQAQPKRICSQIGLCTFDGTRGISIGIQSVVDEGNDKSSGV  420

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             L DAMC ACEM VVWM++QL +NQTQ+ IL YVN+LC R+P+PMGES VDC  + +MP+V
Sbjct  421   LGDAMCPACEMAVVWMRSQLKQNQTQDRILDYVNQLCERMPNPMGESAVDCESVPSMPTV  480

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             +F+IGGK F+L+P EYILKVG+GSAAQCISGFTALD+PPPRGPLWILGD+FMGRYHTVFD
Sbjct  481   AFTIGGKEFELAPEEYILKVGQGSAAQCISGFTALDIPPPRGPLWILGDIFMGRYHTVFD  540

Query  202   YGKMRVGFAEAA  167
              GK+RVGFAEAA
Sbjct  541   SGKLRVGFAEAA  552



>ref|XP_002892661.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68920.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/494 (73%), Positives = 418/494 (85%), Gaps = 10/494 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AFS+ NDG  R+GLKK+K+D  NR+AAR+E+K    LRA     Y+L    G+ +D D+V
Sbjct  22    AFSERNDGTFRVGLKKLKLDSKNRLAARVESKQDKPLRA-----YSL----GNSEDADVV  72

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C  H KY SS+SST
Sbjct  73    VLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSLACLLHPKYKSSRSST  132

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             YEKNGKSA IHYGTG+I+GFFS D+V VGDLVVK Q FIEAT EPG+TF+VAKFDGILGL
Sbjct  133   YEKNGKSAAIHYGTGAIAGFFSNDAVTVGDLVVKDQEFIEATKEPGITFVVAKFDGILGL  192

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      M+ QGL+++P+FSFW NRN  E+EGGELVFGGVDP H+KG+HTY
Sbjct  193   GFQEISVGNATPVWYNMLKQGLIKEPVFSFWFNRNADEEEGGELVFGGVDPNHFKGKHTY  252

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI G PTGFC  GCSAIADSGTSL+AGP++IITMINHAIGA GV
Sbjct  253   VPVTQKGYWQFDMGDVLIGGAPTGFCESGCSAIADSGTSLLAGPTTIITMINHAIGAAGV  312

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VS  569
             VS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S
Sbjct  313   VSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENSKLS  372

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               + DA CSACEM VVW+Q+QL +N TQE IL+YVNELC RLPSPMGES VDC +LSTMP
Sbjct  373   NGVGDAACSACEMAVVWIQSQLRQNMTQERILNYVNELCERLPSPMGESAVDCAQLSTMP  432

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VS +IGGKVFDL+P EY+LKVGEG  AQCISGF ALDV PPRGPLWILGDVFMG+YHTV
Sbjct  433   TVSLTIGGKVFDLAPEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWILGDVFMGKYHTV  492

Query  208   FDYGKMRVGFAEAA  167
             FD+G  +VGFAEAA
Sbjct  493   FDFGNEQVGFAEAA  506



>ref|XP_010458606.1| PREDICTED: aspartic proteinase A1 [Camelina sativa]
 ref|XP_010458607.1| PREDICTED: aspartic proteinase A1 [Camelina sativa]
Length=506

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/494 (73%), Positives = 418/494 (85%), Gaps = 10/494 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AFS+ NDG  R+GLKK+K+D  NR+AA   +K G+ LRA     Y L    GD  D D+V
Sbjct  22    AFSERNDGTFRVGLKKLKLDPKNRLAAHAGSKQGEPLRA-----YTL----GDSGDADVV  72

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C  H KY SS+SST
Sbjct  73    VLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  132

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             YEKNGKSA IHYGTG+ISGFFS D+V VGDLVVK Q FIEAT EPG+TF+VAKFDGILGL
Sbjct  133   YEKNGKSAAIHYGTGAISGFFSNDAVTVGDLVVKDQEFIEATKEPGITFVVAKFDGILGL  192

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GF+EISVG+A      M+ QGL+++P+FSFWLNRN +E+EGGELVFGGVDP H+KG+HTY
Sbjct  193   GFREISVGNAAPVWYNMLKQGLIKEPVFSFWLNRNAEEEEGGELVFGGVDPNHFKGQHTY  252

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI G PTGFC  GCSAIADSGTSL+AGP++IITMINHAIGA GV
Sbjct  253   VPVTQKGYWQFDMGDVLIGGAPTGFCESGCSAIADSGTSLLAGPTTIITMINHAIGAAGV  312

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VS  569
             VS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S
Sbjct  313   VSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLS  372

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               + DA CSACEM VVW+Q+QL +N TQE IL+Y+NELC RLPSPMGES VDC +LST+P
Sbjct  373   NGVGDAACSACEMAVVWIQSQLRQNMTQERILNYINELCERLPSPMGESAVDCTQLSTLP  432

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VS +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTV
Sbjct  433   TVSLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTV  492

Query  208   FDYGKMRVGFAEAA  167
             FD+G  +VGFAEAA
Sbjct  493   FDFGNEQVGFAEAA  506



>ref|NP_172655.1| aspartic proteinase A1 [Arabidopsis thaliana]
 sp|O65390.1|APA1_ARATH RecName: Full=Aspartic proteinase A1; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAC17620.1| Identical to aspartic proteinase cDNA gb|U51036 from A. thaliana. 
ESTs gb|N96313, gb|T21893, gb|R30158, gb|T21482, gb|T43650, 
gb|R64749, gb|R65157, gb|T88269, gb|T44552, gb|T22542, 
gb|T76533, gb|T44350, gb|Z34591, gb|AA728734, gb|T46003, gb|R65157, 
gb|N38290, gb|AA395468, gb|T20815 and gb|Z34173 come 
from this gene [Arabidopsis thaliana]
 gb|AAL08243.1| At1g11910/F12F1_24 [Arabidopsis thaliana]
 gb|AAL08259.1| At1g11910/F12F1_24 [Arabidopsis thaliana]
 gb|AAL36330.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AAM66979.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AAN71979.1| putative aspartic proteinase [Arabidopsis thaliana]
 gb|AEE28813.1| aspartic proteinase A1 [Arabidopsis thaliana]
Length=506

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/494 (72%), Positives = 415/494 (84%), Gaps = 10/494 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AF++ NDG  R+GLKK+K+D  NR+AAR+E+K    LRA          R GD  D D+V
Sbjct  22    AFAERNDGTFRVGLKKLKLDSKNRLAARVESKQEKPLRAY---------RLGDSGDADVV  72

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C  H KY SS+SST
Sbjct  73    VLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSLACLLHPKYKSSRSST  132

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             YEKNGK+A IHYGTG+I+GFFS D+V VGDLVVK Q FIEAT EPG+TF+VAKFDGILGL
Sbjct  133   YEKNGKAAAIHYGTGAIAGFFSNDAVTVGDLVVKDQEFIEATKEPGITFVVAKFDGILGL  192

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG A      M+ QGL+++P+FSFWLNRN  E+EGGELVFGGVDP H+KG+HTY
Sbjct  193   GFQEISVGKAAPVWYNMLKQGLIKEPVFSFWLNRNADEEEGGELVFGGVDPNHFKGKHTY  252

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI G PTGFC  GCSAIADSGTSL+AGP++IITMINHAIGA GV
Sbjct  253   VPVTQKGYWQFDMGDVLIGGAPTGFCESGCSAIADSGTSLLAGPTTIITMINHAIGAAGV  312

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VS  569
             VS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S
Sbjct  313   VSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLS  372

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               + DA CSACEM VVW+Q+QL +N TQE IL+YVNELC RLPSPMGES VDC +LSTMP
Sbjct  373   NGVGDAACSACEMAVVWIQSQLRQNMTQERILNYVNELCERLPSPMGESAVDCAQLSTMP  432

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VS +IGGKVFDL+P EY+LKVGEG  AQCISGF ALDV PPRGPLWILGDVFMG+YHTV
Sbjct  433   TVSLTIGGKVFDLAPEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWILGDVFMGKYHTV  492

Query  208   FDYGKMRVGFAEAA  167
             FD+G  +VGFAEAA
Sbjct  493   FDFGNEQVGFAEAA  506



>ref|XP_010686810.1| PREDICTED: aspartic proteinase A1-like [Beta vulgaris subsp. 
vulgaris]
Length=516

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/493 (72%), Positives = 421/493 (85%), Gaps = 4/493 (1%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SNDG +R+GLKK K D+N+RIA+RL +K  ++LR+S  KY  L G + DL+  DIV L
Sbjct  26    SSSNDGLLRVGLKKKKFDQNSRIASRLGSKEREALRSSFEKY--LLGNSEDLEGADIVAL  83

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQYFG+IGVGTPPQ FTVIFDTGSSNLWVPSSKCYFS+PCFFH+KY SS SSTY+
Sbjct  84    KNYMDAQYFGDIGVGTPPQTFTVIFDTGSSNLWVPSSKCYFSIPCFFHAKYKSSASSTYK  143

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGKSA IHYGTG+ISGFFS+D+VQVGDL+VK Q FIEAT EP +TF+VAKFDGILGLGF
Sbjct  144   KNGKSAAIHYGTGAISGFFSEDNVQVGDLIVKHQEFIEATREPSITFMVAKFDGILGLGF  203

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVG+A      MV QGL+++P+FSFWLNRN +++ GGELVFGGVDPKHYKG+HTY P
Sbjct  204   QEISVGNAVPVWYNMVKQGLIKEPVFSFWLNRNTEDEAGGELVFGGVDPKHYKGKHTYAP  263

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VT+KGYWQFDMG+VLI+GK TG+CSGGC+AIADSGTSL+AGP+++I  IN AIG  GV S
Sbjct  264   VTRKGYWQFDMGDVLIDGKTTGYCSGGCAAIADSGTSLLAGPTTVIAQINQAIGVSGVAS  323

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-  563
             + CK VV+ YG+ +IDLL  E  PKK+CSQIG+CT++G  GVSMGIESVVD+++  S+  
Sbjct  324   QACKKVVDQYGETIIDLLFSEGSPKKVCSQIGVCTYDGTHGVSMGIESVVDKESSDSSSE  383

Query  562   -LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              LHD MCSACEM VVWMQ+QL +N T++ ++SY NELC+R+P+PMG SGVDC ++S MP 
Sbjct  384   GLHDGMCSACEMAVVWMQSQLKQNATKDRVISYANELCDRVPNPMGTSGVDCARVSKMPP  443

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+I GK F+LSP EYILKVGEG AAQCISGFTALDVPPPRGP+WILGDVFMGRYHTVF
Sbjct  444   VSFTIAGKEFELSPEEYILKVGEGPAAQCISGFTALDVPPPRGPIWILGDVFMGRYHTVF  503

Query  205   DYGKMRVGFAEAA  167
             DYG +RVGFAEAA
Sbjct  504   DYGNLRVGFAEAA  516



>ref|XP_010060310.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010060311.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW66975.1| hypothetical protein EUGRSUZ_F00741 [Eucalyptus grandis]
 gb|KCW66976.1| hypothetical protein EUGRSUZ_F00741 [Eucalyptus grandis]
Length=515

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/493 (73%), Positives = 420/493 (85%), Gaps = 1/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
              S S+DG +RIGLK+ ++DKN+  AARL+   G  L       +NL+G   D  D+D+V 
Sbjct  23    LSASDDGLMRIGLKRRRLDKNSWNAARLDLNEGKLLMRPSAGMHNLNGNLRDSGDSDVVA  82

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIGVG+PPQ FTVIFDTGSSNLWVPS+KC+FS+ C+ H +Y SS SSTY
Sbjct  83    LKNYMDAQYFGEIGVGSPPQNFTVIFDTGSSNLWVPSAKCHFSLACYMHPRYKSSHSSTY  142

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGK A+IHYGTGSISGFFSQD V+VGDL+V+ Q FIEAT EPG+TFL+AKFDGILGLG
Sbjct  143   KKNGKPADIHYGTGSISGFFSQDHVEVGDLIVEDQEFIEATKEPGITFLLAKFDGILGLG  202

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MVNQGLV+DP+FSFW NRN +E+EGGE+VFGGVDP HY+GEHTYV
Sbjct  203   FQEISVGNAVPVWYNMVNQGLVKDPVFSFWFNRNAEEEEGGEIVFGGVDPSHYEGEHTYV  262

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+VLI GK TGFC+GGCSAIADSGTSL+AGP++IIT +NHAIGA GVV
Sbjct  263   PVTRKGYWQFDMGDVLIGGKTTGFCAGGCSAIADSGTSLMAGPTTIITEVNHAIGAAGVV  322

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-GVSA  566
             S+ECKAVV  YG+ +I  L+ +  P KICS+IGLCTF+G RGVSMGIE+VVD KN  VS 
Sbjct  323   SEECKAVVAQYGETIIQKLLAKEEPHKICSEIGLCTFDGTRGVSMGIETVVDGKNEKVSG  382

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L+DAMCS CEMTVVWMQNQL  N+TQ+ ILSYVNELC+RLPSPMGES VDC  LS+MP+
Sbjct  383   RLNDAMCSTCEMTVVWMQNQLRLNETQDRILSYVNELCSRLPSPMGESAVDCAGLSSMPN  442

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGG+VFDLSP +YILKVG+G +AQCISGFTALDVPPPRGPLWILGDVFMG+YHTVF
Sbjct  443   VSFTIGGRVFDLSPEQYILKVGDGDSAQCISGFTALDVPPPRGPLWILGDVFMGQYHTVF  502

Query  205   DYGKMRVGFAEAA  167
             DYG +RVGFA+AA
Sbjct  503   DYGNLRVGFAKAA  515



>ref|XP_011046961.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011046962.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=512

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/492 (72%), Positives = 430/492 (87%), Gaps = 4/492 (1%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SNDG +RIGLKK+K+DKNNRIAARL++K  ++LRAS+RKY NL    G+ +DTDIV L
Sbjct  24    SASNDGLLRIGLKKVKLDKNNRIAARLDSK--ETLRASIRKY-NLCSNLGESEDTDIVAL  80

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+D+QY+GEIGVG+PPQKFTVIFDTGSSNLWVPSSKCY SV C+FHSKY S +SSTY+
Sbjct  81    KNYLDSQYYGEIGVGSPPQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSKYDSGKSSTYK  140

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGKSAEI YG+GSISGFFS D+++VG LVVK Q FIEAT EPG+TFLVAKFDGILGLGF
Sbjct  141   KNGKSAEIRYGSGSISGFFSNDAIEVGGLVVKDQEFIEATKEPGITFLVAKFDGILGLGF  200

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVGDA      M+  GL+++P+FSFWLNRN +++EGGE+VFGG+DPKHYKG+HT+VP
Sbjct  201   KEISVGDAVPVWDNMIKHGLIKEPVFSFWLNRNAEDEEGGEIVFGGMDPKHYKGKHTFVP  260

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VT+KGYWQF+MG+V I  KPTG+C+ GC+AIADSGTSL+AGP++IITMIN AIGA GVVS
Sbjct  261   VTRKGYWQFNMGDVHIGDKPTGYCASGCAAIADSGTSLLAGPATIITMINQAIGASGVVS  320

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-  563
             ++CKAVV  YG+ ++DLL+ EA+PK+ICSQIGLC F+G RG+S+ I+SVVDE N  S+  
Sbjct  321   QQCKAVVSQYGEAIMDLLLSEAQPKRICSQIGLCMFDGTRGISISIQSVVDEGNDKSSGV  380

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             L DAMCSACEM VVWM++QL +NQTQ+ IL Y ++LC R+P+PMGES VDC  + +MP+V
Sbjct  381   LGDAMCSACEMAVVWMRSQLKQNQTQDRILDYASQLCERMPNPMGESAVDCESVPSMPTV  440

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             +F+IGGK F+L+P EYILKVG+GSAAQCISGFTALD+PPPRGPLWILGD+FMGRYHTVFD
Sbjct  441   AFTIGGKEFELAPEEYILKVGQGSAAQCISGFTALDIPPPRGPLWILGDIFMGRYHTVFD  500

Query  202   YGKMRVGFAEAA  167
              GK+RVGFAEAA
Sbjct  501   SGKLRVGFAEAA  512



>ref|XP_011008023.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011008024.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=512

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/493 (72%), Positives = 429/493 (87%), Gaps = 4/493 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
              S+SNDG +RIGLKK+K DKNNRIAAR +++  ++LRAS+RKY NL G  G+ +DTDIV 
Sbjct  23    LSESNDGMLRIGLKKVKFDKNNRIAARFDSQ--EALRASIRKY-NLLGNLGESEDTDIVA  79

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY DAQY+GEIGVGTPPQKFTVIFDTGSSNLWVPSSKCY SV C+FHSKY S +SS+Y
Sbjct  80    LKNYFDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSKYNSGKSSSY  139

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSAEI YG+GSISGFFS D+V+VG+LVVK Q FIEAT EP +TFLV KFDGILGLG
Sbjct  140   KKNGKSAEIQYGSGSISGFFSIDAVEVGNLVVKDQEFIEATKEPSITFLVGKFDGILGLG  199

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             F+EI+VG A      M+ QGL+++P+FSFWLNRN  ++EGGE+VFGG+DP HYKG+HTYV
Sbjct  200   FKEIAVGGAVPVWDNMIKQGLIKEPLFSFWLNRNADDEEGGEIVFGGMDPNHYKGKHTYV  259

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+V++  K TG+C+GGC+AIADSGTSL+AGP++IITMINHAIGA GVV
Sbjct  260   PVTQKGYWQFDMGDVIVGDKSTGYCAGGCAAIADSGTSLLAGPTAIITMINHAIGASGVV  319

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S++CKAVV  YG+ ++DLL+ E +PKKICSQIGLCTF+G RG+SMGI+SVVDE N  S+ 
Sbjct  320   SQQCKAVVSQYGEVIMDLLLSEVQPKKICSQIGLCTFDGTRGISMGIQSVVDEGNDKSSG  379

Query  562   -LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L +AMCSACEM V WM++QL +NQTQ+++L Y N+LC R+P+P G+S VDCG + +MP+
Sbjct  380   VLGNAMCSACEMAVFWMRSQLQQNQTQDHVLDYANQLCERVPNPTGQSAVDCGSVFSMPT  439

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             ++F+IGGK F+L+P EYILKVG+GSAAQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVF
Sbjct  440   IAFTIGGKEFELAPEEYILKVGQGSAAQCISGFTAMDIPPPRGPLWILGDVFMGRYHTVF  499

Query  205   DYGKMRVGFAEAA  167
             D GK+RVGFAEAA
Sbjct  500   DSGKLRVGFAEAA  512



>gb|KJB13718.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
 gb|KJB13721.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
 gb|KJB13724.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=512

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/493 (72%), Positives = 418/493 (85%), Gaps = 3/493 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS SNDG  RIGLKK K D+NN +AA+L++K G++LR S RKY  LHG   + +D DIV 
Sbjct  22    FSTSNDGLFRIGLKKRKFDRNNLLAAQLDSKEGEALRGSFRKY--LHGNLQESKDIDIVA  79

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHS+Y SS SSTY
Sbjct  80    LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSRYKSSHSSTY  139

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
               NGK A+I YGTG ISGFFS+D V VGDLVVK+Q FIEATSEP +TFL+AKFDGILGLG
Sbjct  140   NANGKPADIKYGTGQISGFFSEDHVTVGDLVVKNQEFIEATSEPSLTFLLAKFDGILGLG  199

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MVNQGLV++P+FSFWL+RN ++  GGELVFGG+DPKH+KG HTYV
Sbjct  200   FQEISVGNAVPVWYNMVNQGLVKEPVFSFWLSRNSEDNLGGELVFGGMDPKHFKGNHTYV  259

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+ LI  + TGFC+GGCSAIADSGTSL+AGP+ IIT INHAIGA GVV
Sbjct  260   PVTRKGYWQFDMGDFLIGNETTGFCAGGCSAIADSGTSLLAGPTGIITQINHAIGASGVV  319

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S+ECKAVV  YG++++D+L+ +  PKKICSQIGLC F+G +GVSM IES+V+E  G  S 
Sbjct  320   SQECKAVVSEYGEKILDMLLAKDEPKKICSQIGLCLFDGTQGVSMEIESIVNENAGKASG  379

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L DAMCS CEM V+WMQNQL +NQTQ++I+ YVNELC+RLPSPMGES +DC  LS+MPS
Sbjct  380   SLRDAMCSTCEMAVIWMQNQLKQNQTQDHIIDYVNELCDRLPSPMGESSIDCKSLSSMPS  439

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+I GK+F+L P +Y++KVGEG  AQCISGFTALDVPPPRGPLWILGDVFMG++HTVF
Sbjct  440   VSFTIAGKLFELRPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLWILGDVFMGQFHTVF  499

Query  205   DYGKMRVGFAEAA  167
             DYG M++GFAEAA
Sbjct  500   DYGNMQIGFAEAA  512



>gb|AAC49730.1| aspartic proteinase [Arabidopsis thaliana]
Length=486

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/493 (72%), Positives = 414/493 (84%), Gaps = 10/493 (2%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             F++ NDG  R+GLKK+K+D  NR+AAR+E+K    LRA          R GD  D D+V 
Sbjct  3     FAERNDGTFRVGLKKLKLDSKNRLAARVESKQEKPLRAY---------RLGDSGDADVVV  53

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C  H KY SS+SSTY
Sbjct  54    LKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSLACLLHPKYKSSRSSTY  113

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             EKNGK+A IHYGTG+I+GFFS D+V VGDLVVK Q FIEAT EPG+TF+VAKFDGILGLG
Sbjct  114   EKNGKAAAIHYGTGAIAGFFSNDAVTVGDLVVKDQEFIEATKEPGITFVVAKFDGILGLG  173

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      M+ QGL+++P+FSFWLNRN  E+EGGELVFGGVDP H+KG+HTYV
Sbjct  174   FQEISVGKAAPVWYNMLKQGLIKEPVFSFWLNRNADEEEGGELVFGGVDPNHFKGKHTYV  233

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+VLI G PTGFC  GCSAIADSGTSL+AGP++IITMINHAIGA GVV
Sbjct  234   PVTQKGYWQFDMGDVLIGGAPTGFCESGCSAIADSGTSLLAGPTTIITMINHAIGAAGVV  293

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S 
Sbjct  294   SQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLSN  353

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              + DA CSACEM VVW+Q+QL +N TQE IL+YVNELC RLPSPMGES VDC +LSTMP+
Sbjct  354   GVGDAACSACEMAVVWIQSQLRQNMTQERILNYVNELCERLPSPMGESAVDCAQLSTMPT  413

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VS +IGGKVFDL+P EY+LKVGEG  AQCISGF ALDV PPRGPLWILGDVFMG+YHTVF
Sbjct  414   VSLTIGGKVFDLAPEEYVLKVGEGPVAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVF  473

Query  205   DYGKMRVGFAEAA  167
             D+G  +VGFAEAA
Sbjct  474   DFGNEQVGFAEAA  486



>ref|XP_010476135.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
Length=506

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/494 (72%), Positives = 417/494 (84%), Gaps = 10/494 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AFS+ NDG  R+GLKK+K+D  NR+AA   +K G  LR      YNL    GD  D D+V
Sbjct  22    AFSERNDGTFRVGLKKLKLDPKNRLAAHAGSKQGKLLRG-----YNL----GDSGDADVV  72

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C  H KY SS+SST
Sbjct  73    VLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  132

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             YEKNGKSA IHYGTG+ISGFFS D+V VGDLVVK Q FIEAT EPG+TF+VAKFDGILGL
Sbjct  133   YEKNGKSAAIHYGTGAISGFFSNDAVTVGDLVVKDQEFIEATKEPGITFVVAKFDGILGL  192

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GF+EISVG+A      M+ QGL+++P+FSFWLNRN +E+EGGELVFGGVDP H+KG+HTY
Sbjct  193   GFKEISVGNAAPVWYNMLKQGLIKEPVFSFWLNRNAEEEEGGELVFGGVDPNHFKGQHTY  252

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI G PTGFC  GCSAIADSGTSL+AGP+++ITMINHAIGA GV
Sbjct  253   VPVTQKGYWQFDMGDVLIGGAPTGFCESGCSAIADSGTSLLAGPTTVITMINHAIGAAGV  312

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VS  569
             VS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S
Sbjct  313   VSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLS  372

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               + DA CSACEM VVW+Q+QL +N TQE IL+Y+NELC RLPSPMGES VDC +LST+P
Sbjct  373   NGVGDAACSACEMAVVWIQSQLRQNMTQERILNYINELCERLPSPMGESAVDCTQLSTLP  432

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VS +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTV
Sbjct  433   TVSLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTV  492

Query  208   FDYGKMRVGFAEAA  167
             FD+G  +VGFAEAA
Sbjct  493   FDFGNEQVGFAEAA  506



>dbj|BAB20971.1| aspartic proteinase 3 [Nepenthes alata]
Length=507

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/494 (74%), Positives = 431/494 (87%), Gaps = 3/494 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS SNDG +RIGLKK   D+NNRIAARLE + G++ R+S+RKYY LHG  G+ ++TDIV 
Sbjct  15    FSDSNDGLLRIGLKKKIFDQNNRIAARLETEEGEARRSSLRKYY-LHGNLGNPEETDIVA  73

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSVPC+FH+KY SS SS+Y
Sbjct  74    LKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCYFHAKYKSSISSSY  133

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSA+IHYGTG+ISGFFS+D+VQVGDL VK+Q FIEA+ EP VTFLVAKFDGILGLG
Sbjct  134   KKNGKSADIHYGTGAISGFFSEDNVQVGDLAVKAQEFIEASREPSVTFLVAKFDGILGLG  193

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MVNQGLV++P+FSFWLNR   E+EGGE+VFGGVDP H+KG H+YV
Sbjct  194   FQEISVGNATPVWYNMVNQGLVKEPVFSFWLNRKVGEEEGGEIVFGGVDPNHFKGTHSYV  253

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT KGYWQFDMG+VLI+GK T +C GGCSAIADSGTSL+AGP+S++TMINHAIGA GVV
Sbjct  254   PVTHKGYWQFDMGDVLIDGKATEYCEGGCSAIADSGTSLLAGPTSVVTMINHAIGATGVV  313

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVD-EKNGVSA  566
             S+ECKAVV  YGQ ++DLL+ E  P+KICSQIGLCTF+G RGVS+GI+SVVD E NG S+
Sbjct  314   SEECKAVVSQYGQTIMDLLLAEVSPEKICSQIGLCTFDGTRGVSIGIKSVVDKENNGKSS  373

Query  565   D-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               L DA+C ACEM VVWM++QL +NQTQ  IL+YVN+LC++LPSPMGES VDC ++S+M 
Sbjct  374   GILRDALCPACEMAVVWMKSQLEQNQTQNLILNYVNDLCDQLPSPMGESAVDCARISSMA  433

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VS +IGGKVFDL P +YIL+VGEG AAQCISGFTA+D+PPP GPLWILGD+ MGRYHTV
Sbjct  434   TVSSTIGGKVFDLRPEQYILRVGEGPAAQCISGFTAMDIPPPGGPLWILGDILMGRYHTV  493

Query  208   FDYGKMRVGFAEAA  167
             FDYG +RVGFAEAA
Sbjct  494   FDYGNLRVGFAEAA  507



>ref|XP_011461056.1| PREDICTED: aspartic proteinase A1-like [Fragaria vesca subsp. 
vesca]
Length=514

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/493 (75%), Positives = 420/493 (85%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             F  SNDG +R+GLKK K D+NNR+AA L+AK GD++RA + KY NL G  GD QD DIV 
Sbjct  23    FCASNDGLLRVGLKKKKFDQNNRVAANLQAKNGDAVRAVIHKY-NLRGTYGDDQDIDIVS  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFS+ C+ H KY SS SSTY
Sbjct  82    LKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACYLHPKYKSSSSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
              KNGK A I YGTG+ISGFFS+D V VGDLVV+ Q FIEAT EPG+TFLVAKFDGILGLG
Sbjct  142   SKNGKPAAIQYGTGAISGFFSEDHVTVGDLVVQDQEFIEATKEPGITFLVAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MV QGLV++ +FSFW NRN  E+EGGELVFGGVDP HY GEHTYV
Sbjct  202   FQEISVGNAVPVWYNMVKQGLVKEAVFSFWFNRNADEEEGGELVFGGVDPNHYVGEHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+VLI+GK TGFC+GGC+AIADSGTSL+ GP++IIT +NHAIGA G+V
Sbjct  262   PVTQKGYWQFDMGDVLIDGKTTGFCAGGCAAIADSGTSLLVGPTTIITELNHAIGATGIV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-GVSA  566
             S+ECK VV  YG  +I +++ + +P+KICSQIGLCTF+G RGVS+GI+SVVDE N   SA
Sbjct  322   SQECKTVVAEYGDTIIKMILAKDQPQKICSQIGLCTFDGTRGVSVGIKSVVDENNHKSSA  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L DAMCSACEMTVVWMQNQL +NQTQ+ IL YVN+LC+RLPSPMGES VDC  LS+MPS
Sbjct  382   GLSDAMCSACEMTVVWMQNQLKQNQTQDRILDYVNQLCDRLPSPMGESAVDCAGLSSMPS  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGK FDL+P +Y+LKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMG+YHTVF
Sbjct  442   VSFTIGGKQFDLAPEQYVLKVGEGEVAQCISGFTALDVPPPRGPLWILGDVFMGQYHTVF  501

Query  205   DYGKMRVGFAEAA  167
             D+GK R+GFAEAA
Sbjct  502   DFGKERIGFAEAA  514



>ref|XP_008366439.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Malus domestica]
Length=514

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/493 (72%), Positives = 421/493 (85%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             F +SNDG +RIGLKK K+D+NNR+A+++++  G++LRA+++KY  L G   D +D DIV 
Sbjct  23    FCESNDGLLRIGLKKRKLDQNNRVASQIDSNEGEALRAALQKY-RLGGNLADSEDIDIVS  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFS+ C+ H KY SS SSTY
Sbjct  82    LKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACYLHPKYKSSSSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
              KNGK A I YGTG+ISGFFS+D V VGDLVVK Q FIEAT EPG+TFLVAKFDGILGLG
Sbjct  142   NKNGKPAAIQYGTGAISGFFSEDHVTVGDLVVKDQEFIEATKEPGITFLVAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MVNQGL+++P+FSFW NRN  E+EGGE+VFGGVDP HYKG+HTYV
Sbjct  202   FQEISVGNAVPVWYNMVNQGLLKEPVFSFWFNRNADEEEGGEIVFGGVDPNHYKGKHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+V+I+G+ TGFC+ GCSAIADSGTSL+ GP++IIT +NHAIGA G+V
Sbjct  262   PVTQKGYWQFDMGDVMIDGQTTGFCADGCSAIADSGTSLLVGPTTIITELNHAIGASGIV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSA  566
             S+ECK VV  YG+ +I+ ++ + +P KICS IGLC+F+G RGVS+GI+SVV+E  + VS 
Sbjct  322   SQECKTVVAQYGETIIERILAKDQPAKICSXIGLCSFDGTRGVSIGIKSVVEENAHKVSG  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L DA CSACEMTVVWMQNQL +NQTQE IL YVN+LC RLPSPMGES VDCG LS+MP+
Sbjct  382   GLSDATCSACEMTVVWMQNQLKQNQTQERILDYVNQLCERLPSPMGESAVDCGGLSSMPN  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGG+ FDL+P +Y+LKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF
Sbjct  442   VSFTIGGRTFDLTPEQYVLKVGEGDVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  501

Query  205   DYGKMRVGFAEAA  167
             DYG  R+GFAEAA
Sbjct  502   DYGNERIGFAEAA  514



>ref|XP_008366438.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Malus domestica]
Length=518

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/493 (72%), Positives = 421/493 (85%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             F +SNDG +RIGLKK K+D+NNR+A+++++  G++LRA+++KY  L G   D +D DIV 
Sbjct  27    FCESNDGLLRIGLKKRKLDQNNRVASQIDSNEGEALRAALQKY-RLGGNLADSEDIDIVS  85

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFS+ C+ H KY SS SSTY
Sbjct  86    LKNYMDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACYLHPKYKSSSSSTY  145

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
              KNGK A I YGTG+ISGFFS+D V VGDLVVK Q FIEAT EPG+TFLVAKFDGILGLG
Sbjct  146   NKNGKPAAIQYGTGAISGFFSEDHVTVGDLVVKDQEFIEATKEPGITFLVAKFDGILGLG  205

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MVNQGL+++P+FSFW NRN  E+EGGE+VFGGVDP HYKG+HTYV
Sbjct  206   FQEISVGNAVPVWYNMVNQGLLKEPVFSFWFNRNADEEEGGEIVFGGVDPNHYKGKHTYV  265

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+V+I+G+ TGFC+ GCSAIADSGTSL+ GP++IIT +NHAIGA G+V
Sbjct  266   PVTQKGYWQFDMGDVMIDGQTTGFCADGCSAIADSGTSLLVGPTTIITELNHAIGASGIV  325

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSA  566
             S+ECK VV  YG+ +I+ ++ + +P KICS IGLC+F+G RGVS+GI+SVV+E  + VS 
Sbjct  326   SQECKTVVAQYGETIIERILAKDQPAKICSXIGLCSFDGTRGVSIGIKSVVEENAHKVSG  385

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L DA CSACEMTVVWMQNQL +NQTQE IL YVN+LC RLPSPMGES VDCG LS+MP+
Sbjct  386   GLSDATCSACEMTVVWMQNQLKQNQTQERILDYVNQLCERLPSPMGESAVDCGGLSSMPN  445

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGG+ FDL+P +Y+LKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF
Sbjct  446   VSFTIGGRTFDLTPEQYVLKVGEGDVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  505

Query  205   DYGKMRVGFAEAA  167
             DYG  R+GFAEAA
Sbjct  506   DYGNERIGFAEAA  518



>ref|XP_007049085.1| Aspartic protease isoform 2 [Theobroma cacao]
 gb|EOX93242.1| Aspartic protease isoform 2 [Theobroma cacao]
Length=514

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/493 (73%), Positives = 412/493 (84%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS  N+G VRIGL K K+D+ NR+A  +++K G   R  +RKY+ L G  G   D++IV 
Sbjct  23    FSVPNEGMVRIGLIKKKLDQINRVAGDIDSKEGKLSRTPLRKYH-LQGNLGASDDSEIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTP Q FTVIFDTGSSNLWVPSSKCYFSV C+FHSKY SSQSSTY
Sbjct  82    LKNYMDAQYFGEIGIGTPSQTFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSQSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNG SA I YGTG+ISGFFSQDSV+VGDLVV +Q FIEAT EPG+TFL AKFDGI GLG
Sbjct  142   QKNGTSAAIQYGTGAISGFFSQDSVKVGDLVVNNQDFIEATREPGITFLAAKFDGIFGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      MVNQGLV++P+FSFWLNR  + +EGGE+VFGG+D  HYKGEHTYV
Sbjct  202   FQEISVGGAVPVWYNMVNQGLVKEPVFSFWLNRKIEGEEGGEIVFGGIDSNHYKGEHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+VL+ G  TGFCS GC+AIADSGTSL+AGP++IIT INHAIGA GVV
Sbjct  262   PVTQKGYWQFDMGDVLVGGATTGFCSSGCAAIADSGTSLLAGPTTIITQINHAIGASGVV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+ECKA+V  YG+ +++LLV E +P+KICSQIG CTF+G RGVS  IESV DE  G S+D
Sbjct  322   SQECKAIVSQYGKMILELLVSETQPQKICSQIGFCTFDGTRGVSTRIESVADEIVGKSSD  381

Query  562   -LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              +HDAMC+ACEM VVWMQN+L  N+T+E IL YVNELC RLPSP GES VDC  LS+MP 
Sbjct  382   GVHDAMCTACEMAVVWMQNKLRRNETEEQILDYVNELCERLPSPNGESVVDCSSLSSMPG  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGKVFDL+P EY+LKVGEG+ AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF
Sbjct  442   VSFTIGGKVFDLAPEEYVLKVGEGAVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  501

Query  205   DYGKMRVGFAEAA  167
             DYG M VGFAEAA
Sbjct  502   DYGNMTVGFAEAA  514



>ref|XP_010493478.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
 ref|XP_010493486.1| PREDICTED: aspartic proteinase A1-like [Camelina sativa]
Length=506

 Score =   756 bits (1953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/493 (73%), Positives = 414/493 (84%), Gaps = 10/493 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AFS+ NDG  R+GLKK K+D  NR+AA   +K G  LRA     Y L    GD +D D V
Sbjct  22    AFSERNDGTFRVGLKKFKLDPKNRLAAHAGSKQGKPLRA-----YTL----GDSEDADAV  72

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C  H KY SS+SST
Sbjct  73    VLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  132

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             YEKNGKSA IHYGTG+ISGFFS D+V VGDLVVK Q FIEAT EPG+TF+VAKFDGILGL
Sbjct  133   YEKNGKSAAIHYGTGAISGFFSNDAVTVGDLVVKDQEFIEATKEPGITFVVAKFDGILGL  192

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GF+EISVG+A      M+ QGL+++P+FSFWLNRN  E+EGGELVFGGVDP H+KG+HTY
Sbjct  193   GFREISVGNAAPVWYNMLKQGLIKEPVFSFWLNRNADEEEGGELVFGGVDPNHFKGQHTY  252

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI G PTGFC  GCSAIADSGTSL+AGP++IITMINHAIGA GV
Sbjct  253   VPVTQKGYWQFDMGDVLIGGAPTGFCESGCSAIADSGTSLLAGPTTIITMINHAIGAAGV  312

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VS  569
             VS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S
Sbjct  313   VSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLS  372

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               + DA CSACEM VVW+Q+QL +N TQE IL+Y+NELC RLPSPMGES VDC +LST+P
Sbjct  373   NGVGDAACSACEMAVVWIQSQLRQNMTQERILNYINELCERLPSPMGESAVDCTQLSTLP  432

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             SVS +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTV
Sbjct  433   SVSLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTV  492

Query  208   FDYGKMRVGFAEA  170
             FD+G  +VGFAEA
Sbjct  493   FDFGNEQVGFAEA  505



>ref|XP_006303952.1| hypothetical protein CARUB_v10008798mg, partial [Capsella rubella]
 gb|EOA36850.1| hypothetical protein CARUB_v10008798mg, partial [Capsella rubella]
Length=538

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/493 (72%), Positives = 414/493 (84%), Gaps = 11/493 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AFS+ +DG VR+GLKK+K+D  NR+AAR+ +K    LR          G +GD  D D+V
Sbjct  55    AFSERSDGTVRVGLKKLKLDSKNRLAARVGSKQDKPLR----------GYSGDSGDADVV  104

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C  H KY SS+SST
Sbjct  105   ALKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  164

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             YEKNGKSA IHYGTG+ISGFFS D+V VGDLVVK Q FIEAT EPG+TF++AKFDGILGL
Sbjct  165   YEKNGKSAAIHYGTGAISGFFSNDAVTVGDLVVKDQEFIEATKEPGITFVLAKFDGILGL  224

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GF+EISVG+A      M+ QGL+++P+FSFWLNRN  ++EGGELVFGGVDP H+KG+HTY
Sbjct  225   GFREISVGNAAPVWYNMLKQGLIKEPVFSFWLNRNADDEEGGELVFGGVDPNHFKGKHTY  284

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI   PTGFC  GCSAIADSGTSL+AGP+ IITMINHAIGA GV
Sbjct  285   VPVTQKGYWQFDMGDVLIGSAPTGFCENGCSAIADSGTSLLAGPTPIITMINHAIGAAGV  344

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VS  569
             VS++CK VV+ YG+ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S
Sbjct  345   VSQQCKTVVDQYGETILDLLLSETQPKKICSQIGLCTFDGTRGVSMGIESVVDKENAKLS  404

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               + DA CSACEM VVW+Q+QL +N TQE IL+Y+NELC RLPSPMGES VDC +LSTMP
Sbjct  405   NGVGDAACSACEMAVVWIQSQLRQNMTQERILNYINELCERLPSPMGESAVDCAQLSTMP  464

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VS +IGGKVFDLSP EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTV
Sbjct  465   TVSLTIGGKVFDLSPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTV  524

Query  208   FDYGKMRVGFAEA  170
             FD+G  +VGFAEA
Sbjct  525   FDFGNEQVGFAEA  537



>gb|KHG05834.1| Asparticase [Gossypium arboreum]
Length=511

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/493 (72%), Positives = 418/493 (85%), Gaps = 4/493 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS SNDG  RIGLKK K D+NN +AA+L++K G++LR S RKY  LHG   + +D DIV 
Sbjct  22    FSTSNDGLFRIGLKKRKFDRNNLLAAQLDSKEGEALRGSFRKY--LHGNLQESKDIDIVA  79

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHS+Y SS SSTY
Sbjct  80    LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSRYKSSHSSTY  139

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
               NGK A+I YGTG ISGFFS+D V VGDLVVK+Q FIEATSEP +TFL+AKFDGILGLG
Sbjct  140   NANGKPADIKYGTGQISGFFSEDHVTVGDLVVKNQEFIEATSEPSLTFLLAKFDGILGLG  199

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEI+VG+A      MVNQGLV++P+FSFWL+RN ++  GGELVFGG+DPKH+KG HTYV
Sbjct  200   FQEIAVGNAVPVYN-MVNQGLVKEPVFSFWLSRNSEDNLGGELVFGGMDPKHFKGNHTYV  258

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PV +KGYWQFDMG+ LI  + TGFC+GGCSAIADSGTSL+AGP+ IIT INHAIGA GVV
Sbjct  259   PVRRKGYWQFDMGDFLIGNETTGFCAGGCSAIADSGTSLLAGPTGIITQINHAIGASGVV  318

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S+ECKAVV  YG++++D+L+ +  PKKICSQIGLC F+G +GVSMGIES+V+E  G  S 
Sbjct  319   SQECKAVVSEYGEKILDMLLAKDEPKKICSQIGLCLFDGTQGVSMGIESIVNENAGKASG  378

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L DAMCS CEM V+WMQNQL +NQT+++I+ YVNELC+RLPSPMGES +DC  LS+MPS
Sbjct  379   SLRDAMCSTCEMAVIWMQNQLKQNQTEDHIIDYVNELCDRLPSPMGESSIDCKSLSSMPS  438

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+I GK+F+L P +Y++KVGEG  AQCISGFTALDVPPPRGPLWILGDVFMG++HTVF
Sbjct  439   VSFTIAGKLFELRPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLWILGDVFMGQFHTVF  498

Query  205   DYGKMRVGFAEAA  167
             DYG M++GFAEAA
Sbjct  499   DYGNMQIGFAEAA  511



>ref|XP_009118162.1| PREDICTED: aspartic proteinase A1 [Brassica rapa]
Length=506

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/493 (72%), Positives = 416/493 (84%), Gaps = 10/493 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A ++ NDG  R+GLKK+K+D  +RIAAR+ +K    LR      Y L    GD  D DIV
Sbjct  22    ASAERNDGTFRVGLKKLKLDPKSRIAARVGSKQLKPLRG-----YGL----GDSGDADIV  72

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C FHSKY SS+SST
Sbjct  73    TLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLFHSKYKSSRSST  132

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             YEKNGKSA IHYGTG+I+GFFS D+V VGDLVVK Q FIEAT EPG+TF++AKFDGILGL
Sbjct  133   YEKNGKSAAIHYGTGAIAGFFSNDAVTVGDLVVKDQEFIEATKEPGITFVLAKFDGILGL  192

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      M+ QGL+++P+FSFWLNRN  ++EGGELVFGGVDP HYKGEHTY
Sbjct  193   GFQEISVGNAAPVWYNMLKQGLIKEPVFSFWLNRNADDEEGGELVFGGVDPNHYKGEHTY  252

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI G PTG+C  GCSAIADSGTSL+AGP+++ITMINHAIGA GV
Sbjct  253   VPVTQKGYWQFDMGDVLIGGAPTGYCESGCSAIADSGTSLLAGPTTVITMINHAIGAAGV  312

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G R VSMGIESVVD++N  S+
Sbjct  313   VSQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGKRDVSMGIESVVDKENAKSS  372

Query  565   D-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
             + + DA CSACEM VVW+Q+QL +N TQE IL Y+N+LC RLPSPMGES VDC +LSTMP
Sbjct  373   NGVGDAACSACEMAVVWIQSQLRQNMTQERILDYINDLCERLPSPMGESAVDCAQLSTMP  432

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VS +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTV
Sbjct  433   TVSLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTV  492

Query  208   FDYGKMRVGFAEA  170
             FD+GK +VGFAEA
Sbjct  493   FDFGKEQVGFAEA  505



>gb|AGP76185.1| aspartic proteinase [Brassica rapa subsp. chinensis]
Length=506

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/491 (73%), Positives = 417/491 (85%), Gaps = 10/491 (2%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             ++ NDG  R+GLKK+K+D  +RIAAR+ +K    LR      Y L    GD  D DIV L
Sbjct  24    AEGNDGTFRVGLKKLKLDPKSRIAARVGSKQLKPLRG-----YGL----GDSGDADIVTL  74

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C FHSKY SS+SSTYE
Sbjct  75    KNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLFHSKYKSSRSSTYE  134

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGKSA IHYGTG+I+GFFS D+V VGDLVVK Q FIEAT EPG+TF++AKFDGILGLGF
Sbjct  135   KNGKSAAIHYGTGAIAGFFSNDAVTVGDLVVKDQEFIEATKEPGITFVLAKFDGILGLGF  194

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVG+A      M+ QGL+++P+FSFWLNRN +++EGGELVFGGVDP HYKGEHTYVP
Sbjct  195   QEISVGNAAPVWYNMLKQGLIKEPVFSFWLNRNAEDEEGGELVFGGVDPNHYKGEHTYVP  254

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQFDMG+VLI G PTG+C  GCSAIADSGTSL+AGP+++ITMINHAIGA GVVS
Sbjct  255   VTQKGYWQFDMGDVLIGGAPTGYCESGCSAIADSGTSLLAGPTTVITMINHAIGAAGVVS  314

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-  563
             ++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVS+GIESVVD++N  S++ 
Sbjct  315   QQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGKRGVSVGIESVVDQENVKSSNG  374

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             + DA CSACEM VVW+Q+QL +N TQE IL Y+N+LC RLPSPMGES VDC +LSTMPSV
Sbjct  375   VGDAACSACEMAVVWIQSQLRQNMTQERILDYINDLCERLPSPMGESAVDCAQLSTMPSV  434

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             S +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD
Sbjct  435   SLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFD  494

Query  202   YGKMRVGFAEA  170
             +GK +VGFAEA
Sbjct  495   FGKEQVGFAEA  505



>gb|ACN24614.1| aspartic acid protease [Phaseolus vulgaris]
Length=513

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/489 (72%), Positives = 416/489 (85%), Gaps = 3/489 (1%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  1451
             NDG  RIGLKK+K+D NNR+AAR+ +K  DS RAS+RK++ L    G  +DTDIV LKNY
Sbjct  27    NDGLRRIGLKKIKLDPNNRLAARIGSK-DDSFRASIRKFH-LQNNFGGTEDTDIVALKNY  84

Query  1450  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNG  1271
             +DAQYFGEI +GT PQKFTVIFDTGSSNLWVPSS C FSV C+FH+KY SS+SSTY+KNG
Sbjct  85    LDAQYFGEIAIGTSPQKFTVIFDTGSSNLWVPSSLCTFSVACYFHAKYRSSKSSTYKKNG  144

Query  1270  KSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEI  1091
              +A I YGTG+ISGFFS DSV+VGD+VVKSQ FIEAT EPGV FL AKFDGILGLGFQEI
Sbjct  145   TAAAIQYGTGAISGFFSYDSVRVGDIVVKSQEFIEATREPGVVFLAAKFDGILGLGFQEI  204

Query  1090  SVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQ  911
             SVG+A      MV QGL+++P+FSFW NR P+E+EGGE+VFGGVDP HYKG+HTYVPVT+
Sbjct  205   SVGNAVPVWYNMVEQGLIKEPVFSFWFNRKPEEEEGGEIVFGGVDPAHYKGKHTYVPVTR  264

Query  910   KGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKEC  731
             KGYW+FDMG+VLI GKPTG+C+ GC AIADSGTSL+AGP++IITMINHAIGA G++S+EC
Sbjct  265   KGYWRFDMGDVLIGGKPTGYCADGCLAIADSGTSLLAGPTTIITMINHAIGAAGIMSQEC  324

Query  730   KAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLHD  554
             K VV  YGQ +++LL+ E +PKKICSQIGLCTF+G RG+ MGI SVVDE     S  LHD
Sbjct  325   KTVVAEYGQTILNLLLAETQPKKICSQIGLCTFDGTRGIDMGIASVVDEIARKSSGGLHD  384

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
             A CSACEM VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGES +D G +S++P VSF+
Sbjct  385   AACSACEMAVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGESSIDRGNISSLPVVSFT  444

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IGG+ FDL P EYILKVGEG  AQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVFD+G 
Sbjct  445   IGGRTFDLLPEEYILKVGEGPVAQCISGFTAIDIPPPRGPLWILGDVFMGRYHTVFDFGN  504

Query  193   MRVGFAEAA  167
             +RVGFA+AA
Sbjct  505   LRVGFADAA  513



>gb|KJB13723.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=508

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/493 (72%), Positives = 416/493 (84%), Gaps = 7/493 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS SNDG  RIGLKK K D+NN +AA+L++K G++LR S RKY  LHG   + +D DIV 
Sbjct  22    FSTSNDGLFRIGLKKRKFDRNNLLAAQLDSKEGEALRGSFRKY--LHGNLQESKDIDIVA  79

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHS+Y SS SSTY
Sbjct  80    LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSRYKSSHSSTY  139

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
               NGK A+I YGTG ISGFFS+D V VGDLVVK+Q FIEATSEP +TFL+AKFDGILGLG
Sbjct  140   NANGKPADIKYGTGQISGFFSEDHVTVGDLVVKNQEFIEATSEPSLTFLLAKFDGILGLG  199

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MVNQGLV++P+FSFWL+RN ++  GGELVFGG+DPKH+KG HTYV
Sbjct  200   FQEISVGNAVPVWYNMVNQGLVKEPVFSFWLSRNSEDNLGGELVFGGMDPKHFKGNHTYV  259

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+ LI  + TGFC+GGCSAIADSGTSL+AGP+ IIT INHAIGA GVV
Sbjct  260   PVTRKGYWQFDMGDFLIGNETTGFCAGGCSAIADSGTSLLAGPTGIITQINHAIGASGVV  319

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S+ECKAVV  YG++++D+L+     KKICSQIGLC F+G +GVSM IES+V+E  G  S 
Sbjct  320   SQECKAVVSEYGEKILDMLL----AKKICSQIGLCLFDGTQGVSMEIESIVNENAGKASG  375

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L DAMCS CEM V+WMQNQL +NQTQ++I+ YVNELC+RLPSPMGES +DC  LS+MPS
Sbjct  376   SLRDAMCSTCEMAVIWMQNQLKQNQTQDHIIDYVNELCDRLPSPMGESSIDCKSLSSMPS  435

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+I GK+F+L P +Y++KVGEG  AQCISGFTALDVPPPRGPLWILGDVFMG++HTVF
Sbjct  436   VSFTIAGKLFELRPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLWILGDVFMGQFHTVF  495

Query  205   DYGKMRVGFAEAA  167
             DYG M++GFAEAA
Sbjct  496   DYGNMQIGFAEAA  508



>ref|XP_006417290.1| hypothetical protein EUTSA_v10007418mg [Eutrema salsugineum]
 dbj|BAJ34217.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35643.1| hypothetical protein EUTSA_v10007418mg [Eutrema salsugineum]
Length=506

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/493 (72%), Positives = 415/493 (84%), Gaps = 10/493 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S+ NDG VR+GLKK+K+D  NR+AAR+ ++    LRA     ++L    GD  D DIV
Sbjct  22    ASSERNDGTVRVGLKKLKLDPKNRLAARISSEQEKPLRA-----FSL----GDSGDADIV  72

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C  H KY SS+SST
Sbjct  73    ALKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  132

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             YEKNGKSA IHYGTG+I+GFFS D+V VGDLVVK Q FIEAT EPG+TF++AKFDGILGL
Sbjct  133   YEKNGKSAAIHYGTGAIAGFFSNDAVTVGDLVVKDQEFIEATKEPGITFVLAKFDGILGL  192

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GF+EISVG+A      M+ QGL+++P+FSFWLNRN ++ EGGELVFGGVDP H+KG+HTY
Sbjct  193   GFKEISVGNAAPVWYNMLKQGLIKEPVFSFWLNRNAEDDEGGELVFGGVDPNHFKGKHTY  252

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI   PTGFC  GCSAIADSGTSL+AGP++IITMINHAIGA GV
Sbjct  253   VPVTQKGYWQFDMGDVLIGNAPTGFCESGCSAIADSGTSLLAGPTTIITMINHAIGAAGV  312

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VS  569
             VS++CK VV+ YG+ +++LL+ E +PKKICSQIGLCTFNG RGVSMGIESVVD++N  +S
Sbjct  313   VSQQCKTVVDQYGRTILELLLSETQPKKICSQIGLCTFNGKRGVSMGIESVVDKENAKLS  372

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               + DA CSACEM VVW+Q+QL +N TQE IL Y NELC RLPSPMGES VDC +LSTMP
Sbjct  373   NGVGDAACSACEMAVVWIQSQLRQNMTQERILDYANELCERLPSPMGESAVDCAQLSTMP  432

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VS +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTV
Sbjct  433   TVSLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTV  492

Query  208   FDYGKMRVGFAEA  170
             FD+GK +VGFAEA
Sbjct  493   FDFGKEQVGFAEA  505



>gb|AAB03108.1| aspartic protease [Brassica napus]
 emb|CDY34613.1| BnaC08g41720D [Brassica napus]
Length=506

 Score =   751 bits (1939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/494 (72%), Positives = 416/494 (84%), Gaps = 10/494 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A ++ NDG  R+GLKK+K D  +RIAA + +K    LR      Y L    GD  D DIV
Sbjct  22    ASAERNDGTFRVGLKKLKFDPRSRIAAPVGSKQLKPLRG-----YGL----GDSGDADIV  72

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C FHSKY SS+SST
Sbjct  73    TLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLFHSKYKSSRSST  132

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             YEKNGKSA IHYGTG+I+GFFS D+V VGDLVVK Q FIEAT EPG+TF++AKFDGILGL
Sbjct  133   YEKNGKSAAIHYGTGAIAGFFSNDAVTVGDLVVKDQEFIEATKEPGITFVLAKFDGILGL  192

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      M+ QGL+++P+FSFWLNRN +++EGGELVFGGVDP H+KGEHTY
Sbjct  193   GFQEISVGNAAPVWYNMLKQGLIKEPVFSFWLNRNAEDEEGGELVFGGVDPNHFKGEHTY  252

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI G PTG+C  GCSAIADSGTSL+AGP+++ITMINHAIGA GV
Sbjct  253   VPVTQKGYWQFDMGDVLIGGAPTGYCESGCSAIADSGTSLLAGPTTVITMINHAIGAAGV  312

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  S+
Sbjct  313   VSQQCKIVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGKRGVSMGIESVVDKENAKSS  372

Query  565   D-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               + DA CSACEM VVW+Q+QL +N TQE IL Y+N+LC RLPSPMGES VDC +LSTMP
Sbjct  373   SGVGDAACSACEMAVVWIQSQLRQNMTQERILDYINDLCERLPSPMGESAVDCAQLSTMP  432

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VS +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTV
Sbjct  433   TVSLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTV  492

Query  208   FDYGKMRVGFAEAA  167
             FD+GK +VGFAEAA
Sbjct  493   FDFGKEQVGFAEAA  506



>emb|CDY34819.1| BnaA09g47450D [Brassica napus]
Length=615

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/491 (72%), Positives = 417/491 (85%), Gaps = 10/491 (2%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             ++ NDG  R+GLKK+K+D  +RIAAR+ +K    LR      Y L    GD  D DIV L
Sbjct  133   AEGNDGTFRVGLKKLKLDPKSRIAARVGSKQLKPLRG-----YGL----GDSGDADIVTL  183

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C FHSKY SS+SSTYE
Sbjct  184   KNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLFHSKYKSSRSSTYE  243

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGKSA IHYGTG+I+GFFS D+V VGDLVVK Q FIEAT EPG+TF++AKFDGILGLGF
Sbjct  244   KNGKSAAIHYGTGAIAGFFSNDAVTVGDLVVKDQEFIEATKEPGITFVLAKFDGILGLGF  303

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVG+A      M+ QGL+++P+FSFWLNR  +++EGGELVFGGVDP HYKGEHTYVP
Sbjct  304   QEISVGNAAPVWYNMLKQGLIKEPVFSFWLNRKAEDEEGGELVFGGVDPNHYKGEHTYVP  363

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQFDMG+VLI G PTG+C  GCSAIADSGTSL+AGP+++ITMINHAIGA GVVS
Sbjct  364   VTQKGYWQFDMGDVLIGGAPTGYCESGCSAIADSGTSLLAGPTTVITMINHAIGAAGVVS  423

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-  563
             ++CK VV+ YGQ ++DLL+ EA+PKKICSQIGLCTF+G RGVS+GIESVVD++N  S++ 
Sbjct  424   QQCKTVVDQYGQTILDLLLSEAQPKKICSQIGLCTFDGKRGVSVGIESVVDQENVKSSNG  483

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             + DA CSACEM VVW+Q+QL +N TQE IL Y+N+LC RLPSPMGES VDC +LSTMP+V
Sbjct  484   VGDAACSACEMAVVWIQSQLRQNMTQERILDYINDLCERLPSPMGESAVDCAQLSTMPTV  543

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             S +IGGKVFDL+P EY+LKVGEG AAQCISGF ALDV PPRGPLWILGDVFMG+YHTVFD
Sbjct  544   SLTIGGKVFDLAPEEYVLKVGEGPAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTVFD  603

Query  202   YGKMRVGFAEA  170
             +GK +VGFAEA
Sbjct  604   FGKEQVGFAEA  614



>ref|XP_009110686.1| PREDICTED: aspartic proteinase A1-like [Brassica rapa]
Length=507

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/494 (72%), Positives = 416/494 (84%), Gaps = 9/494 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A ++ NDG VR+GLKK+K D    ++AR    A  S   +  + YNL    GD  D DIV
Sbjct  22    ASAERNDGTVRVGLKKLKSDPQIHLSAR----AFGSHEENPPRAYNL----GDSGDADIV  73

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C  H KY SS+SST
Sbjct  74    TLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  133

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             YEKNGKSA IHYGTG+I+GFFS D+V VGDLVVK Q FIEAT EPG+TF+VAKFDGILGL
Sbjct  134   YEKNGKSAAIHYGTGAIAGFFSNDAVTVGDLVVKDQEFIEATKEPGLTFVVAKFDGILGL  193

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      M+ QGL+++P+FSFWLNRN +++EGGELVFGGVDPKH+KG+HTY
Sbjct  194   GFQEISVGNAAPVWYNMLKQGLIKEPVFSFWLNRNAEDEEGGELVFGGVDPKHFKGQHTY  253

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI G PTG+C  GCSAIADSGTSL+AGP++IITMINHAIGA GV
Sbjct  254   VPVTQKGYWQFDMGDVLIGGAPTGYCESGCSAIADSGTSLLAGPTTIITMINHAIGASGV  313

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VS  569
              S++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S
Sbjct  314   ASQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGKRGVSMGIESVVDKENAKLS  373

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               + DA CSACEM VVW+Q+QL +N TQE IL YVNELC R+PSPMGES VDC +LSTMP
Sbjct  374   NGVGDAGCSACEMAVVWIQSQLRQNMTQERILDYVNELCERIPSPMGESAVDCAQLSTMP  433

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VS +IGGKVFDL+P+EYILKVGEG+AAQCISGF ALDV PPRGPLWILGDVFMG+YHTV
Sbjct  434   TVSLTIGGKVFDLAPHEYILKVGEGAAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTV  493

Query  208   FDYGKMRVGFAEAA  167
             FD+GK +VGFAEAA
Sbjct  494   FDFGKAQVGFAEAA  507



>ref|XP_008229973.1| PREDICTED: aspartic proteinase A1-like [Prunus mume]
Length=515

 Score =   748 bits (1931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/496 (72%), Positives = 419/496 (84%), Gaps = 7/496 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKN---NRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTD  1472
             FS +NDG VRIGLKKMKID+    NR +  +E +  ++    +RKY+ L G  GD +DTD
Sbjct  23    FSTTNDGLVRIGLKKMKIDQKCHMNRRSNTIEQE--ETPGGPIRKYH-LRGNLGDSEDTD  79

Query  1471  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQS  1292
             IV LKNYMDAQYFGEIG+G+P QKFTVIFDTGSSNLWVPS+KCYFSV CFFHSKY SSQS
Sbjct  80    IVALKNYMDAQYFGEIGIGSPAQKFTVIFDTGSSNLWVPSAKCYFSVACFFHSKYKSSQS  139

Query  1291  STYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGIL  1112
             STY KNGKSA I YGTG+I+GFFSQD V VG+LVVK Q FIEAT EPG+TF+ AKFDGIL
Sbjct  140   STYTKNGKSAAIQYGTGAIAGFFSQDHVTVGNLVVKDQDFIEATKEPGITFVAAKFDGIL  199

Query  1111  GLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEH  932
             GLGFQEISVG+A      +VNQGLV +P+FSFWLNRN + +EGGE+VFGGVD  HYKGEH
Sbjct  200   GLGFQEISVGNAVPVWYNLVNQGLVTEPVFSFWLNRNTEGEEGGEIVFGGVDSNHYKGEH  259

Query  931   TYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGAD  752
             TYVPVTQKGYWQFDMG+VLI G+ +GFC+ GCSAIADSGTSL+AGP+++IT INHAIGA 
Sbjct  260   TYVPVTQKGYWQFDMGDVLIGGESSGFCASGCSAIADSGTSLLAGPTTVITQINHAIGAS  319

Query  751   GVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGV  572
             GVVS+ECK VVE YG+ +I++L+ +A+PKKICSQIG CTF+G  GVSMGIES+V+EK  +
Sbjct  320   GVVSQECKTVVEQYGKTIIEMLLAQAQPKKICSQIGFCTFDGTHGVSMGIESMVNEKLEM  379

Query  571   SAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLST  395
             ++D +HDA C+ACEM VVWMQN+L  N+T++ IL+YVNELC RLPSP GES V CG LS+
Sbjct  380   TSDGVHDAACAACEMAVVWMQNRLRLNETEDQILNYVNELCERLPSPSGESVVQCGALSS  439

Query  394   MPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYH  215
             +PSVSF+IGGKVFDL+P +Y+LKVGEG AAQCISGF ALDV PPRGPLWILGD+FMGRYH
Sbjct  440   LPSVSFTIGGKVFDLAPEQYVLKVGEGVAAQCISGFIALDVAPPRGPLWILGDIFMGRYH  499

Query  214   TVFDYGKMRVGFAEAA  167
             TVFDYG   VGFAEAA
Sbjct  500   TVFDYGNSSVGFAEAA  515



>emb|CDY21021.1| BnaA08g25040D [Brassica napus]
Length=526

 Score =   748 bits (1930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/494 (72%), Positives = 416/494 (84%), Gaps = 9/494 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A ++ NDG VR+GLKK+K D    ++AR    A  S   +  + YNL    GD  D DIV
Sbjct  41    ASAERNDGTVRVGLKKLKSDPQIHLSAR----AFGSHEENPPRAYNL----GDSGDADIV  92

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C  H KY SS+SST
Sbjct  93    TLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  152

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             YEKNGKSA IHYGTG+I+GFFS D+V VGDLVVK Q FIEAT EPG+TF+VAKFDGILGL
Sbjct  153   YEKNGKSAAIHYGTGAIAGFFSNDAVTVGDLVVKDQEFIEATKEPGLTFVVAKFDGILGL  212

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      M+ QGL+++P+FSFWLNRN +++EGGELVFGGVDPKH+KG+HTY
Sbjct  213   GFQEISVGNAAPVWYNMLKQGLIKEPVFSFWLNRNAEDEEGGELVFGGVDPKHFKGQHTY  272

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI G PTG+C  GCSAIADSGTSL+AGP++IITMINHAIGA GV
Sbjct  273   VPVTQKGYWQFDMGDVLIGGAPTGYCESGCSAIADSGTSLLAGPTTIITMINHAIGASGV  332

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VS  569
              S++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S
Sbjct  333   ASQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGKRGVSMGIESVVDKENAKLS  392

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               + DA CSACEM VVW+Q+QL +N TQE IL YVNELC R+PSPMGES VDC +LSTMP
Sbjct  393   NGVGDAGCSACEMAVVWIQSQLRQNMTQERILDYVNELCERIPSPMGESAVDCAQLSTMP  452

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VS +IGGKVFDL+P+EYILKVGEG+AAQCISGF ALDV PPRGPLWILGDVFMG+YHTV
Sbjct  453   TVSLTIGGKVFDLAPHEYILKVGEGAAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTV  512

Query  208   FDYGKMRVGFAEAA  167
             FD+GK +VGFAEAA
Sbjct  513   FDFGKAQVGFAEAA  526



>ref|XP_007215237.1| hypothetical protein PRUPE_ppa004349mg [Prunus persica]
 gb|EMJ16436.1| hypothetical protein PRUPE_ppa004349mg [Prunus persica]
Length=515

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/493 (72%), Positives = 412/493 (84%), Gaps = 1/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS +NDG VRIGLKKMKID+   +  R  A   +       + Y+L G  GD +DTDIV 
Sbjct  23    FSTTNDGLVRIGLKKMKIDQKCHMNRRSNANEQEETPGGPIRKYHLRGNLGDSEDTDIVA  82

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+G+P QKFTVIFDTGSSNLWVPS+KCYFSV CFFHSKY SSQSSTY
Sbjct  83    LKNYMDAQYFGEIGIGSPAQKFTVIFDTGSSNLWVPSAKCYFSVACFFHSKYKSSQSSTY  142

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
              KNGKSA I YGTG+I+GFFSQD V VG+LVVK Q FIEAT EPG+TF+ AKFDGILGLG
Sbjct  143   TKNGKSAAIQYGTGAIAGFFSQDHVTVGNLVVKDQDFIEATKEPGITFVAAKFDGILGLG  202

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      +VNQGLV +P+FSFWLNRN + +EGGE+VFGGVD  HYKGEHTYV
Sbjct  203   FQEISVGNAVPVWYNLVNQGLVTEPVFSFWLNRNTEGEEGGEIVFGGVDSNHYKGEHTYV  262

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+VLI G+ +GFC+ GCSAIADSGTSL+AGP+++IT INHAIGA GVV
Sbjct  263   PVTQKGYWQFDMGDVLIGGETSGFCASGCSAIADSGTSLLAGPTTVITQINHAIGASGVV  322

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+ECK VVE YG+ ++++L+ +A+PKKICSQIG CTF+G  GVSMGIES+V+EK  +++D
Sbjct  323   SQECKTVVEQYGKTIMEMLLAQAQPKKICSQIGFCTFDGTHGVSMGIESMVNEKLEMTSD  382

Query  562   -LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              +HDA C+ACEM VVWMQN+L  N+T++ IL+YVNELC RLPSP GES V C  LS++PS
Sbjct  383   GVHDAACTACEMAVVWMQNRLRLNETEDQILNYVNELCERLPSPSGESVVQCDALSSLPS  442

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGKVFDL+P +Y+LKVGEG AAQCISGF ALDV PPRGPLWILGD+FMGRYHTVF
Sbjct  443   VSFTIGGKVFDLAPEQYVLKVGEGVAAQCISGFIALDVAPPRGPLWILGDIFMGRYHTVF  502

Query  205   DYGKMRVGFAEAA  167
             DYG   VGFAEAA
Sbjct  503   DYGNSTVGFAEAA  515



>emb|CDY31221.1| BnaC08g15160D [Brassica napus]
Length=595

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/494 (72%), Positives = 417/494 (84%), Gaps = 9/494 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A ++ NDG  R+GLKK+K+D    +AAR    A  S + +  + YNL    GD  D DIV
Sbjct  110   ASAERNDGTFRVGLKKLKLDPKGGLAAR----AFGSHQENPPRAYNL----GDSGDADIV  161

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTV+FDTGSSNLWVPSSKCYFS+ C  H KY SS+SST
Sbjct  162   TLKNYLDAQYYGEIAIGTPPQKFTVVFDTGSSNLWVPSSKCYFSIACLLHPKYKSSRSST  221

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             YEKNGKSA IHYGTG+I+GFFS D+V VGDLVVK Q FIEAT EPG+TF+VAKFDGILGL
Sbjct  222   YEKNGKSAAIHYGTGAIAGFFSNDAVTVGDLVVKDQEFIEATKEPGLTFVVAKFDGILGL  281

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      M+ QGL+++P+FSFWLNRN +++EGGELVFGGVDPKH+KG+HTY
Sbjct  282   GFQEISVGNAAPVWYNMLKQGLIKEPVFSFWLNRNAEDEEGGELVFGGVDPKHFKGQHTY  341

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI G PTG+C  GCSAIADSGTSL+AGP++IITMINHAIGA GV
Sbjct  342   VPVTQKGYWQFDMGDVLIGGAPTGYCESGCSAIADSGTSLLAGPTTIITMINHAIGASGV  401

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VS  569
              S++CK VV+ YGQ ++DLL+ E +PKKICSQIGLCTF+G RGVSMGIESVVD++N  +S
Sbjct  402   ASQQCKTVVDQYGQTILDLLLSETQPKKICSQIGLCTFDGKRGVSMGIESVVDKENAKLS  461

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               + DA CSACEM VVW+Q+QL +N TQE IL YVNELC R+PSPMGES VDC +LSTMP
Sbjct  462   NGVGDAACSACEMAVVWIQSQLRQNMTQERILDYVNELCERIPSPMGESAVDCAQLSTMP  521

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VS +IGGKVFDL+P+EY+LKVGEG+AAQCISGF ALDV PPRGPLWILGDVFMG+YHTV
Sbjct  522   TVSLTIGGKVFDLAPHEYVLKVGEGAAAQCISGFIALDVAPPRGPLWILGDVFMGKYHTV  581

Query  208   FDYGKMRVGFAEAA  167
             FD+GK +VGFAEAA
Sbjct  582   FDFGKAQVGFAEAA  595



>gb|KJB22150.1| hypothetical protein B456_004G031800 [Gossypium raimondii]
 gb|KJB22151.1| hypothetical protein B456_004G031800 [Gossypium raimondii]
Length=514

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/493 (71%), Positives = 410/493 (83%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS  ND  VRIGLKK KID+NNR+AA LE+K   +  A +RKY  LHG  G+ +D DIV 
Sbjct  23    FSTPNDRLVRIGLKKRKIDRNNRMAAHLESKEEKASEAFLRKY-RLHGNLGESEDIDIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTP Q FTVIFDTGSSNLWVPSSKCYFS+ C+FH KY SS S TY
Sbjct  82    LKNYMDAQYFGEIGIGTPTQNFTVIFDTGSSNLWVPSSKCYFSIACYFHPKYKSSHSRTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             + NGK A+I YGTG+ISGFFS+D V VGDLVVK Q FIEAT E  +TFL+AKFDGILGLG
Sbjct  142   KANGKPADIQYGTGAISGFFSEDHVTVGDLVVKHQEFIEATKESSLTFLIAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             F+EISVG+A      MVNQGLV +P+FSFWLNRNP++  GGE+VFGG+DPKHYKGEHTYV
Sbjct  202   FKEISVGNAVPVWYNMVNQGLVNEPVFSFWLNRNPEDDVGGEVVFGGMDPKHYKGEHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+VLI  + TG C+ GCSAI DSGTSL+ GP++II  +NHAIGA GVV
Sbjct  262   PVTQKGYWQFDMGDVLIGDQTTGLCASGCSAIVDSGTSLLTGPTAIIAQVNHAIGATGVV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S+ECK VV  YG+ +IDLL+ + +P K+CSQIGLC+F+G R VSMGIESVV+E  G  S 
Sbjct  322   SQECKTVVSEYGETIIDLLLSKDQPLKVCSQIGLCSFDGTRDVSMGIESVVNENAGKASG  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
             ++HDAMCS CEM V+W+Q+QL +NQTQE IL YVNELC+RLPSPMGES VDC  LS+MPS
Sbjct  382   NVHDAMCSVCEMAVIWVQSQLKQNQTQERILDYVNELCDRLPSPMGESVVDCNSLSSMPS  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             V+F+IGGK+ +L+P +YILKVG+G  AQCISGF ALDVPPPRGPLWILGDVFMG++HTVF
Sbjct  442   VAFTIGGKILELTPEQYILKVGDGELAQCISGFGALDVPPPRGPLWILGDVFMGKFHTVF  501

Query  205   DYGKMRVGFAEAA  167
             DYG M++GFAEAA
Sbjct  502   DYGNMQIGFAEAA  514



>ref|XP_008797519.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797520.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797521.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797522.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
 ref|XP_008797523.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
Length=512

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/490 (73%), Positives = 411/490 (84%), Gaps = 8/490 (2%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHG--RNGDLQDTDIVGLKN  1454
             DG +RIGLKK  +D+N+R+AARL  K G  L A     Y L G   NGD  +TDI+ LKN
Sbjct  28    DGLIRIGLKKKPMDQNSRLAARLVEKEGKPLVAG---KYGLRGGLENGD--ETDIISLKN  82

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YM+AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV CFFHS+Y SS+SSTY+KN
Sbjct  83    YMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACFFHSRYKSSRSSTYQKN  142

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKSA IHYGTGS+SGFFSQD V VGDLVVK Q FIEAT EP VTFLVAKFDGILGLGF+E
Sbjct  143   GKSAAIHYGTGSVSGFFSQDHVAVGDLVVKDQIFIEATREPSVTFLVAKFDGILGLGFKE  202

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG+       MVNQGL+++P+F+FW NR+  E EGGE+VFGGVDPKH+KG+HTYVPVT
Sbjct  203   ISVGNVVPVWYNMVNQGLIKEPVFAFWFNRHVDEGEGGEIVFGGVDPKHFKGKHTYVPVT  262

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQF+MG+V I  + TGFCSGGC+AIADSGTSL+AGP++II  IN  IGA GVVS+E
Sbjct  263   QKGYWQFNMGDVHIGNQSTGFCSGGCAAIADSGTSLVAGPTTIIAEINQKIGASGVVSQE  322

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-  557
             CKAVV  YGQ+++DLL+ E  P KICSQIGLC F+G  GV +GIESVV++   +SA L  
Sbjct  323   CKAVVAQYGQQILDLLLSETEPAKICSQIGLCAFDGTHGVGIGIESVVNDNGDLSAGLQS  382

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             DAMC++CEM V+WMQNQL +N+TQ+ IL+Y+NELC RLPSPMGES VDC  L +MPSVSF
Sbjct  383   DAMCTSCEMAVIWMQNQLKQNETQDRILNYINELCERLPSPMGESSVDCASLDSMPSVSF  442

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK F+L+P +YILKVGEG+AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFDYG
Sbjct  443   TIGGKSFELTPEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFDYG  502

Query  196   KMRVGFAEAA  167
              MRVGFAEAA
Sbjct  503   NMRVGFAEAA  512



>gb|KHN33009.1| Aspartic proteinase [Glycine soja]
Length=504

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/493 (72%), Positives = 410/493 (83%), Gaps = 9/493 (2%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             F   NDG  RIGLKK+K+D ++ +  +         R+S+RK++ L    G  +DTD+V 
Sbjct  20    FCAPNDGLRRIGLKKVKLDTDDVVGFK-------EFRSSIRKHH-LQNILGGAEDTDVVA  71

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFSV CF H++Y SSQSSTY
Sbjct  72    LKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACFMHARYRSSQSSTY  131

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
              +NG SA I YGTG+ISGFFS D V+VGD+VVK Q FIEAT EPGVTF+ AKFDGILGLG
Sbjct  132   RENGTSAAIQYGTGAISGFFSNDDVKVGDIVVKDQEFIEATREPGVTFVAAKFDGILGLG  191

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      MV QGLV+DP+FSFWLNR P+E+ GGELVFGG DP HYKG+HTYV
Sbjct  192   FQEISVGYAVPVWYTMVEQGLVKDPVFSFWLNRKPEEENGGELVFGGADPAHYKGKHTYV  251

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+VLI GKPTG+C+  CSAIADSGTSL+AGP+++ITMIN AIGA GVV
Sbjct  252   PVTRKGYWQFDMGDVLISGKPTGYCTNDCSAIADSGTSLLAGPTTVITMINQAIGAAGVV  311

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSA  566
             SKEC++VV  YGQ +++LL+ EA+PKKICSQIGLCTF+G  GVSMGIESVVD+ +   S 
Sbjct  312   SKECRSVVNQYGQTILELLLAEAKPKKICSQIGLCTFDGTHGVSMGIESVVDKNEKKSSG  371

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              + DA CSACEM V+WMQNQL +NQT++ I+ Y NELC +LP+PMG S VDCGKLS+MP 
Sbjct  372   GIRDAGCSACEMAVIWMQNQLRQNQTEDRIIDYANELCEKLPNPMGPSSVDCGKLSSMPI  431

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGKVFDLSP EYILKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHT+F
Sbjct  432   VSFTIGGKVFDLSPEEYILKVGEGPEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTIF  491

Query  205   DYGKMRVGFAEAA  167
             DYGK+RVGFAEAA
Sbjct  492   DYGKLRVGFAEAA  504



>ref|XP_008349314.1| PREDICTED: aspartic proteinase-like [Malus domestica]
Length=507

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/491 (71%), Positives = 418/491 (85%), Gaps = 10/491 (2%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQ--DTDIVGLK  1457
             NDG  RIGLK++K+D N+R+AA+LE+K  + LR      Y L    G+ +  D DIV LK
Sbjct  24    NDGLSRIGLKRVKLDSNDRVAAQLESK--NRLRK-----YRLPSNLGESESGDVDIVSLK  76

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+GEI +GTPPQ FTVIFDTGS+NLWVPSSKCYFS  C+FH++Y S QS TY+K
Sbjct  77    NYLDAQYYGEIAIGTPPQPFTVIFDTGSTNLWVPSSKCYFSFACYFHARYKSGQSKTYKK  136

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NG SA I YGTG+ISGFFS+D+V+VGD+VVK+Q FIEATSEPG+TFL AKFDG+LGLGFQ
Sbjct  137   NGTSASIQYGTGAISGFFSEDNVKVGDIVVKNQDFIEATSEPGLTFLAAKFDGLLGLGFQ  196

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG A      M+ QGL+++P+FSFWLNRN QE+ GGE+VFGGVDP HYKG+HTYVPV
Sbjct  197   EISVGGAVPVWYNMIKQGLIKEPVFSFWLNRNAQEEAGGEIVFGGVDPNHYKGKHTYVPV  256

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T+KGYWQF+MG+VLI GKP+G+C+GGC AIADSGTSL+AGP++++ +IN AIGA GVVS+
Sbjct  257   TKKGYWQFEMGDVLIGGKPSGYCAGGCYAIADSGTSLVAGPTTVVALINQAIGASGVVSQ  316

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL-  560
             ECKAVV  YGQ ++DLL+ EA+PK++CSQIGLCTF+G R VSMGIESVVDE  G S+ + 
Sbjct  317   ECKAVVNQYGQTILDLLLAEAQPKQVCSQIGLCTFDGTRSVSMGIESVVDENGGKSSGIT  376

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
             HDA CSACEM VVWMQ QL +N TQ+ IL+YVNELC ++P+P+G+S VDCGKLS+MPSVS
Sbjct  377   HDASCSACEMAVVWMQTQLKQNLTQDRILNYVNELCEKMPNPLGQSAVDCGKLSSMPSVS  436

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGKVF+L+P EYILKVGEGS AQCISGFT +D+PPPRGPLWILGD+FMGRYHTVFD 
Sbjct  437   FTIGGKVFELTPEEYILKVGEGSQAQCISGFTNMDIPPPRGPLWILGDIFMGRYHTVFDA  496

Query  199   GKMRVGFAEAA  167
             GKMRVGFAEAA
Sbjct  497   GKMRVGFAEAA  507



>ref|NP_176419.2| aspartic proteinase A2 [Arabidopsis thaliana]
 ref|NP_001031219.1| aspartic proteinase A2 [Arabidopsis thaliana]
 sp|Q8VYL3.1|APA2_ARATH RecName: Full=Aspartic proteinase A2; AltName: Full=Aspartic 
protease 57; Short=AtASP57; Flags: Precursor [Arabidopsis thaliana]
 gb|AAL49856.1| putative aspartic protease [Arabidopsis thaliana]
 gb|AAN13225.1| putative aspartic protease [Arabidopsis thaliana]
 dbj|BAH19961.1| AT1G62290 [Arabidopsis thaliana]
 gb|AEE33946.1| aspartic proteinase A2 [Arabidopsis thaliana]
 gb|AEE33947.1| aspartic proteinase A2 [Arabidopsis thaliana]
Length=513

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/493 (70%), Positives = 418/493 (85%), Gaps = 3/493 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A+SK NDG  R+GLKK+K+D NNR+A R  +K  ++LR+S+R Y N  G  GD  D DIV
Sbjct  22    AYSKRNDGTFRVGLKKLKLDPNNRLATRFGSKQEEALRSSLRSYNNNLG--GDSGDADIV  79

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KC+FS+ C+FH+KY SS+SST
Sbjct  80    PLKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFFSLSCYFHAKYKSSRSST  139

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+K+GK A IHYG+GSISGFFS D+V VGDLVVK Q FIE TSEPG+TFLVAKFDG+LGL
Sbjct  140   YKKSGKRAAIHYGSGSISGFFSYDAVTVGDLVVKDQEFIETTSEPGLTFLVAKFDGLLGL  199

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEI+VG+A      M+ QGL++ P+FSFWLNR+P+ +EGGE+VFGGVDPKH++GEHT+
Sbjct  200   GFQEIAVGNATPVWYNMLKQGLIKRPVFSFWLNRDPKSEEGGEIVFGGVDPKHFRGEHTF  259

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQ+GYWQFDMGEVLI G+ TG+C  GCSAIADSGTSL+AGP++++ MIN AIGA GV
Sbjct  260   VPVTQRGYWQFDMGEVLIAGESTGYCGSGCSAIADSGTSLLAGPTAVVAMINKAIGASGV  319

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLC ++G  GVSMGIESVVD++N  S+
Sbjct  320   VSQQCKTVVDQYGQTILDLLLAETQPKKICSQIGLCAYDGTHGVSMGIESVVDKENTRSS  379

Query  565   D-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               L DA C ACEM VVW+Q+QL +N TQE I++Y+NE+C R+PSP GES VDC +LS MP
Sbjct  380   SGLRDAGCPACEMAVVWIQSQLRQNMTQERIVNYINEICERMPSPNGESAVDCSQLSKMP  439

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VSF+IGGKVFDL+P EY+LK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMG+YHTV
Sbjct  440   TVSFTIGGKVFDLAPEEYVLKIGEGPVAQCISGFTALDIPPPRGPLWILGDVFMGKYHTV  499

Query  208   FDYGKMRVGFAEA  170
             FD+G  +VGFAEA
Sbjct  500   FDFGNEQVGFAEA  512



>ref|XP_003546159.1| PREDICTED: aspartic proteinase-like [Glycine max]
Length=507

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/493 (72%), Positives = 410/493 (83%), Gaps = 9/493 (2%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             F   NDG  RIGLKK+K+D ++ +  +         R+S+RK++ L    G  +DTD+V 
Sbjct  23    FCAPNDGLRRIGLKKVKLDTDDVVGFK-------EFRSSIRKHH-LQNILGGAEDTDVVA  74

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFSV CF H++Y SSQSSTY
Sbjct  75    LKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACFMHARYRSSQSSTY  134

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
              +NG SA I YGTG+ISGFFS D V+VGD+VVK Q FIEAT EPGVTF+ AKFDGILGLG
Sbjct  135   RENGTSAAIQYGTGAISGFFSNDDVKVGDIVVKDQEFIEATREPGVTFVAAKFDGILGLG  194

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      MV QGLV+DP+FSFWLNR P+E+ GGELVFGG DP HYKG+HTYV
Sbjct  195   FQEISVGYAVPVWYTMVEQGLVKDPVFSFWLNRKPEEENGGELVFGGADPAHYKGKHTYV  254

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+VLI GKPTG+C+  CSAIADSGTSL+AGP+++ITMIN AIGA GVV
Sbjct  255   PVTRKGYWQFDMGDVLISGKPTGYCTNDCSAIADSGTSLLAGPTTVITMINQAIGAAGVV  314

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSA  566
             SKEC++VV  YGQ +++LL+ EA+PKKICSQIGLCTF+G  GVSMGIESVVD+ +   S 
Sbjct  315   SKECRSVVNQYGQTILELLLAEAKPKKICSQIGLCTFDGTHGVSMGIESVVDKNEKKSSG  374

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              + DA CSACEM V+WMQNQL +NQT++ I+ Y NELC +LP+PMG S VDCGKLS+MP 
Sbjct  375   GIRDAGCSACEMAVIWMQNQLRQNQTEDRIIDYANELCEKLPNPMGPSSVDCGKLSSMPI  434

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGKVFDLSP EYILKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHT+F
Sbjct  435   VSFTIGGKVFDLSPEEYILKVGEGPEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTIF  494

Query  205   DYGKMRVGFAEAA  167
             DYGK+RVGFAEAA
Sbjct  495   DYGKLRVGFAEAA  507



>gb|KHG04193.1| Asparticase [Gossypium arboreum]
Length=514

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/494 (71%), Positives = 409/494 (83%), Gaps = 2/494 (0%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
              FS  ND  VRIGLKK KID+NNR+AA LE+K G +  A +RKY  LHG  G+ +D DIV
Sbjct  22    VFSTPNDRLVRIGLKKRKIDRNNRMAAHLESKEGKASEAFLRKY-RLHGNLGESEDIDIV  80

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQYFGEIG+GTP Q FTVIFDTGSSNLWVPSSKCYFS+ C+FH KY SS+S T
Sbjct  81    ALKNYMDAQYFGEIGIGTPTQNFTVIFDTGSSNLWVPSSKCYFSIACYFHPKYKSSRSRT  140

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+ NGK A+I YGTG+ISGFFS+D V VGDLVVK Q FIEAT E  +TFL+AKFDGILGL
Sbjct  141   YKANGKPADIQYGTGAISGFFSEDHVTVGDLVVKHQEFIEATKESSLTFLIAKFDGILGL  200

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GF+EISVG+A      MVNQGLV +P+FSFWLNRNP++  GGE+VFGG+DPKHYKGEHTY
Sbjct  201   GFKEISVGNAVPVWYNMVNQGLVNEPVFSFWLNRNPEDDVGGEVVFGGMDPKHYKGEHTY  260

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPV QKGYWQFDMG+VLI  + TG C+ GCSAI DSGTSL+ GP++II  +NHAIGA GV
Sbjct  261   VPVKQKGYWQFDMGDVLIGDQTTGLCASGCSAIVDSGTSLLTGPTAIIAQVNHAIGATGV  320

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VS  569
             VS+ECK VV  YG+ +IDLL+ + +P K+CSQIGLC+F+G R VSMGIESVV+E  G  S
Sbjct  321   VSQECKTVVSEYGEMIIDLLLSKDQPLKVCSQIGLCSFDGTRDVSMGIESVVNENAGKAS  380

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
              ++HDAMCS CEM V+W+Q+QL +NQTQE IL YVNELC+RLPSPMGES VDC  LS MP
Sbjct  381   GNVHDAMCSVCEMAVIWVQSQLKQNQTQERILDYVNELCDRLPSPMGESVVDCNSLSAMP  440

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             SV+F+IGGK+ +L+P +YILKVG+G  AQCISGF ALDVPPPRGPLWILGDVFMG++HTV
Sbjct  441   SVAFTIGGKILELTPEQYILKVGDGELAQCISGFGALDVPPPRGPLWILGDVFMGKFHTV  500

Query  208   FDYGKMRVGFAEAA  167
             FDYG M++GFAEA 
Sbjct  501   FDYGNMQIGFAEAT  514



>gb|AAB03843.2| aspartic proteinase [Vigna unguiculata]
 gb|AAQ14346.1| aspartic proteinase [Vigna unguiculata]
Length=513

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/489 (72%), Positives = 412/489 (84%), Gaps = 3/489 (1%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  1451
             NDG  RIGLKK+K+D NNR+AAR+ +   DS RAS+RK++ L        +TDIV LKNY
Sbjct  27    NDGLRRIGLKKIKLDPNNRLAARIGSN-DDSFRASIRKFH-LQNNFAGTGETDIVALKNY  84

Query  1450  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNG  1271
             +DAQY+GEI +GT PQKFTVIFDTGSSNLWVPSS+C FS+ C+FH+KY S +SSTY +NG
Sbjct  85    LDAQYYGEISIGTSPQKFTVIFDTGSSNLWVPSSRCTFSLACYFHAKYRSGRSSTYRRNG  144

Query  1270  KSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEI  1091
              +A I YGTG+I+GFFS D+V+VGD+VVK+Q FIEAT EPGV FL AKFDGILGLGFQEI
Sbjct  145   TAAAIQYGTGAIAGFFSYDNVRVGDIVVKNQEFIEATREPGVVFLAAKFDGILGLGFQEI  204

Query  1090  SVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQ  911
             SVG+A      MV QGL+++P+FSFWLNR  +E+EGGELVFGGVDP HYKGEHTYVPVT+
Sbjct  205   SVGNAVPVWYNMVEQGLIKEPVFSFWLNRKTEEEEGGELVFGGVDPAHYKGEHTYVPVTR  264

Query  910   KGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKEC  731
             KGYWQFDMG+VLI GKPTG+C+GGC+AIADSGTSL+AGP++IITMINHAIGA GV+S+EC
Sbjct  265   KGYWQFDMGDVLIGGKPTGYCAGGCAAIADSGTSLLAGPTAIITMINHAIGASGVMSQEC  324

Query  730   KAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHD  554
             K VV  YGQ +++LL+ E +PKKICSQIGLCTF+G RGV MGIESVVDE     S  LHD
Sbjct  325   KTVVAEYGQTILNLLLAETQPKKICSQIGLCTFDGTRGVDMGIESVVDENARKSSGGLHD  384

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
             A CSACEM VVW+QNQLS NQTQ+ ILSYVN+LC+++PSPMGES V CG +S++P VSF+
Sbjct  385   AGCSACEMAVVWVQNQLSRNQTQDQILSYVNQLCDKMPSPMGESSVGCGDISSLPVVSFT  444

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IGG+ FDL P EYILKVGEG  AQCISGFTA+D+ PPRGPLWILGDVFMG YHTVFD+G 
Sbjct  445   IGGRTFDLRPEEYILKVGEGPVAQCISGFTAIDIAPPRGPLWILGDVFMGPYHTVFDFGN  504

Query  193   MRVGFAEAA  167
              RVGFAEAA
Sbjct  505   QRVGFAEAA  513



>ref|XP_008800700.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X2 [Phoenix 
dactylifera]
Length=512

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/492 (72%), Positives = 409/492 (83%), Gaps = 4/492 (1%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S   DG +R+GLKK  +D+N+R AARL  K G  L   V   Y L G  G+  +TDIV L
Sbjct  24    SAEGDGLIRVGLKKKPMDQNSRPAARLVEKEGKPL---VAGKYGLRGGLGNGDETDIVSL  80

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYM+AQYFGEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFS+ C FHS+YTS++SSTY 
Sbjct  81    KNYMNAQYFGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACLFHSRYTSTRSSTYR  140

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A+IHYGTGSISGFFSQD V VGDLVV+ Q FIEAT EP +TFLVAKFDGILGLGF
Sbjct  141   KNGKPADIHYGTGSISGFFSQDHVTVGDLVVQDQVFIEATREPSITFLVAKFDGILGLGF  200

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVG+       MVNQGL+++P+FSFW NR+  E EGGE+VFGGVDP H+KG+HTYVP
Sbjct  201   KEISVGNVEPVWYTMVNQGLIKEPVFSFWFNRHADEGEGGEIVFGGVDPNHFKGKHTYVP  260

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQF+MG+VLI  + TGFCSGGC+AIADSGTSLIAGP++II  IN  IGA GVVS
Sbjct  261   VTQKGYWQFNMGDVLIGNQSTGFCSGGCAAIADSGTSLIAGPTTIIAEINQKIGASGVVS  320

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECKAVV  YGQ ++D+L+ E +P KICS IGLCTF+G  GVS+GIESVV++   +SA L
Sbjct  321   QECKAVVAQYGQEILDMLLSETQPAKICSHIGLCTFDGTHGVSVGIESVVNDNGDLSAGL  380

Query  559   H-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
               DAMC+ACEM VVWMQNQL +N+TQE IL+Y+NELC RLPSPMGES VDC  L++MPSV
Sbjct  381   QSDAMCTACEMAVVWMQNQLKQNETQELILNYINELCERLPSPMGESSVDCASLASMPSV  440

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IGGK F+L+P +YILKVGEG+AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFD
Sbjct  441   SFTIGGKSFELTPEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFD  500

Query  202   YGKMRVGFAEAA  167
             Y  +RVGFAEAA
Sbjct  501   YENLRVGFAEAA  512



>sp|O04057.1|ASPR_CUCPE RecName: Full=Aspartic proteinase; Flags: Precursor [Cucurbita 
pepo]
 dbj|BAA19607.1| aspartic endopeptidase [Cucurbita pepo]
Length=513

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/492 (74%), Positives = 428/492 (87%), Gaps = 3/492 (1%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SNDG +R+GLKK+K+D  NR+AAR+E+K  + L+A+ RKY N  G  G+  DTDIV L
Sbjct  24    SASNDGLLRVGLKKIKLDPENRLAARVESKDAEILKAAFRKY-NPKGNLGESSDTDIVAL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWV   +C FSV C FH++Y SS+SS+Y+
Sbjct  83    KNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWV-LCECLFSVACHFHARYKSSRSSSYK  141

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNG SA I YGTG++SGFFS D+V+VGDLVVK Q FIEAT EP +TFLVAKFDG+LGLGF
Sbjct  142   KNGTSASIRYGTGAVSGFFSYDNVKVGDLVVKEQVFIEATREPSLTFLVAKFDGLLGLGF  201

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEI+VG+A      MV QGLV++P+FSFWLNRN +E+EGGE+VFGGVDPKHY+G+HTYVP
Sbjct  202   QEIAVGNAVPVWYNMVEQGLVKEPVFSFWLNRNVEEEEGGEIVFGGVDPKHYRGKHTYVP  261

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQFDMG+VLI+G+PTGFC GGCSAIADSGTSL+AGP+ +ITMINHAIGA GVVS
Sbjct  262   VTQKGYWQFDMGDVLIDGEPTGFCDGGCSAIADSGTSLLAGPTPVITMINHAIGAKGVVS  321

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-  563
             ++CKAVV  YGQ ++DLL+ EA PKKICSQI LCTF+G RGVSMGIESVVDE  G S+D 
Sbjct  322   QQCKAVVAQYGQTIMDLLLSEADPKKICSQINLCTFDGTRGVSMGIESVVDENAGKSSDS  381

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             LHD MCS CEMTVVWMQNQL +NQT+E I++Y+NELC+R+PSPMG+S VDCG+LS+MP+V
Sbjct  382   LHDGMCSVCEMTVVWMQNQLRQNQTKERIINYINELCDRMPSPMGQSAVDCGQLSSMPTV  441

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IGGK+FDL+P EYILKVGEG  AQCISGFTA D+PPPRGPLWILGDVFMGRYHTVFD
Sbjct  442   SFTIGGKIFDLAPEEYILKVGEGPVAQCISGFTAFDIPPPRGPLWILGDVFMGRYHTVFD  501

Query  202   YGKMRVGFAEAA  167
             +GK+RVG AEAA
Sbjct  502   FGKLRVGSAEAA  513



>gb|KDO78303.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
Length=491

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/465 (78%), Positives = 412/465 (89%), Gaps = 2/465 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SNDG VRIGLKKMK+D NNR+AARLE++ G++LRASV+KY        D +DTDIV L
Sbjct  24    SVSNDGLVRIGLKKMKLDPNNRLAARLESEHGEALRASVKKY-GFPNNLRDSEDTDIVAL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+ CYFSV C+FHSKY SSQSSTY+
Sbjct  83    KNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTNCYFSVACYFHSKYKSSQSSTYK  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNG+SA I YGTG+I+GFFS DSV+VGDLVVK Q FIEAT EPGVTF+VAKFDGILGLGF
Sbjct  143   KNGESASIQYGTGAIAGFFSYDSVKVGDLVVKDQEFIEATREPGVTFMVAKFDGILGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVG+A      MV QGL+QDP+FSFWLNRN QE EGGE+VFGGVDP HYKG+HTYVP
Sbjct  203   QEISVGNAVPVWYNMVKQGLIQDPVFSFWLNRNQQEDEGGEIVFGGVDPNHYKGKHTYVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQF+MG+VLI GKPTG+C+GGCSAIADSGTSL+AGP+++ITMINHAIGA GVVS
Sbjct  263   VTQKGYWQFNMGDVLIGGKPTGYCAGGCSAIADSGTSLLAGPTTVITMINHAIGASGVVS  322

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-  563
             ++CKAVVE YGQ ++DLL+ EA PKKICSQ+GLCTF+G RGVSMGIESVVDE N  S+  
Sbjct  323   QQCKAVVEQYGQTILDLLLFEAHPKKICSQMGLCTFDGKRGVSMGIESVVDESNDKSSGV  382

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             L++AMCSACEM VVWMQNQL +NQTQENIL YVNELC+R+PSPMGES VDCGKLS+MP V
Sbjct  383   LNNAMCSACEMAVVWMQNQLQQNQTQENILQYVNELCDRMPSPMGESAVDCGKLSSMPIV  442

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  248
             SF+IGGKVFDLSP EYILKVGEG  AQCISGFTA+DVPPPRGPLW
Sbjct  443   SFTIGGKVFDLSPEEYILKVGEGPEAQCISGFTAMDVPPPRGPLW  487



>ref|XP_008800699.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Phoenix 
dactylifera]
Length=547

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/492 (72%), Positives = 409/492 (83%), Gaps = 4/492 (1%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S   DG +R+GLKK  +D+N+R AARL  K G  L   V   Y L G  G+  +TDIV L
Sbjct  59    SAEGDGLIRVGLKKKPMDQNSRPAARLVEKEGKPL---VAGKYGLRGGLGNGDETDIVSL  115

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYM+AQYFGEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFS+ C FHS+YTS++SSTY 
Sbjct  116   KNYMNAQYFGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACLFHSRYTSTRSSTYR  175

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A+IHYGTGSISGFFSQD V VGDLVV+ Q FIEAT EP +TFLVAKFDGILGLGF
Sbjct  176   KNGKPADIHYGTGSISGFFSQDHVTVGDLVVQDQVFIEATREPSITFLVAKFDGILGLGF  235

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVG+       MVNQGL+++P+FSFW NR+  E EGGE+VFGGVDP H+KG+HTYVP
Sbjct  236   KEISVGNVEPVWYTMVNQGLIKEPVFSFWFNRHADEGEGGEIVFGGVDPNHFKGKHTYVP  295

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQF+MG+VLI  + TGFCSGGC+AIADSGTSLIAGP++II  IN  IGA GVVS
Sbjct  296   VTQKGYWQFNMGDVLIGNQSTGFCSGGCAAIADSGTSLIAGPTTIIAEINQKIGASGVVS  355

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECKAVV  YGQ ++D+L+ E +P KICS IGLCTF+G  GVS+GIESVV++   +SA L
Sbjct  356   QECKAVVAQYGQEILDMLLSETQPAKICSHIGLCTFDGTHGVSVGIESVVNDNGDLSAGL  415

Query  559   H-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
               DAMC+ACEM VVWMQNQL +N+TQE IL+Y+NELC RLPSPMGES VDC  L++MPSV
Sbjct  416   QSDAMCTACEMAVVWMQNQLKQNETQELILNYINELCERLPSPMGESSVDCASLASMPSV  475

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IGGK F+L+P +YILKVGEG+AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFD
Sbjct  476   SFTIGGKSFELTPEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFD  535

Query  202   YGKMRVGFAEAA  167
             Y  +RVGFAEAA
Sbjct  536   YENLRVGFAEAA  547



>ref|XP_009357472.1| PREDICTED: aspartic proteinase-like [Pyrus x bretschneideri]
 ref|XP_009357473.1| PREDICTED: aspartic proteinase-like [Pyrus x bretschneideri]
Length=507

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/491 (70%), Positives = 418/491 (85%), Gaps = 10/491 (2%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQ--DTDIVGLK  1457
             NDG  RIGLK++K+D N+R+AA+LE+K G      +RKY  L    G+ +  D DIV LK
Sbjct  24    NDGLSRIGLKRVKLDSNDRVAAQLESKYG------LRKY-RLPSNLGESESGDVDIVSLK  76

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+GEI +GTPPQ FTVIFDTGS+NLWVPSSKCYFS  C+FH++Y S QS TY+K
Sbjct  77    NYLDAQYYGEIAIGTPPQPFTVIFDTGSANLWVPSSKCYFSFACYFHARYKSGQSKTYKK  136

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NG SA I YGTG+ISGFFS+D+V+VGD+VVK+Q FIEATSEPG+TFL AKFDG+LGLGFQ
Sbjct  137   NGTSASIQYGTGAISGFFSKDNVKVGDIVVKNQDFIEATSEPGLTFLAAKFDGLLGLGFQ  196

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG A      M+ QGL+++P+FSFWLNRN QE+ GGE+VFGGVDP H+KG+HTYVPV
Sbjct  197   EISVGGAVPVWYNMIKQGLIKEPVFSFWLNRNAQEEAGGEIVFGGVDPNHFKGKHTYVPV  256

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T+KGYWQF+MG+VLI G+P+G+C+GGC AIADSGTSL+AGP++++ +IN AIGA GVVS+
Sbjct  257   TKKGYWQFEMGDVLIGGQPSGYCAGGCYAIADSGTSLVAGPTTVVALINRAIGASGVVSQ  316

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL-  560
             ECKAVV  YGQ ++DLL  EA+PKK+CSQIGLCTF+G R VSMGIESVVDE  G S+ + 
Sbjct  317   ECKAVVNQYGQTILDLLFAEAQPKKVCSQIGLCTFDGTRSVSMGIESVVDENGGKSSGIT  376

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
             HDA CSACEM VVWMQ QL  N T++ IL+YVNELC ++P+P+G+S VDCGKLS+MPSVS
Sbjct  377   HDASCSACEMAVVWMQTQLKHNLTEDRILNYVNELCEKMPNPLGQSAVDCGKLSSMPSVS  436

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGKVF+L+P+EYILKVGEGS AQCISGFT +D+PPPRGPLWILGD+FMGRYHTVFD 
Sbjct  437   FTIGGKVFELTPDEYILKVGEGSQAQCISGFTNMDIPPPRGPLWILGDIFMGRYHTVFDA  496

Query  199   GKMRVGFAEAA  167
             GKMRVGFAEAA
Sbjct  497   GKMRVGFAEAA  507



>ref|XP_009353298.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=510

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/493 (71%), Positives = 408/493 (83%), Gaps = 6/493 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
              S  NDG VRIGLKKMKID+   +  R     G ++R      Y+L    G+ +DTDIV 
Sbjct  23    ISTPNDGLVRIGLKKMKIDQTCHLNRRSNGTPGGTIRK-----YHLRSNLGESEDTDIVA  77

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTP QKFTVIFDTGSSNLWVPS+KCYFSV C+ H KY SSQSSTY
Sbjct  78    LKNYMDAQYFGEIGIGTPAQKFTVIFDTGSSNLWVPSAKCYFSVACYLHPKYKSSQSSTY  137

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
              KNGKSA I YGTG+ISGFFSQD VQVGDLVV+ Q FIEAT EPGVTF+ AKFDGILGLG
Sbjct  138   TKNGKSAAIQYGTGAISGFFSQDHVQVGDLVVQDQDFIEATKEPGVTFVAAKFDGILGLG  197

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVGDA      +VNQGLV++P+FSFWLNRN + +EGGE+VFGGVD  H+KGEHTYV
Sbjct  198   FQEISVGDAVPVWYNLVNQGLVKEPVFSFWLNRNTEGEEGGEIVFGGVDSSHFKGEHTYV  257

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+VLI G+ +G+C+ GCSAIADSGTSL+AGP+++IT INHAIGA GVV
Sbjct  258   PVTQKGYWQFDMGDVLIGGESSGYCASGCSAIADSGTSLLAGPTTVITQINHAIGASGVV  317

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+ECK VVE YG+ +I++LV +A+P+KICSQIG CTF+G RGVS GIES+VD+K    +D
Sbjct  318   SQECKIVVEQYGKTIIEMLVAKAQPQKICSQIGFCTFDGTRGVSTGIESMVDQKQEKKSD  377

Query  562   -LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              +HDA C+ACEM VVWMQN+L +NQT+E IL YVN+LC RLPSP GES V+C  LS++PS
Sbjct  378   GVHDATCAACEMAVVWMQNKLMKNQTEEQILDYVNQLCERLPSPSGESVVECDALSSLPS  437

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IG KVFDL+P +Y+LKVGEG AAQCISGF ALD+ PPRGPLWILGDVFMG+YHTVF
Sbjct  438   VSFTIGAKVFDLAPEQYVLKVGEGVAAQCISGFIALDIAPPRGPLWILGDVFMGKYHTVF  497

Query  205   DYGKMRVGFAEAA  167
             DYG   VGFAEAA
Sbjct  498   DYGNSSVGFAEAA  510



>ref|XP_011100273.1| PREDICTED: cyprosin-like [Sesamum indicum]
Length=504

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/493 (72%), Positives = 414/493 (84%), Gaps = 10/493 (2%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS   DG +RIGLKK K+++ NR +  L +K G S         NL G N ++  TDI+ 
Sbjct  21    FSARADGLLRIGLKKRKLNQINRFSETLGSKQGGS--------NNLGGVN-EVSGTDIIS  71

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY+DAQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV C FHSKY SS+SSTY
Sbjct  72    LKNYLDAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACLFHSKYKSSRSSTY  131

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSA IHYGTGSISGFFS+D VQ+G+LVVK Q FIEAT EPG+TFL AKFDGILGLG
Sbjct  132   KKNGKSAAIHYGTGSISGFFSRDHVQLGNLVVKDQDFIEATKEPGITFLAAKFDGILGLG  191

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MVNQGLV+DP+FSFWLNR   E++GGELVFGGVDP H+KGEHTYV
Sbjct  192   FQEISVGNAVPVWYNMVNQGLVKDPVFSFWLNRKGNEEDGGELVFGGVDPNHFKGEHTYV  251

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMGEVLI G+ TGFCSGGCSAIADSGTSL+AGP++++T+INHAIGA GVV
Sbjct  252   PVTQKGYWQFDMGEVLIGGETTGFCSGGCSAIADSGTSLLAGPTTVVTLINHAIGATGVV  311

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGV-SA  566
             S+ECK+VV  YG+ ++++L+ +  P++ICS+IGLC+ +G R VSM IESVVD+ +   S 
Sbjct  312   SQECKSVVSLYGKTILEMLLSKEEPQRICSRIGLCSSDGIRDVSMIIESVVDKDSTKDSY  371

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              LHD MC+AC+M VVWMQNQL  N T+E IL Y+NELC+RLPSPMGES VDC  LS+MP+
Sbjct  372   GLHDEMCTACQMAVVWMQNQLRRNVTEEKILDYINELCDRLPSPMGESAVDCSVLSSMPN  431

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGK FDL+P +Y+LKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMG+YHTVF
Sbjct  432   VSFTIGGKSFDLTPEQYVLKVGEGDAAQCISGFTALDVPPPRGPLWILGDVFMGQYHTVF  491

Query  205   DYGKMRVGFAEAA  167
             DYG M+VGFAEAA
Sbjct  492   DYGNMKVGFAEAA  504



>dbj|BAB20970.1| aspartic proteinase 2 [Nepenthes alata]
Length=514

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/488 (71%), Positives = 412/488 (84%), Gaps = 2/488 (0%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNYM  1448
             D  +R+GLKK K+D+ NR+++    K   S   S+ K+  L    G+  D DI+ LKNYM
Sbjct  28    DRLLRVGLKKRKLDQINRLSSHYGCKGKGSTSPSIWKH-GLGNGLGNSDDADIISLKNYM  86

Query  1447  DAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNGK  1268
             DAQYFGEIG+G+PPQKFTVIFDTGSSNLWVPS+KCYFS+ C+ H KY S +SSTY KNGK
Sbjct  87    DAQYFGEIGIGSPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHPKYKSFKSSTYAKNGK  146

Query  1267  SAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEIS  1088
             SA IHYGTG+ISGFFSQD V++GDLVV++Q FIEAT EP +TF+ AKFDGILGLGFQEIS
Sbjct  147   SAAIHYGTGAISGFFSQDHVKMGDLVVENQDFIEATKEPSITFVAAKFDGILGLGFQEIS  206

Query  1087  VGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQK  908
             VGDA      M++QGLV +P+FSFWLNR  +E+EGGE+VFGGVDP HYKGEHTYVPVT+K
Sbjct  207   VGDAVPAWYNMIDQGLVNEPVFSFWLNRKSEEEEGGEIVFGGVDPNHYKGEHTYVPVTRK  266

Query  907   GYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKECK  728
             GYWQFDM +VL+ G+ TG+CSGGCSAIADSGTSL+AGP++II  INHAIGA G+VS+ECK
Sbjct  267   GYWQFDMDDVLVGGETTGYCSGGCSAIADSGTSLLAGPTTIIVQINHAIGASGLVSQECK  326

Query  727   AVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDA  551
             AVV  YG+ ++D LV EA+P+KICSQIGLCTF+G RGVSMGIESVV++  G S+D L DA
Sbjct  327   AVVSQYGKAILDALVAEAQPQKICSQIGLCTFDGKRGVSMGIESVVEKNPGNSSDGLQDA  386

Query  550   MCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSI  371
             MC+ACEM VVWMQNQL +N+T+E IL+YVNELCNRLPSPMGES VDCG LS+MP+VS +I
Sbjct  387   MCTACEMAVVWMQNQLRQNRTEEQILNYVNELCNRLPSPMGESSVDCGSLSSMPNVSLTI  446

Query  370   GGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKM  191
             GGKVFDLSP +Y+LKVGEG AAQCISGF ALD+ PPRGPLWILGD+FMG+YHTVFDYG +
Sbjct  447   GGKVFDLSPEKYVLKVGEGVAAQCISGFIALDIAPPRGPLWILGDIFMGQYHTVFDYGNL  506

Query  190   RVGFAEAA  167
              VGFAEAA
Sbjct  507   SVGFAEAA  514



>ref|XP_002886481.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62740.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=513

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/491 (70%), Positives = 414/491 (84%), Gaps = 3/491 (1%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S+ NDG  R+GLKK+K+D NNR+A R  +K  ++LR+S+  Y N  G   D  D DIV L
Sbjct  24    SQRNDGTFRVGLKKLKLDPNNRLATRFGSKQEEALRSSLPSYNNNLGS--DSGDADIVPL  81

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KC+FS+ CFFH+K+ SS+SSTY+
Sbjct  82    KNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFFSLSCFFHAKFKSSRSSTYK  141

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             K+GK A IHYG+GSISGFFS D+V VGDLVVK Q FIEATSEPG+TFLVAKFDG+LGLGF
Sbjct  142   KSGKRAAIHYGSGSISGFFSYDAVTVGDLVVKDQEFIEATSEPGLTFLVAKFDGLLGLGF  201

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEI+VG+A      M+ QGL++ P+FSFWLNR+P+ +EGGE+VFGGVDPKH+KGEHT+VP
Sbjct  202   QEIAVGNATPVWYNMLKQGLIERPVFSFWLNRDPKSEEGGEIVFGGVDPKHFKGEHTFVP  261

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQ+GYWQFDMGEVLI G  TG+C  GCSAIADSGTSL+AGP+++I MIN AIGA GVVS
Sbjct  262   VTQRGYWQFDMGEVLIAGDSTGYCGSGCSAIADSGTSLLAGPTAVIAMINKAIGASGVVS  321

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-  563
             ++CK VV+ YGQ ++DLL+ E +PKKICSQIGLC F+G  GVSMGIESVVD++N  S+  
Sbjct  322   QQCKTVVDQYGQTILDLLLAETQPKKICSQIGLCAFDGTHGVSMGIESVVDKENTRSSSG  381

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             L DA C ACEM V+W+Q+QL +N TQE I++Y+NE+C R+PSP GES VDC +LS MP+V
Sbjct  382   LRDAGCPACEMAVMWIQSQLRQNMTQERIVNYINEICERMPSPNGESAVDCSQLSKMPTV  441

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IGGKVFDL+P EY+LK+GEG  AQCISGFTALDVPPPRGPLWILGDVFMG+YHTVFD
Sbjct  442   SFTIGGKVFDLAPEEYVLKIGEGPVAQCISGFTALDVPPPRGPLWILGDVFMGKYHTVFD  501

Query  202   YGKMRVGFAEA  170
             +G  +VGFAEA
Sbjct  502   FGNEQVGFAEA  512



>ref|XP_007049084.1| Aspartic proteinase A1 isoform 1 [Theobroma cacao]
 gb|EOX93241.1| Aspartic proteinase A1 isoform 1 [Theobroma cacao]
Length=550

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/529 (68%), Positives = 412/529 (78%), Gaps = 38/529 (7%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS  N+G VRIGL K K+D+ NR+A  +++K G   R  +RKY+ L G  G   D++IV 
Sbjct  23    FSVPNEGMVRIGLIKKKLDQINRVAGDIDSKEGKLSRTPLRKYH-LQGNLGASDDSEIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTP Q FTVIFDTGSSNLWVPSSKCYFSV C+FHSKY SSQSSTY
Sbjct  82    LKNYMDAQYFGEIGIGTPSQTFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSQSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNG SA I YGTG+ISGFFSQDSV+VGDLVV +Q FIEAT EPG+TFL AKFDGI GLG
Sbjct  142   QKNGTSAAIQYGTGAISGFFSQDSVKVGDLVVNNQDFIEATREPGITFLAAKFDGIFGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      MVNQGLV++P+FSFWLNR  + +EGGE+VFGG+D  HYKGEHTYV
Sbjct  202   FQEISVGGAVPVWYNMVNQGLVKEPVFSFWLNRKIEGEEGGEIVFGGIDSNHYKGEHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPS----------------  791
             PVTQKGYWQFDMG+VL+ G  TGFCS GC+AIADSGTSL+AGP+                
Sbjct  262   PVTQKGYWQFDMGDVLVGGATTGFCSSGCAAIADSGTSLLAGPTLIYDFYALLDLLKLSI  321

Query  790   --------------------SIITMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEAR  671
                                 +IIT INHAIGA GVVS+ECKA+V  YG+ +++LLV E +
Sbjct  322   VSFLKQFYSDAERLCRSNMWTIITQINHAIGASGVVSQECKAIVSQYGKMILELLVSETQ  381

Query  670   PKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSEN  494
             P+KICSQIG CTF+G RGVS  IESV DE  G S+D +HDAMC+ACEM VVWMQN+L  N
Sbjct  382   PQKICSQIGFCTFDGTRGVSTRIESVADEIVGKSSDGVHDAMCTACEMAVVWMQNKLRRN  441

Query  493   QTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEG  314
             +T+E IL YVNELC RLPSP GES VDC  LS+MP VSF+IGGKVFDL+P EY+LKVGEG
Sbjct  442   ETEEQILDYVNELCERLPSPNGESVVDCSSLSSMPGVSFTIGGKVFDLAPEEYVLKVGEG  501

Query  313   SAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  167
             + AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG M VGFAEAA
Sbjct  502   AVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNMTVGFAEAA  550



>ref|XP_003534602.1| PREDICTED: aspartic proteinase [Glycine max]
 gb|KHN40871.1| Aspartic proteinase [Glycine soja]
Length=507

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/493 (70%), Positives = 410/493 (83%), Gaps = 9/493 (2%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             F   NDG  RIGLKK+K++ +       + +     R+S+RK++ L    G  ++TD+V 
Sbjct  23    FCAPNDGLGRIGLKKVKLNTH-------DVEGLKEFRSSIRKHH-LQNILGGAEETDVVA  74

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFS+ CF H++Y SSQSSTY
Sbjct  75    LKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACFMHARYRSSQSSTY  134

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
              +NG SA I YGTG+ISGFFS D V+VGD+VVK Q FIEAT EPGVTF+ AKFDGILGLG
Sbjct  135   RENGTSAAIQYGTGAISGFFSNDDVKVGDIVVKDQEFIEATREPGVTFVAAKFDGILGLG  194

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQ+ISVG A      MV QGLV+DP+FSFWLNR P+E+ GGELVFGG DP HYKG+HTYV
Sbjct  195   FQDISVGYAVPVWYSMVEQGLVKDPVFSFWLNRKPEEENGGELVFGGADPAHYKGKHTYV  254

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+VLI GKPTG+C+  CSAIADSGTSL+AGP++++TMIN AIGA GVV
Sbjct  255   PVTRKGYWQFDMGDVLIAGKPTGYCADDCSAIADSGTSLLAGPTTVVTMINQAIGASGVV  314

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSA  566
             SKEC++VV  YGQ +++LL+ EA+PKKICSQIGLCTF+G  GVSMGIESVVD+ +   S 
Sbjct  315   SKECRSVVNQYGQTILELLLAEAKPKKICSQIGLCTFDGTHGVSMGIESVVDKNERKSSG  374

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              + DA CSACEM V+WMQNQL +NQT++ I+ Y NELC++LP+PMG+S VDC KLS+MP 
Sbjct  375   SIRDAGCSACEMAVIWMQNQLRQNQTEDRIIDYANELCDKLPNPMGQSSVDCEKLSSMPI  434

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGGKVFDLSP EYILKVGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHT+F
Sbjct  435   VSFTIGGKVFDLSPQEYILKVGEGPEAQCISGFTALDVPPPRGPLWILGDVFMGRYHTIF  494

Query  205   DYGKMRVGFAEAA  167
             DYGK+RVGFAEAA
Sbjct  495   DYGKLRVGFAEAA  507



>ref|XP_009347130.1| PREDICTED: aspartic proteinase A1-like [Pyrus x bretschneideri]
Length=512

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/495 (71%), Positives = 409/495 (83%), Gaps = 8/495 (2%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
              S  NDG VRIGLKKMKID+   +  R     G ++R      Y+L    G+ +DTDIV 
Sbjct  23    ISTPNDGLVRIGLKKMKIDQTCHLNRRSNGTPGGTIRK-----YHLRSNLGESEDTDIVA  77

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTP QKFTVIFDTGSSNLWVPS+KCYFSV C+ H KY SSQSSTY
Sbjct  78    LKNYMDAQYFGEIGIGTPAQKFTVIFDTGSSNLWVPSAKCYFSVACYLHPKYKSSQSSTY  137

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPG--VTFLVAKFDGILG  1109
              KNGKSA I YGTG+ISGFFSQD VQVGDLVV+ Q FIEAT EPG  VTF+ AKFDGILG
Sbjct  138   TKNGKSAAIQYGTGAISGFFSQDHVQVGDLVVQDQDFIEATKEPGPGVTFVAAKFDGILG  197

Query  1108  LGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHT  929
             LGFQEISVGDA      +VNQGLV++P+FSFWLNRN + +EGGE+VFGGVD  H+KGEHT
Sbjct  198   LGFQEISVGDAVPVWYNLVNQGLVKEPVFSFWLNRNTEGEEGGEIVFGGVDSSHFKGEHT  257

Query  928   YVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADG  749
             YVPVTQKGYWQFDMG+VLI G+ +G+C+ GCSAIADSGTSL+AGP+++IT INHAIGA G
Sbjct  258   YVPVTQKGYWQFDMGDVLIGGESSGYCASGCSAIADSGTSLLAGPTTVITQINHAIGASG  317

Query  748   VVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS  569
             VVS+ECK VVE YG+ +I++LV +A+P+KICSQIG CTF+G RGVS GIES+VD+K    
Sbjct  318   VVSQECKIVVEQYGKTIIEMLVAKAQPQKICSQIGFCTFDGTRGVSTGIESMVDQKQEKK  377

Query  568   AD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             +D +HDA C+ACEM VVWMQN+L +NQT+E IL YVN+LC RLPSP GES V+C  LS++
Sbjct  378   SDGVHDATCAACEMAVVWMQNKLMKNQTEEQILDYVNQLCERLPSPSGESVVECDALSSL  437

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             PSVSF+IG KVFDL+P +Y+LKVGEG AAQCISGF ALD+ PPRGPLWILGDVFMG+YHT
Sbjct  438   PSVSFTIGAKVFDLAPEQYVLKVGEGVAAQCISGFIALDIAPPRGPLWILGDVFMGKYHT  497

Query  211   VFDYGKMRVGFAEAA  167
             VFDYG + VGFAEAA
Sbjct  498   VFDYGNLSVGFAEAA  512



>ref|XP_010418210.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418211.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418212.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
 ref|XP_010418213.1| PREDICTED: aspartic proteinase A2 isoform X1 [Camelina sativa]
Length=514

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/494 (70%), Positives = 416/494 (84%), Gaps = 4/494 (1%)
 Frame = -2

Query  1645  AFSKSND-GFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDI  1469
             A S+SND G +R+GLKK+K+D NNR+A R  +   ++LR+S R Y N  G  GD  D DI
Sbjct  22    ATSESNDDGTIRVGLKKLKLDPNNRLATRFGSSQEEALRSSFRSYNNNLG--GDSGDADI  79

Query  1468  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSS  1289
             V LKNY+DAQY+GEI +GTPPQKFTVIFDTGS+NLWVPS KC+ S+ CFFH+KY SS+SS
Sbjct  80    VALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSANLWVPSGKCFLSISCFFHAKYKSSRSS  139

Query  1288  TYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILG  1109
             TY+K+GK A IHYG+GSISGFFS D+V VGDLVVK Q FIEATSEPG+TF+VAKFDG+LG
Sbjct  140   TYKKDGKRAAIHYGSGSISGFFSYDAVTVGDLVVKDQEFIEATSEPGITFVVAKFDGLLG  199

Query  1108  LGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHT  929
             LGFQEISVG+A      M+ QGL++ P+FSFWLNR+P+ +EGGE+VFGGVDP H++GEHT
Sbjct  200   LGFQEISVGNATPVWYNMLTQGLIKKPVFSFWLNRDPKSEEGGEIVFGGVDPNHFRGEHT  259

Query  928   YVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADG  749
             YVPVTQ+GYWQFDMGEVLI G+ TG+C  GCSAIADSGTSL+AGP+++I MIN AIGA G
Sbjct  260   YVPVTQRGYWQFDMGEVLIAGESTGYCGSGCSAIADSGTSLLAGPTAVIAMINKAIGASG  319

Query  748   VVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-GV  572
             VVS++CK VV+ YGQ ++DLL+ E +P+KICSQIGLC F+G +GVSMGI+SVVD++N   
Sbjct  320   VVSQQCKTVVDQYGQIILDLLLAETQPQKICSQIGLCGFDGTQGVSMGIDSVVDKENMKS  379

Query  571   SADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             S+ L  A C  CEM VVW+Q+QL +N TQE I++YVNE+C R+P+P GES VDC KLSTM
Sbjct  380   SSGLRGAGCPPCEMAVVWIQSQLRQNMTQERIVNYVNEICERMPNPNGESAVDCSKLSTM  439

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P+VSF+IGGKVFDL+P EYILK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMG+YHT
Sbjct  440   PTVSFTIGGKVFDLAPEEYILKIGEGPVAQCISGFTALDIPPPRGPLWILGDVFMGKYHT  499

Query  211   VFDYGKMRVGFAEA  170
             VFD+G  RVGFAEA
Sbjct  500   VFDFGNERVGFAEA  513



>ref|XP_010430270.1| PREDICTED: aspartic proteinase A2-like [Camelina sativa]
Length=514

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/494 (70%), Positives = 415/494 (84%), Gaps = 4/494 (1%)
 Frame = -2

Query  1645  AFSKSND-GFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDI  1469
             A S+SND G  R+GLKK+K+D NNR+A R  +   ++LR+S R Y N  G  GD  D DI
Sbjct  22    ATSESNDDGTFRVGLKKLKLDPNNRLATRFGSNQEEALRSSFRSYNNNLG--GDSGDADI  79

Query  1468  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSS  1289
             V LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KC+ S+ CFFH+KY SS+SS
Sbjct  80    VALKNYLDAQYYGEISIGTPPQKFTVIFDTGSSNLWVPSGKCFLSLSCFFHAKYKSSRSS  139

Query  1288  TYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILG  1109
             TY+K+G+ A IHYG+GSISGFFS D+V VGDLVVK Q FIEATSEPG+TF+VAKFDG+LG
Sbjct  140   TYKKSGERAAIHYGSGSISGFFSYDAVTVGDLVVKDQEFIEATSEPGITFVVAKFDGLLG  199

Query  1108  LGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHT  929
             LGFQEISVG+A      M+ QGL++ P+FSFWLNR+P+ +EGGE+VFGGVDP H++GEHT
Sbjct  200   LGFQEISVGNATPVWYNMLTQGLIKKPVFSFWLNRDPKSEEGGEIVFGGVDPNHFRGEHT  259

Query  928   YVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADG  749
             YVPVTQ+GYWQFDMGEVLI+ + TG+C  GCSAIADSGTSL+AGP+++I MIN AIGA G
Sbjct  260   YVPVTQRGYWQFDMGEVLIDRESTGYCGSGCSAIADSGTSLLAGPTAVIAMINKAIGASG  319

Query  748   VVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-GV  572
             VVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLC F+G  GVSMGIESVVD++N   
Sbjct  320   VVSQQCKTVVDQYGQIILDLLLAETQPKKICSQIGLCDFDGTEGVSMGIESVVDKENMKS  379

Query  571   SADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             S+ L  A C  CEM VVW+Q+QL +N TQE I++YVNE+C R+P+P GES VDC KLSTM
Sbjct  380   SSGLRGAGCPPCEMAVVWIQSQLRQNMTQERIVNYVNEICERMPNPNGESAVDCSKLSTM  439

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P+VSF+IGGKVFDL+P EYILK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMG+YHT
Sbjct  440   PTVSFTIGGKVFDLAPEEYILKIGEGPVAQCISGFTALDIPPPRGPLWILGDVFMGKYHT  499

Query  211   VFDYGKMRVGFAEA  170
             VFD+GK RVGFAEA
Sbjct  500   VFDFGKERVGFAEA  513



>gb|KDO62072.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=492

 Score =   733 bits (1893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/466 (74%), Positives = 400/466 (86%), Gaps = 2/466 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS  N G  RIGLKK K D NNR+AARL++K G+S R S+RKY +L G  G+  D DIV 
Sbjct  23    FSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKY-SLRGNLGESGDADIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHSKY S +SSTY
Sbjct  82    LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSA+IHYGTG+ISGFFS+D V++GDLVVK Q FIEAT EP +TFL+AKFDGILGLG
Sbjct  142   KKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      MVNQGLV +P+FSFW NRN  E+EGGE+VFGG+DP HYKGEHTYV
Sbjct  202   FQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEEEGGEIVFGGMDPDHYKGEHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+V+I+G+ TGFC+GGC+AIADSGTSL+AGP++IIT +NHAIGA G+V
Sbjct  262   PVTQKGYWQFDMGDVMIDGQTTGFCAGGCAAIADSGTSLLAGPTTIITQVNHAIGATGIV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S+ECKAVV  YG+ +I++L+ +  P+KICSQIGLCTF+G+RGVSMGIESVV E N   S 
Sbjct  322   SQECKAVVSQYGEEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGIESVVPENNHRASG  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
               HDAMCS CEM VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGES VDC +LS++P 
Sbjct  382   GFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGESAVDCSRLSSLPI  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  248
             VSF+IGGK+FDL+P++YILKVGEG AAQCISGF+ALDV PPRGPLW
Sbjct  442   VSFTIGGKIFDLTPDQYILKVGEGDAAQCISGFSALDVAPPRGPLW  487



>ref|XP_008342027.1| PREDICTED: aspartic proteinase A1-like [Malus domestica]
Length=538

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/492 (71%), Positives = 410/492 (83%), Gaps = 6/492 (1%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S  +DG VRIGLKKMKID+   +  R     G  +R      Y+L G  G+ +DTDIV L
Sbjct  52    STPSDGLVRIGLKKMKIDQTCHLNRRNNGTPGGPIRK-----YHLRGNLGESEDTDIVAL  106

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQYFGEIG+GTP QKFTVIFDTGSSNLWVPS+KCYFSV C+ H KY SSQSSTY 
Sbjct  107   KNYMDAQYFGEIGIGTPAQKFTVIFDTGSSNLWVPSAKCYFSVACYLHPKYKSSQSSTYT  166

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGKSA I YGTG+ISGFFSQD +QVGDLVVK Q FIEAT EPGVTF+ AKFDGILGLGF
Sbjct  167   KNGKSAAIQYGTGAISGFFSQDHIQVGDLVVKDQDFIEATKEPGVTFVAAKFDGILGLGF  226

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVGDA      +VNQGLV++P+FSFWLNRN + +EGGE+VFGGVD  H+KG+HTYVP
Sbjct  227   QEISVGDAVPVWYNLVNQGLVKEPVFSFWLNRNTEGEEGGEIVFGGVDSSHFKGKHTYVP  286

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQFDMG+VLI+G+ +GFC+ GCSAIADSGTSL+AGP++++T INHAIGA GVVS
Sbjct  287   VTQKGYWQFDMGDVLIDGESSGFCANGCSAIADSGTSLLAGPTTVVTQINHAIGASGVVS  346

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-  563
             +ECK VVE YG+ +I++L+ +++P+K+CSQIG CTF+G RGVS GIES+VD+K    +D 
Sbjct  347   QECKTVVEQYGKTIIEMLMAKSQPQKVCSQIGFCTFDGTRGVSTGIESMVDQKPEKQSDG  406

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             ++DA C+ACEM VVWMQ++L +NQT+E IL YVN+LC RLPSP GES V C  LS++PSV
Sbjct  407   VNDATCAACEMAVVWMQSRLRKNQTEEQILDYVNQLCERLPSPSGESVVQCDALSSLPSV  466

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IGGKVFDL+P +YILKVGEG AAQCISGF ALDV PPRGPLWILGD+FMGRYHTVFD
Sbjct  467   SFTIGGKVFDLAPEQYILKVGEGVAAQCISGFIALDVAPPRGPLWILGDIFMGRYHTVFD  526

Query  202   YGKMRVGFAEAA  167
             YG + VGFAEAA
Sbjct  527   YGNLSVGFAEAA  538



>gb|KHN35722.1| Aspartic proteinase [Glycine soja]
Length=514

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/493 (71%), Positives = 419/493 (85%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             +   NDG  RIGLKK+K+D  NR+AAR+ +K  DS RAS+RK++ L    G  ++TDIV 
Sbjct  23    YCAPNDGLRRIGLKKIKLDPKNRLAARIGSKDVDSFRASIRKFH-LQNNFGGSEETDIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY+DAQY+GEI +GT PQKFTVIFDTGSSNLWVPSSKC FSV C+FH+KY SS+SSTY
Sbjct  82    LKNYLDAQYYGEIAIGTSPQKFTVIFDTGSSNLWVPSSKCTFSVACYFHAKYKSSKSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNG +A I YGTG+ISGFFS DSV+VGD+ VK+Q FIEAT EPGVTFL AKFDGILGLG
Sbjct  142   KKNGTAAAIQYGTGAISGFFSYDSVRVGDIFVKNQEFIEATREPGVTFLAAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MV+QGL+++P+FSFW NR P+E+EGGE+VFGGVDP HYKG+HTYV
Sbjct  202   FQEISVGNAVPVWYNMVDQGLIKEPVFSFWFNRKPEEEEGGEIVFGGVDPAHYKGKHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+VLI GKPTG+C+ GCSAIADSGTSL+AGP+++ITMINHAIGA GV+
Sbjct  262   PVTRKGYWQFDMGDVLIGGKPTGYCADGCSAIADSGTSLLAGPTTVITMINHAIGASGVM  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSA  566
             S+ECK VV  YGQ ++DLL+ E +PKKICS+IGLC F+G RGV +GI+SVVDE +   S 
Sbjct  322   SQECKTVVAEYGQTILDLLLSETQPKKICSRIGLCAFDGTRGVDVGIKSVVDENERKSSG  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
               H A C ACEM VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGES VDCG +S++P 
Sbjct  382   GHHGAACPACEMAVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGESAVDCGNISSLPV  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGG+ FDLSP EYILKVGEG  AQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVF
Sbjct  442   VSFTIGGRTFDLSPEEYILKVGEGPVAQCISGFTAIDIPPPRGPLWILGDVFMGRYHTVF  501

Query  205   DYGKMRVGFAEAA  167
             D+GK RVGFA+AA
Sbjct  502   DFGKQRVGFADAA  514



>ref|XP_003567869.1| PREDICTED: phytepsin [Brachypodium distachyon]
Length=505

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/490 (71%), Positives = 405/490 (83%), Gaps = 13/490 (3%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRN--GDLQDTDIVGLKN  1454
             +G VRI LKK  ID+NNR+A RL  + G           +L G N  G   + DIV L+N
Sbjct  26    EGLVRIALKKRPIDQNNRVATRLSGEEGQ----------HLGGANSLGSEDEGDIVALQN  75

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YM+AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFS+ C+FHS+Y + QSSTY+KN
Sbjct  76    YMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYFHSRYKAGQSSTYKKN  135

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GK A I YGTGSI+G+FS+DSV VGDLVVK Q FIEAT EPGVTF+VAKFDGILGLGFQE
Sbjct  136   GKPAAIQYGTGSIAGYFSEDSVTVGDLVVKDQEFIEATKEPGVTFMVAKFDGILGLGFQE  195

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG A      M+ QGL+ DP+FSFW NR+  E EGGE+VFGG+DPKHY GEHTYVPVT
Sbjct  196   ISVGKAVPVWYKMIEQGLISDPVFSFWFNRHAGEGEGGEIVFGGMDPKHYIGEHTYVPVT  255

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQFDMG+VL+ GK TGFC+GGC+AIADSGTSL+AGP++IIT IN  IGA GVVS+E
Sbjct  256   QKGYWQFDMGDVLVGGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINEKIGAAGVVSQE  315

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-  557
             CK VV  YGQ+++DLL+ E +PKKICSQ+GLCTF+G RGVS GI SVVD++   S  LH 
Sbjct  316   CKTVVSQYGQQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGIRSVVDDEAEKSNGLHS  375

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             D MC+ACEM VVWMQNQLS+N+TQ+ IL+Y+N+LC+RLPSPMGES VDCG L++MP + F
Sbjct  376   DPMCNACEMAVVWMQNQLSQNKTQDVILNYINQLCDRLPSPMGESSVDCGSLASMPEIEF  435

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK F L P EYILKVGEG AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYG
Sbjct  436   TIGGKKFALKPEEYILKVGEGPAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVFDYG  495

Query  196   KMRVGFAEAA  167
             K+RVGFA+AA
Sbjct  496   KLRVGFAKAA  505



>ref|XP_006654801.1| PREDICTED: aspartic proteinase oryzasin-1-like [Oryza brachyantha]
Length=509

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/492 (71%), Positives = 409/492 (83%), Gaps = 5/492 (1%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             + + +G VRI LKK  ID+N+R+AA+L  + G + R  +R   +L G      + DIV L
Sbjct  22    ASAAEGLVRIALKKRPIDENSRVAAQLSGEEG-ARRLGLRGANSLGGGG---SEGDIVAL  77

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYM+AQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFS+ CFFHS+Y S QSSTY+
Sbjct  78    KNYMNAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACFFHSRYKSGQSSTYQ  137

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A I YGTGSI+GFFS+DSV VGDLVVK Q FIEAT EPG+TF+VAKFDGILGLGF
Sbjct  138   KNGKPAAIQYGTGSIAGFFSEDSVTVGDLVVKDQEFIEATKEPGLTFMVAKFDGILGLGF  197

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVGDA      MV QGLV DP+FSFW NR+  E EGGE+VFGG+DP HYK  HTYVP
Sbjct  198   QEISVGDAVPVWYKMVEQGLVSDPVFSFWFNRHSDEGEGGEIVFGGMDPSHYKSNHTYVP  257

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQF+MG+VLI GK TGFC+ GCSAIADSGTSL+AGP++IIT IN  IGA GVVS
Sbjct  258   VTQKGYWQFEMGDVLIGGKTTGFCASGCSAIADSGTSLLAGPTAIITEINEKIGATGVVS  317

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS  I+SVVD++ G S  L
Sbjct  318   QECKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSAEIKSVVDDEAGKSNGL  377

Query  559   H-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             H DAMC+ACEM VVWMQNQL++N+TQ+ IL+Y+N+LC++LPSPMGES VDCG L++MP +
Sbjct  378   HSDAMCNACEMAVVWMQNQLAQNKTQDRILNYINQLCDKLPSPMGESSVDCGSLASMPEI  437

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             +F+IGGK F L P +YILKVGEG AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFD
Sbjct  438   AFTIGGKQFALKPEQYILKVGEGPAAQCISGFTAMDIPPPRGPLWILGDVFMGAYHTVFD  497

Query  202   YGKMRVGFAEAA  167
             YGKMRVGFA++A
Sbjct  498   YGKMRVGFAKSA  509



>ref|XP_010046321.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 ref|XP_010046325.1| PREDICTED: aspartic proteinase A1-like [Eucalyptus grandis]
 gb|KCW88765.1| hypothetical protein EUGRSUZ_A01109 [Eucalyptus grandis]
 gb|KCW88766.1| hypothetical protein EUGRSUZ_A01109 [Eucalyptus grandis]
Length=514

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/493 (72%), Positives = 420/493 (85%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS S++G +R+GLKK K+D+ NR+AA+  +K  ++L    RKY   HG NG+  DTDIV 
Sbjct  23    FSSSDNGLIRVGLKKRKLDQLNRVAAQRYSKERETLGGLGRKY-KFHGYNGEDDDTDIVS  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQY+GEIG+GTP QKFTV+FDTGSSNLWVPSSKCYFS+ C+ HSKY SS+SS+Y
Sbjct  82    LKNYMDAQYYGEIGIGTPAQKFTVVFDTGSSNLWVPSSKCYFSIACYLHSKYKSSESSSY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSA+IHYG+G+I+GFFSQD+V+VGDLV+K Q FIEAT EPG+TF+ AKFDGILGLG
Sbjct  142   KKNGKSADIHYGSGAIAGFFSQDNVKVGDLVIKKQEFIEATKEPGLTFVAAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MVNQGLV +P+FSFWLNRN +  EGGELVFGGVD  HYKGEHTYV
Sbjct  202   FQEISVGNAVPLWYNMVNQGLVPEPVFSFWLNRNTKGDEGGELVFGGVDSSHYKGEHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+VLI+G+ TGFC  GCSAIADSGTSL+AGP+++IT INHAIGA GVV
Sbjct  262   PVTQKGYWQFDMGDVLIDGETTGFCGSGCSAIADSGTSLLAGPTTVITQINHAIGASGVV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSA  566
             S+ECK VV  YG+ ++++L+ EA+P+KICSQ+G CTF+G  GV MGIESVVD+ ++  S 
Sbjct  322   SQECKMVVGQYGKTILEMLLAEAQPQKICSQVGFCTFDGTHGVRMGIESVVDKNEHKSSG  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L D MC+ACEM VVWMQNQL +NQT+E IL YVN+LC RLPSPMGES VDC +LS++PS
Sbjct  382   GLGDGMCTACEMAVVWMQNQLRKNQTEEQILDYVNQLCERLPSPMGESVVDCSELSSLPS  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VS +IGGKVFDL+P EY+L+VGEG AAQC+SGF ALDV PPRGPLWILGDVFMGRYHTVF
Sbjct  442   VSLTIGGKVFDLAPEEYVLQVGEGVAAQCVSGFIALDVAPPRGPLWILGDVFMGRYHTVF  501

Query  205   DYGKMRVGFAEAA  167
             DYG M+VGFAEAA
Sbjct  502   DYGNMQVGFAEAA  514



>ref|XP_006391910.1| hypothetical protein EUTSA_v10023414mg [Eutrema salsugineum]
 gb|ESQ29196.1| hypothetical protein EUTSA_v10023414mg [Eutrema salsugineum]
Length=511

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/491 (70%), Positives = 412/491 (84%), Gaps = 6/491 (1%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             + NDG  RIGLKK+K+D NNR+AAR  +K  + L+  +R   NL G +GD    DIV LK
Sbjct  26    ERNDGTFRIGLKKLKLDPNNRLAARFGSKQ-EELK-EIRSNNNLLGDSGD---ADIVALK  80

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KCYFS+ CFFH+KY SS SSTY+K
Sbjct  81    NYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFSLSCFFHAKYRSSLSSTYKK  140

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YG+GS+SGFFS D+V VGDLVV+ Q FIEATSEPG+TFLV KFDG+LGLGFQ
Sbjct  141   NGKRAAIRYGSGSVSGFFSYDAVTVGDLVVQDQEFIEATSEPGLTFLVGKFDGLLGLGFQ  200

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG+A      M+NQGL++ P+FSFWLNR+ + +EGGE+VFGGVDPKH+KGEHTYVPV
Sbjct  201   EISVGNATPVWYNMLNQGLIKKPLFSFWLNRDIESEEGGEIVFGGVDPKHFKGEHTYVPV  260

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             TQ+GYWQFDMGEVLI GK TG+C  GCSAIADSGTSLIAGP++++ MIN AIGA GVVS+
Sbjct  261   TQRGYWQFDMGEVLIAGKSTGYCESGCSAIADSGTSLIAGPTTVVAMINKAIGASGVVSQ  320

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-L  560
             +CK VV+ YGQ ++ LL+ E +PKKICSQIG+CTF+G  GVSMGIESVVD+++  S   L
Sbjct  321   QCKTVVDQYGQTILSLLLAETQPKKICSQIGVCTFDGTHGVSMGIESVVDKEDTKSPRGL  380

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
              DA C ACEM VVW+Q+QL +N TQE I++Y+N++C R+PSP GES VDC +LSTMP+VS
Sbjct  381   RDAGCVACEMAVVWIQSQLKQNMTQERIVNYINDICERMPSPNGESAVDCSQLSTMPTVS  440

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGKVFDL+P EY+LK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMGRYHTVFD+
Sbjct  441   FTIGGKVFDLAPEEYVLKIGEGPVAQCISGFTALDIPPPRGPLWILGDVFMGRYHTVFDF  500

Query  199   GKMRVGFAEAA  167
             G  +VGFAEAA
Sbjct  501   GNEQVGFAEAA  511



>emb|CBI23210.3| unnamed protein product [Vitis vinifera]
Length=429

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/429 (80%), Positives = 386/429 (90%), Gaps = 1/429 (0%)
 Frame = -2

Query  1450  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNG  1271
             MDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFSVPC+FHSKY SSQSSTY KNG
Sbjct  1     MDAQYFGEIGIGTPPQTFTVIFDTGSSNLWVPSSKCYFSVPCYFHSKYKSSQSSTYRKNG  60

Query  1270  KSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEI  1091
             KSA+IHYGTG+ISGFFS+D+V+VGDLVVK+Q FIEAT EP VTFLVAKFDGILGLGFQEI
Sbjct  61    KSADIHYGTGAISGFFSEDNVKVGDLVVKNQEFIEATREPSVTFLVAKFDGILGLGFQEI  120

Query  1090  SVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQ  911
             SVG+A      MV QGLV++P+FSFWLNR   + EGGELVFGGVDP H+KGEHTYVPVTQ
Sbjct  121   SVGNAVPVWYNMVKQGLVKEPVFSFWLNRKTDDDEGGELVFGGVDPDHFKGEHTYVPVTQ  180

Query  910   KGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKEC  731
             KGYWQFDMGEVLI+G+ TG+C+GGC+AIADSGTSL+AGP++++ MINHAIGA GVVS+EC
Sbjct  181   KGYWQFDMGEVLIDGETTGYCAGGCAAIADSGTSLLAGPTAVVAMINHAIGATGVVSQEC  240

Query  730   KAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLHD  554
             K VV  YG+ ++DLL+ EA P+KICSQIGLCTF+G RGV MGIESVVDEKNG  S+ +HD
Sbjct  241   KTVVAQYGETIMDLLLSEASPQKICSQIGLCTFDGTRGVGMGIESVVDEKNGDKSSGVHD  300

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
             A CSACEM VVWMQ+QL +NQT+E IL YVNELC+RLPSPMGES VDC +LS+MP+VS +
Sbjct  301   AGCSACEMAVVWMQSQLRQNQTKERILEYVNELCDRLPSPMGESAVDCLQLSSMPNVSLT  360

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IGGKVFDLS NEY+LKVGEG+AAQCISGF A+DVPPPRGPLWILGDVFMGRYHTVFDYG 
Sbjct  361   IGGKVFDLSANEYVLKVGEGAAAQCISGFIAMDVPPPRGPLWILGDVFMGRYHTVFDYGN  420

Query  193   MRVGFAEAA  167
             MRVGFAEAA
Sbjct  421   MRVGFAEAA  429



>ref|XP_003529645.1| PREDICTED: aspartic proteinase-like isoform X1 [Glycine max]
 ref|XP_006584085.1| PREDICTED: aspartic proteinase-like isoform X2 [Glycine max]
Length=514

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/493 (71%), Positives = 419/493 (85%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             +   NDG  RIGLKK+K+D  NR+AAR+ +K  DS RAS+RK++ L    G  ++TDIV 
Sbjct  23    YCAPNDGLRRIGLKKIKLDPKNRLAARIGSKDVDSFRASIRKFH-LQNNFGGSEETDIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY+DAQY+GEI +GT PQKFTVIFDTGSSNLWVPSSKC FSV C+FH+KY SS+SSTY
Sbjct  82    LKNYLDAQYYGEIAIGTSPQKFTVIFDTGSSNLWVPSSKCTFSVACYFHAKYKSSKSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNG +A I YGTG+ISGFFS DSV+VGD+ VK+Q FIEAT EPGVTFL AKFDGILGLG
Sbjct  142   KKNGTAAAIQYGTGAISGFFSYDSVRVGDIFVKNQEFIEATREPGVTFLAAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MV+QGL+++P+FSFW NR P+E+EGGE+VFGGVDP HYKG+HTYV
Sbjct  202   FQEISVGNAVPVWYNMVDQGLIKEPVFSFWFNRKPEEEEGGEIVFGGVDPAHYKGKHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+VLI GKPTG+C+ GCSAIADSGTSL+AGP+++ITMINHAIGA GV+
Sbjct  262   PVTRKGYWQFDMGDVLIGGKPTGYCADGCSAIADSGTSLLAGPTTVITMINHAIGASGVM  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSA  566
             S+ECK VV  YGQ ++DLL+ E +PKKICS+IGLC F+G RGV +GI+SVVDE +   S 
Sbjct  322   SQECKTVVAEYGQTILDLLLSETQPKKICSRIGLCAFDGTRGVDVGIKSVVDENERKSSG  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
               H A C ACEM VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGES VDCG +S++P 
Sbjct  382   GHHGAACPACEMAVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGESAVDCGNISSLPV  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGG+ F+LSP EYILKVGEG  AQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVF
Sbjct  442   VSFTIGGRTFELSPEEYILKVGEGPVAQCISGFTAIDIPPPRGPLWILGDVFMGRYHTVF  501

Query  205   DYGKMRVGFAEAA  167
             D+GK RVGFA+AA
Sbjct  502   DFGKQRVGFADAA  514



>ref|XP_009395027.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009395028.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/491 (70%), Positives = 405/491 (82%), Gaps = 3/491 (1%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S + DG +RIGL+K  +D+N+R+A RL  K G +L     +Y    G   + +D DI+ L
Sbjct  26    SAAADGLIRIGLRKKALDENSRLAGRLLEKEGKALMGP--RYGLRGGLESNDEDADIISL  83

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYM+AQYFGEIG+GTP QKFTVIFDTGSSNLWVPSSKCYFS+ C+FHSKY SSQSSTYE
Sbjct  84    KNYMNAQYFGEIGIGTPAQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYKSSQSSTYE  143

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK+AEIHYGTGSISGFFS D V +GDLVVK Q FIEAT EPGVTFL AKFDGILGLGF
Sbjct  144   KNGKTAEIHYGTGSISGFFSGDHVALGDLVVKDQDFIEATREPGVTFLAAKFDGILGLGF  203

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVGD       +V QGL+++P+FSFW NRN +E EGGE+VFGGVDP HY+G+H YVP
Sbjct  204   KEISVGDVTPVWYNLVKQGLIKEPVFSFWFNRNAEEGEGGEIVFGGVDPNHYEGDHVYVP  263

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQF+MG+VLI  + TGFC+GGC+AIADSGTSLIAGP+++IT IN  IGA GVVS
Sbjct  264   VTQKGYWQFNMGDVLIGDESTGFCAGGCAAIADSGTSLIAGPTTVITEINQKIGASGVVS  323

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECKAVV  YGQ+++  L+ + +P KICSQ+GLCTF+G  GVS+GIESV++E    SA L
Sbjct  324   QECKAVVAQYGQQILAKLMSQTQPSKICSQVGLCTFDGTHGVSIGIESVINENEDASAGL  383

Query  559   H-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             H D MC ACEM VVWMQNQL  NQTQE+IL+Y+NELC RLPSPMGES VDC  +++MPSV
Sbjct  384   HSDGMCHACEMAVVWMQNQLRLNQTQESILNYINELCERLPSPMGESSVDCASVASMPSV  443

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IG K F+L P +YILKVG+G+AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFD
Sbjct  444   SFTIGDKTFELKPEQYILKVGQGTAAQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFD  503

Query  202   YGKMRVGFAEA  170
             YG +RVGFA A
Sbjct  504   YGNLRVGFAPA  514



>ref|XP_006600236.1| PREDICTED: aspartic proteinase 1 isoform X1 [Glycine max]
Length=514

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/493 (70%), Positives = 418/493 (85%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             +   N G  RIGLKK+K+D  NR+AAR+ +K  DS RAS+RK++ L    G  ++TDIV 
Sbjct  23    YCAPNAGLRRIGLKKIKLDPKNRLAARVGSKDVDSFRASIRKFH-LQNNFGGTEETDIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY+DAQY+GEI +GT PQKF VIFDTGSSNLWVPSSKC FSV C+FH+KY SS+SST+
Sbjct  82    LKNYLDAQYYGEIAIGTSPQKFAVIFDTGSSNLWVPSSKCTFSVACYFHAKYKSSKSSTF  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNG +A I YGTG+ISGFFS DSV+VG++VVK+Q FIEAT EPGVTFL AKFDGILGLG
Sbjct  142   KKNGTAAAIQYGTGAISGFFSYDSVRVGEIVVKNQEFIEATREPGVTFLAAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MV+QGL+++P+FSFW NRNP+E+EGGE+VFGGVDP HYKG+HTYV
Sbjct  202   FQEISVGNAAPVWYNMVDQGLLKEPVFSFWFNRNPEEEEGGEIVFGGVDPAHYKGKHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+VLI GKPTG+C+ GCSAIADSGTSL+AGP+++ITMINHAIGA GV+
Sbjct  262   PVTRKGYWQFDMGDVLIGGKPTGYCANGCSAIADSGTSLLAGPTTVITMINHAIGASGVM  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS-A  566
             S+ECK +V  YGQ ++DLL+ E +PKKICS+IGLC F+G  GV +GI+SVVDE    S  
Sbjct  322   SQECKTIVAEYGQTILDLLLAETQPKKICSRIGLCAFDGTHGVDVGIKSVVDENERKSLG  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
               H A C ACEM VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGES VDCG +S++P 
Sbjct  382   GHHGAACPACEMAVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGESAVDCGNISSLPV  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGG+ FDLSP EY+LKVGEG  AQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVF
Sbjct  442   VSFTIGGRTFDLSPEEYVLKVGEGPVAQCISGFTAIDIPPPRGPLWILGDVFMGRYHTVF  501

Query  205   DYGKMRVGFAEAA  167
             D+GK+RVGFA+AA
Sbjct  502   DFGKLRVGFADAA  514



>ref|XP_010924299.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase oryzasin-1-like 
[Elaeis guineensis]
Length=546

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/490 (71%), Positives = 407/490 (83%), Gaps = 9/490 (2%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHG--RNGDLQDTDIVGLKN  1454
             DG +RIGLKK  +D+N+R+AARL  + G  L A     Y L G   NGD  +TDI+ LKN
Sbjct  63    DGLIRIGLKKKPMDQNSRLAARL-VEEGKPLMAG---KYGLRGGPENGD--ETDIISLKN  116

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YM+AQYFGEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFS+ CFFHS+Y S++SSTY+KN
Sbjct  117   YMNAQYFGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACFFHSRYRSTRSSTYQKN  176

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GK A+IHYGTGSISGFFSQD V VGDLVV+ Q FIEAT EP +TFLVAKFDGI GLGFQE
Sbjct  177   GKPADIHYGTGSISGFFSQDHVTVGDLVVEDQVFIEATREPSITFLVAKFDGIFGLGFQE  236

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG+       MV QGL++DP+FSFW NR+  E EGGE+VFGGVDP H+ G+HTYVPVT
Sbjct  237   ISVGNVEPVWYNMVKQGLIKDPVFSFWFNRHADEGEGGEIVFGGVDPNHFTGKHTYVPVT  296

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQF+MG+VLI  + TGFCSGGC+AIADSGTSLIAGP++II  INH IGA GVVS+E
Sbjct  297   QKGYWQFNMGDVLIGNQSTGFCSGGCAAIADSGTSLIAGPTTIIAEINHKIGAAGVVSQE  356

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-  557
             CKAVV  YGQ ++D+L+ E +P KICS+IGLC F+G  GVS+GIE+VV +   +SA    
Sbjct  357   CKAVVAQYGQEILDMLLSETQPAKICSRIGLCAFDGTHGVSIGIENVVHDNGDLSAGFQS  416

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             DAMC+ACEM VVWMQNQL +N+TQE IL+Y+NELC RLPSPMGES VDC  L++MPS+SF
Sbjct  417   DAMCTACEMAVVWMQNQLRQNETQERILNYINELCERLPSPMGESSVDCASLASMPSISF  476

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK F+L+P +YILKVGEG AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFDYG
Sbjct  477   TIGGKSFELTPEQYILKVGEGVAAQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFDYG  536

Query  196   KMRVGFAEAA  167
              +RVGFA+AA
Sbjct  537   NLRVGFADAA  546



>ref|XP_004507671.1| PREDICTED: aspartic proteinase-like isoform X1 [Cicer arietinum]
 ref|XP_004507672.1| PREDICTED: aspartic proteinase-like isoform X2 [Cicer arietinum]
 ref|XP_004507673.1| PREDICTED: aspartic proteinase-like isoform X3 [Cicer arietinum]
Length=498

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/490 (69%), Positives = 408/490 (83%), Gaps = 18/490 (4%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             SNDG  RIGLKK+K+D+NN++AA + +                  +  + ++TDIV LKN
Sbjct  26    SNDGLRRIGLKKIKLDRNNKLAAGIRSN-----------------KLVETEETDIVALKN  68

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             Y+DAQY+GEI +G  PQKFTVIFDTGSSNLWVPSSKC FSV C+FH+KY S QS+TY KN
Sbjct  69    YLDAQYYGEIAIGNSPQKFTVIFDTGSSNLWVPSSKCTFSVACYFHAKYKSRQSNTYRKN  128

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             G +A I YGTG+ISGFFS DSV+VGD+VVK+Q FIEAT EPGVTFLVAKFDGILGLGFQE
Sbjct  129   GTAAAIQYGTGAISGFFSYDSVKVGDIVVKNQEFIEATKEPGVTFLVAKFDGILGLGFQE  188

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG A      MV QGL+Q+P+FSFWLNR P+E+EGGE+VFGGVDP HYKGEHTYVPVT
Sbjct  189   ISVGYAVPVWYNMVEQGLIQEPVFSFWLNRKPEEEEGGEIVFGGVDPAHYKGEHTYVPVT  248

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             +KGYWQFDMG+V+I+GK TG+C+ GCSAIADSGTSL+AGP+++ITMIN AIGA GVVSKE
Sbjct  249   RKGYWQFDMGDVIIDGKSTGYCADGCSAIADSGTSLLAGPTTVITMINQAIGASGVVSKE  308

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLH  557
             CK +V  YGQ +++LL+ EA+PKKICS+IGLCTF+G  GV++ IESVVDE +   S  LH
Sbjct  309   CKTIVAEYGQTIMNLLLAEAQPKKICSEIGLCTFDGTHGVNLAIESVVDESERKSSGGLH  368

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
              A CSACEM VVWMQNQLS+N+TQ+ IL+Y+N LC+++PSPMGES VDC  +S++P VSF
Sbjct  369   GASCSACEMAVVWMQNQLSQNKTQDQILTYINNLCDKMPSPMGESSVDCEDISSLPVVSF  428

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGG+ FDL+P EYILKVGEG AAQCISGFTA+D+ PPRGP+WILGD+FMGRYHTVFD+G
Sbjct  429   TIGGRTFDLAPEEYILKVGEGPAAQCISGFTAIDIAPPRGPIWILGDIFMGRYHTVFDFG  488

Query  196   KMRVGFAEAA  167
             K RVGFAEAA
Sbjct  489   KSRVGFAEAA  498



>emb|CDY08632.1| BnaC04g19410D [Brassica napus]
Length=511

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/496 (69%), Positives = 415/496 (84%), Gaps = 6/496 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S+SNDG +R+GLKK+K+D NNR+A R  +K   + R+S++++      + +  D DIV
Sbjct  19    ASSESNDGTLRVGLKKLKLDPNNRLATRFGSKQEKAFRSSLKEF---RSNDKNAGDADIV  75

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KCYFS+ CFFHSKY SS+SST
Sbjct  76    ALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFSLSCFFHSKYKSSRSST  135

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+++GK A IHYG+GSI+GFFS D+V VGDLVVK+Q FIEATSEPG+TFLVAKFDG+LGL
Sbjct  136   YKESGKRAAIHYGSGSIAGFFSYDAVTVGDLVVKTQEFIEATSEPGLTFLVAKFDGLLGL  195

Query  1105  GFQEISVGDAXXX--XXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEH  932
             GFQEISVG+A        M+ QGL++ P+FSFWLNR+ + +EGGELVFGGVDPKH+KGEH
Sbjct  196   GFQEISVGNATPVWYAYNMLKQGLIKKPVFSFWLNRDTKSEEGGELVFGGVDPKHFKGEH  255

Query  931   TYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGAD  752
             TYVPVT++GYWQFDMGEVLI GK TG+C  GCSAIADSGTSL+AGP+++I MIN AIGA 
Sbjct  256   TYVPVTRRGYWQFDMGEVLIAGKSTGYCENGCSAIADSGTSLLAGPTAVIAMINKAIGAS  315

Query  751   GVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVD-EKNG  575
             GVVS++CK VV+ YGQ ++DLL+ +A+PK ICSQIGLCTF+G  GVSMGIESVVD E   
Sbjct  316   GVVSQQCKTVVDQYGQSILDLLLAKAQPKHICSQIGLCTFDGTHGVSMGIESVVDKESTK  375

Query  574   VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLST  395
              S+ L DA C+ CEM VVW+Q+QL +N TQ+ I++Y+N++C R+PSP GES VDC +L  
Sbjct  376   SSSGLRDAGCAPCEMAVVWIQSQLMQNMTQKRIVNYINDICERMPSPNGESAVDCSQLCK  435

Query  394   MPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYH  215
             MP+VSF+IGGKVFDL+P EY+LK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMGRYH
Sbjct  436   MPTVSFTIGGKVFDLAPEEYVLKIGEGPVAQCISGFTALDLPPPRGPLWILGDVFMGRYH  495

Query  214   TVFDYGKMRVGFAEAA  167
             TVF +G  +VGFAEAA
Sbjct  496   TVFHFGNEQVGFAEAA  511



>ref|XP_009123365.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123366.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123367.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
 ref|XP_009123369.1| PREDICTED: aspartic proteinase A2 isoform X1 [Brassica rapa]
Length=509

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/494 (68%), Positives = 417/494 (84%), Gaps = 4/494 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S+SNDG +R+GLKK+K+D  NR+A R  +K   + R+S++++      + +  D DIV
Sbjct  19    ASSESNDGTLRVGLKKLKLDPTNRLATRFGSKQEKAFRSSLKEF---RSNDKNAGDADIV  75

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KCYFS+ CFFHSKY SS+SST
Sbjct  76    ALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFSLSCFFHSKYKSSRSST  135

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+++GK A IHYG+GSISGFFS D+V VGDLVVK+Q FIEATSEPG+TFLVAKFDG+LGL
Sbjct  136   YKESGKRAAIHYGSGSISGFFSYDAVTVGDLVVKNQEFIEATSEPGLTFLVAKFDGLLGL  195

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      M+ QGL++ P+FSFWLNR+ + +EGGEL+FGGVDPKH+KGEHTY
Sbjct  196   GFQEISVGNATPVWYNMLKQGLIKKPVFSFWLNRDTKSEEGGELIFGGVDPKHFKGEHTY  255

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPV+++GYWQFDMGEVLI GK TG+C  GC+AIADSGTSL+AGP+++I MIN AIGA GV
Sbjct  256   VPVSRRGYWQFDMGEVLIAGKSTGYCGNGCTAIADSGTSLLAGPTAVIAMINKAIGASGV  315

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS++CK VV+ YGQ ++DLL+ +A+PK ICS+IGLCTF+G  GVSMGIESVV+++N  S+
Sbjct  316   VSQQCKTVVDQYGQTILDLLLAKAQPKHICSKIGLCTFDGTHGVSMGIESVVEKENTKSS  375

Query  565   D-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               L DA C+ CEM V+W+Q+QL +N TQ+ I++ +N++C R+PSP GES VDC +LS MP
Sbjct  376   SGLRDAGCAPCEMAVMWIQSQLMQNMTQKRIVNNINDICERMPSPNGESAVDCSQLSKMP  435

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VSF+IGGKVFDLSP EY+LK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMGRYHTV
Sbjct  436   TVSFTIGGKVFDLSPEEYVLKIGEGPVAQCISGFTALDLPPPRGPLWILGDVFMGRYHTV  495

Query  208   FDYGKMRVGFAEAA  167
             FD+G  +VGFAEAA
Sbjct  496   FDFGNEQVGFAEAA  509



>ref|XP_009358756.1| PREDICTED: aspartic proteinase-like [Pyrus x bretschneideri]
Length=507

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/494 (70%), Positives = 410/494 (83%), Gaps = 10/494 (2%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQ--DTDIV  1466
             S  NDG  RI LKK+K+D N+R+AA+LE+K G      +RKY  L    G+ +  D DIV
Sbjct  21    SAPNDGLSRIALKKVKLDSNDRVAAQLESKNG------LRKY-RLPSNLGEPESGDVDIV  73

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ CFFH+KY S QS T
Sbjct  74    SLKNYLDAQYYGEIAIGTPPQPFTVIFDTGSSNLWVPSSKCYFSLACFFHAKYDSGQSRT  133

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+ NG SA I YGTG+ISGFFS D+V+VGD+VVK+Q FIEATSEPG+TFL AKFDG+LGL
Sbjct  134   YKNNGTSASIQYGTGAISGFFSNDNVKVGDIVVKNQDFIEATSEPGLTFLAAKFDGLLGL  193

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG +      MV +GL+++P+FSFWLNRN Q++ GGE+VFGGVDPKH+KG+HTY
Sbjct  194   GFQEISVGGSVPVWYNMVERGLIKEPVFSFWLNRNAQDEAGGEIVFGGVDPKHFKGKHTY  253

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVT+KGYWQF+MG+VLI GKPTG+C+GGC AIADSGTSL+ GPS+ IT IN AIGA GV
Sbjct  254   VPVTRKGYWQFNMGDVLIGGKPTGYCAGGCFAIADSGTSLLTGPSTAITKINQAIGASGV  313

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS+ECKAVV  YG+ ++DLLV E  PKK+CSQIG+C F+G R VSMGIESVVDE NG S+
Sbjct  314   VSQECKAVVNQYGRTILDLLVAEVHPKKVCSQIGVCNFDGTRSVSMGIESVVDENNGKSS  373

Query  565   D-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               LHDA CSACEM VVWMQN+L +N TQ  IL+YVNELC ++P   G+S VDCGKLS+MP
Sbjct  374   GILHDASCSACEMAVVWMQNELKQNMTQGRILNYVNELCEKMPDASGQSTVDCGKLSSMP  433

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
              VSF+IGGKVF L+ NEYILKVGEG+ AQCISGFT++D+P PRGPLWILGD+FMGRYHTV
Sbjct  434   PVSFTIGGKVFRLTSNEYILKVGEGAQAQCISGFTSMDIPRPRGPLWILGDIFMGRYHTV  493

Query  208   FDYGKMRVGFAEAA  167
             FDYG MRVGFAEAA
Sbjct  494   FDYGNMRVGFAEAA  507



>ref|NP_001237064.1| aspartic proteinase 1 precursor [Glycine max]
 dbj|BAB62890.1| aspartic proteinase 1 [Glycine max]
Length=514

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/493 (70%), Positives = 418/493 (85%), Gaps = 2/493 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             +   N G  RIGLKK+K+D  NR+AAR+ +K  DS RAS+R+++ L    G  ++TDIV 
Sbjct  23    YCAPNAGLRRIGLKKIKLDPKNRLAARVGSKDVDSFRASIRQFH-LQNNFGGTEETDIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY+DAQY+GEI +GT PQKF VIFDTGSSNLWVPSSKC FSV C+FH+KY SS+SST+
Sbjct  82    LKNYLDAQYYGEIAIGTSPQKFAVIFDTGSSNLWVPSSKCTFSVACYFHAKYKSSKSSTF  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNG +A I YGTG+ISGFFS DSV+VG++VVK+Q FIEAT EPGVTFL AKFDGILGLG
Sbjct  142   KKNGTAAAIQYGTGAISGFFSYDSVRVGEIVVKNQEFIEATREPGVTFLAAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MV+QGL+++P+FSFW NRNP+E+EGGE+VFGGVDP HYKG+HTYV
Sbjct  202   FQEISVGNAAPVWYNMVDQGLLKEPVFSFWFNRNPEEEEGGEIVFGGVDPAHYKGKHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+VLI GKPTG+C+ GCSAIADSGTSL+AGP+++ITMINHAIGA GV+
Sbjct  262   PVTRKGYWQFDMGDVLIGGKPTGYCANGCSAIADSGTSLLAGPTTVITMINHAIGASGVM  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS-A  566
             S+ECK +V  YGQ ++DLL+ E +PKKICS+IGLC F+G  GV +GI+SVVDE    S  
Sbjct  322   SQECKTIVAEYGQTILDLLLAETQPKKICSRIGLCAFDGTHGVDVGIKSVVDENERKSLG  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
               H A C ACEM VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGES VDCG +S++P 
Sbjct  382   GHHGAACPACEMAVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGESAVDCGNISSLPV  441

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGG+ FDLSP EY+LKVGEG  AQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVF
Sbjct  442   VSFTIGGRTFDLSPEEYVLKVGEGPVAQCISGFTAIDIPPPRGPLWILGDVFMGRYHTVF  501

Query  205   DYGKMRVGFAEAA  167
             D+GK+RVGFA+AA
Sbjct  502   DFGKLRVGFADAA  514



>gb|AFH58568.1| aspartic acid protease [Ananas comosus]
Length=514

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/491 (71%), Positives = 406/491 (83%), Gaps = 4/491 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRN-GDLQDTDIVGLK  1457
             S DG VRIGLKK  ID+NNRIAARL  K    L A+ R  Y L G    + ++TDI+ LK
Sbjct  26    SADGLVRIGLKKRPIDENNRIAARLVEKEEGPLLAARR--YGLRGAPLKEGEETDIIALK  83

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NYM+AQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFS+ C FH+KY S +SS+Y K
Sbjct  84    NYMNAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACLFHTKYKSGRSSSYHK  143

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGKSA IHYGTG+ISGFFS D V+VGDLVVK+Q FIEAT EP VTF+VAKFDGILGLGFQ
Sbjct  144   NGKSASIHYGTGAISGFFSTDHVKVGDLVVKTQDFIEATKEPSVTFVVAKFDGILGLGFQ  203

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG+A      MV+QGL+++P+FSFW NRN  + EGGE+VFGG DP HYKG HTYVPV
Sbjct  204   EISVGNAVPVWYNMVDQGLIKEPVFSFWFNRNANDGEGGEIVFGGADPNHYKGNHTYVPV  263

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             TQKGYWQF+MG+VL+ G+ TGFC+GGC+AIADSGTSL+AGP++II  IN  IGA GVVS+
Sbjct  264   TQKGYWQFEMGDVLVGGQSTGFCNGGCAAIADSGTSLLAGPTTIIAEINQKIGASGVVSQ  323

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS-ADL  560
             ECKAVV  YGQ+++ +L+ E +P KICS IGLCTF+G +GVS GIESVV++    S A L
Sbjct  324   ECKAVVAEYGQQILQMLLAEVQPGKICSSIGLCTFDGKQGVSAGIESVVNKDTRRSAAGL  383

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
              DAMC+ CEM VVWMQNQ+S+NQTQE I +Y+N+LC +LPSPMGES VDC  +++MP +S
Sbjct  384   SDAMCNVCEMAVVWMQNQISQNQTQELIFNYLNQLCEKLPSPMGESSVDCSSVASMPDIS  443

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGK F L P +YIL+VGEG AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFDY
Sbjct  444   FTIGGKKFSLKPEQYILQVGEGYAAQCISGFTALDVPPPRGPLWILGDVFMGAYHTVFDY  503

Query  199   GKMRVGFAEAA  167
             G MRVGFA+AA
Sbjct  504   GNMRVGFADAA  514



>ref|NP_001056348.1| Os05g0567100 [Oryza sativa Japonica Group]
 sp|Q42456.2|ASPR1_ORYSJ RecName: Full=Aspartic proteinase oryzasin-1; Flags: Precursor 
[Oryza sativa Japonica Group]
 gb|AAU10663.1| aspartic proteinase oryzasin 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF18262.1| Os05g0567100 [Oryza sativa Japonica Group]
 gb|EAY99059.1| hypothetical protein OsI_21016 [Oryza sativa Indica Group]
 gb|ACA50495.1| aspartic proteinase oryzasin 1 [Oryza sativa Japonica Group]
 dbj|BAG90572.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96074.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96985.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64719.1| hypothetical protein OsJ_19575 [Oryza sativa Japonica Group]
Length=509

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/492 (71%), Positives = 409/492 (83%), Gaps = 5/492 (1%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             + + +G VRI LKK  ID+N+R+AARL  + G + R  +R   +L G      + DIV L
Sbjct  22    ASAAEGLVRIALKKRPIDENSRVAARLSGEEG-ARRLGLRGANSLGGGG---GEGDIVAL  77

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYM+AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFS+ CFFHS+Y S QSSTY+
Sbjct  78    KNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACFFHSRYKSGQSSTYQ  137

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A I YGTGSI+GFFS+DSV VGDLVVK Q FIEAT EPG+TF+VAKFDGILGLGF
Sbjct  138   KNGKPAAIQYGTGSIAGFFSEDSVTVGDLVVKDQEFIEATKEPGLTFMVAKFDGILGLGF  197

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVGDA      MV QGLV +P+FSFW NR+  E EGGE+VFGG+DP HYKG HTYVP
Sbjct  198   QEISVGDAVPVWYKMVEQGLVSEPVFSFWFNRHSDEGEGGEIVFGGMDPSHYKGNHTYVP  257

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             V+QKGYWQF+MG+VLI GK TGFC+ GCSAIADSGTSL+AGP++IIT IN  IGA GVVS
Sbjct  258   VSQKGYWQFEMGDVLIGGKTTGFCASGCSAIADSGTSLLAGPTAIITEINEKIGATGVVS  317

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI+SVVD++ G S  L
Sbjct  318   QECKTVVSQYGQQILDLLLAETQPSKICSQVGLCTFDGKHGVSAGIKSVVDDEAGESNGL  377

Query  559   HDA-MCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
                 MC+ACEM VVWMQNQL++N+TQ+ IL+Y+N+LC++LPSPMGES VDCG L++MP +
Sbjct  378   QSGPMCNACEMAVVWMQNQLAQNKTQDLILNYINQLCDKLPSPMGESSVDCGSLASMPEI  437

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IGGK F L P EYILKVGEG+AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFD
Sbjct  438   SFTIGGKKFALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGAYHTVFD  497

Query  202   YGKMRVGFAEAA  167
             YGKMRVGFA++A
Sbjct  498   YGKMRVGFAKSA  509



>emb|CDY24888.1| BnaA03g59920D [Brassica napus]
Length=511

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/496 (68%), Positives = 417/496 (84%), Gaps = 6/496 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S+SNDG +R+GLKK+K+D  NR+A R  +K   + R+S++++      + +  D DIV
Sbjct  19    ASSESNDGTLRVGLKKLKLDPTNRLATRFGSKQEKAFRSSLKEF---RSNDKNAGDADIV  75

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KCYFS+ CFFHSKY SS+SST
Sbjct  76    ALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFSLSCFFHSKYKSSRSST  135

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+++GK A IHYG+GSISGFFS D+V VGDLVVK+Q FIEATSEPG+TFLVAKFDG+LGL
Sbjct  136   YKESGKRAAIHYGSGSISGFFSYDAVTVGDLVVKNQEFIEATSEPGLTFLVAKFDGLLGL  195

Query  1105  GFQEISVGDAXXX--XXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEH  932
             GFQEISVG+A        M+ QGL++ P+FSFWLNR+ + +EGGEL+FGGVDPKH+KGEH
Sbjct  196   GFQEISVGNATPVWYAYNMLKQGLIKKPVFSFWLNRDTKSEEGGELIFGGVDPKHFKGEH  255

Query  931   TYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGAD  752
             TYVPV+++GYWQFDMGEVLI GK TG+C  GC+AIADSGTSL+AGP+++I MIN AIGA 
Sbjct  256   TYVPVSRRGYWQFDMGEVLIAGKSTGYCGNGCTAIADSGTSLLAGPTAVIAMINKAIGAS  315

Query  751   GVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGV  572
             GVVS++CK VV+ YGQ ++DLL+ +A+PK ICS+IGLCTF+G  GVSMGIESVVD++N  
Sbjct  316   GVVSQQCKTVVDQYGQTILDLLLAKAQPKHICSKIGLCTFDGTHGVSMGIESVVDKENTK  375

Query  571   SAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLST  395
             S+  L DA C+ CEM VVW+Q+QL +N TQ+ I++ +N++C R+PSP GES VDC +LS 
Sbjct  376   SSSGLRDAGCAPCEMAVVWIQSQLMQNMTQKRIVNNINDICERMPSPNGESAVDCSQLSK  435

Query  394   MPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYH  215
             MP+VSF+IGGKVFDLSP EY+LK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMGRYH
Sbjct  436   MPTVSFTIGGKVFDLSPEEYVLKIGEGPVAQCISGFTALDLPPPRGPLWILGDVFMGRYH  495

Query  214   TVFDYGKMRVGFAEAA  167
             TVFD+G  +VGFAEAA
Sbjct  496   TVFDFGNEQVGFAEAA  511



>ref|XP_009410967.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410968.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410969.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/491 (71%), Positives = 405/491 (82%), Gaps = 9/491 (2%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHG-RNGDLQDTDIVGLK  1457
             S DG VRI LKK  +D+N R+AARL     +  R   RK    HG R G+ +DTDIV LK
Sbjct  26    SADGLVRIKLKKKPLDENGRLAARL---VQERRRLMARK----HGFRLGNGEDTDIVSLK  78

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NYM+AQYFGEIG+G+P QKFTVIFDTGSSNLWVPSSKCYFSV CF HS+Y S++SSTY+K
Sbjct  79    NYMNAQYFGEIGIGSPAQKFTVIFDTGSSNLWVPSSKCYFSVACFLHSRYKSTRSSTYQK  138

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGKSA IHYG+G+ISGFFSQD V +GDLVVK Q FIEAT EP VTF+VAKFDGILGLGF+
Sbjct  139   NGKSAAIHYGSGAISGFFSQDHVTIGDLVVKYQDFIEATREPSVTFVVAKFDGILGLGFK  198

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG+A      M+ QGLV++P+FSFW NRN  E EGGE+VFGGVDP HYKGEH YVPV
Sbjct  199   EISVGNAVPVWYNMIKQGLVKEPVFSFWFNRNADEGEGGEIVFGGVDPNHYKGEHIYVPV  258

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             TQKGYWQFDMG+V I+G+ TGFC+GGC+AIADSGTSLIAGP ++I  IN  IGA GVVS+
Sbjct  259   TQKGYWQFDMGDVHIDGQSTGFCAGGCAAIADSGTSLIAGPMTVIAEINQKIGASGVVSQ  318

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             ECKAVV  YG++++D+L+ E  P K+CS+IGLCTF+G  GVS+GIESVV+E   VS+ L 
Sbjct  319   ECKAVVAQYGEQILDMLLSETEPSKVCSRIGLCTFDGTHGVSIGIESVVNENADVSSGLQ  378

Query  556   -DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
              DA+CS CEM VVWMQNQL +NQTQE +L+Y+NELC RLPSPMGES VDC  +S+MP VS
Sbjct  379   SDAICSVCEMAVVWMQNQLRQNQTQERVLNYINELCERLPSPMGESSVDCAAISSMPGVS  438

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IG K F+L+  +YILKVGEG+AAQCISGF ALDVPPPRGP+WILGDVFMG YHTVFDY
Sbjct  439   FTIGNKTFELTAEQYILKVGEGAAAQCISGFIALDVPPPRGPIWILGDVFMGVYHTVFDY  498

Query  199   GKMRVGFAEAA  167
             G +RVGFAEAA
Sbjct  499   GNLRVGFAEAA  509



>dbj|BAA06876.1| aspartic protease [Oryza sativa]
 dbj|BAA06875.1| aspartic protease [Oryza sativa]
Length=509

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/492 (70%), Positives = 408/492 (83%), Gaps = 5/492 (1%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             + + +G VRI LKK  ID+N+R+AARL  + G + R  +R   +L G      + DIV L
Sbjct  22    ASAEEGLVRIALKKRPIDENSRVAARLSGEEG-ARRLGLRGANSLGGGG---GEGDIVAL  77

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYM+AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFS+ CFFHS+Y S QSSTY+
Sbjct  78    KNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACFFHSRYKSGQSSTYQ  137

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A I YGTGSI+GFFS+DSV VGDLVVK Q FIEAT EPG+TF+VAKFDGILGLGF
Sbjct  138   KNGKPAAIQYGTGSIAGFFSEDSVTVGDLVVKDQEFIEATKEPGLTFMVAKFDGILGLGF  197

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEISVGDA      MV QGLV +P+FSFW NR+  E EGGE+VFGG+DP HYKG HTYVP
Sbjct  198   QEISVGDAVPVWYKMVEQGLVSEPVFSFWFNRHSDEGEGGEIVFGGMDPSHYKGNHTYVP  257

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             V+QKGYWQF+MG+VLI GK TGFC+ GCSAIADSGTSL+AGP++IIT IN  IGA GVVS
Sbjct  258   VSQKGYWQFEMGDVLIGGKTTGFCASGCSAIADSGTSLLAGPTAIITEINEKIGATGVVS  317

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI+SVVD++ G S  L
Sbjct  318   QECKTVVSQYGQQILDLLLAETQPSKICSQVGLCTFDGKHGVSAGIKSVVDDEAGESNGL  377

Query  559   HDA-MCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
                 MC+ACEM VVWMQNQL++N+TQ+ IL+Y+N+LC++LPSPMGES VDCG L++MP +
Sbjct  378   QSGPMCNACEMAVVWMQNQLAQNKTQDLILNYINQLCDKLPSPMGESSVDCGSLASMPEI  437

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IG K F L P EYILKVGEG+AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFD
Sbjct  438   SFTIGAKKFALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGAYHTVFD  497

Query  202   YGKMRVGFAEAA  167
             YGKMRVGFA++A
Sbjct  498   YGKMRVGFAKSA  509



>dbj|BAB20969.1| aspartic proteinase 1 [Nepenthes alata]
Length=514

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/488 (72%), Positives = 411/488 (84%), Gaps = 2/488 (0%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  1451
             ND  +R+GLKK K+D+ NR ++    K  +S+  ++RKY  L    G+  D DI+ LKNY
Sbjct  27    NDRLLRVGLKKRKLDQINRFSSLYGCKGKESINPAIRKY-GLGNGLGNSDDADIISLKNY  85

Query  1450  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNG  1271
             M+AQYFGEIG+GTPPQKFT+IFDTGSSNLWVPS+KCYFS+ C+FHSKY SS SS+Y KNG
Sbjct  86    MNAQYFGEIGIGTPPQKFTLIFDTGSSNLWVPSAKCYFSIACYFHSKYKSSLSSSYTKNG  145

Query  1270  KSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEI  1091
             KSAEIHYGTG+ISGFFSQD V++GDLVV++Q FIEAT EP +TF+ AKFDGILGLGFQEI
Sbjct  146   KSAEIHYGTGAISGFFSQDHVKLGDLVVENQDFIEATREPSITFVAAKFDGILGLGFQEI  205

Query  1090  SVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQ  911
             SVG+A      MV QGLV +P+FSFWLNRN  E+EGGE+VFGGVDP HYKGEHT+VPVT 
Sbjct  206   SVGNAVPVWYNMVKQGLVNEPVFSFWLNRNATEEEGGEIVFGGVDPNHYKGEHTFVPVTH  265

Query  910   KGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKEC  731
             KGYWQFDM +VL+ G+ TG+CSGGCSAIADSGTSL+AGP++I+  INHAIGA GVVS+EC
Sbjct  266   KGYWQFDMDDVLVGGETTGYCSGGCSAIADSGTSLLAGPTTIVAQINHAIGASGVVSQEC  325

Query  730   KAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVSADLHD  554
             KAVV  YG  ++D+L+ E +PKKICSQIGLCTF+G RGVS+GI+SVVD   +G S+ L D
Sbjct  326   KAVVAQYGTAILDMLISETQPKKICSQIGLCTFDGKRGVSVGIKSVVDMNVDGSSSGLQD  385

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
             A C+ACEMTVVWMQNQL +NQT+E IL+YVNELCNRLPSPMGES VDC  LS+MP VSF+
Sbjct  386   ATCTACEMTVVWMQNQLKQNQTEERILNYVNELCNRLPSPMGESAVDCSSLSSMPGVSFT  445

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             +GGKVFDL P +YIL+VGEG A QCISGFTALDV PP GPLWILGD+FMG+YHTVFDYG 
Sbjct  446   VGGKVFDLLPEQYILQVGEGVATQCISGFTALDVAPPLGPLWILGDIFMGQYHTVFDYGN  505

Query  193   MRVGFAEA  170
             MRVGFAEA
Sbjct  506   MRVGFAEA  513



>ref|XP_012087602.1| PREDICTED: aspartic proteinase A1-like isoform X2 [Jatropha curcas]
Length=511

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/497 (69%), Positives = 414/497 (83%), Gaps = 8/497 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDT---  1475
             A S  N G +RIGLKK K+D+ NR A  +++K G+S+R + +KY   H RN DL+D+   
Sbjct  19    ALSVHNVGLIRIGLKKRKMDQVNRPAGTIDSKEGESMRTATKKY---HFRN-DLRDSGDA  74

Query  1474  DIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQ  1295
             + V LKNY+DAQYFGEIG+GTP Q FTVIFDTGSSNLWVPSSKCYFS+ C+FHS+Y SS+
Sbjct  75    EFVTLKNYLDAQYFGEIGIGTPSQTFTVIFDTGSSNLWVPSSKCYFSLACYFHSRYKSSE  134

Query  1294  SSTYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGI  1115
             SSTYEKNG SA I YGTGSI+GFFSQD+VQVGDLV++ Q FIEAT EPG+ F+VAKFDGI
Sbjct  135   SSTYEKNGTSAAIRYGTGSIAGFFSQDNVQVGDLVIRDQDFIEATKEPGIIFMVAKFDGI  194

Query  1114  LGLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGE  935
              GLGFQEISVG+A      MVNQGLV++ +FSFWLNRN + +EGGE+VFGGVDP HYKGE
Sbjct  195   FGLGFQEISVGNAVPVWYNMVNQGLVKEQVFSFWLNRNVKGEEGGEIVFGGVDPNHYKGE  254

Query  934   HTYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGA  755
             HTYVPVTQKGYWQFDMG+VLI+G+ TGFC+ GC AIADSGTSL+AGP+++IT INHAIGA
Sbjct  255   HTYVPVTQKGYWQFDMGDVLIDGETTGFCASGCKAIADSGTSLLAGPTTVITQINHAIGA  314

Query  754   DGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG  575
              GVVS+ECK +VE YG+ +++LL+ +A+P+KICSQIG CTF+G +GVS  IESVVD    
Sbjct  315   SGVVSQECKTMVEQYGKVILELLLAQAQPQKICSQIGFCTFDGTQGVSTNIESVVDASMD  374

Query  574   VSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLS  398
               +D L DA C+ACEM VVW+QN+L  NQTQ+ IL+YVN+LC+RLPSP GES VDC  LS
Sbjct  375   RQSDGLQDAACTACEMMVVWIQNRLRLNQTQDQILNYVNQLCDRLPSPNGESAVDCSSLS  434

Query  397   TMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRY  218
             +M ++SF+IGGK F+L+P +Y+LKVGEG +AQCISGFTA D+PPPRGPLWILGDVFMG Y
Sbjct  435   SMANISFTIGGKAFELTPEQYVLKVGEGVSAQCISGFTAFDLPPPRGPLWILGDVFMGPY  494

Query  217   HTVFDYGKMRVGFAEAA  167
             HTVFDYG + VGFA+AA
Sbjct  495   HTVFDYGNLTVGFAKAA  511



>ref|XP_003610462.1| Aspartic proteinase [Medicago truncatula]
 gb|AES92659.1| fungal proteinase A, aspartic proteinase superfamily protein 
[Medicago truncatula]
Length=519

 Score =   725 bits (1871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/495 (70%), Positives = 414/495 (84%), Gaps = 13/495 (3%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAG-------DSLRASVRKYYNLHGRNGDLQDTDI  1469
             DG  RI LKK+++D+NN++AA   A AG       DSL++S+RKY NL     + Q+TDI
Sbjct  30    DGLRRIALKKIQLDRNNKLAAAAAAAAGGRRTKDTDSLQSSIRKY-NLAN---NYQETDI  85

Query  1468  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSS  1289
             V LKNY+DAQY+GEI +GT PQKFTVIFDTGSSNLWVPSSKC FSV C+FH+KY S++S+
Sbjct  86    VALKNYLDAQYYGEISIGTSPQKFTVIFDTGSSNLWVPSSKCTFSVACYFHAKYKSTKST  145

Query  1288  TYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILG  1109
             TY KNG +A I YGTG+ISGFFS DSV+VGD+VVK+Q FIEAT EPGVTFLVAKFDGILG
Sbjct  146   TYRKNGTAAAIQYGTGAISGFFSYDSVKVGDIVVKNQEFIEATKEPGVTFLVAKFDGILG  205

Query  1108  LGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHT  929
             LGFQEISVG+A      MV QGL+Q+P+FSFWLNR P+E+EGGE+VFGGVDP HYKG HT
Sbjct  206   LGFQEISVGNAVPVWYNMVEQGLIQEPVFSFWLNRKPEEEEGGEIVFGGVDPAHYKGNHT  265

Query  928   YVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADG  749
             YVPV +KGYWQFDMG+V I+GK TG+C  GCSAIADSGTSL+AGP+++ITMINHAIGA G
Sbjct  266   YVPVKRKGYWQFDMGDVTIDGKSTGYCVDGCSAIADSGTSLLAGPTTVITMINHAIGASG  325

Query  748   VVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVD-EKNGV  572
             VVSKECK +V  YGQ +++LL+ EA+PKKICS+IGLCTF+G  GV + IESVVD  +   
Sbjct  326   VVSKECKTIVAEYGQTILNLLLAEAQPKKICSEIGLCTFDGTHGVDLAIESVVDGNERKS  385

Query  571   SADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             S+ LH A CSACEM VVWMQNQL +N+TQ+ IL+Y+N LC+++PSPMGES VDC  +S++
Sbjct  386   SSGLHGASCSACEMAVVWMQNQLRQNKTQDQILTYINNLCDKMPSPMGESSVDCENISSL  445

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P +SF+IGG+ FDL+P EYI KVGEG AAQCISGF A+DVPPPRGP+WILGD+FMGRYHT
Sbjct  446   PVISFTIGGRTFDLAPEEYI-KVGEGPAAQCISGFVAIDVPPPRGPIWILGDIFMGRYHT  504

Query  211   VFDYGKMRVGFAEAA  167
             VFD+GK RVGFAEAA
Sbjct  505   VFDFGKSRVGFAEAA  519



>ref|XP_008647844.1| PREDICTED: aspartic proteinase oryzasin-1 isoform X1 [Zea mays]
 gb|ACN27572.1| unknown [Zea mays]
 gb|ACR38429.1| unknown [Zea mays]
 gb|AFW79205.1| aspartic proteinase oryzasin-1 isoform 1 [Zea mays]
 gb|AFW79206.1| aspartic proteinase oryzasin-1 isoform 2 [Zea mays]
Length=510

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/491 (69%), Positives = 408/491 (83%), Gaps = 6/491 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             S++G VR+ LKK+ +D+N R+AARL A+    L   + +  N  G  GD  D+D++ LKN
Sbjct  24    SSEGLVRVALKKLPVDQNGRVAARLSAEERQRL---LLRGANALGSGGD-DDSDVIALKN  79

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YM+AQYFGEIGVG+P QKFTVIFDTGSSNLWVPSSKCYFS+ C+FHS+Y S QSSTY+KN
Sbjct  80    YMNAQYFGEIGVGSPQQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSRYKSGQSSTYKKN  139

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GK A I YGTGSI+GFFS+DSV +GDLVVK Q FIEAT EPG+TF+VAKFDGILGLGFQE
Sbjct  140   GKPAAIRYGTGSIAGFFSEDSVTLGDLVVKDQEFIEATKEPGLTFMVAKFDGILGLGFQE  199

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG+A      MV QGL+ DP+FSFW NR+  E EGGE+VFGG+D  HYKG+HT+VPVT
Sbjct  200   ISVGNATPVWYNMVKQGLISDPVFSFWFNRHADEGEGGEIVFGGMDSSHYKGDHTFVPVT  259

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             +KGYWQF+MG+VL++GK TGFC+GGC+AIADSGTSL+AGP++IIT IN  IGA GVVS+E
Sbjct  260   RKGYWQFNMGDVLVDGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINEKIGAAGVVSQE  319

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--L  560
             CK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD++ G S     
Sbjct  320   CKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGIRSVVDDEAGKSNGGLK  379

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
              D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMGES VDCG L++MP ++
Sbjct  380   SDPMCNACEMAVVWMQNQLAQNKTQELILNYINQLCERLPSPMGESAVDCGSLASMPDIA  439

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGK F L P +YILKVGEG AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDY
Sbjct  440   FTIGGKKFKLKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLWILGDVFMGVYHTVFDY  499

Query  199   GKMRVGFAEAA  167
             GK+RVGFAE+A
Sbjct  500   GKLRVGFAESA  510



>gb|KDO54711.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=530

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/495 (69%), Positives = 421/495 (85%), Gaps = 4/495 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AF+  NDG VRIGL+K K+D+ NR+  +  +K  +++R  VR+Y NLHG  GD  DTDIV
Sbjct  38    AFALPNDGLVRIGLRKKKLDQINRLVGQTVSKEEETMRTPVRRY-NLHGSLGD-SDTDIV  95

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              L N+MDAQYFGE+ +GTP Q FTVIFDTGSSNLWVPS+KCYFSV C+FHSKY SS SST
Sbjct  96    ALNNFMDAQYFGEVSIGTPSQTFTVIFDTGSSNLWVPSAKCYFSVSCYFHSKYKSSHSST  155

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y++NG SA I YGTG+ISGFFSQD+V+VGDLVVK+Q FIEAT E  +TFL AKFDGILGL
Sbjct  156   YKRNGTSAAIQYGTGAISGFFSQDNVKVGDLVVKNQDFIEATKEASITFLAAKFDGILGL  215

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEIS+G A      M++QGLV++P+FSFWLNR+ + +EGGE+VFGGVDP HYKGEHTY
Sbjct  216   GFQEISIGKAIPVWYNMLDQGLVKEPVFSFWLNRDIEGEEGGEIVFGGVDPDHYKGEHTY  275

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVT+KGYWQF+MG+VLI+G+ TG+CS GC+AIADSGTSL+AGP++IIT INHAIGA GV
Sbjct  276   VPVTKKGYWQFEMGDVLIDGETTGYCSTGCNAIADSGTSLLAGPTTIITQINHAIGASGV  335

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             +S+ECK +V+ YG+ ++++L+ E +P+KICSQ+GLCTF+G RG SMGIESV+D+ +  S+
Sbjct  336   ISQECKTLVDQYGKTILEMLIAETQPQKICSQMGLCTFDGTRGFSMGIESVIDKSSDKSS  395

Query  565   D-LHD-AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             D +HD AMCSACEM V+WMQN+L  N+T + IL+YVN+LC+RLPSP GES VDC  LS+M
Sbjct  396   DGVHDSAMCSACEMAVIWMQNKLRRNETADQILNYVNQLCDRLPSPNGESAVDCDNLSSM  455

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P+VSF+IGGKVFDL+PNEY+L+VGEG AAQCISGFTA DV PPRGPLWILGDVFMGRYHT
Sbjct  456   PNVSFTIGGKVFDLAPNEYVLEVGEGVAAQCISGFTAFDVAPPRGPLWILGDVFMGRYHT  515

Query  211   VFDYGKMRVGFAEAA  167
             VFDYG + +GFAEAA
Sbjct  516   VFDYGNLSIGFAEAA  530



>ref|XP_006469663.1| PREDICTED: aspartic proteinase-like [Citrus sinensis]
 gb|KDO54712.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=514

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/495 (69%), Positives = 421/495 (85%), Gaps = 4/495 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AF+  NDG VRIGL+K K+D+ NR+  +  +K  +++R  VR+Y NLHG  GD  DTDIV
Sbjct  22    AFALPNDGLVRIGLRKKKLDQINRLVGQTVSKEEETMRTPVRRY-NLHGSLGD-SDTDIV  79

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              L N+MDAQYFGE+ +GTP Q FTVIFDTGSSNLWVPS+KCYFSV C+FHSKY SS SST
Sbjct  80    ALNNFMDAQYFGEVSIGTPSQTFTVIFDTGSSNLWVPSAKCYFSVSCYFHSKYKSSHSST  139

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y++NG SA I YGTG+ISGFFSQD+V+VGDLVVK+Q FIEAT E  +TFL AKFDGILGL
Sbjct  140   YKRNGTSAAIQYGTGAISGFFSQDNVKVGDLVVKNQDFIEATKEASITFLAAKFDGILGL  199

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEIS+G A      M++QGLV++P+FSFWLNR+ + +EGGE+VFGGVDP HYKGEHTY
Sbjct  200   GFQEISIGKAIPVWYNMLDQGLVKEPVFSFWLNRDIEGEEGGEIVFGGVDPDHYKGEHTY  259

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVT+KGYWQF+MG+VLI+G+ TG+CS GC+AIADSGTSL+AGP++IIT INHAIGA GV
Sbjct  260   VPVTKKGYWQFEMGDVLIDGETTGYCSTGCNAIADSGTSLLAGPTTIITQINHAIGASGV  319

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             +S+ECK +V+ YG+ ++++L+ E +P+KICSQ+GLCTF+G RG SMGIESV+D+ +  S+
Sbjct  320   ISQECKTLVDQYGKTILEMLIAETQPQKICSQMGLCTFDGTRGFSMGIESVIDKSSDKSS  379

Query  565   D-LHD-AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             D +HD AMCSACEM V+WMQN+L  N+T + IL+YVN+LC+RLPSP GES VDC  LS+M
Sbjct  380   DGVHDSAMCSACEMAVIWMQNKLRRNETADQILNYVNQLCDRLPSPNGESAVDCDNLSSM  439

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P+VSF+IGGKVFDL+PNEY+L+VGEG AAQCISGFTA DV PPRGPLWILGDVFMGRYHT
Sbjct  440   PNVSFTIGGKVFDLAPNEYVLEVGEGVAAQCISGFTAFDVAPPRGPLWILGDVFMGRYHT  499

Query  211   VFDYGKMRVGFAEAA  167
             VFDYG + +GFAEAA
Sbjct  500   VFDYGNLSIGFAEAA  514



>ref|XP_010926197.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010926203.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
 ref|XP_010926209.1| PREDICTED: aspartic proteinase oryzasin-1-like isoform X1 [Elaeis 
guineensis]
Length=512

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/490 (72%), Positives = 413/490 (84%), Gaps = 8/490 (2%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHG--RNGDLQDTDIVGLKN  1454
             DG +RIGLKK  +D+N+R+AARL  K G  L   V   Y L G   NGD  +TDI+ LKN
Sbjct  28    DGLIRIGLKKKPMDENSRLAARLAEKEGKPL---VAGKYGLRGGLDNGD--ETDIISLKN  82

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YM+AQYFGEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHS+Y SS+SSTY+KN
Sbjct  83    YMNAQYFGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSRYKSSRSSTYQKN  142

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKSA+IHYGTGSI+GFFSQD V VGDL VK Q FIEAT EP VTFLVAKFDGILGLGF+E
Sbjct  143   GKSADIHYGTGSIAGFFSQDHVAVGDLAVKDQIFIEATREPSVTFLVAKFDGILGLGFKE  202

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVGDA      MVNQGLV++ +FSFW NR+  E EGGE++FGGVD KH+KG+HTYVPVT
Sbjct  203   ISVGDAVPVWYNMVNQGLVKEAVFSFWFNRHADEGEGGEIIFGGVDSKHFKGKHTYVPVT  262

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQF+MG+V I  + TGFCSGGC+AIADSGTSL+AGP++II  IN  IGA GVVS+E
Sbjct  263   QKGYWQFNMGDVYIGNQSTGFCSGGCAAIADSGTSLVAGPTTIIAEINQKIGASGVVSQE  322

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-  557
             CKAVV  YGQ+++D+L+ E +P KICS+IGLC F+G  GV +GIESVV++   +SA L  
Sbjct  323   CKAVVSQYGQQILDMLLSETQPAKICSRIGLCAFDGTHGVGIGIESVVNDNGDLSAGLQS  382

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             DAMC++CEM VVWMQNQL +N+TQ+ IL+Y+N+LC RLPSPMGES VDC  L +MPS+SF
Sbjct  383   DAMCTSCEMAVVWMQNQLKQNETQDRILNYINDLCERLPSPMGESSVDCASLDSMPSISF  442

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK F+L+P +YILKVGEG+AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFDYG
Sbjct  443   TIGGKSFELTPEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFDYG  502

Query  196   KMRVGFAEAA  167
             KMRVGFAEAA
Sbjct  503   KMRVGFAEAA  512



>ref|XP_008371074.1| PREDICTED: aspartic proteinase [Malus domestica]
Length=508

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/495 (70%), Positives = 413/495 (83%), Gaps = 11/495 (2%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQ--DTDIV  1466
             S  NDG  RIGLKK+K+D N+ +AA+LE+K G      +RKY  L    G+ +  D DIV
Sbjct  21    SAPNDGLSRIGLKKVKLDSNDWVAAQLESKNG------LRKY-RLPSNLGEPESGDVDIV  73

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQY+GEI +GTPPQ FTVIFDTGSSNLWVPSSKCY S+ CFFH+KY S QS T
Sbjct  74    SLKNYMDAQYYGEIAIGTPPQPFTVIFDTGSSNLWVPSSKCYVSLACFFHAKYNSGQSRT  133

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+ NG SA I YG+G+ISGFFS D+V+VGD+VVK+Q FIEATSEPG+TF+ AKFDG+LGL
Sbjct  134   YKNNGTSASIQYGSGAISGFFSNDNVKVGDIVVKNQDFIEATSEPGLTFVTAKFDGLLGL  193

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG +      MV +GL+++P+FSFWLNRN Q++ GGE+VFGGVDPKH+KG+HTY
Sbjct  194   GFQEISVGGSVPVWYNMVERGLIKEPVFSFWLNRNAQDEAGGEIVFGGVDPKHFKGKHTY  253

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVT+KGYWQF+MG+VLI GKPTGFC+GGC AIADSGTSL+ GPS+ IT IN AIGA GV
Sbjct  254   VPVTRKGYWQFNMGDVLIGGKPTGFCAGGCFAIADSGTSLLTGPSTSITKINQAIGASGV  313

Query  745   VSKECKAVVENYGQRMIDLLVM-EARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS  569
             VS+ECKAVV  YG+ ++DLLV  E +PKK+CSQIG+CTF+G R VSMGIESVVDEKNG S
Sbjct  314   VSQECKAVVNQYGRTILDLLVAHEVQPKKVCSQIGVCTFDGTRSVSMGIESVVDEKNGKS  373

Query  568   AD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             +  LHDA CSACEM VVWMQN+L  N TQ+ IL+YVNELC ++P  +G+S VDCGKLS+M
Sbjct  374   SGILHDASCSACEMAVVWMQNELKXNITQDRILNYVNELCEKMPDTLGQSTVDCGKLSSM  433

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P VSF+IGG+ F L+ +EYILKVGEG+ AQCISGFT+LD+P PRGPLWILGD+FMGRYHT
Sbjct  434   PPVSFTIGGRAFKLTSDEYILKVGEGAQAQCISGFTSLDIPRPRGPLWILGDIFMGRYHT  493

Query  211   VFDYGKMRVGFAEAA  167
             VFDYGKMRVGFA+AA
Sbjct  494   VFDYGKMRVGFADAA  508



>ref|XP_006364164.1| PREDICTED: aspartic proteinase-like [Solanum tuberosum]
Length=508

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/492 (69%), Positives = 400/492 (81%), Gaps = 6/492 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS SNDG VR+G+KK K+D+ N++   +++    S R      Y L G  GD  DTDI+ 
Sbjct  23    FSVSNDGLVRVGIKKRKLDQTNQVFGGIDSNGVHSARK-----YRLGGNVGD-SDTDIIA  76

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY+DAQYFGEI +G+PPQKFTVIFDTGSSNLWVPS+KC+FS+ C+ H KY SS SSTY
Sbjct  77    LKNYLDAQYFGEISIGSPPQKFTVIFDTGSSNLWVPSAKCHFSLACYLHPKYKSSHSSTY  136

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNG SA IHYGTGSISG+FS D+V+VGDLVVK Q FIEAT EPG+TFL AKFDGILGLG
Sbjct  137   KKNGTSAAIHYGTGSISGYFSNDNVKVGDLVVKDQDFIEATREPGITFLAAKFDGILGLG  196

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      MVNQGLV+  +FSFW NRN +E+EGGELVFGGVDPKH+KGEHTYV
Sbjct  197   FQEISVGKAVPVWYNMVNQGLVKQSVFSFWFNRNAEEEEGGELVFGGVDPKHFKGEHTYV  256

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT KGYWQFDMG+VL+ G+ TGFCSGGCSAIADSGTSL+AGP++IIT INHAIGA GVV
Sbjct  257   PVTHKGYWQFDMGDVLVGGETTGFCSGGCSAIADSGTSLLAGPTTIITQINHAIGASGVV  316

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+ECK+VV  YG+ ++DLL  +A P++ICSQI LC+ +G R VSM IESVVD+ N  S  
Sbjct  317   SQECKSVVSEYGKTILDLLESKAAPQQICSQINLCSRDGGRDVSMIIESVVDKHNEASNG  376

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             +HD MC  CEM VVWMQNQL  N+T + I  Y+N+LC+RLPSPMGES V+C  L++MP+V
Sbjct  377   VHDEMCRVCEMAVVWMQNQLRRNETADRIFDYMNKLCDRLPSPMGESAVNCNSLASMPNV  436

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF++G K F+L+P +Y+LKVGE    QCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD
Sbjct  437   SFTVGNKTFELTPQQYVLKVGEAPVTQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  496

Query  202   YGKMRVGFAEAA  167
               KMRVGFAEAA
Sbjct  497   SEKMRVGFAEAA  508



>ref|NP_001148782.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
 gb|ACG32889.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
Length=510

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/490 (69%), Positives = 407/490 (83%), Gaps = 6/490 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             S++G VR+ LKK+ +D+N R+AARL A+    L   + +  N  G  GD  D+D++ LKN
Sbjct  24    SSEGLVRVALKKLPVDQNGRVAARLSAEERQRL---LLRGSNALGSGGD-DDSDVIALKN  79

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YM+AQYFGEIGVG+P QKFTVIFDTGSSNLWVPSSKCYFS+ C+FHS+Y S QSSTY+KN
Sbjct  80    YMNAQYFGEIGVGSPQQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSRYKSGQSSTYKKN  139

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GK A I YGTGSI+GFFS+DSV +GDLVVK Q FIEAT EPG+TF+VAKFDGILGLGFQE
Sbjct  140   GKPAAIRYGTGSIAGFFSEDSVTLGDLVVKDQEFIEATKEPGLTFMVAKFDGILGLGFQE  199

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG+A      MV QGL+ DP+FSFW NR+  E EGGE+VFGG+D  HYKG+HT+VPVT
Sbjct  200   ISVGNATPVWYNMVKQGLISDPVFSFWFNRHADEGEGGEIVFGGMDSSHYKGDHTFVPVT  259

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             +KGYWQF+MG+VL++GK TGFC+GGC+AIADSGTSL+AGP++IIT IN  IGA GVVS+E
Sbjct  260   RKGYWQFNMGDVLVDGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINEKIGAAGVVSQE  319

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--L  560
             CK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD++ G S     
Sbjct  320   CKTVVSQYGQQILDLLLAETQPTKICSQVGLCTFDGTHGVSAGIRSVVDDEAGKSNGGLK  379

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
              D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMGES VDCG L++MP ++
Sbjct  380   SDPMCNACEMAVVWMQNQLAQNKTQELILNYINQLCERLPSPMGESAVDCGSLASMPDIA  439

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGK F L P +YILKVGEG AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDY
Sbjct  440   FTIGGKKFKLKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLWILGDVFMGVYHTVFDY  499

Query  199   GKMRVGFAEA  170
             GK+RVGFAE+
Sbjct  500   GKLRVGFAES  509



>ref|XP_007147707.1| hypothetical protein PHAVU_006G147900g [Phaseolus vulgaris]
 gb|ESW19701.1| hypothetical protein PHAVU_006G147900g [Phaseolus vulgaris]
Length=554

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/494 (70%), Positives = 406/494 (82%), Gaps = 9/494 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S  NDG  RIGLKK+K+D ++ +  +        LR+  RK+ +L        + DIV
Sbjct  69    ASSAPNDGLRRIGLKKIKLDSDDVMRFK-------ELRSLARKH-DLQNILRGAAEPDIV  120

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
             GLKNY+DAQY+GEI +GTPPQ FTVIFDTGSSNLWVPSSKCY S+ C+ H+KY SSQSST
Sbjct  121   GLKNYLDAQYYGEIAIGTPPQTFTVIFDTGSSNLWVPSSKCYLSLACYTHAKYKSSQSST  180

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y  NG SA I YG+GSISGFFS D+V+VGD+V+ +QAFIEAT EPGVTF+ AKFDGILGL
Sbjct  181   YSANGTSAAIEYGSGSISGFFSNDNVRVGDVVISNQAFIEATREPGVTFVAAKFDGILGL  240

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      MV QGLV+DP+FSFWLNR P+E+ GGE+VFGG D  HY+G+HTY
Sbjct  241   GFQEISVGNAVPVWYNMVEQGLVKDPVFSFWLNRKPEEENGGEIVFGGADSAHYRGKHTY  300

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVT+KGYWQFDMGEVLI GKPTGFC+ GCSAIADSGTSL+AGP++I+T IN AIGA GV
Sbjct  301   VPVTRKGYWQFDMGEVLIAGKPTGFCASGCSAIADSGTSLLAGPTTIVTEINQAIGASGV  360

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-GVS  569
             VSKECK+VVE YGQ +++LL+ EA+P KICSQIGLC+F+G RGVS GIESVVD+ N   S
Sbjct  361   VSKECKSVVEQYGQTIMELLLAEAKPNKICSQIGLCSFDGTRGVSTGIESVVDKNNRNSS  420

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               + DA+CS CEM V+WMQNQL +NQT++ I+ YVN LC++LPSPMG+S VDCGKLS+MP
Sbjct  421   GAIRDAVCSTCEMAVIWMQNQLRQNQTEDRIIDYVNGLCDKLPSPMGQSSVDCGKLSSMP  480

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
              VSF++GGKVFDLSP EYILKVGEG  AQCISGF ALDVPPPRGPLWILGDVFMGRYHT+
Sbjct  481   IVSFTVGGKVFDLSPKEYILKVGEGPQAQCISGFIALDVPPPRGPLWILGDVFMGRYHTI  540

Query  208   FDYGKMRVGFAEAA  167
             FDYG+ RVGFA AA
Sbjct  541   FDYGQQRVGFAVAA  554



>ref|XP_009600571.1| PREDICTED: cyprosin-like [Nicotiana tomentosiformis]
Length=508

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/492 (69%), Positives = 404/492 (82%), Gaps = 6/492 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS SNDG +R+G+KK K+D+ N+    +++   +S R      Y+L G  GD  DTDI+ 
Sbjct  23    FSVSNDGLIRVGIKKRKLDQINQAFGGIDSNGANSART-----YHLGGNIGD-SDTDIIA  76

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY+DAQYFGEI +G+PPQKFTVIFDTGSSNLWVPS++CYFS+ C+ H KY SS SSTY
Sbjct  77    LKNYLDAQYFGEICIGSPPQKFTVIFDTGSSNLWVPSARCYFSLACYLHPKYKSSHSSTY  136

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNG SA I YGTGSISG+FS D+V+VGDL+VK Q FIEAT EPG+TFL AKFDGILGLG
Sbjct  137   KKNGTSAAIRYGTGSISGYFSNDNVKVGDLIVKDQDFIEATREPGITFLAAKFDGILGLG  196

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG +      MVNQGLV+ P+FSFW NRN QE+EGGELVFGGVDP H+KG+HTYV
Sbjct  197   FQEISVGKSVPVWYNMVNQGLVKKPVFSFWFNRNAQEEEGGELVFGGVDPNHFKGKHTYV  256

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT KGYWQFDMG+VL+ G+ TGFCSGGCSAIADSGTSL+AGP++IIT INHAIGA GVV
Sbjct  257   PVTHKGYWQFDMGDVLVGGETTGFCSGGCSAIADSGTSLLAGPTTIITQINHAIGASGVV  316

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+ECK++V  YG+ ++DLL  +A P+KICSQIGLC+ +G+R VSM IESVVD+ NG S  
Sbjct  317   SQECKSLVTEYGKTILDLLESKAAPQKICSQIGLCSSDGSRDVSMIIESVVDKHNGASNG  376

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             L D MC  CEM V+WMQNQ+  N+T ++I  YVN+LC+RLPSPMGES VDC  L++MP+V
Sbjct  377   LGDEMCRVCEMAVIWMQNQMRRNETADSIYDYVNQLCDRLPSPMGESAVDCSSLASMPNV  436

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF++G + F L+P +Y+L+VGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD
Sbjct  437   SFTVGNQTFGLTPQQYVLQVGEGPVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  496

Query  202   YGKMRVGFAEAA  167
             YG  RVGFAEAA
Sbjct  497   YGNSRVGFAEAA  508



>ref|XP_012087600.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Jatropha curcas]
 ref|XP_012087601.1| PREDICTED: aspartic proteinase A1-like isoform X1 [Jatropha curcas]
 gb|KDP24853.1| hypothetical protein JCGZ_24447 [Jatropha curcas]
Length=512

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/498 (69%), Positives = 414/498 (83%), Gaps = 9/498 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDT---  1475
             A S  N G +RIGLKK K+D+ NR A  +++K G+S+R + +KY   H RN DL+D+   
Sbjct  19    ALSVHNVGLIRIGLKKRKMDQVNRPAGTIDSKEGESMRTATKKY---HFRN-DLRDSGDA  74

Query  1474  DIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQ  1295
             + V LKNY+DAQYFGEIG+GTP Q FTVIFDTGSSNLWVPSSKCYFS+ C+FHS+Y SS+
Sbjct  75    EFVTLKNYLDAQYFGEIGIGTPSQTFTVIFDTGSSNLWVPSSKCYFSLACYFHSRYKSSE  134

Query  1294  SSTYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGI  1115
             SSTYEKNG SA I YGTGSI+GFFSQD+VQVGDLV++ Q FIEAT EPG+ F+VAKFDGI
Sbjct  135   SSTYEKNGTSAAIRYGTGSIAGFFSQDNVQVGDLVIRDQDFIEATKEPGIIFMVAKFDGI  194

Query  1114  LGLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGE  935
              GLGFQEISVG+A      MVNQGLV++ +FSFWLNRN + +EGGE+VFGGVDP HYKGE
Sbjct  195   FGLGFQEISVGNAVPVWYNMVNQGLVKEQVFSFWLNRNVKGEEGGEIVFGGVDPNHYKGE  254

Query  934   HTYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGA  755
             HTYVPVTQKGYWQFDMG+VLI+G+ TGFC+ GC AIADSGTSL+AGP+++IT INHAIGA
Sbjct  255   HTYVPVTQKGYWQFDMGDVLIDGETTGFCASGCKAIADSGTSLLAGPTTVITQINHAIGA  314

Query  754   DGVVSKECKAVVENYGQRMIDLLV-MEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN  578
              GVVS+ECK +VE YG+ +++LL+  +A+P+KICSQIG CTF+G +GVS  IESVVD   
Sbjct  315   SGVVSQECKTMVEQYGKVILELLLAQQAQPQKICSQIGFCTFDGTQGVSTNIESVVDASM  374

Query  577   GVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKL  401
                +D L DA C+ACEM VVW+QN+L  NQTQ+ IL+YVN+LC+RLPSP GES VDC  L
Sbjct  375   DRQSDGLQDAACTACEMMVVWIQNRLRLNQTQDQILNYVNQLCDRLPSPNGESAVDCSSL  434

Query  400   STMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGR  221
             S+M ++SF+IGGK F+L+P +Y+LKVGEG +AQCISGFTA D+PPPRGPLWILGDVFMG 
Sbjct  435   SSMANISFTIGGKAFELTPEQYVLKVGEGVSAQCISGFTAFDLPPPRGPLWILGDVFMGP  494

Query  220   YHTVFDYGKMRVGFAEAA  167
             YHTVFDYG + VGFA+AA
Sbjct  495   YHTVFDYGNLTVGFAKAA  512



>gb|KGN64503.1| Aspartic proteinase [Cucumis sativus]
Length=489

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/492 (70%), Positives = 400/492 (81%), Gaps = 40/492 (8%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S SNDG +R+GLKK+ +D  NR+AARLE+K  + L+A+ RKY N +G  G+  DTDIV L
Sbjct  37    SVSNDGLLRVGLKKINLDPENRLAARLESKDAEILKAAFRKY-NPNGNLGESSDTDIVAL  95

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS+KC FSV C FH++Y SS+SSTY+
Sbjct  96    KNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSAKCLFSVACHFHARYKSSRSSTYK  155

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNG SA I YGTG++SGFFS D+V+VGDLVVK+Q FIEAT EPG+TFLVAKFDG+LGLGF
Sbjct  156   KNGTSASIRYGTGAVSGFFSYDNVKVGDLVVKNQLFIEATREPGLTFLVAKFDGLLGLGF  215

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             QEI+VG A      MV QGLV++P+FSFWLNRN +E+EGGE+VFGGVDPKHYKG+HTYVP
Sbjct  216   QEIAVGSAVPVWYNMVEQGLVKEPVFSFWLNRNAEEEEGGEIVFGGVDPKHYKGKHTYVP  275

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQFDMG+VLI+GKPTG+C GGCSAIADSGTSL+AGP+                 
Sbjct  276   VTQKGYWQFDMGDVLIDGKPTGYCEGGCSAIADSGTSLLAGPT-----------------  318

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-  563
                                  A PKKICSQI LCTF+G RGVSMGIESVVDE  G S+D 
Sbjct  319   ---------------------ADPKKICSQIKLCTFDGTRGVSMGIESVVDENAGKSSDG  357

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             L D MCS CEMTVVWMQNQL +NQT+E I++Y+NELC+R+PSPMG+S VDCG LS+MPSV
Sbjct  358   LRDGMCSVCEMTVVWMQNQLRQNQTKERIINYINELCDRMPSPMGQSAVDCGTLSSMPSV  417

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IG KVFDL+P EYILKVGEG+AAQCISGFTA D+PPPRGPLWILGDVFMGRYHTVFD
Sbjct  418   SFTIGDKVFDLAPEEYILKVGEGAAAQCISGFTAFDIPPPRGPLWILGDVFMGRYHTVFD  477

Query  202   YGKMRVGFAEAA  167
             +GK+RVGFAEAA
Sbjct  478   FGKLRVGFAEAA  489



>ref|XP_004151126.1| PREDICTED: aspartic proteinase A1-like [Cucumis sativus]
 ref|XP_011650512.1| PREDICTED: aspartic proteinase A1-like [Cucumis sativus]
Length=513

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/493 (69%), Positives = 405/493 (82%), Gaps = 3/493 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             F  SNDG VRIGLK+ K  +NNR+A+++  K G SL+ SV KY       GD  D DIVG
Sbjct  23    FCASNDGKVRIGLKRRKFGQNNRVASKIATKEGISLKNSVEKY-QPSANLGDSDDFDIVG  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY++AQYFGEIG+GTPPQKF VIFDTGSSNLWVPSSKC FSV C  HSKY S +SSTY
Sbjct  82    LKNYLNAQYFGEIGIGTPPQKFAVIFDTGSSNLWVPSSKC-FSVACLLHSKYKSKRSSTY  140

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSA I YGTG+ISG+FS+D+V+VGDL+VK Q FIEAT EP +TF++A+FDGILGLG
Sbjct  141   KKNGKSASIKYGTGAISGYFSEDNVKVGDLIVKKQDFIEATREPSLTFVLAQFDGILGLG  200

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             F+EISVGDA      MV+Q LV++P+FSFW NRN  E++GGE+VFGGVDP HYKGEHTYV
Sbjct  201   FKEISVGDAVPVWYNMVDQNLVKEPVFSFWFNRNADEEQGGEIVFGGVDPDHYKGEHTYV  260

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+VLI G  TGFCSGGCSAIADSGTSL+AGP++IIT +NHAIGA GVV
Sbjct  261   PVTKKGYWQFDMGDVLINGSTTGFCSGGCSAIADSGTSLLAGPTTIITQVNHAIGASGVV  320

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+ECKAVV  YG+ +I +L+ + +PKKICS +GLC F+G RGVSMGIESVVD     S++
Sbjct  321   SEECKAVVAEYGETIIKMLLAKDQPKKICSTLGLCAFDGERGVSMGIESVVDNTTQKSSN  380

Query  562   -LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L D MC+ACEM VVW Q+QL E +TQ+ IL+Y++ LC +LPSPMGES +DC  LST+PS
Sbjct  381   GLRDVMCNACEMAVVWAQSQLKEEKTQDQILNYIDGLCEKLPSPMGESVIDCDSLSTLPS  440

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             +SF+IGGKVF+L P +Y+LKV EG   +CISGF ALDVPPPRGPLWILGDVFMG YHTVF
Sbjct  441   ISFTIGGKVFELKPEQYVLKVTEGPVTECISGFAALDVPPPRGPLWILGDVFMGSYHTVF  500

Query  205   DYGKMRVGFAEAA  167
             DYG  RVGFAEAA
Sbjct  501   DYGNSRVGFAEAA  513



>emb|CAA57510.1| cyprosin [Cynara cardunculus]
Length=509

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/496 (71%), Positives = 414/496 (83%), Gaps = 11/496 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDT--D  1472
             AFS SN G +R+GLKK K+D+ N+++       G S+ A  RK +   G  G L+D+  D
Sbjct  22    AFSVSNGGLLRVGLKKRKVDQINQLSGH-----GVSMEAKARKDF---GFGGALRDSGSD  73

Query  1471  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQS  1292
             I+ LKNYMDAQY+GEIG+G+PPQKFTVIFDTGSSNLWVPS+KCYFSV C FHSKY SS S
Sbjct  74    IIALKNYMDAQYYGEIGIGSPPQKFTVIFDTGSSNLWVPSAKCYFSVACLFHSKYKSSHS  133

Query  1291  STYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGIL  1112
             STY+KNG SA I YGTGSISGF SQDSV++GDLVVK Q FIEAT EPG+TFL AKFDGIL
Sbjct  134   STYKKNGTSAAIQYGTGSISGFVSQDSVKLGDLVVKEQDFIEATKEPGITFLAAKFDGIL  193

Query  1111  GLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEH  932
             GLGFQEISVG +      MVNQGLVQ+P+FSFW NRN  E+EGGELVFGGVDP H+KG+H
Sbjct  194   GLGFQEISVGKSVPLWYNMVNQGLVQEPVFSFWFNRNADEEEGGELVFGGVDPNHFKGKH  253

Query  931   TYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGAD  752
             TYVPVT+KGYWQFDMG+VLIE K TGFCS GC+AIADSGTSL+AGP++IIT INHAIGA 
Sbjct  254   TYVPVTEKGYWQFDMGDVLIEDKTTGFCSDGCAAIADSGTSLLAGPTAIITEINHAIGAK  313

Query  751   GVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGV  572
             GV+S++CK +V  YG+ MI++L+ EA+P KICSQ+ LCTF+G R  S  IESVVDE NG 
Sbjct  314   GVMSQQCKTLVSQYGKTMIEMLLSEAQPDKICSQMKLCTFDGARDASSIIESVVDENNGK  373

Query  571   SAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLST  395
             S+  +HD MC+ CEM VVWMQNQ+  N+T++NI++YVNELC+RLPSPMGES VDC  LS+
Sbjct  374   SSSGVHDEMCTFCEMAVVWMQNQIKRNETEDNIINYVNELCDRLPSPMGESAVDCNSLSS  433

Query  394   MPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYH  215
             MP+++F+IGGKVF+L P +YILK+GEG AAQCISGFTA+DV PPRGPLWILGDVFMGRYH
Sbjct  434   MPNIAFTIGGKVFELCPEQYILKIGEGEAAQCISGFTAMDVAPPRGPLWILGDVFMGRYH  493

Query  214   TVFDYGKMRVGFAEAA  167
             TVFDYGK+RVGFAEAA
Sbjct  494   TVFDYGKLRVGFAEAA  509



>ref|XP_009394234.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/490 (70%), Positives = 401/490 (82%), Gaps = 7/490 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             S DG VRIGLKK  +D+N+R AARL        R S+ + +    +NG  +D DI+ LKN
Sbjct  26    SADGLVRIGLKKKPLDENDRFAARLVQDG----RRSISREHGFRLKNG--EDVDIISLKN  79

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YM+AQYFGE+G+G+P QKFTVIFDTGSSNLWVPSSKCYFS+ CFFHS+Y S++SS+Y+KN
Sbjct  80    YMNAQYFGEVGIGSPSQKFTVIFDTGSSNLWVPSSKCYFSIACFFHSRYKSTRSSSYQKN  139

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKSA IHYG+GSISGFFSQD V VG LVVKSQ FIEAT EP  TFLVAKFDGILGLGF+E
Sbjct  140   GKSAAIHYGSGSISGFFSQDHVTVGGLVVKSQDFIEATREPSATFLVAKFDGILGLGFKE  199

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG A      MV QGLV++P+FSFW NR+  E EGGE+VFGGVDP HYKGEHTYVPVT
Sbjct  200   ISVGKAVPVWYNMVKQGLVKEPVFSFWFNRHADEGEGGEIVFGGVDPNHYKGEHTYVPVT  259

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQF+MG+VLI G+ TGFC GGC+AIADSGTSLIAGP++II  IN  IGA GVVS+E
Sbjct  260   QKGYWQFNMGDVLIGGESTGFCDGGCAAIADSGTSLIAGPTTIIAEINQKIGASGVVSQE  319

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-  557
             CKAVV  YGQ+++ +L+ E  P KICSQIGLCTF+G RGVS+ IESVV+E    S+ +  
Sbjct  320   CKAVVAQYGQQILKMLLSETEPAKICSQIGLCTFDGTRGVSIDIESVVNENADASSGVQT  379

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             ++MC  CEM+VVWMQNQL +NQTQE +L+Y+N LC RLPSPMGES VDC  +S+MP VSF
Sbjct  380   NSMCGVCEMSVVWMQNQLRQNQTQERVLNYINGLCERLPSPMGESSVDCAAISSMPGVSF  439

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IG K F+L+  +YILKVGEG+AAQCISGFTALDVPPPRGPLWILGDVFMG YHTVFDY 
Sbjct  440   TIGNKTFELAAEQYILKVGEGAAAQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFDYR  499

Query  196   KMRVGFAEAA  167
              +RVGFAEAA
Sbjct  500   NLRVGFAEAA  509



>gb|ABG37021.1| aspartic protease [Nicotiana tabacum]
Length=508

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/492 (68%), Positives = 403/492 (82%), Gaps = 6/492 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS SNDG +R+G+KK K+D+ N+    +++   +S R      Y+L G  GD  DTDI+ 
Sbjct  23    FSVSNDGLIRVGIKKRKLDQINQAFGGIDSNGANSART-----YHLGGNIGD-SDTDIIA  76

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY+DAQYFGEI +G+PPQKFTVIFDTGSSNLWVPS++CYFS+ C+ H KY SS SSTY
Sbjct  77    LKNYLDAQYFGEICIGSPPQKFTVIFDTGSSNLWVPSARCYFSLACYLHPKYKSSHSSTY  136

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNG SA I YGTGSISG+FS D+V+VGDL+VK Q FIEAT EPG+TFL AKFDGILGLG
Sbjct  137   KKNGTSAAIRYGTGSISGYFSNDNVKVGDLIVKDQDFIEATREPGITFLAAKFDGILGLG  196

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG +      MVNQGLV+ P+FSFW NRN QE+EGGELVFGGVDP H+KG+HTYV
Sbjct  197   FQEISVGKSVPVWYNMVNQGLVKKPVFSFWFNRNAQEEEGGELVFGGVDPNHFKGKHTYV  256

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT KGYWQFDMG+VL+ G+ TGFCSGGCSAIADSGTSL+AGP++IIT INH IGA GVV
Sbjct  257   PVTHKGYWQFDMGDVLVGGETTGFCSGGCSAIADSGTSLLAGPTTIITQINHVIGASGVV  316

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+ECK++V  YG+ ++DLL  +A P+KICSQIGLC+ +G+R VSM IESVVD+ NG S  
Sbjct  317   SQECKSLVTEYGKTILDLLESKAAPQKICSQIGLCSSDGSRDVSMIIESVVDKHNGASNG  376

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             L D MC  CEM V+WMQNQ+  N+T ++I  YVN+LC+RLPSPMGES VDC  L++MP+V
Sbjct  377   LGDEMCRVCEMAVIWMQNQMRRNETADSIYDYVNQLCDRLPSPMGESAVDCSSLASMPNV  436

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF++G + F L+P +Y+L+VGEG  AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD
Sbjct  437   SFTVGNQTFGLTPQQYVLQVGEGPVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  496

Query  202   YGKMRVGFAEAA  167
             YG  RVGFAEAA
Sbjct  497   YGNSRVGFAEAA  508



>ref|XP_006301275.1| hypothetical protein CARUB_v10021675mg [Capsella rubella]
 gb|EOA34173.1| hypothetical protein CARUB_v10021675mg [Capsella rubella]
Length=514

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/490 (70%), Positives = 416/490 (85%), Gaps = 3/490 (1%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             +++DG  R+ LKK+K+D +NR+AAR  +    +L++S+R Y N  G  GD  DTDIV LK
Sbjct  26    RNDDGTFRVSLKKLKLDPHNRLAARFGSNQEKALKSSLRSYSNNLG--GDSGDTDIVALK  83

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KC+FS+ CFFH+KY SS+SSTY+K
Sbjct  84    NYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFFSLSCFFHAKYKSSRSSTYKK  143

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             +GK A IHYG+GSISGFFS D+V VGDLVV+ Q FIEATSEPG+TFLVAKFDG+LGLGFQ
Sbjct  144   SGKRAAIHYGSGSISGFFSSDAVTVGDLVVRDQEFIEATSEPGLTFLVAKFDGLLGLGFQ  203

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG+A      M+ QGL++ P+FSFWLNR+P+ +EGGE+VFGGVDPKH++GEHTYVPV
Sbjct  204   EISVGNATPVWYNMLTQGLIKKPVFSFWLNRDPKSEEGGEIVFGGVDPKHFRGEHTYVPV  263

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             TQ+GYWQFDMGEVLI G+ TG+C  GCSAIADSGTSL+AGP+++I MIN AIGA GVVS+
Sbjct  264   TQRGYWQFDMGEVLIAGESTGYCGSGCSAIADSGTSLLAGPTAVIAMINKAIGASGVVSQ  323

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADL  560
             +CK VV+ YGQ +++LL+ + +PKKICSQIGLCTF+G +GVSMGIESVVD++   +S  L
Sbjct  324   QCKTVVDQYGQTILELLLAKTQPKKICSQIGLCTFDGTKGVSMGIESVVDKETAKLSNGL  383

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
               A C ACEM VVW+Q+QL +N TQE I++YVNE+C R+PSP GES VDC +LS MP+VS
Sbjct  384   RGAGCPACEMAVVWIQSQLRQNMTQERIVNYVNEMCERMPSPNGESAVDCSQLSKMPTVS  443

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGKVFDL+P EYILK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMG+YHTVFD+
Sbjct  444   FTIGGKVFDLAPEEYILKIGEGPVAQCISGFTALDIPPPRGPLWILGDVFMGKYHTVFDF  503

Query  199   GKMRVGFAEA  170
             G  RVGFAEA
Sbjct  504   GNERVGFAEA  513



>gb|KHN03495.1| Aspartic proteinase [Glycine soja]
Length=510

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/493 (70%), Positives = 414/493 (84%), Gaps = 6/493 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             +   N G  RIGLKK+K+D  NR+AAR+ +K  DS RAS+RK++ L    G  ++TDIV 
Sbjct  23    YCAPNAGLRRIGLKKIKLDPKNRLAARVGSKDVDSFRASIRKFH-LQNNFGGTEETDIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY+DAQY+GEI +GT PQKF VIFDTGSSNLWVPSSKC FSV C+FH+KY SS+SST+
Sbjct  82    LKNYLDAQYYGEIAIGTSPQKFAVIFDTGSSNLWVPSSKCTFSVACYFHAKYKSSKSSTF  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNG +A I YGTG+ISGFFS DSV+VG++V     FIEAT EPGVTFL AKFDGILGLG
Sbjct  142   KKNGTAAAIQYGTGAISGFFSYDSVRVGEIV----EFIEATREPGVTFLAAKFDGILGLG  197

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MV+QGL+++P+FSFW NRNP+E+EGGE+VFGGVDP HYKG+HTYV
Sbjct  198   FQEISVGNAAPVWYNMVDQGLLKEPVFSFWFNRNPEEEEGGEIVFGGVDPAHYKGKHTYV  257

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+VLI GKPTG+C+ GCSAIADSGTSL+AGP+++ITMINHAIGA GV+
Sbjct  258   PVTRKGYWQFDMGDVLIGGKPTGYCANGCSAIADSGTSLLAGPTTVITMINHAIGASGVM  317

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS-A  566
             S+ECK +V  YGQ ++DLL+ E +PKKICS+IGLC F+G  GV +GI+SVVDE    S  
Sbjct  318   SQECKTIVAEYGQTILDLLLAETQPKKICSRIGLCAFDGTHGVDVGIKSVVDENERKSLG  377

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
               H A C ACEM VVWMQNQLS NQTQ+ ILSY+N+LC+++PSPMGES VDCG +S++P 
Sbjct  378   GHHGAACPACEMAVVWMQNQLSRNQTQDQILSYINQLCDKMPSPMGESAVDCGDISSLPV  437

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+IGG+ FDLSP EY+LKVGEG  AQCISGFTA+D+PPPRGPLWILGDVFMGRYHTVF
Sbjct  438   VSFTIGGRTFDLSPEEYVLKVGEGPVAQCISGFTAIDIPPPRGPLWILGDVFMGRYHTVF  497

Query  205   DYGKMRVGFAEAA  167
             D+GK+RVGFA+AA
Sbjct  498   DFGKLRVGFADAA  510



>ref|XP_004961190.1| PREDICTED: aspartic proteinase oryzasin-1-like [Setaria italica]
Length=507

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/495 (68%), Positives = 404/495 (82%), Gaps = 13/495 (3%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRN--GDLQDTDIV  1466
             + + +G VRI LKK  ID+N+R+A RL A+    L         L G N  G   + DI+
Sbjct  22    ASAAEGLVRIALKKRAIDQNSRVAERLSAEEKQRL---------LRGANSLGSGGEGDII  72

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYM+AQYFGEIGVGTP QKFTVIFDTGSSNLWVPSSKCYFS+ C+FHS+Y S QSST
Sbjct  73    ALKNYMNAQYFGEIGVGTPAQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSRYKSGQSST  132

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y++NGK A IHYGTG+I+GFFS+DSV +G LVVK Q FIEAT EPG+TF+VAKFDGILGL
Sbjct  133   YKENGKPAAIHYGTGAIAGFFSEDSVTLGGLVVKDQEFIEATKEPGLTFMVAKFDGILGL  192

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      M+ QGL+ DP+FSFW NR+  E EGGE+VFGG+DP HYKG HTY
Sbjct  193   GFQEISVGNAVPVWYNMIKQGLISDPVFSFWFNRHAGEGEGGEIVFGGMDPNHYKGNHTY  252

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQF+MG+VL++GK TGFC GGC+AIADSGTSL+AGP++IIT IN  IGA GV
Sbjct  253   VPVTQKGYWQFNMGDVLVDGKSTGFCKGGCAAIADSGTSLLAGPTAIITEINEKIGAAGV  312

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS+ECK VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD++ G S 
Sbjct  313   VSQECKTVVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSAGIRSVVDDEAGKSN  372

Query  565   D--LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
                  D MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC+RLPSPMGES VDC  L +M
Sbjct  373   GGLRSDPMCNACEMAVVWMQNQLAQNKTQELILNYINQLCDRLPSPMGESSVDCASLKSM  432

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P+++F+IGGK F L P +YILKVGEGSAAQCISGFTA+D+PPPRGPLWILGDVFMG YHT
Sbjct  433   PNIAFTIGGKKFSLKPEQYILKVGEGSAAQCISGFTAIDIPPPRGPLWILGDVFMGAYHT  492

Query  211   VFDYGKMRVGFAEAA  167
             VFDYGK+RVGFA++A
Sbjct  493   VFDYGKLRVGFADSA  507



>gb|AJA72485.1| arctiumsin [Arctium minus]
Length=509

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/494 (70%), Positives = 410/494 (83%), Gaps = 7/494 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AFS SN G +R+GLKK K+D+ N++        G S+    RK +   G   D  D+DI+
Sbjct  22    AFSVSNGGLIRVGLKKRKVDQINQLRGH-----GASMEGKARKDFGFGGTLRD-SDSDII  75

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQY+GEIG+G PPQKFTVIFDTGSSNLWVPS+KCYFSV C FHSKY SS SST
Sbjct  76    ALKNYMDAQYYGEIGIGAPPQKFTVIFDTGSSNLWVPSAKCYFSVACLFHSKYKSSHSST  135

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+KNG SA I YGTGSISGF SQDSV++GDLVVK Q FIEAT EPGVTFL AKFDGILGL
Sbjct  136   YKKNGTSAAIQYGTGSISGFVSQDSVKLGDLVVKEQDFIEATKEPGVTFLAAKFDGILGL  195

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG +      MVNQGLV +P+FSFW NRN  E+EGGELVFGGVDP H+KG+HTY
Sbjct  196   GFQEISVGKSVPVWYNMVNQGLVPEPVFSFWFNRNADEEEGGELVFGGVDPNHFKGKHTY  255

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVT+KGYWQFDMG+VLIE K TGFCS GC+AIADSGTSL+AGP+++IT INHAIGA GV
Sbjct  256   VPVTEKGYWQFDMGDVLIEDKTTGFCSDGCAAIADSGTSLLAGPTAVITQINHAIGAKGV  315

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             +S++CK +V  YG+ +I++L+ EA+P KICSQ+ LCTF+G R VS  IESVVD+ NG S+
Sbjct  316   MSQQCKTLVSQYGKTIIEMLLSEAQPDKICSQMKLCTFDGARDVSSIIESVVDKSNGKSS  375

Query  565   -DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               +HD MC+ CEM VVWMQNQ+  N+T++NI++YVNELC+RLPSPMGES VDC  LS+MP
Sbjct  376   GGVHDEMCTFCEMAVVWMQNQIKRNETEDNIINYVNELCDRLPSPMGESAVDCNSLSSMP  435

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +++F+IGGKVF+L P +YILK+GEG AAQCISGFTA+DVPPPRGPLWILGDVFMGRYHTV
Sbjct  436   NIAFTIGGKVFELCPEQYILKIGEGEAAQCISGFTAMDVPPPRGPLWILGDVFMGRYHTV  495

Query  208   FDYGKMRVGFAEAA  167
             FDYGK+RVGFAEAA
Sbjct  496   FDYGKLRVGFAEAA  509



>ref|XP_004243484.1| PREDICTED: cyprosin-like [Solanum lycopersicum]
Length=508

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/492 (69%), Positives = 399/492 (81%), Gaps = 6/492 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS SNDG VR+ +KK K+D+ N +   +++    S R      Y L G  GD  D+ I+ 
Sbjct  23    FSVSNDGLVRVEIKKRKLDQTNHVFGGIDSNGVHSARK-----YRLGGNVGD-SDSGIIA  76

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY+DAQYFGEI +G+PPQKFTVIFDTGSSNLWVPS+KC+FS+ C+ H KY SS SSTY
Sbjct  77    LKNYLDAQYFGEISIGSPPQKFTVIFDTGSSNLWVPSAKCHFSLACYLHPKYKSSHSSTY  136

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNG SA IHYGTGSISG+FS D+V+VGDLVVK Q FIEAT EPG+TFL AKFDGILGLG
Sbjct  137   KKNGTSAAIHYGTGSISGYFSNDNVKVGDLVVKDQDFIEATREPGITFLAAKFDGILGLG  196

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      MVNQGLV+  +FSFW NRN +E+EGGELVFGGVDP H+KGEHTYV
Sbjct  197   FQEISVGKAVPVWYNMVNQGLVKQSVFSFWFNRNAEEEEGGELVFGGVDPNHFKGEHTYV  256

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT KGYWQFDMG+VL+ G+ TGFCSGGCSAIADSGTSL+AGP++IIT INHAIGA GVV
Sbjct  257   PVTHKGYWQFDMGDVLVGGETTGFCSGGCSAIADSGTSLLAGPTTIITQINHAIGASGVV  316

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+ECK+VV  YG+ ++DLL  +A P++ICSQIGLC+ +G + VSM IESVVD+ N  S  
Sbjct  317   SQECKSVVSEYGKTILDLLESKAAPQQICSQIGLCSRDGGKDVSMIIESVVDKHNEASNG  376

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             +HD MC  CEM VVWMQNQL  N+T + I  Y+N+LC+R+PSPMGES VDC  L++MP+V
Sbjct  377   VHDEMCRVCEMAVVWMQNQLRRNETADRIFDYMNKLCDRIPSPMGESAVDCNSLASMPNV  436

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF++G K F+L+P +Y+LKVGE   AQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD
Sbjct  437   SFTVGDKTFELTPQQYVLKVGEAPVAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  496

Query  202   YGKMRVGFAEAA  167
             Y KMRVGFAEAA
Sbjct  497   YEKMRVGFAEAA  508



>ref|XP_004293311.1| PREDICTED: aspartic proteinase A1 [Fragaria vesca subsp. vesca]
Length=512

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/490 (71%), Positives = 414/490 (84%), Gaps = 7/490 (1%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY-YNLHGRNGDLQDTDIVGLKN  1454
             NDG VRIGLKK+K D N R+AA  +   G     S+RKY +  +  + + +D DIV LKN
Sbjct  28    NDGLVRIGLKKVKPDANQRLAAGYKNGEG-----SIRKYRFGSNVGDAEGEDIDIVKLKN  82

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             Y+DAQY+GEI +GTPPQ FTVIFDTGSSNLWVPS+KCYFSV C+FH+KY SS SSTY+KN
Sbjct  83    YLDAQYYGEIAIGTPPQPFTVIFDTGSSNLWVPSNKCYFSVACYFHAKYKSSDSSTYKKN  142

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKSA I YGTGSISGFFS D+V+VGDLVVK Q FIEATSEPG+TFL AKFDG+LGLGFQE
Sbjct  143   GKSAAIQYGTGSISGFFSNDNVKVGDLVVKDQEFIEATSEPGLTFLAAKFDGLLGLGFQE  202

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG+A      M+ QGL+++P+FSFW+NR    QEGGELVFGGVDP H+KG+HTYVPVT
Sbjct  203   ISVGNAVPVWYNMIKQGLIKEPVFSFWMNRKVAAQEGGELVFGGVDPNHFKGKHTYVPVT  262

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             +KGYWQFDMG+VLI  KPTG+C+GGC+AIADSGTSL+AGP++++ MIN AIGA+GVVS+E
Sbjct  263   KKGYWQFDMGDVLIGDKPTGYCAGGCNAIADSGTSLLAGPTTVVAMINKAIGANGVVSQE  322

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADLH  557
             CKAVV+ YGQ +++LL+ EA+P+KICSQIG+CTF+G R VSMGIESVVD+ +   S  LH
Sbjct  323   CKAVVQQYGQTILELLLAEAQPRKICSQIGVCTFDGTRSVSMGIESVVDKNRKKSSGVLH  382

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             DA CSACEM VVWMQNQL +NQTQE IL+YVNELC+R+PSP G+S VDC +LSTMP++SF
Sbjct  383   DASCSACEMAVVWMQNQLQQNQTQEFILNYVNELCDRMPSPNGQSAVDCQRLSTMPTISF  442

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGKVF L   EY+LKVGEG+ AQCISGF  +DVPPPRGPLWILGDVFMGRYHTVFDYG
Sbjct  443   TIGGKVFPLRAEEYVLKVGEGAQAQCISGFIGMDVPPPRGPLWILGDVFMGRYHTVFDYG  502

Query  196   KMRVGFAEAA  167
             K RVGFAEAA
Sbjct  503   KKRVGFAEAA  512



>ref|XP_009415269.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=514

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/492 (71%), Positives = 411/492 (84%), Gaps = 4/492 (1%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S   DGF+RIGLKK  +D+++R+A+R+  K   SL     + Y L     D  D D + L
Sbjct  26    SAEEDGFIRIGLKKKPLDESSRLASRIMDKERKSLMG---RKYGLGDGLEDEGDADYISL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYM+AQYFGEIGVGTP QKFTVIFDTGSSNLWVPS+KCYFS+ C+FHSKY SS+SS+Y+
Sbjct  83    KNYMNAQYFGEIGVGTPAQKFTVIFDTGSSNLWVPSAKCYFSLACYFHSKYKSSKSSSYK  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A I YG+GSISGFFSQD V VGDLVVK Q FIEAT EP VTFLVAKFDGILGLGF
Sbjct  143   KNGKPAAIRYGSGSISGFFSQDHVTVGDLVVKDQVFIEATREPSVTFLVAKFDGILGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVG+       +V QGLV++PIFSFW NRN ++ EGGE+VFGGVDP HYKGEHTYVP
Sbjct  203   KEISVGNVTPVWYNIVEQGLVKEPIFSFWFNRNSEDGEGGEIVFGGVDPSHYKGEHTYVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQF MG+V+I G+ TG+C+GGC+AIADSGTSL+AGP++II  INH IGA GVVS
Sbjct  263   VTQKGYWQFKMGDVMIGGQSTGYCAGGCAAIADSGTSLLAGPTTIIAEINHKIGASGVVS  322

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECKAVV  YGQ+++DLL+ E +P KIC+QIGLCTF+G RG+S+G+ESVV++   +SA L
Sbjct  323   QECKAVVAEYGQQILDLLLAETQPAKICAQIGLCTFDGTRGISIGLESVVNDNGDISAGL  382

Query  559   H-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
               DAMCSACEM VVWMQNQL +NQT+E+IL+Y+NELC+RLPSPMGES VDCG L++MP V
Sbjct  383   QSDAMCSACEMAVVWMQNQLRQNQTKEHILNYINELCDRLPSPMGESAVDCGALASMPGV  442

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IGGKVF+L P +YILKVGEGS AQCISGFTA D+PPPRGPLWILGDVFMG YHTVFD
Sbjct  443   SFTIGGKVFELKPEQYILKVGEGSVAQCISGFTAFDIPPPRGPLWILGDVFMGAYHTVFD  502

Query  202   YGKMRVGFAEAA  167
             YG +R+GFAEAA
Sbjct  503   YGNLRIGFAEAA  514



>emb|CAA70340.1| aspartic proteinase [Centaurea calcitrapa]
Length=509

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/494 (70%), Positives = 411/494 (83%), Gaps = 7/494 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AFS SN G +R+GLKK K+D+ N++        G S+    RK +   G   D  D+DI+
Sbjct  22    AFSASNGGLLRVGLKKRKVDQINQLRNH-----GASMEGKARKDFGFGGSLRD-SDSDII  75

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQY+GEIG+G+P QKFTVIFDTGSSNLWVPS+KCYFSV C FHSKY SS SST
Sbjct  76    ELKNYMDAQYYGEIGIGSPAQKFTVIFDTGSSNLWVPSAKCYFSVACLFHSKYKSSHSST  135

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+KNG SA I YGTGSISGF SQDSV++GDLVVK Q FIEAT EPGVTFL AKFDGILGL
Sbjct  136   YKKNGTSAAIQYGTGSISGFVSQDSVKLGDLVVKEQDFIEATKEPGVTFLAAKFDGILGL  195

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG +      MVNQGLVQ+P+FSFW NRN  E+EGGELVFGGVDP H+KG+HTY
Sbjct  196   GFQEISVGKSVPVWYNMVNQGLVQEPVFSFWFNRNADEEEGGELVFGGVDPNHFKGKHTY  255

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQF+MG+VLIE K TGFC+ GC+AIADSGTSL+AGP++IIT INHAIGA GV
Sbjct  256   VPVTQKGYWQFNMGDVLIEDKTTGFCADGCAAIADSGTSLLAGPTAIITQINHAIGAKGV  315

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             +S++CK +V+ YG+ +I++L+ EA+P KICSQ+ LCTF+G R VS  IESVVD+ NG S+
Sbjct  316   MSQQCKTLVDQYGKTIIEMLLSEAQPDKICSQMKLCTFDGARDVSSIIESVVDKNNGKSS  375

Query  565   -DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               +HD MC+ CEM VVWMQNQ+  NQT++NI++YVNELC+RLPSPMGES VDC  LS+MP
Sbjct  376   GGVHDEMCTFCEMAVVWMQNQIKRNQTEDNIINYVNELCDRLPSPMGESAVDCNDLSSMP  435

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +++F+IGGKVF+L P +YILK+GEG AAQCISGFTA+DV PPRGPLWILGDVFMG+YHTV
Sbjct  436   NIAFTIGGKVFELCPEQYILKIGEGEAAQCISGFTAMDVAPPRGPLWILGDVFMGQYHTV  495

Query  208   FDYGKMRVGFAEAA  167
             FDYGK+RVGFAEAA
Sbjct  496   FDYGKLRVGFAEAA  509



>ref|XP_004486175.1| PREDICTED: aspartic proteinase-like isoform X1 [Cicer arietinum]
 ref|XP_004486176.1| PREDICTED: aspartic proteinase-like isoform X2 [Cicer arietinum]
 gb|AIA58652.1| aspartic proteinase [Cicer arietinum]
Length=508

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/489 (69%), Positives = 405/489 (83%), Gaps = 8/489 (2%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  1451
             N+G  RIGLKK+K+  N+     L+   GD  ++ +RKY   +   G ++  D+V LKNY
Sbjct  27    NEGLRRIGLKKIKLGPND-----LKGLKGD--QSIIRKYRLENNILGGIEKADVVALKNY  79

Query  1450  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNG  1271
             +DAQY+GEI +GTPPQKFTVIFDTGSSN WVPS +CYFS+ C  H+KY SSQSSTY  NG
Sbjct  80    LDAQYYGEITIGTPPQKFTVIFDTGSSNTWVPSVRCYFSLACLVHAKYRSSQSSTYRPNG  139

Query  1270  KSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEI  1091
              SA I YGTG++SGFFS D+V VGD+V+K Q FIE T EPGVTF+ AKFDG+LGLGFQEI
Sbjct  140   TSASIQYGTGAVSGFFSYDNVGVGDIVIKDQEFIETTREPGVTFVAAKFDGLLGLGFQEI  199

Query  1090  SVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQ  911
             SVG A      MV QGLV+DP+FSFWLNR P+E+EGGE+VFGGVDP H+KGEHTYVPVT+
Sbjct  200   SVGKAVPIWYNMVEQGLVKDPVFSFWLNRKPEEEEGGEIVFGGVDPAHFKGEHTYVPVTR  259

Query  910   KGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKEC  731
             KGYWQFDMG+VLI+GKPTG+C+  CSAIADSGTSL+AGP+++ITMIN AIGA GV S+EC
Sbjct  260   KGYWQFDMGDVLIDGKPTGYCANDCSAIADSGTSLLAGPTTVITMINQAIGASGVASQEC  319

Query  730   KAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA-DLHD  554
             ++ V+ YGQ ++ LL+ E +PKKICSQIGLCTF+G  GVSMGI+SVV++ + +S+  L D
Sbjct  320   RSFVDQYGQTILQLLLTETQPKKICSQIGLCTFDGTHGVSMGIQSVVEQTDRISSGGLQD  379

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
             A CS CEM VVWMQNQL +NQT+E IL+YV+ LC+++P+PMG+S VDC K+S+MP VSF+
Sbjct  380   ASCSVCEMAVVWMQNQLRQNQTEERILNYVHSLCDKMPNPMGQSSVDCAKISSMPVVSFT  439

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IGGK FDLS  EYILKVGEGSAAQCISGFTALDVPPPRGPLWILGD+FMGRYHTVFDYGK
Sbjct  440   IGGKKFDLSSQEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDIFMGRYHTVFDYGK  499

Query  193   MRVGFAEAA  167
             +RVGFA+AA
Sbjct  500   LRVGFAQAA  508



>gb|KHG16917.1| Asparticase [Gossypium arboreum]
Length=551

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/474 (72%), Positives = 401/474 (85%), Gaps = 2/474 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
              + S+DG VRIGLKK K D NNR+A+RLE++   +L AS+++ Y LH  +GD +DTDIV 
Sbjct  70    MTASDDGLVRIGLKKKKFDPNNRLASRLESEDRQALIASMQEKYGLHNNHGDHEDTDIVA  129

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQY+GEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSV C+FHSKY +S+S TY
Sbjct  130   LKNYMDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKASESKTY  189

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGK A I YGTG+ISGFFS D+VQ+G+LVV+ Q FIE T EPG+ FL AKFDGILGLG
Sbjct  190   KKNGKPASIQYGTGAISGFFSYDNVQIGNLVVEDQEFIETTKEPGLIFLAAKFDGILGLG  249

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             F+EISVG A      M+ QGL+++P+FSFWLNRN  E+ GGE+VFGGVDP HYKG+HTYV
Sbjct  250   FKEISVGKA-VPVYNMLKQGLIKEPVFSFWLNRNVGEEVGGEIVFGGVDPDHYKGKHTYV  308

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+VLI  KPTGFC+GGC+AIADSGTSL+AGP+++ITMINHAIGA GVV
Sbjct  309   PVTQKGYWQFDMGDVLIGDKPTGFCAGGCAAIADSGTSLLAGPTTVITMINHAIGATGVV  368

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+ECKAVV+ YGQ +IDLL+ E +P+KICSQIGLCTF+G  GVS GIESVV+E NG S+ 
Sbjct  369   SQECKAVVQQYGQTIIDLLLAETQPQKICSQIGLCTFDGAHGVSTGIESVVEEGNGKSSG  428

Query  562   LH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
             +  +AMC ACEM VVWMQNQL +NQTQ+ IL+YVN+LC+R+PSPMGES V+CG LS+MP+
Sbjct  429   VQGNAMCPACEMAVVWMQNQLKQNQTQDIILNYVNQLCDRMPSPMGESAVECGSLSSMPT  488

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMG  224
             VSF+IG +VFDLSP EYILKVGEG  AQCISGFTALDVPPPRG L I    F G
Sbjct  489   VSFTIGDEVFDLSPEEYILKVGEGPQAQCISGFTALDVPPPRGLLCIFVRCFHG  542



>emb|CAM12780.1| aspartic proteinase [Fagopyrum esculentum]
Length=506

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/494 (70%), Positives = 405/494 (82%), Gaps = 8/494 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S +N+  VR+GLKK K+D  NR A+R   K        + + Y L    GD  DT I+
Sbjct  20    ALSVANNDLVRVGLKKRKLDPTNRPASRFGCKK------HLMQKYGLGNGFGD-DDTGII  72

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQYFGEI +GTP Q FTVIFDTGSSNLWVPS KCY S+ CFFHSKY SS+SST
Sbjct  73    SLKNYMDAQYFGEIAIGTPSQTFTVIFDTGSSNLWVPSGKCYLSIACFFHSKYKSSKSST  132

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y KNGKSAEIHYGTG+ISG+FSQD+V+VGDLVV++Q FIEAT EP +TF+ AKFDGILGL
Sbjct  133   YVKNGKSAEIHYGTGAISGYFSQDNVKVGDLVVENQEFIEATREPSLTFVAAKFDGILGL  192

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG A      MVNQGLV +P+FSFWLNRN  E+ GGE+VFGG+DP H+KGEHTY
Sbjct  193   GFQEISVGKAVPVWYNMVNQGLVNEPVFSFWLNRNADEEVGGEIVFGGIDPAHHKGEHTY  252

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             +PVTQKGYWQFD+ +VL+ G+ TGFCSGGCSAIADSGTSL+AGP+ ++  INHAIGA GV
Sbjct  253   LPVTQKGYWQFDLDDVLVGGESTGFCSGGCSAIADSGTSLLAGPTPVVAQINHAIGASGV  312

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVS  569
             VS+ECK VV  YG++++DLLV + +P+KICSQIGLCTF+G RGVSMGIESVVD+  +  S
Sbjct  313   VSQECKTVVSQYGKQILDLLVSQTQPRKICSQIGLCTFDGTRGVSMGIESVVDKNVDKSS  372

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
              +L DA CSACEM VVWMQNQL +NQT++ IL Y N+LC RLPSPMGES VDCG LST+P
Sbjct  373   GNLKDATCSACEMAVVWMQNQLKQNQTEDRILDYANQLCERLPSPMGESAVDCGSLSTLP  432

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VSF++GGK F L+P +YIL+VGEG A QCISGF ALDVPPPRGPLWILGD+FMG+YHTV
Sbjct  433   TVSFTLGGKTFALAPEQYILQVGEGPATQCISGFIALDVPPPRGPLWILGDIFMGQYHTV  492

Query  208   FDYGKMRVGFAEAA  167
             FD+G M+VGFAEAA
Sbjct  493   FDHGNMQVGFAEAA  506



>gb|AFB73927.2| preprocirsin [Cirsium vulgare]
Length=509

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/494 (70%), Positives = 408/494 (83%), Gaps = 7/494 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S SNDG +R+GLKK K+D+ N+++       G S+    RK +   G   D  D+DI+
Sbjct  22    AISVSNDGLIRVGLKKRKVDQINQLSGH-----GASMEGKARKDFGFGGTLRD-SDSDII  75

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQY+GEIG+G PPQKFTVIFDTGSSNLWVPS+KCYFSV C FHSKY SS SST
Sbjct  76    ALKNYMDAQYYGEIGIGAPPQKFTVIFDTGSSNLWVPSAKCYFSVACLFHSKYKSSHSST  135

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+KNG SA I YGTGSISGF SQDSV++GDLVVK Q FIEAT EPG+TFL AKFDGILGL
Sbjct  136   YKKNGTSAAIQYGTGSISGFVSQDSVKLGDLVVKEQDFIEATKEPGITFLAAKFDGILGL  195

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG +      MVNQGLVQ+P+FSFW NRN  E+EGGELVFGGVDP H+KG+HTY
Sbjct  196   GFQEISVGKSVPVWYNMVNQGLVQEPVFSFWFNRNANEEEGGELVFGGVDPNHFKGKHTY  255

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVT+KGYWQF+MG+VLIE K TGFCS GC+AIADSGTSL+AGP++IIT INHA GA GV
Sbjct  256   VPVTEKGYWQFNMGDVLIEDKTTGFCSDGCAAIADSGTSLLAGPTAIITEINHASGAKGV  315

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             +S++CK +V  YG+ +I++L+ EA+P KICSQ+ LCTF+G R VS  IESVVD+ NG S+
Sbjct  316   MSQQCKTLVSQYGKSIIEMLLSEAQPDKICSQMKLCTFDGARDVSSIIESVVDKNNGKSS  375

Query  565   -DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
                +D MC+ CEM VVWMQNQ+  N+T++NI++YVNELC+RLPSPMGES VDC  LS+MP
Sbjct  376   GGANDEMCTFCEMAVVWMQNQIKRNETEDNIINYVNELCDRLPSPMGESAVDCNSLSSMP  435

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +++F+IGGKVF+L P +YILK+GEG AAQCISGFTA+DV PPRGPLWILGDVFMGRYHTV
Sbjct  436   NIAFTIGGKVFELCPEQYILKIGEGEAAQCISGFTAMDVAPPRGPLWILGDVFMGRYHTV  495

Query  208   FDYGKMRVGFAEAA  167
             FDYGK RVGFAEAA
Sbjct  496   FDYGKSRVGFAEAA  509



>ref|NP_001150729.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
 gb|ACG40142.1| aspartic proteinase oryzasin-1 precursor [Zea mays]
Length=518

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/488 (68%), Positives = 397/488 (81%), Gaps = 5/488 (1%)
 Frame = -2

Query  1624  GFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNYMD  1445
             G VR+ LKK  +D+N R+AARL A+    L   + +  N  G  G   D+D++ L  Y +
Sbjct  34    GLVRVALKKQPVDQNARVAARLSAEERQRL---LLRGANALGSAGGDDDSDVIALNXYXN  90

Query  1444  AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNGKS  1265
             AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFS+ C+FHS+Y S QSSTY+KNGK 
Sbjct  91    AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACYFHSRYKSGQSSTYKKNGKP  150

Query  1264  AEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEISV  1085
             A I YGTG+I+GFFS+DSV++GDL V  Q FIEAT EPG+TF+VAKFDGILGLGFQEISV
Sbjct  151   AAIQYGTGAIAGFFSEDSVKLGDLDVNDQEFIEATKEPGLTFMVAKFDGILGLGFQEISV  210

Query  1084  GDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQKG  905
             G+A      MV QGL+ DP+FSFW NR+  E EGGE+VFGG+D  HYKG+HTYVPVTQKG
Sbjct  211   GNATPVWYNMVKQGLISDPVFSFWFNRHAGEGEGGEIVFGGMDSSHYKGDHTYVPVTQKG  270

Query  904   YWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKECKA  725
             YWQF+MG+VL++GK TGFC+GGC+AIADSGTSL+AGP++IIT IN  IGA GVVS+ECK 
Sbjct  271   YWQFNMGDVLVDGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINEKIGAAGVVSQECKT  330

Query  724   VVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD--LHDA  551
             VV  YGQ+++DLL+ E +P KICSQ+GLCTF+G  GVS GI SVVD+K G S      D 
Sbjct  331   VVSQYGQQILDLLLAETQPAKICSQVGLCTFDGTHGVSTGIRSVVDDKAGKSNGGLKSDP  390

Query  550   MCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSI  371
             MC+ACEM VVWMQNQL++N+TQE IL+Y+N+LC RLPSPMGES VDC  L +MP ++F+I
Sbjct  391   MCNACEMAVVWMQNQLAQNKTQELILTYINQLCERLPSPMGESAVDCASLGSMPDIAFTI  450

Query  370   GGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKM  191
             GGK F L P +YILKVGEG AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDY K+
Sbjct  451   GGKKFKLKPEQYILKVGEGQAAQCISGFTAMDIPPPRGPLWILGDVFMGVYHTVFDYXKL  510

Query  190   RVGFAEAA  167
             RVGFAE+A
Sbjct  511   RVGFAESA  518



>gb|KJB13719.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=495

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/466 (71%), Positives = 392/466 (84%), Gaps = 3/466 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS SNDG  RIGLKK K D+NN +AA+L++K G++LR S RKY  LHG   + +D DIV 
Sbjct  22    FSTSNDGLFRIGLKKRKFDRNNLLAAQLDSKEGEALRGSFRKY--LHGNLQESKDIDIVA  79

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHS+Y SS SSTY
Sbjct  80    LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSRYKSSHSSTY  139

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
               NGK A+I YGTG ISGFFS+D V VGDLVVK+Q FIEATSEP +TFL+AKFDGILGLG
Sbjct  140   NANGKPADIKYGTGQISGFFSEDHVTVGDLVVKNQEFIEATSEPSLTFLLAKFDGILGLG  199

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MVNQGLV++P+FSFWL+RN ++  GGELVFGG+DPKH+KG HTYV
Sbjct  200   FQEISVGNAVPVWYNMVNQGLVKEPVFSFWLSRNSEDNLGGELVFGGMDPKHFKGNHTYV  259

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+ LI  + TGFC+GGCSAIADSGTSL+AGP+ IIT INHAIGA GVV
Sbjct  260   PVTRKGYWQFDMGDFLIGNETTGFCAGGCSAIADSGTSLLAGPTGIITQINHAIGASGVV  319

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S+ECKAVV  YG++++D+L+ +  PKKICSQIGLC F+G +GVSM IES+V+E  G  S 
Sbjct  320   SQECKAVVSEYGEKILDMLLAKDEPKKICSQIGLCLFDGTQGVSMEIESIVNENAGKASG  379

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L DAMCS CEM V+WMQNQL +NQTQ++I+ YVNELC+RLPSPMGES +DC  LS+MPS
Sbjct  380   SLRDAMCSTCEMAVIWMQNQLKQNQTQDHIIDYVNELCDRLPSPMGESSIDCKSLSSMPS  439

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLW  248
             VSF+I GK+F+L P +Y++KVGEG  AQCISGFTALDVPPPRGPLW
Sbjct  440   VSFTIAGKLFELRPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLW  485



>gb|AAV84085.2| aspartic proteinase 9 [Fagopyrum esculentum]
Length=506

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/494 (69%), Positives = 405/494 (82%), Gaps = 8/494 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             + S +N+  VR+GLKK K+D  NR A+R   K        + + Y L    GD  DT I+
Sbjct  20    SLSVANNDLVRVGLKKRKLDPTNRPASRFGCKK------HLMQKYGLGNGFGD-DDTGII  72

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQYFGEI +GTP Q FTVIFDTGSSNLWVPS KCY S+ CFFHSKY SS+SST
Sbjct  73    SLKNYMDAQYFGEIAIGTPSQTFTVIFDTGSSNLWVPSGKCYLSIACFFHSKYKSSKSST  132

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y KNGKSAEIHYGTG+ISG+FSQD+V+VGDLVV++Q FIEAT EP +TF+ AKFDGILGL
Sbjct  133   YVKNGKSAEIHYGTGAISGYFSQDNVKVGDLVVENQEFIEATREPSLTFVAAKFDGILGL  192

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG A      MVNQGLV +P+FSFWLNRN  E+ GGE+VFGG+DP H+KGEHTY
Sbjct  193   GFQEISVGKAVPVWYNMVNQGLVNEPVFSFWLNRNADEEIGGEIVFGGIDPAHHKGEHTY  252

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             +PVTQKGYWQFD+ +VL+ G+ TGFCSGGCSAIADSGTSL+AGP+ ++  INHAIGA GV
Sbjct  253   LPVTQKGYWQFDLDDVLVGGESTGFCSGGCSAIADSGTSLLAGPTPVVAQINHAIGASGV  312

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK-NGVS  569
             VS+ECK VV  YG++++DLLV + +P+KICSQIGLCTF+G RGVSMGIESVVD+  +  S
Sbjct  313   VSQECKTVVSQYGKQILDLLVSQTQPRKICSQIGLCTFDGTRGVSMGIESVVDKNVDKSS  372

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
              +L DA CSACEM VVWMQNQL +NQT++ IL Y N+LC RLPSPMGES VDCG LST+P
Sbjct  373   GNLKDATCSACEMAVVWMQNQLKQNQTEDRILDYANQLCERLPSPMGESAVDCGSLSTLP  432

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VSF++GGK F L+P +YIL+VGEG A QCISGF ALDVPPPRGPLWILGD+FMG+YHTV
Sbjct  433   TVSFTLGGKTFALAPEQYILQVGEGPATQCISGFIALDVPPPRGPLWILGDIFMGQYHTV  492

Query  208   FDYGKMRVGFAEAA  167
             FD+G M+VGFAEAA
Sbjct  493   FDHGNMQVGFAEAA  506



>gb|AGE15494.1| preprosilpepsin 1 [Silybum marianum]
Length=506

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/493 (70%), Positives = 406/493 (82%), Gaps = 8/493 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AFS SN G VR+GLKK K+D+ N+++       G S+    RK +       D  D+DI+
Sbjct  22    AFSVSNGGLVRVGLKKRKVDQINQLSGH-----GASMEGKARKDFGFGSTLRD-SDSDII  75

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQY+GEIG+G P QKFTVIFDTGSSNLWVPS+KCYFSV C FHSKY SS SST
Sbjct  76    ALKNYMDAQYYGEIGIGEPAQKFTVIFDTGSSNLWVPSAKCYFSVACLFHSKYKSSHSST  135

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+KNG SA I YGTGSISGF SQDSV++GDLVVK Q FIEAT EPG+TFL AKFDGILGL
Sbjct  136   YKKNGTSAAIQYGTGSISGFVSQDSVKLGDLVVKEQDFIEATKEPGITFLAAKFDGILGL  195

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG +      MVNQGLV +P+FSFW NRN  E+EGGELVFGGVDP H+KG HTY
Sbjct  196   GFQEISVGKSVPVWYNMVNQGLVHEPVFSFWFNRNADEEEGGELVFGGVDPNHFKGRHTY  255

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQF+MG+VLIE K TGFCS GC+AIADSGTSL+AGP++IIT INHAIGA GV
Sbjct  256   VPVTQKGYWQFNMGDVLIEDKTTGFCSDGCAAIADSGTSLLAGPTAIITQINHAIGAKGV  315

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             +S++CK +V+ YG+ +I++L+ EA+P KICSQ+ LCTFNG R VS  IESVVD+ NG S+
Sbjct  316   MSQQCKTLVDQYGKSIIEMLLSEAQPDKICSQMKLCTFNGARDVSSIIESVVDKNNGKSS  375

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
                + MC+ CEM VVWMQNQ+  NQTQ+NI++YV+ELC+RLPSPMGES VDC  LS+MP+
Sbjct  376   G--NEMCTFCEMAVVWMQNQIKRNQTQDNIINYVSELCDRLPSPMGESAVDCNSLSSMPN  433

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             +SF+IGGKVF+L P +YILK+G+G AAQCISGFTA+DV PPRGPLWILGDVFMGRYHTVF
Sbjct  434   ISFTIGGKVFELCPEQYILKIGDGEAAQCISGFTAMDVAPPRGPLWILGDVFMGRYHTVF  493

Query  205   DYGKMRVGFAEAA  167
             DYGK+RVGFAEAA
Sbjct  494   DYGKLRVGFAEAA  506



>emb|CAA48939.1| cyprosin [Cynara cardunculus]
Length=474

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/482 (69%), Positives = 401/482 (83%), Gaps = 10/482 (2%)
 Frame = -2

Query  1606  LKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTD--IVGLKNYMDAQYF  1433
             LKK K++  N         AG +   + RKY    G  G+ +D+D  ++ LKNYMDAQYF
Sbjct  1     LKKRKVNILNHPGEH----AGSNDANARRKY----GVRGNFRDSDGELIALKNYMDAQYF  52

Query  1432  GEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNGKSAEIH  1253
             GEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV C FHSKY S+ S+TY+KNGKSA I 
Sbjct  53    GEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACLFHSKYRSTDSTTYKKNGKSAAIQ  112

Query  1252  YGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEISVGDAX  1073
             YGTGSISGFFSQDSV++GDL+VK Q FIEAT EPG+TFL AKFDGILGLGFQEISVGDA 
Sbjct  113   YGTGSISGFFSQDSVKLGDLLVKEQDFIEATKEPGITFLAAKFDGILGLGFQEISVGDAV  172

Query  1072  XXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQKGYWQF  893
                  M+NQGLVQ+P+FSFWLNRN  EQEGGELVFGGVDP H+KGEHTYVPVTQKGYWQF
Sbjct  173   PVWYTMLNQGLVQEPVFSFWLNRNADEQEGGELVFGGVDPNHFKGEHTYVPVTQKGYWQF  232

Query  892   DMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKECKAVVEN  713
             +MG+VLI  K TGFC+ GC+AIADSGTSL+AG ++I+T IN AIGA GV+S++CK++V+ 
Sbjct  233   EMGDVLIGDKTTGFCASGCAAIADSGTSLLAGTTTIVTQINQAIGAAGVMSQQCKSLVDQ  292

Query  712   YGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACE  533
             YG+ MI++L+ E +P+KICSQ+ LC+F+G+   SM IESVVD+  G S+ LHD MC+ C+
Sbjct  293   YGKSMIEMLLSEEQPEKICSQMKLCSFDGSHDTSMIIESVVDKSKGKSSGLHDEMCTMCQ  352

Query  532   MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  353
             M VVWMQNQ+ +N+T+ENI++YV++LC RLPSPMGES VDC  LS+MP+++F++GGK F+
Sbjct  353   MAVVWMQNQIRQNETEENIINYVDKLCERLPSPMGESAVDCSSLSSMPNIAFTVGGKTFN  412

Query  352   LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  173
             LSP +Y+LKVGEG+ AQCISGFTA+DV PP GPLWILGDVFMG+YHTVFDYG +RVGFAE
Sbjct  413   LSPEQYVLKVGEGATAQCISGFTAMDVAPPHGPLWILGDVFMGQYHTVFDYGNLRVGFAE  472

Query  172   AA  167
             AA
Sbjct  473   AA  474



>ref|XP_009419881.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=515

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/488 (68%), Positives = 397/488 (81%), Gaps = 3/488 (1%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNYM  1448
             D  +RIGL+K  + +N RIAARL  K G  L A  R++    G   + +D DIV LKNY+
Sbjct  30    DALIRIGLRKKPLGENGRIAARLLDKEGKDLMA--RRHGLRGGVGSNEEDEDIVSLKNYL  87

Query  1447  DAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNGK  1268
             +AQYFGEIG+G+P QKFTVIFDTGSSNLW+PSSKC  SV C+FHSKY S+ SSTY+KNGK
Sbjct  88    NAQYFGEIGIGSPAQKFTVIFDTGSSNLWIPSSKCILSVACYFHSKYKSTASSTYQKNGK  147

Query  1267  SAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEIS  1088
             SAEIHYG+GSISGFFS+D V +G+L+VK+Q FIEATSEP VTFLVAKFDGILGLGFQEIS
Sbjct  148   SAEIHYGSGSISGFFSEDHVTIGNLIVKNQDFIEATSEPSVTFLVAKFDGILGLGFQEIS  207

Query  1087  VGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQK  908
             VGDA      MVNQGL++DP+FSFW NRN +E EGGE+VFGG DP HYKGEH YVPV+QK
Sbjct  208   VGDAVPVWYNMVNQGLIKDPVFSFWFNRNAEEGEGGEIVFGGADPNHYKGEHVYVPVSQK  267

Query  907   GYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKECK  728
             GYWQF+MG++ I  + TG CSGGC+ IADSGTSLIAGP++ I  IN+ IG  GVVS+ECK
Sbjct  268   GYWQFNMGDLFIGDEATGLCSGGCAVIADSGTSLIAGPTAAIAEINNRIGVSGVVSQECK  327

Query  727   AVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DA  551
             AVV  YGQR+ ++L+ + +P K+CSQIGLC  +G   VS+ IESVV E   VS+ LH DA
Sbjct  328   AVVAQYGQRIFEMLISQTQPTKMCSQIGLCASDGTGAVSIAIESVVSENKDVSSSLHNDA  387

Query  550   MCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSI  371
             MC+ACEM +VWMQNQLS+NQTQE +L+++NELC RLPSPMGES VDC  + +MPSVSF+I
Sbjct  388   MCNACEMALVWMQNQLSQNQTQEEMLNHINELCERLPSPMGESSVDCAAIPSMPSVSFTI  447

Query  370   GGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKM  191
             G ++F+L P +YILKVGEG+  QCISGFTALDVPPPRGPLWILGDVFMG YHTVFDYG  
Sbjct  448   GDRIFELQPEQYILKVGEGAEEQCISGFTALDVPPPRGPLWILGDVFMGVYHTVFDYGNS  507

Query  190   RVGFAEAA  167
             RVGFA+AA
Sbjct  508   RVGFAQAA  515



>ref|XP_006838131.1| PREDICTED: cyprosin [Amborella trichopoda]
 gb|ERN00700.1| hypothetical protein AMTR_s00106p00075970 [Amborella trichopoda]
Length=513

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/488 (70%), Positives = 407/488 (83%), Gaps = 2/488 (0%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNYM  1448
             +G VRIGLKK  +D N+ +A+R+ A  G + +   RK+  L G   +  D DI+ LKNYM
Sbjct  27    NGLVRIGLKKKSLDPNSLLASRIAAGDGKASKTQPRKFCGLRGNTLN-SDEDIISLKNYM  85

Query  1447  DAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNGK  1268
             DAQY+GEIGVG+PPQ FTVIFDTGSSNLWVPSSKCYFSV C+FHSKY +S+SS+Y++NGK
Sbjct  86    DAQYYGEIGVGSPPQTFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKASKSSSYKENGK  145

Query  1267  SAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEIS  1088
             S EIHYGTGS+SG+ SQD VQVGDLVVK Q FIEAT EP +TFLVAKFDGILGLGFQ IS
Sbjct  146   SCEIHYGTGSVSGYLSQDHVQVGDLVVKDQVFIEATKEPSITFLVAKFDGILGLGFQSIS  205

Query  1087  VGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQK  908
             VG+       MV +GLV++PIFSFW NRN Q++EGGE+VFGGVDP H+ GEHTYVPVTQK
Sbjct  206   VGNVVPVWYNMVKKGLVKEPIFSFWFNRNAQDEEGGEIVFGGVDPNHFIGEHTYVPVTQK  265

Query  907   GYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKECK  728
             GYWQFDMG+ LI GK TGFC+ GC+AIAD+GTSLIAGP+ IIT INH IGA GVVS+ECK
Sbjct  266   GYWQFDMGDFLIGGKSTGFCANGCAAIADTGTSLIAGPTPIITEINHKIGAAGVVSQECK  325

Query  727   AVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-DA  551
             AVV+ YG +++ LL+ EA+P+KICSQIGLC F+G+  V MGIESVVD KNG  + L  D+
Sbjct  326   AVVQQYGDKIMQLLLAEAQPQKICSQIGLCEFDGSHSVGMGIESVVDMKNGGKSSLKTDS  385

Query  550   MCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSI  371
             MCSACEM VVW+QNQL +N TQ+ I++Y+NELC RLPSPMG+S VDC KLS+MP+V+F+I
Sbjct  386   MCSACEMAVVWIQNQLKQNMTQDRIMNYINELCERLPSPMGQSAVDCNKLSSMPNVAFTI  445

Query  370   GGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKM  191
             GGK F+L+P +YILKVGEG+AAQCISGF+ALDV PPRGPLWILGDV +G YHTVFDYG +
Sbjct  446   GGKAFELTPQQYILKVGEGAAAQCISGFSALDVAPPRGPLWILGDVVLGVYHTVFDYGNL  505

Query  190   RVGFAEAA  167
             RVGFA+AA
Sbjct  506   RVGFAKAA  513



>ref|XP_009123370.1| PREDICTED: aspartic proteinase A2 isoform X2 [Brassica rapa]
Length=501

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/494 (67%), Positives = 410/494 (83%), Gaps = 12/494 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S+SNDG +R+GLKK+K+D  NR+A R  +K   + R+S++++      + +  D DIV
Sbjct  19    ASSESNDGTLRVGLKKLKLDPTNRLATRFGSKQEKAFRSSLKEF---RSNDKNAGDADIV  75

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KCYFS        Y SS+SST
Sbjct  76    ALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCYFS--------YKSSRSST  127

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+++GK A IHYG+GSISGFFS D+V VGDLVVK+Q FIEATSEPG+TFLVAKFDG+LGL
Sbjct  128   YKESGKRAAIHYGSGSISGFFSYDAVTVGDLVVKNQEFIEATSEPGLTFLVAKFDGLLGL  187

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      M+ QGL++ P+FSFWLNR+ + +EGGEL+FGGVDPKH+KGEHTY
Sbjct  188   GFQEISVGNATPVWYNMLKQGLIKKPVFSFWLNRDTKSEEGGELIFGGVDPKHFKGEHTY  247

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPV+++GYWQFDMGEVLI GK TG+C  GC+AIADSGTSL+AGP+++I MIN AIGA GV
Sbjct  248   VPVSRRGYWQFDMGEVLIAGKSTGYCGNGCTAIADSGTSLLAGPTAVIAMINKAIGASGV  307

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS++CK VV+ YGQ ++DLL+ +A+PK ICS+IGLCTF+G  GVSMGIESVV+++N  S+
Sbjct  308   VSQQCKTVVDQYGQTILDLLLAKAQPKHICSKIGLCTFDGTHGVSMGIESVVEKENTKSS  367

Query  565   D-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               L DA C+ CEM V+W+Q+QL +N TQ+ I++ +N++C R+PSP GES VDC +LS MP
Sbjct  368   SGLRDAGCAPCEMAVMWIQSQLMQNMTQKRIVNNINDICERMPSPNGESAVDCSQLSKMP  427

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VSF+IGGKVFDLSP EY+LK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMGRYHTV
Sbjct  428   TVSFTIGGKVFDLSPEEYVLKIGEGPVAQCISGFTALDLPPPRGPLWILGDVFMGRYHTV  487

Query  208   FDYGKMRVGFAEAA  167
             FD+G  +VGFAEAA
Sbjct  488   FDFGNEQVGFAEAA  501



>gb|KJB13722.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=492

 Score =   705 bits (1820),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/493 (68%), Positives = 398/493 (81%), Gaps = 23/493 (5%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS SNDG  RIGLKK K D+NN +AA+L++K G++LR S RKY  LHG   + +D DIV 
Sbjct  22    FSTSNDGLFRIGLKKRKFDRNNLLAAQLDSKEGEALRGSFRKY--LHGNLQESKDIDIVA  79

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQ FT+                     C+FHS+Y SS SSTY
Sbjct  80    LKNYMDAQYFGEIGIGTPPQNFTI--------------------ACYFHSRYKSSHSSTY  119

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
               NGK A+I YGTG ISGFFS+D V VGDLVVK+Q FIEATSEP +TFL+AKFDGILGLG
Sbjct  120   NANGKPADIKYGTGQISGFFSEDHVTVGDLVVKNQEFIEATSEPSLTFLLAKFDGILGLG  179

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MVNQGLV++P+FSFWL+RN ++  GGELVFGG+DPKH+KG HTYV
Sbjct  180   FQEISVGNAVPVWYNMVNQGLVKEPVFSFWLSRNSEDNLGGELVFGGMDPKHFKGNHTYV  239

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+ LI  + TGFC+GGCSAIADSGTSL+AGP+ IIT INHAIGA GVV
Sbjct  240   PVTRKGYWQFDMGDFLIGNETTGFCAGGCSAIADSGTSLLAGPTGIITQINHAIGASGVV  299

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S+ECKAVV  YG++++D+L+ +  PKKICSQIGLC F+G +GVSM IES+V+E  G  S 
Sbjct  300   SQECKAVVSEYGEKILDMLLAKDEPKKICSQIGLCLFDGTQGVSMEIESIVNENAGKASG  359

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L DAMCS CEM V+WMQNQL +NQTQ++I+ YVNELC+RLPSPMGES +DC  LS+MPS
Sbjct  360   SLRDAMCSTCEMAVIWMQNQLKQNQTQDHIIDYVNELCDRLPSPMGESSIDCKSLSSMPS  419

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             VSF+I GK+F+L P +Y++KVGEG  AQCISGFTALDVPPPRGPLWILGDVFMG++HTVF
Sbjct  420   VSFTIAGKLFELRPEQYVMKVGEGDGAQCISGFTALDVPPPRGPLWILGDVFMGQFHTVF  479

Query  205   DYGKMRVGFAEAA  167
             DYG M++GFAEAA
Sbjct  480   DYGNMQIGFAEAA  492



>emb|CDP10762.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/492 (67%), Positives = 399/492 (81%), Gaps = 7/492 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS SND  +R+ LKK K+D+ +R +  ++   G   R + R+       N    DTDI+ 
Sbjct  23    FSASNDKLIRVALKKTKLDQISRFSGNVDLTEGGFARINRRR------GNVVQSDTDIIA  76

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQY+GEIGVGTPPQKFTVIFDTGSSNLWVPS KCYFSV C+FHSKY S  SSTY
Sbjct  77    LKNYMDAQYYGEIGVGTPPQKFTVIFDTGSSNLWVPSVKCYFSVACYFHSKYKSGHSSTY  136

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSAEIHYGTGSISGFFSQD V++G+L+VK Q FIEAT EPG+TFL AKFDGILGLG
Sbjct  137   KKNGKSAEIHYGTGSISGFFSQDHVKLGNLIVKDQDFIEATREPGITFLAAKFDGILGLG  196

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MV QGLV+ P+FSFW NR  +E++GGE+VFGGVD  H+KG+H YV
Sbjct  197   FQEISVGNAVPVWYNMVKQGLVEQPVFSFWFNRKAEEEQGGEIVFGGVDTNHFKGDHAYV  256

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
              VTQKGYWQF+MG+VLI G+ TGFC+ GCSAIADSGTSL+AGP++++T INHAIGA GV+
Sbjct  257   NVTQKGYWQFNMGDVLIGGETTGFCAEGCSAIADSGTSLLAGPTTVVTQINHAIGASGVL  316

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+EC +VV  YG+ +I++L+ +  P++ICS+IGLC+ +G+  VSM IESVV E +  S  
Sbjct  317   SQECMSVVTEYGKTIIEMLLAKVEPQQICSKIGLCSSDGSHDVSMLIESVV-ETDMTSDG  375

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
               D MC+AC+M VVWMQNQL  NQT+E IL Y+N+LC+RLPSPMGES VDC  L++MP +
Sbjct  376   PRDNMCTACQMAVVWMQNQLRRNQTEEKILDYINQLCDRLPSPMGESAVDCSALASMPKI  435

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF IG K F+LSP +YIL+VGEG+AAQCISGFTALDV PPRGPLWILGDVFMG+YHTVFD
Sbjct  436   SFIIGSKTFELSPEQYILRVGEGAAAQCISGFTALDVLPPRGPLWILGDVFMGQYHTVFD  495

Query  202   YGKMRVGFAEAA  167
             YGKMRVGFAEAA
Sbjct  496   YGKMRVGFAEAA  507



>ref|XP_002872693.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48952.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/490 (66%), Positives = 404/490 (82%), Gaps = 9/490 (2%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             +  DG +RIGLKK K+D++NR+A++L  K   S   S + Y+ L+  N D+     V LK
Sbjct  27    RKGDGTIRIGLKKRKLDRSNRLASQLFLKNRGSW--SPKDYFRLNDANADM-----VPLK  79

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+G+I +GTPPQKFTVIFDTGSSNLW+PS+KCY SV C+FHSKY +SQSS+Y K
Sbjct  80    NYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSKYKASQSSSYRK  139

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISG+FS D V+VGD+VVK Q FIEAT+EPG+TFL+AKFDGILGLGF+
Sbjct  140   NGKPASIRYGTGAISGYFSNDDVKVGDIVVKEQEFIEATTEPGITFLLAKFDGILGLGFK  199

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG++      MV +GLV+DP+FSFWLNRNPQ+QEGGE+VFGGVDPKH+KGEHTYVPV
Sbjct  200   EISVGNSTPVWYNMVEKGLVKDPVFSFWLNRNPQDQEGGEIVFGGVDPKHFKGEHTYVPV  259

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T KGYWQFDMG++ I GKPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA G+VS+
Sbjct  260   THKGYWQFDMGDLQIAGKPTGYCAKGCSAIADSGTSLLTGPSTVITMINHAIGAQGIVSR  319

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             ECKAVV+ YG+ M++ L+ +  PKK+CSQIG+C ++G   VSM I+SVVD+  G S  L+
Sbjct  320   ECKAVVDQYGKTMLNSLLAQEDPKKVCSQIGVCAYDGTHSVSMDIQSVVDD--GTSGLLN  377

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
              AMCSACEM  VWM+++L++NQTQE IL+Y  ELCN +P+   +S VDC ++S+MP VSF
Sbjct  378   QAMCSACEMAAVWMESELTQNQTQERILAYAAELCNHIPTKNQQSAVDCERVSSMPIVSF  437

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             SIGG+ FDLSP +YI K+G+G  +QC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYG
Sbjct  438   SIGGRTFDLSPQDYIFKIGDGVESQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYG  497

Query  196   KMRVGFAEAA  167
             K RVGFA+AA
Sbjct  498   KARVGFAKAA  507



>gb|AFX73039.1| preprogaline A [Galium verum]
Length=506

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/493 (67%), Positives = 394/493 (80%), Gaps = 10/493 (2%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
              S S    VR+ LKK K+D+ NR+A       G   R S R    L+G  G   D+DI+ 
Sbjct  23    LSASETKLVRVSLKKAKLDQVNRLA-------GSVPRGSAR-INRLYGNMGS-SDSDIIA  73

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQY+GEIG+GTP QKFTVIFDTGSSNLWVPS+KCYFS  C+FHSKY S  SSTY
Sbjct  74    LKNYMDAQYYGEIGIGTPAQKFTVIFDTGSSNLWVPSTKCYFSPACYFHSKYNSKHSSTY  133

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSAEIHYGTGSI+GFFSQDSV++GDLVVK Q FIEAT EPG+TF+ AKFDG+LGLG
Sbjct  134   KKNGKSAEIHYGTGSIAGFFSQDSVKLGDLVVKDQDFIEATREPGITFVAAKFDGLLGLG  193

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      MV QGLV +P+FSFW NR+  E++GGELVFGGVDP H+KGEH Y 
Sbjct  194   FQEISVGKAVPVWYNMVKQGLVAEPVFSFWFNRHTDEEQGGELVFGGVDPSHFKGEHVYA  253

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
              VT+KGYWQFDMG+VL+ G+ TGFC+ GCSAIADSGTSL+AGP++++  INHAIGA GVV
Sbjct  254   KVTKKGYWQFDMGDVLVGGESTGFCANGCSAIADSGTSLLAGPTAVVVQINHAIGATGVV  313

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+ECK+VV  YG+ ++D+L+ +  PK IC+ IGLC   G+R   M IESVV+E +  S  
Sbjct  314   SQECKSVVSQYGKTILDMLLAKTEPKTICASIGLCLPKGSRDDDMIIESVVEETDSASDG  373

Query  562   L-HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
             L +D MCSAC+M VVWMQNQ+ +NQT+E IL Y+N+LC+RLPSPMGES VDC  L+++P 
Sbjct  374   LRNDEMCSACQMAVVWMQNQVRQNQTEEKILDYINQLCDRLPSPMGESAVDCSSLASLPK  433

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             ++FSIGGK F+LSP EY+LKVGEG+AAQCISGFTALDV PP GPLWILGDVFMG YHTVF
Sbjct  434   IAFSIGGKAFELSPEEYVLKVGEGAAAQCISGFTALDVAPPLGPLWILGDVFMGSYHTVF  493

Query  205   DYGKMRVGFAEAA  167
             DYG MRVGFAEAA
Sbjct  494   DYGNMRVGFAEAA  506



>dbj|BAA76870.1| aspartic proteinase [Helianthus annuus]
Length=509

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/496 (67%), Positives = 407/496 (82%), Gaps = 11/496 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHG--RNGDLQDTD  1472
             AFS +  G +R+GLKK K ++ NR++       G S+  + R+ +  +   RN    + D
Sbjct  22    AFSSTKGGLLRVGLKKRKTNQFNRVSEH-----GLSMEGTDRRNFGFYDTLRN---SEGD  73

Query  1471  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQS  1292
             ++ LKNYMDAQYFGEIG+GTPPQKFTV+FDTGS+NLWVPSSKC+ SV C FH KY +S+S
Sbjct  74    VIVLKNYMDAQYFGEIGIGTPPQKFTVVFDTGSANLWVPSSKCFLSVACLFHQKYKASRS  133

Query  1291  STYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGIL  1112
             STY+KNG +A I YGTG+ISG FS+DSV++GDLVVK Q FIEAT EPG+TFL AKFDGIL
Sbjct  134   STYKKNGTAAAIQYGTGAISGVFSRDSVKLGDLVVKEQDFIEATREPGITFLAAKFDGIL  193

Query  1111  GLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEH  932
             GLG+Q+ISVG A      MVNQGLVQ+P+FSFW NR+  E+EGGELVFGGVDP H+KG+H
Sbjct  194   GLGYQDISVGKAVPVWYNMVNQGLVQEPVFSFWFNRHTGEEEGGELVFGGVDPNHFKGKH  253

Query  931   TYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGAD  752
             TYVPVTQKGYWQFDMG+VLI  K TGFCSGGC+AIADSGTSL+AGP++IIT INHAIGA 
Sbjct  254   TYVPVTQKGYWQFDMGDVLIGDKTTGFCSGGCAAIADSGTSLLAGPTTIITQINHAIGAA  313

Query  751   GVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-  575
             GV+S++CK +V+ YG+ +I++L+ EA+P KICS++ LCTF+G+R VS  IESVVD+ NG 
Sbjct  314   GVMSQQCKTLVDQYGKTIIEMLLSEAQPDKICSRMNLCTFDGSRDVSSIIESVVDKNNGK  373

Query  574   VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLST  395
              SA L+D +C+ CEM VVWMQ+QL  NQT+++I++YVNELC+R+PSPMGES VDC  LS 
Sbjct  374   SSAGLNDGICAFCEMAVVWMQSQLKRNQTEDSIINYVNELCDRIPSPMGESAVDCQTLSN  433

Query  394   MPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYH  215
             MP+++F+IGGK FDL+P +YILKVGEG  AQCISGFTALDV PP GPLWI GDVFMG+YH
Sbjct  434   MPNIAFTIGGKTFDLTPEQYILKVGEGEVAQCISGFTALDVAPPHGPLWIHGDVFMGQYH  493

Query  214   TVFDYGKMRVGFAEAA  167
             TVFD+GK RVGFAEAA
Sbjct  494   TVFDFGKSRVGFAEAA  509



>ref|XP_010455726.1| PREDICTED: aspartic proteinase A3 isoform X1 [Camelina sativa]
 ref|XP_010455728.1| PREDICTED: aspartic proteinase A3 isoform X1 [Camelina sativa]
Length=508

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/491 (66%), Positives = 405/491 (82%), Gaps = 10/491 (2%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAK-AGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             ++ DG +RIGLKK K+D++NR+A++L  K  G+S     + ++ L+  N D+     V L
Sbjct  27    RNGDGTIRIGLKKRKLDRSNRLASQLFLKNRGESWFP--KDHFRLNDANADM-----VPL  79

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+G+I +GTPPQKFTVIFDTGSSNLW+PS+KCY SV C+FHSKY +SQSSTY 
Sbjct  80    KNYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSKYKASQSSTYR  139

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A I YGTG+I+G+FS D V+VGDLVVK Q FIEATSEPG+TFL+AKFDGILGLGF
Sbjct  140   KNGKPASIRYGTGAIAGYFSYDDVKVGDLVVKEQEFIEATSEPGITFLLAKFDGILGLGF  199

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVG++      MV +GLV++PIFSFWLNRNPQ+ EGGE+VFGGVDPKH+KGEHTYVP
Sbjct  200   KEISVGNSTPVWYNMVEKGLVKEPIFSFWLNRNPQDPEGGEIVFGGVDPKHFKGEHTYVP  259

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VT KGYWQFDMG++ I GKPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA G+VS
Sbjct  260   VTHKGYWQFDMGDLQIAGKPTGYCAKGCSAIADSGTSLLTGPSTVITMINHAIGAQGIVS  319

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECKAVV+ YG+ M++ L+ +  PKK+CSQIG+C F+G   VSMGI+SVVD+  G S  L
Sbjct  320   RECKAVVDQYGKTMLNSLLAQEDPKKVCSQIGVCAFDGTDSVSMGIQSVVDD--GASGLL  377

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
             + AMCSAC+M  VWM+++L++NQTQE IL+Y  ELC+ +P+   +S VDC K+S+MP VS
Sbjct  378   NQAMCSACQMAAVWMESELTQNQTQERILAYAAELCDHIPTQNQQSAVDCEKVSSMPIVS  437

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGG+ FDLSP +YI K+GEG   QC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDY
Sbjct  438   FTIGGRTFDLSPQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDY  497

Query  199   GKMRVGFAEAA  167
             GK RVGFA+AA
Sbjct  498   GKARVGFAKAA  508



>ref|XP_006840365.1| PREDICTED: aspartic proteinase A1 [Amborella trichopoda]
 gb|ERN02040.1| hypothetical protein AMTR_s00045p00122510 [Amborella trichopoda]
Length=510

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/489 (68%), Positives = 399/489 (82%), Gaps = 5/489 (1%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKNY  1451
             ND  VRIGLKK   D     A ++ AK G+  R +VR Y  L  + GD  D DIV LKNY
Sbjct  26    NDRLVRIGLKKKGFDLQTLTARKIVAK-GNPPR-NVRNYEILR-KLGD-SDVDIVSLKNY  81

Query  1450  MDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNG  1271
             +DAQY+GEIG+G+P Q FTV+FDTGSSNLWVPSSKCYFS+PC+FHSKY +S+SSTY K G
Sbjct  82    LDAQYYGEIGIGSPSQTFTVVFDTGSSNLWVPSSKCYFSLPCYFHSKYKASKSSTYTKIG  141

Query  1270  KSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEI  1091
              S EIHYGTGSISGF SQD+V+VGDLVVK QAFIEAT EP +TFL++KFDGILGLGF+EI
Sbjct  142   NSCEIHYGTGSISGFLSQDNVEVGDLVVKDQAFIEATREPSLTFLISKFDGILGLGFKEI  201

Query  1090  SVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQ  911
             +VGD       MV+QGLV +P+FSFW NRN  + EGGE+VFGGVDP H+KGEHT+VPVT+
Sbjct  202   AVGDVSPVWYNMVDQGLVSEPVFSFWFNRNEDDSEGGEIVFGGVDPNHFKGEHTFVPVTR  261

Query  910   KGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKEC  731
             KGYWQFDMG+VLI+G+ TGFC+ GC+AIADSGTSL+ GP++I+  INHAIGA+G+VS++C
Sbjct  262   KGYWQFDMGDVLIDGQSTGFCADGCAAIADSGTSLLTGPTTIVAEINHAIGAEGIVSQQC  321

Query  730   KAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHD-  554
             K VV  YG+ +++LL+ E +P+KICSQIGLC F+GNR VS GI SVVD+++G  A + D 
Sbjct  322   KLVVSQYGEMILELLLSETQPQKICSQIGLCVFDGNRDVSSGIASVVDKEDGSKASVGDS  381

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
             AMC+ACEM VVW+QNQ+  N+T+  IL Y N+LC RLPSPMGES VDC  +S MP+VSF 
Sbjct  382   AMCTACEMAVVWIQNQIKRNETKTQILEYANQLCERLPSPMGESAVDCNNISGMPNVSFI  441

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IG K FDL P++Y+LKVGEG  AQCISGF+ALD+PPPRGPLWILGDVFMG YHTVFDYG 
Sbjct  442   IGNKAFDLRPDQYVLKVGEGVTAQCISGFSALDMPPPRGPLWILGDVFMGAYHTVFDYGN  501

Query  193   MRVGFAEAA  167
             +RVGFAEAA
Sbjct  502   LRVGFAEAA  510



>ref|XP_011006459.1| PREDICTED: cyprosin-like isoform X2 [Populus euphratica]
Length=514

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/500 (68%), Positives = 407/500 (81%), Gaps = 13/500 (3%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAAR-------LEAKAGDSLRASVRKYYNLHGRNGDL  1484
              S  +DG +RIGLKK K+D+  R            E   G S  A+ +KYYNL    G+ 
Sbjct  20    LSARDDGLMRIGLKKKKLDQLGRRVVPGPVNFIPKEEGGGASKPAATKKYYNL----GE-  74

Query  1483  QDTDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYT  1304
              + DIV LKNY+DAQY+GEI +GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHSKY 
Sbjct  75    TEADIVALKNYLDAQYYGEIAIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACYFHSKYK  134

Query  1303  SSQSSTYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKF  1124
             SS S+TY KNG SA I YGTGSISGFFSQDSV+VGDLVVK+Q FIEAT EPGVTFL +KF
Sbjct  135   SSASTTYVKNGTSAAIQYGTGSISGFFSQDSVEVGDLVVKNQDFIEATKEPGVTFLASKF  194

Query  1123  DGILGLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHY  944
             DGILGLGFQEISVG+A      MVNQGLV++ +FSFWLNRN + +EGGE+VFGGVDP HY
Sbjct  195   DGILGLGFQEISVGNAVPVWYNMVNQGLVKEKVFSFWLNRNVEGEEGGEIVFGGVDPNHY  254

Query  943   KGEHTYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHA  764
             KGEHTYVPVT KGYWQFDMG++LI  + TG C+GGC AIADSGTSL+AGP+++IT IN+A
Sbjct  255   KGEHTYVPVTHKGYWQFDMGDLLIGTETTGLCAGGCKAIADSGTSLLAGPTTVITQINNA  314

Query  763   IGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE  584
             IGA G+VS+ECK VV  YG+ ++++LV +A+P+K+CSQI  CTF+G +GVSM IESVV+E
Sbjct  315   IGASGIVSEECKTVVAQYGKIILEMLVAQAQPRKVCSQISFCTFDGTQGVSMNIESVVEE  374

Query  583   KNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCG  407
              +  S+D LHDAMC+ACEM VVWM+N+L  N T++ IL YVN+LC+RLPSP GES V+C 
Sbjct  375   SSDKSSDGLHDAMCTACEMIVVWMENRLRLNDTKDQILDYVNDLCDRLPSPNGESAVECS  434

Query  406   KLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFM  227
              LS+M SVSF IGGK+F+LSP +Y+LKVGEG +AQCISGFTALDVPPPRGPLWILGDVFM
Sbjct  435   SLSSMSSVSFEIGGKLFELSPEQYVLKVGEGVSAQCISGFTALDVPPPRGPLWILGDVFM  494

Query  226   GRYHTVFDYGKMRVGFAEAA  167
             GRYHTVFDYG + VGFA+AA
Sbjct  495   GRYHTVFDYGNLTVGFADAA  514



>sp|P42210.1|ASPR_HORVU RecName: Full=Phytepsin; AltName: Full=Aspartic proteinase; Contains: 
RecName: Full=Phytepsin 32 kDa subunit; Contains: RecName: 
Full=Phytepsin 29 kDa subunit; Contains: RecName: Full=Phytepsin 
16 kDa subunit; Contains: RecName: Full=Phytepsin 
11 kDa subunit; Flags: Precursor [Hordeum vulgare]
 emb|CAA39602.1| aspartic proteinase [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/493 (70%), Positives = 401/493 (81%), Gaps = 18/493 (4%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRN--GDLQDTDIVGLKN  1454
             +G VRI LKK  ID+N+R+A  L       L         L G N     ++ DIV LKN
Sbjct  28    EGLVRIALKKRPIDRNSRVATGLSGGEEQPL---------LSGANPLRSEEEGDIVALKN  78

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YM+AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFS+ C+ HS+Y +  SSTY+KN
Sbjct  79    YMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHSRYKAGASSTYKKN  138

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GK A I YGTGSI+G+FS+DSV VGDLVVK Q FIEAT EPG+TFLVAKFDGILGLGF+E
Sbjct  139   GKPAAIQYGTGSIAGYFSEDSVTVGDLVVKDQEFIEATKEPGITFLVAKFDGILGLGFKE  198

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG A      M+ QGLV DP+FSFWLNR+  E EGGE++FGG+DPKHY GEHTYVPVT
Sbjct  199   ISVGKAVPVWYKMIEQGLVSDPVFSFWLNRHVDEGEGGEIIFGGMDPKHYVGEHTYVPVT  258

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQFDMG+VL+ GK TGFC+GGC+AIADSGTSL+AGP++IIT IN  IGA GVVS+E
Sbjct  259   QKGYWQFDMGDVLVGGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINEKIGAAGVVSQE  318

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK----NGVSA  566
             CK +V  YGQ+++DLL+ E +PKKICSQ+GLCTF+G RGVS GI SVVD++    NG+ A
Sbjct  319   CKTIVSQYGQQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGIRSVVDDEPVKSNGLRA  378

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
                D MCSACEM VVWMQNQL++N+TQ+ IL YVN+LCNRLPSPMGES VDCG L +MP 
Sbjct  379   ---DPMCSACEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLPSPMGESAVDCGSLGSMPD  435

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             + F+IGGK F L P EYILKVGEG+AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVF
Sbjct  436   IEFTIGGKKFALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVF  495

Query  205   DYGKMRVGFAEAA  167
             DYGK+R+GFA+AA
Sbjct  496   DYGKLRIGFAKAA  508



>ref|NP_192355.1| aspartic proteinase A3 [Arabidopsis thaliana]
 sp|Q9XEC4.1|APA3_ARATH RecName: Full=Aspartic proteinase A3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAD29758.1|AF076243_5 putative aspartic protease [Arabidopsis thaliana]
 gb|AAK50111.1|AF372974_1 AT4g04460/T26N6_7 [Arabidopsis thaliana]
 emb|CAB77914.1| putative aspartic protease [Arabidopsis thaliana]
 gb|AEE82390.1| aspartic proteinase A3 [Arabidopsis thaliana]
Length=508

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/490 (66%), Positives = 406/490 (83%), Gaps = 8/490 (2%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             ++ DG +RIGLKK K+D++NR+A++L  K   S   S + Y+ L+  N D+     V LK
Sbjct  27    RNGDGTIRIGLKKRKLDRSNRLASQLFLKNRGS-HWSPKHYFRLNDENADM-----VPLK  80

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+G+I +GTPPQKFTVIFDTGSSNLW+PS+KCY SV C+FHSKY +SQSS+Y K
Sbjct  81    NYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSKYKASQSSSYRK  140

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISG+FS D V+VGD+VVK Q FIEATSEPG+TFL+AKFDGILGLGF+
Sbjct  141   NGKPASIRYGTGAISGYFSNDDVKVGDIVVKEQEFIEATSEPGITFLLAKFDGILGLGFK  200

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG++      MV +GLV++PIFSFWLNRNP++ EGGE+VFGGVDPKH+KGEHT+VPV
Sbjct  201   EISVGNSTPVWYNMVEKGLVKEPIFSFWLNRNPKDPEGGEIVFGGVDPKHFKGEHTFVPV  260

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T KGYWQFDMG++ I GKPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA G+VS+
Sbjct  261   THKGYWQFDMGDLQIAGKPTGYCAKGCSAIADSGTSLLTGPSTVITMINHAIGAQGIVSR  320

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             ECKAVV+ YG+ M++ L+ +  PKK+CSQIG+C ++G + VSMGI+SVVD+  G S  L+
Sbjct  321   ECKAVVDQYGKTMLNSLLAQEDPKKVCSQIGVCAYDGTQSVSMGIQSVVDD--GTSGLLN  378

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
              AMCSACEM  VWM+++L++NQTQE IL+Y  ELC+ +P+   +S VDCG++S+MP V+F
Sbjct  379   QAMCSACEMAAVWMESELTQNQTQERILAYAAELCDHIPTQNQQSAVDCGRVSSMPIVTF  438

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             SIGG+ FDL+P +YI K+GEG  +QC SGFTA+D+ PPRGPLWILGD+FMG YHTVFDYG
Sbjct  439   SIGGRSFDLTPQDYIFKIGEGVESQCTSGFTAMDIAPPRGPLWILGDIFMGPYHTVFDYG  498

Query  196   KMRVGFAEAA  167
             K RVGFA+AA
Sbjct  499   KGRVGFAKAA  508



>ref|XP_004287958.1| PREDICTED: aspartic proteinase A1-like [Fragaria vesca subsp. 
vesca]
Length=515

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/496 (68%), Positives = 411/496 (83%), Gaps = 7/496 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAK-AGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
              S SNDG VRIGLKK+K+D+ ++I     A+ A  S+RA +++Y      +GD   TDIV
Sbjct  23    LSTSNDGLVRIGLKKVKLDQTSQIHRDTNAQNAQGSVRAPLKEYRLRGDYSGD---TDIV  79

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYMDAQYFGEIG+GTP QKFTVIFDTGSSNLWVPS+KCYFSV CFFHSKY SSQSS+
Sbjct  80    ELKNYMDAQYFGEIGIGTPVQKFTVIFDTGSSNLWVPSAKCYFSVACFFHSKYKSSQSSS  139

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             + KNG SA I YGTG+I+GFFSQD V VG+LVVK Q FIEAT EPG+TF+ AKFDGILGL
Sbjct  140   HTKNGTSAAIQYGTGAIAGFFSQDHVTVGNLVVKDQDFIEATKEPGITFVAAKFDGILGL  199

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             G+QEISVG A      MV+QGLV++P+FSFWLNRN + +EGGE+VFGG+D  HY GEHTY
Sbjct  200   GYQEISVGGAVPVWYNMVSQGLVKEPVFSFWLNRNTEGEEGGEIVFGGMDSNHYVGEHTY  259

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVTQKGYWQFDMG+VLI G+ +G C+ GCSAIADSGTSL+AGP++IIT INHAIGA G+
Sbjct  260   VPVTQKGYWQFDMGDVLIGGESSGLCASGCSAIADSGTSLLAGPTTIITQINHAIGASGI  319

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS+ECKA+V+ YG+ ++++L+ + +P++ICSQIGLCTF+G RGVSMGIE+VVD+     +
Sbjct  320   VSQECKAIVDQYGKIILEMLLAQVKPQRICSQIGLCTFDGTRGVSMGIETVVDQNTETKS  379

Query  565   D-LHDAMCSACEMTVVWMQNQ--LSENQTQENILSYVNELCNRLPSPMGESGVDCGKLST  395
             D +HDA C+ACEM VVW+QNQ  L+ NQT+E IL+Y NELC RLPSP GES V C  LS+
Sbjct  380   DGVHDAACTACEMAVVWIQNQLRLNLNQTEEQILNYANELCERLPSPNGESAVQCNTLSS  439

Query  394   MPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYH  215
             +P++SF+IGGKVFDL+P +Y+LK+GEG+AAQC+SGF ALDV PPRGPLWILGD+FMG+YH
Sbjct  440   LPTISFTIGGKVFDLAPEQYVLKMGEGAAAQCLSGFIALDVAPPRGPLWILGDIFMGQYH  499

Query  214   TVFDYGKMRVGFAEAA  167
             TVFDYG   VGFA AA
Sbjct  500   TVFDYGNANVGFAVAA  515



>gb|AHB32105.1| aspartic proteinase [Camellia sinensis]
Length=507

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/494 (69%), Positives = 408/494 (83%), Gaps = 9/494 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             +FS S++  +R+GLKK K+D+  R+    E  +G S R      Y L G   D  DTDI+
Sbjct  22    SFSASDNRLIRVGLKKRKLDQIKRLGE--EGFSGASERN-----YRLRGNFED-SDTDII  73

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNYM+AQYFGEIG+GTP QKFTVIFDTGSSNLWVPS+KCYFSV C+ HSKY SS SST
Sbjct  74    SLKNYMNAQYFGEIGIGTPSQKFTVIFDTGSSNLWVPSAKCYFSVACYLHSKYKSSYSST  133

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+KNGKSAEIHYGTG+I+GFFSQD V++GDLVVK Q FIEAT EPG+TFL AKFDGILGL
Sbjct  134   YKKNGKSAEIHYGTGAIAGFFSQDHVKMGDLVVKDQDFIEATREPGITFLAAKFDGILGL  193

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+A      MV+QGLV +P+FSFW NRN  E EGGE+VFGGVD  H+KGEHTY
Sbjct  194   GFQEISVGNAVPVWYNMVDQGLVNEPVFSFWFNRNSGENEGGEIVFGGVDSNHFKGEHTY  253

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPV QKGYWQFDMG+VLI+G+ TGFC GGCSAIADSGTSL+AGP++IIT INHAIGA G+
Sbjct  254   VPVVQKGYWQFDMGDVLIDGETTGFCGGGCSAIADSGTSLLAGPTTIITQINHAIGASGI  313

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS+ECKAVV  YG+ ++++L+ +A P+KICSQIGLC  +G++ VS+GIESVVD+    S+
Sbjct  314   VSQECKAVVAQYGKMILEMLLAQAEPQKICSQIGLCYSDGSQDVSIGIESVVDKNRHESS  373

Query  565   DLH-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
              +H +A C+AC+M V+WMQNQL  NQTQ+ IL+Y+NELC+RLPSPMGES VDC  LS+MP
Sbjct  374   GVHGEASCTACQMMVIWMQNQLKGNQTQDRILNYINELCDRLPSPMGESAVDCSSLSSMP  433

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
              VSF+IGGKVFDL+P +Y+L+VG+G   QCISGFTALDV PPRGPLWILGDVFMG+YHTV
Sbjct  434   IVSFTIGGKVFDLTPEQYVLQVGDGPETQCISGFTALDVTPPRGPLWILGDVFMGQYHTV  493

Query  208   FDYGKMRVGFAEAA  167
             FDYG M VGFAEAA
Sbjct  494   FDYGNMTVGFAEAA  507



>pdb|1QDM|A Chain A, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley 
Vacuolar Aspartic Proteinase.
 pdb|1QDM|B Chain B, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley 
Vacuolar Aspartic Proteinase.
 pdb|1QDM|C Chain C, Crystal Structure Of Prophytepsin, A Zymogen Of A Barley 
Vacuolar Aspartic Proteinase.
Length=478

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/490 (70%), Positives = 399/490 (81%), Gaps = 18/490 (4%)
 Frame = -2

Query  1618  VRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRN--GDLQDTDIVGLKNYMD  1445
             VRI LKK  ID+N+R+A  L       L         L G N     ++ DIV LKNYM+
Sbjct  1     VRIALKKRPIDRNSRVATGLSGGEEQPL---------LSGANPLRSEEEGDIVALKNYMN  51

Query  1444  AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNGKS  1265
             AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFS+ C+ HS+Y +  SSTY+KNGK 
Sbjct  52    AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHSRYKAGASSTYKKNGKP  111

Query  1264  AEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEISV  1085
             A I YGTGSI+G+FS+DSV VGDLVVK Q FIEAT EPG+TFLVAKFDGILGLGF+EISV
Sbjct  112   AAIQYGTGSIAGYFSEDSVTVGDLVVKDQEFIEATKEPGITFLVAKFDGILGLGFKEISV  171

Query  1084  GDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQKG  905
             G A      M+ QGLV DP+FSFWLNR+  E EGGE++FGG+DPKHY GEHTYVPVTQKG
Sbjct  172   GKAVPVWYKMIEQGLVSDPVFSFWLNRHVDEGEGGEIIFGGMDPKHYVGEHTYVPVTQKG  231

Query  904   YWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKECKA  725
             YWQFDMG+VL+ GK TGFC+GGC+AIADSGTSL+AGP++IIT IN  IGA GVVS+ECK 
Sbjct  232   YWQFDMGDVLVGGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINEKIGAAGVVSQECKT  291

Query  724   VVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEK----NGVSADLH  557
             +V  YGQ+++DLL+ E +PKKICSQ+GLCTF+G RGVS GI SVVD++    NG+ A   
Sbjct  292   IVSQYGQQILDLLLAETQPKKICSQVGLCTFDGTRGVSAGIRSVVDDEPVKSNGLRA---  348

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             D MCSACEM VVWMQNQL++N+TQ+ IL YVN+LCNRLPSPMGES VDCG L +MP + F
Sbjct  349   DPMCSACEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLPSPMGESAVDCGSLGSMPDIEF  408

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK F L P EYILKVGEG+AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFDYG
Sbjct  409   TIGGKKFALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVFDYG  468

Query  196   KMRVGFAEAA  167
             K+R+GFA+AA
Sbjct  469   KLRIGFAKAA  478



>ref|XP_010496363.1| PREDICTED: aspartic proteinase A3-like [Camelina sativa]
Length=512

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/491 (66%), Positives = 404/491 (82%), Gaps = 10/491 (2%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAK-AGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             ++ DG +RIGLKK K+D+ NR+A++L  K  G S     + ++ L+  N D+     V L
Sbjct  31    RNGDGTIRIGLKKRKLDRGNRLASQLFLKNRGGSWFP--KDHFRLNDANADM-----VPL  83

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+G+I +GTPPQKFTVIFDTGSSNLW+PS+KCY SV C+FHSKY +SQSSTY+
Sbjct  84    KNYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSKYKASQSSTYK  143

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A I YGTG+I+G+FS D V+VGDLVVK Q FIEATSEPG+TFL+AKFDGILGLGF
Sbjct  144   KNGKPASIRYGTGAIAGYFSYDDVKVGDLVVKEQEFIEATSEPGITFLLAKFDGILGLGF  203

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVG++      MV +GLV++PIFSFWLNRNP++ EGGE+VFGG+DPKH+KGEHTYVP
Sbjct  204   KEISVGNSTPVWYNMVEKGLVKEPIFSFWLNRNPKDPEGGEIVFGGLDPKHFKGEHTYVP  263

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VT KGYWQFDMG++ I GKPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA G+VS
Sbjct  264   VTHKGYWQFDMGDLQIAGKPTGYCAKGCSAIADSGTSLLTGPSTVITMINHAIGAQGIVS  323

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECKAVV+ YG+ M++ L+ +  PKK+CSQIG+C F+G   VSMGI+SVVD+  G S  L
Sbjct  324   RECKAVVDQYGKTMLNSLLAQEDPKKVCSQIGVCAFDGTDSVSMGIQSVVDD--GASGLL  381

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
             + AMCSAC+M  VWM+++L++NQTQE IL+Y  ELC+ +P+   +S VDC K+S+MP VS
Sbjct  382   NQAMCSACQMAAVWMESELTQNQTQERILAYAAELCDHIPTQNQQSAVDCEKVSSMPIVS  441

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGG+ FDLSP +YI K+GEG   QC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDY
Sbjct  442   FTIGGRTFDLSPQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDY  501

Query  199   GKMRVGFAEAA  167
             GK RVGFA+AA
Sbjct  502   GKARVGFAKAA  512



>ref|XP_008784384.1| PREDICTED: aspartic proteinase oryzasin-1-like [Phoenix dactylifera]
Length=518

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/495 (67%), Positives = 404/495 (82%), Gaps = 4/495 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY-YNLHGRNGDLQDTDI  1469
             AF  S DG  RIGLKK  +D+N+R+AARL  +  ++   + RKY Y   G  G  ++ ++
Sbjct  24    AFPVSADGVFRIGLKKRALDQNSRLAARLAVREEEAAALAARKYGYFEPGPVGPGEEGNV  83

Query  1468  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSS  1289
             V LKNYM+AQYF EIG+G+PPQ FTVIFDTGSSNLWVPSSKCYFSV C+FHSKY SS SS
Sbjct  84    VALKNYMNAQYFAEIGLGSPPQNFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKSSLSS  143

Query  1288  TYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILG  1109
             TY+KNG+SA IHYGTGS+SGFFSQD V VG+L +K+Q FIEAT EP +TF+VAKFDGILG
Sbjct  144   TYQKNGRSANIHYGTGSVSGFFSQDYVTVGELTIKNQVFIEATREPSITFMVAKFDGILG  203

Query  1108  LGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHT  929
             LGF+EISVG        MVNQ LV++ +FSFW NRN ++ EGGE++FGG+DPKHY+GEHT
Sbjct  204   LGFKEISVGKVVPVWDNMVNQSLVKESVFSFWFNRNTEDGEGGEIMFGGMDPKHYRGEHT  263

Query  928   YVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADG  749
             YVPVTQKGYWQFDMG+VLI G+ TGFC+ GC AIADSGTSLIAGP++II  +N  IGA G
Sbjct  264   YVPVTQKGYWQFDMGDVLIGGQTTGFCAEGCQAIADSGTSLIAGPTTIIAEVNQKIGAAG  323

Query  748   VVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS  569
             +VS++CKAVV  YG++++++L+ +  P KICS+IGLC F+G RGVSMGI+S+V+ K   S
Sbjct  324   IVSQQCKAVVSQYGEKIMEMLMEKEEPAKICSRIGLCAFDGTRGVSMGIKSMVNGKRDRS  383

Query  568   A-DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
                L D MCS CEM VVWMQ+QL +NQT E +L+Y++ELC RLPSPMGES VDC  LS+M
Sbjct  384   TGGLGDGMCSYCEMAVVWMQSQLVQNQTLEQVLNYISELCERLPSPMGESAVDCNSLSSM  443

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P+VSF+IGGK+FDL P +YILKVG+GS+AQCISGFTALDV  P+GPLWILGDVFMG YHT
Sbjct  444   PTVSFTIGGKIFDLKPEQYILKVGDGSSAQCISGFTALDV--PQGPLWILGDVFMGAYHT  501

Query  211   VFDYGKMRVGFAEAA  167
             VFDYG+ RVGFAEAA
Sbjct  502   VFDYGQQRVGFAEAA  516



>gb|KEH36904.1| fungal proteinase A, aspartic proteinase superfamily protein 
[Medicago truncatula]
Length=510

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/491 (68%), Positives = 406/491 (83%), Gaps = 10/491 (2%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYY--NLHGRNGDLQDTDIVGLK  1457
             N+G  RIGLKK K++  N     L +K  +S  +S+R Y   N+ G  G+    D+V LK
Sbjct  27    NEGLRRIGLKKNKLEPKNL----LGSKGCESSWSSIRNYASKNILGGAGE---ADVVALK  79

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+GEI +GTPPQ FTVIFDTGSSN WVPS KCYFS+ C  H+KY SSQSSTY+ 
Sbjct  80    NYLDAQYYGEISIGTPPQTFTVIFDTGSSNTWVPSVKCYFSLACLVHAKYKSSQSSTYKP  139

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NG  A I YGTG++SGFFS D+V+VGD+VVK   FIEAT EPG+TF+ AKFDG+LGLGFQ
Sbjct  140   NGTHAAIQYGTGAVSGFFSYDNVKVGDVVVKDVEFIEATREPGLTFVAAKFDGLLGLGFQ  199

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG+A      MV QGLV+DP+FSFWLNRNP E++GGELVFGGVDP H+KGEHTYVPV
Sbjct  200   EISVGNAVPIWYKMVKQGLVKDPVFSFWLNRNPNEEQGGELVFGGVDPAHFKGEHTYVPV  259

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T+KGYWQF MG+VLI+GKPTG+C+  CSAIADSGTSL+AGP+++ITMIN AIGA GV S+
Sbjct  260   TRKGYWQFAMGDVLIDGKPTGYCANDCSAIADSGTSLLAGPTTVITMINQAIGASGVYSQ  319

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             EC+ VV+ YG  ++ LLV EA+PKK+CSQIGLCTF+G +G+SMGI+SVV++ + +S+  H
Sbjct  320   ECRTVVDQYGHSILQLLVAEAQPKKVCSQIGLCTFDGTQGISMGIQSVVEQTDRISSGGH  379

Query  556   -DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
              DA CS CEM VVWMQNQL +NQT+E I++Y + LC+++P+P+G+S VDC K+S+MP VS
Sbjct  380   QDATCSVCEMAVVWMQNQLKQNQTEERIINYADSLCDKMPNPLGQSSVDCAKISSMPKVS  439

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGK FDL+P EYILKVGEG+AAQCISGFTALDVPPPRGPLWILGD+FMGRYHTVFDY
Sbjct  440   FTIGGKKFDLAPEEYILKVGEGAAAQCISGFTALDVPPPRGPLWILGDIFMGRYHTVFDY  499

Query  199   GKMRVGFAEAA  167
             GK+RVGFAEAA
Sbjct  500   GKLRVGFAEAA  510



>dbj|BAE20413.1| aspartic proteinase [Triticum aestivum]
Length=508

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/492 (69%), Positives = 400/492 (81%), Gaps = 14/492 (3%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDL---QDTDIVGLK  1457
             +G VRI LKK  ID+N+R+A  L  +          + + L G +  L   ++ DIV LK
Sbjct  26    EGLVRIALKKRAIDRNSRVAKSLSDR---------EEVHLLGGASNTLPSEEEGDIVSLK  76

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NYM+AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFS+ C+ H++Y +  SSTY+K
Sbjct  77    NYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACYLHARYKAGASSTYKK  136

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTGSI+G+FS+DSV VGDLVVK Q FIEAT EPGVTFLVAKFDGILGLGF+
Sbjct  137   NGKPAAIQYGTGSIAGYFSEDSVTVGDLVVKDQEFIEATKEPGVTFLVAKFDGILGLGFK  196

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQE-QEGGELVFGGVDPKHYKGEHTYVP  920
             EISVG A      MV QGL+ DP+FSFWLNR+  +  EGGE++FGG+DPKHY GEHTYVP
Sbjct  197   EISVGKAVPVWYNMVEQGLISDPVFSFWLNRHADDEGEGGEIIFGGMDPKHYVGEHTYVP  256

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
              TQKGYWQFDMG+VL+ GK TGFC+GGC+AIADSGTSL+AGP++IIT IN  IGA GVVS
Sbjct  257   ATQKGYWQFDMGDVLVGGKSTGFCAGGCAAIADSGTSLLAGPTAIITEINEKIGAAGVVS  316

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECK +V  YGQ+++DLL+ E +PKK+CSQ+GLCTF+G RGVS GI SVVD++   S  L
Sbjct  317   QECKTIVSQYGQQILDLLLAETQPKKVCSQVGLCTFDGTRGVSAGIRSVVDDEPVKSNGL  376

Query  559   H-DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             H D MCSACEM VVWMQNQL++N+TQ+ IL YVN+LCNRLPSPMGES VDC  L +MP +
Sbjct  377   HTDPMCSACEMAVVWMQNQLAQNKTQDLILDYVNQLCNRLPSPMGESAVDCASLGSMPDI  436

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
              F+I GK F L P EYILKVGEG+AAQCISGFTA+D+PPPRGPLWILGDVFMG YHTVFD
Sbjct  437   EFTISGKKFALKPEEYILKVGEGAAAQCISGFTAMDIPPPRGPLWILGDVFMGPYHTVFD  496

Query  202   YGKMRVGFAEAA  167
             YGK+RVGFA+AA
Sbjct  497   YGKLRVGFAKAA  508



>ref|XP_002302872.2| aspartic endopeptidase family protein [Populus trichocarpa]
 gb|EEE82145.2| aspartic endopeptidase family protein [Populus trichocarpa]
Length=514

 Score =   692 bits (1787),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/500 (68%), Positives = 405/500 (81%), Gaps = 13/500 (3%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAAR-------LEAKAGDSLRASVRKYYNLHGRNGDL  1484
              S  +DG +RIGLKK K+D   R            E   G S  A+ +KYYN+    G+ 
Sbjct  20    LSARDDGLMRIGLKKKKLDHLGRRVVPGSVNFIPEEEGGGASKPAATKKYYNI----GE-  74

Query  1483  QDTDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYT  1304
              + DIV LKNY+DAQY+GEI +GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHSKY 
Sbjct  75    TEADIVALKNYLDAQYYGEITIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACYFHSKYK  134

Query  1303  SSQSSTYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKF  1124
             SS S+TY KNG SA I YGTGSISGFFSQDSV+VGDLVVK+Q FIEAT EPGVTFL +KF
Sbjct  135   SSASTTYVKNGTSAAIQYGTGSISGFFSQDSVEVGDLVVKNQGFIEATKEPGVTFLASKF  194

Query  1123  DGILGLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHY  944
             DGILGLGFQEISVG+A      MVNQGLV++ +FSFWLNRN + +EGGE+VFGGVDP HY
Sbjct  195   DGILGLGFQEISVGNAVPVWYNMVNQGLVKEKVFSFWLNRNVEGEEGGEIVFGGVDPNHY  254

Query  943   KGEHTYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHA  764
             KGEHTYVPVT KGYWQFDMG++LI  + TG C+GGC AIADSGTSL+AGP+++IT IN+A
Sbjct  255   KGEHTYVPVTHKGYWQFDMGDLLIGTETTGLCAGGCKAIADSGTSLLAGPTTVITQINNA  314

Query  763   IGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE  584
             IGA G+VS+ECK VV  YG+ ++++LV +A+P+K+CSQI  CTF+G +GVSM IESVV+E
Sbjct  315   IGASGIVSEECKTVVAQYGKIILEMLVAQAQPRKVCSQISFCTFDGTQGVSMNIESVVEE  374

Query  583   KNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCG  407
              +  S+D LHDAMC+ACEM VVWM+N+L  N T++ IL YVN LC+RLPSP GES V+C 
Sbjct  375   NSDKSSDGLHDAMCTACEMMVVWMENRLRLNDTEDQILDYVNNLCDRLPSPNGESAVECS  434

Query  406   KLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFM  227
              LS+MPS+SF IGGK+F+LSP +Y+LKVGEG +AQCISGFTALDVPPP GPLWILGDVFM
Sbjct  435   SLSSMPSISFEIGGKLFELSPEQYVLKVGEGVSAQCISGFTALDVPPPHGPLWILGDVFM  494

Query  226   GRYHTVFDYGKMRVGFAEAA  167
             GRYHTVFDYG + VGFA+AA
Sbjct  495   GRYHTVFDYGNLTVGFADAA  514



>ref|XP_010432791.1| PREDICTED: aspartic proteinase A3-like isoform X1 [Camelina sativa]
 ref|XP_010432799.1| PREDICTED: aspartic proteinase A3-like isoform X1 [Camelina sativa]
Length=508

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/491 (65%), Positives = 403/491 (82%), Gaps = 10/491 (2%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAK-AGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             +  DG +RIGLKK K+D++NR+A++L  K  G S     + ++ L+  N D+     V L
Sbjct  27    RKGDGTIRIGLKKRKLDRSNRLASQLFLKNRGGSWFP--KDHFRLNDANADM-----VPL  79

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+G+I +GTPPQKFTVIFDTGSSNLW+PS+KCY SV C+FHSKY +SQSSTY 
Sbjct  80    KNYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSKYKASQSSTYR  139

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A I YGTG+I+G+FS D V+VGDLVVK Q FIEATSEPG+TFL+AKFDGILGLGF
Sbjct  140   KNGKPASIRYGTGAIAGYFSYDDVKVGDLVVKEQEFIEATSEPGITFLLAKFDGILGLGF  199

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EI+VG++      MV +GLV++PIFSFWLNRNP++ EGGE+VFGG+DPKH+KGEHTYVP
Sbjct  200   KEIAVGNSTPVWYNMVEKGLVKEPIFSFWLNRNPKDPEGGEIVFGGLDPKHFKGEHTYVP  259

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VT KGYWQFDMG++ I GKPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA G+VS
Sbjct  260   VTHKGYWQFDMGDLQIAGKPTGYCAKGCSAIADSGTSLLTGPSTVITMINHAIGAQGIVS  319

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECKAVV+ YG+ M++ L+ +  PKK+CSQIG+C F+G   VSMGI+SVVD+  G S  L
Sbjct  320   RECKAVVDQYGKTMLNSLLAQEDPKKVCSQIGVCAFDGTDSVSMGIQSVVDD--GASGLL  377

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
             + AMCSAC+M  VWM+++L++N+TQE IL+Y  ELC+ +P+   +S VDC K+S+MP VS
Sbjct  378   NQAMCSACQMAAVWMESELTQNKTQERILAYAAELCDHIPTQNQQSAVDCEKVSSMPIVS  437

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGG+ FDLSP +YI K+GEG   QC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDY
Sbjct  438   FTIGGRTFDLSPQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDY  497

Query  199   GKMRVGFAEAA  167
             GK RVGFA+AA
Sbjct  498   GKARVGFAKAA  508



>ref|XP_009114571.1| PREDICTED: aspartic proteinase A3 isoform X1 [Brassica rapa]
Length=507

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/490 (66%), Positives = 402/490 (82%), Gaps = 9/490 (2%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             +  DG +RIGLKK K+D+ NR+A++L  K   S   S + Y+ L+  N     +DIV LK
Sbjct  27    QKGDGTLRIGLKKRKLDRANRLASQLFLKNRGSW--SPKDYFRLNDAN-----SDIVPLK  79

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+GEI +GTPPQKFT IFDTGSSNLWVPSS CYFS+ C+FHSKY +  SSTY++
Sbjct  80    NYLDAQYYGEITIGTPPQKFTAIFDTGSSNLWVPSSNCYFSIACYFHSKYKARDSSTYKR  139

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISG+FS D V+VG LV+K Q FIEATSEPG+TFL+AKFDGILGLGF+
Sbjct  140   NGKPASIRYGTGAISGYFSNDDVKVGGLVIKDQVFIEATSEPGITFLLAKFDGILGLGFK  199

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EI+VG++      MV +GLV++PIFSFWLNRNP++ EGG++VFGGVDPKH+KGEHTYVPV
Sbjct  200   EIAVGNSTPVWYNMVEKGLVKEPIFSFWLNRNPEDPEGGQIVFGGVDPKHFKGEHTYVPV  259

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T+KGYWQFDMG++ I GKPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA G+ S+
Sbjct  260   TRKGYWQFDMGDLNIAGKPTGYCANGCSAIADSGTSLLTGPSTVITMINHAIGAVGIASQ  319

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             ECK V+  YGQ M++ LV +  P+K+CSQIGLC F+G   VSMGI+SVV++  GVS+ L+
Sbjct  320   ECKTVIGQYGQTMLESLVSQVDPRKVCSQIGLCGFDGTHSVSMGIKSVVED--GVSSLLN  377

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             +AMCSACEM  VWMQ++LS+NQTQE IL+Y  ELC+ +P+P  +S VDC ++S+MP V+F
Sbjct  378   EAMCSACEMASVWMQSELSQNQTQERILAYAAELCDHIPNPNQQSAVDCERVSSMPIVTF  437

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK FDLSP +YI K+G+G  AQC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYG
Sbjct  438   TIGGKPFDLSPQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYG  497

Query  196   KMRVGFAEAA  167
             K RVGFA+A 
Sbjct  498   KTRVGFAKAT  507



>emb|CDY16668.1| BnaA09g20460D [Brassica napus]
Length=507

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/490 (66%), Positives = 402/490 (82%), Gaps = 9/490 (2%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             +  DG +RIGLKK K+D+ NR+A++L  K   S   S + Y+ L+  N     +DIV LK
Sbjct  27    QKGDGTLRIGLKKRKLDRANRLASQLFLKNRGSW--SPKDYFRLNDAN-----SDIVPLK  79

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+GEI +GTPPQKFT IFDTGSSNLWVPSS CYFS+ C+FHSKY +  SSTY++
Sbjct  80    NYLDAQYYGEITIGTPPQKFTAIFDTGSSNLWVPSSNCYFSIACYFHSKYKARDSSTYKR  139

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISG+FS D V+VG LV+K Q FIEATSEPG+TFL+AKFDGILGLGF+
Sbjct  140   NGKPASIRYGTGAISGYFSNDDVKVGGLVIKDQEFIEATSEPGITFLLAKFDGILGLGFK  199

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EI+VG++      MV +GLV++PIFSFWLNRNP++ EGG++VFGGVDPKH+KGEHTYVPV
Sbjct  200   EIAVGNSTPVWYNMVEKGLVKEPIFSFWLNRNPEDPEGGQIVFGGVDPKHFKGEHTYVPV  259

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T+KGYWQFDMG++ I GKPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA G+ S+
Sbjct  260   TRKGYWQFDMGDLNIAGKPTGYCANGCSAIADSGTSLLTGPSTVITMINHAIGAVGIASQ  319

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             ECK V+  YGQ M++ LV +  P+K+CSQIGLC F+G   VSMGI+SVV++  GVS+ L+
Sbjct  320   ECKTVIGQYGQTMLESLVSQVDPRKVCSQIGLCGFDGTHSVSMGIKSVVED--GVSSLLN  377

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             +AMCSACEM  VWMQ++LS+NQTQE IL+Y  ELC+ +P+P  +S VDC ++S+MP V+F
Sbjct  378   EAMCSACEMASVWMQSELSQNQTQERILAYAAELCDHIPNPNQQSAVDCERVSSMPIVTF  437

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK FDLSP +YI K+G+G  AQC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYG
Sbjct  438   TIGGKPFDLSPQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYG  497

Query  196   KMRVGFAEAA  167
             K RVGFA+A 
Sbjct  498   KTRVGFAKAT  507



>ref|XP_006286432.1| hypothetical protein CARUB_v10003637mg [Capsella rubella]
 gb|EOA19330.1| hypothetical protein CARUB_v10003637mg [Capsella rubella]
Length=503

 Score =   690 bits (1781),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/491 (66%), Positives = 405/491 (82%), Gaps = 15/491 (3%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAK-AGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             ++ DG +RIGLKK K+D++NR+A++L  K  G S   S + ++ L+G N D+     V L
Sbjct  27    RNGDGTIRIGLKKRKLDRSNRLASQLFLKNRGGSW--SPKDHFRLNGANADM-----VPL  79

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+G+I +GTPPQKFTVIFDTGSSNLW+PS+KCY SV C+FH+KY +SQSSTY 
Sbjct  80    KNYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHTKYKASQSSTYR  139

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A I YGTG+I+G+FS D V+VGDLVVK Q FIEATSEPG+TFL+AKFDGILGLGF
Sbjct  140   KNGKPASIRYGTGAIAGYFSNDDVKVGDLVVKEQEFIEATSEPGITFLLAKFDGILGLGF  199

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVG++      MV +GLV++PIFSFWLNRNPQ+ EGGE+VFGGVDPKH+KGEHTYVP
Sbjct  200   KEISVGNSTPVWYNMVEKGLVKEPIFSFWLNRNPQDPEGGEIVFGGVDPKHFKGEHTYVP  259

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VT KGYWQFDMG++ I GKPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA G+VS
Sbjct  260   VTHKGYWQFDMGDLQIAGKPTGYCAKGCSAIADSGTSLLTGPSTVITMINHAIGAQGIVS  319

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECKAVV+ YG+ M++ L+ +    K+CSQIG+C ++G   VSMGIESVVD+ +G+   L
Sbjct  320   RECKAVVDQYGKTMLNSLLAQ----KVCSQIGVCAYDGTHSVSMGIESVVDDASGL---L  372

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
             + AMCSACEM  VWM+++L++N+TQE IL+Y  ELC+ +P+   +S V+C K+S+MP VS
Sbjct  373   NQAMCSACEMAAVWMESELTQNKTQERILAYAAELCDHIPTQNQQSAVNCEKVSSMPIVS  432

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGG+ FDLSP +YI K+GEG   QC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDY
Sbjct  433   FTIGGRTFDLSPQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDY  492

Query  199   GKMRVGFAEAA  167
             GK RVGFA+AA
Sbjct  493   GKARVGFAKAA  503



>ref|XP_010455729.1| PREDICTED: aspartic proteinase A3 isoform X2 [Camelina sativa]
Length=504

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/491 (66%), Positives = 403/491 (82%), Gaps = 14/491 (3%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAK-AGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             ++ DG +RIGLKK K+D++NR+A++L  K  G+S     + ++ L+  N D+     V L
Sbjct  27    RNGDGTIRIGLKKRKLDRSNRLASQLFLKNRGESWFP--KDHFRLNDANADM-----VPL  79

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+G+I +GTPPQKFTVIFDTGSSNLW+PS+KCY SV C+FHSKY +SQSSTY 
Sbjct  80    KNYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSKYKASQSSTYR  139

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A I YGTG+I+G+FS D V+VGDLVVK Q FIEATSEPG+TFL+AKFDGILGLGF
Sbjct  140   KNGKPASIRYGTGAIAGYFSYDDVKVGDLVVKEQEFIEATSEPGITFLLAKFDGILGLGF  199

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVG++      MV +GLV++PIFSFWLNRNPQ+ EGGE+VFGGVDPKH+KGEHTYVP
Sbjct  200   KEISVGNSTPVWYNMVEKGLVKEPIFSFWLNRNPQDPEGGEIVFGGVDPKHFKGEHTYVP  259

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VT KGYWQFDMG++ I GKPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA G+VS
Sbjct  260   VTHKGYWQFDMGDLQIAGKPTGYCAKGCSAIADSGTSLLTGPSTVITMINHAIGAQGIVS  319

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECKAVV+ YG+ M++ L+ +    K+CSQIG+C F+G   VSMGI+SVVD+  G S  L
Sbjct  320   RECKAVVDQYGKTMLNSLLAQ----KVCSQIGVCAFDGTDSVSMGIQSVVDD--GASGLL  373

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
             + AMCSAC+M  VWM+++L++NQTQE IL+Y  ELC+ +P+   +S VDC K+S+MP VS
Sbjct  374   NQAMCSACQMAAVWMESELTQNQTQERILAYAAELCDHIPTQNQQSAVDCEKVSSMPIVS  433

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGG+ FDLSP +YI K+GEG   QC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDY
Sbjct  434   FTIGGRTFDLSPQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDY  493

Query  199   GKMRVGFAEAA  167
             GK RVGFA+AA
Sbjct  494   GKARVGFAKAA  504



>ref|XP_010667516.1| PREDICTED: aspartic proteinase A1-like [Beta vulgaris subsp. 
vulgaris]
Length=513

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/471 (70%), Positives = 389/471 (83%), Gaps = 5/471 (1%)
 Frame = -2

Query  1567  ARLEAKAGDSLRASVR---KYYNLHGRNGDLQDTDIVGLKNYMDAQYFGEIGVGTPPQKF  1397
             +RL  + G S+  S+R   K Y L        D DIV LKNY+DAQYFGEIGVGTPPQKF
Sbjct  44    SRLTTQYG-SIEESIRMPMKRYGLANNLASNDDADIVPLKNYLDAQYFGEIGVGTPPQKF  102

Query  1396  TVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNGKSAEIHYGTGSISGFFSQ  1217
             TVIFDTGSSNLWVPSSKCYFS+ C FHSKY + +S +Y KNGK AEIHYGTG+ISG+FS+
Sbjct  103   TVIFDTGSSNLWVPSSKCYFSIACLFHSKYNARKSKSYTKNGKRAEIHYGTGAISGYFSE  162

Query  1216  DSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEISVGDAXXXXXXMVNQGLV  1037
             D V +GDLVV++Q FIEAT EP +TF+ AKFDGILGLGFQEISVG A      M++QGLV
Sbjct  163   DHVTLGDLVVENQDFIEATREPSITFVAAKFDGILGLGFQEISVGKAVPVWYNMLDQGLV  222

Query  1036  QDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQKGYWQFDMGEVLIEGKPT  857
             ++P+FSFWLNRN  E+EGGE+VFGGVDP HYKGEHT+ PV+QKGYWQFDM +V ++G+ T
Sbjct  223   KEPVFSFWLNRNADEEEGGEIVFGGVDPDHYKGEHTWAPVSQKGYWQFDMDDVSVDGETT  282

Query  856   GFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKECKAVVENYGQRMIDLLVME  677
             G+C+ GCSAIADSGTSL+AGP++++  INHAIGA GV S ECKAVV  YG+++++LL+ E
Sbjct  283   GYCADGCSAIADSGTSLLAGPTAVVAQINHAIGASGVASMECKAVVSQYGKQILELLLSE  342

Query  676   ARPKKICSQIGLCTFNGNRGVSMGIESVVD-EKNGVSADLHDAMCSACEMTVVWMQNQLS  500
              +PKKICSQIGLCTF+G R VSMGIESVVD   +  S  L D+MC+ACEM VVWMQNQL 
Sbjct  343   TQPKKICSQIGLCTFDGKRDVSMGIESVVDVNVDKSSGGLRDSMCTACEMAVVWMQNQLR  402

Query  499   ENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVG  320
             +NQT+E IL+Y NELC RLPSPMGES VDC  LS+MPS+SF+I G  FDL+P +YILKVG
Sbjct  403   QNQTEERILNYANELCERLPSPMGESAVDCSSLSSMPSISFTIAGTTFDLTPEQYILKVG  462

Query  319   EGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  167
             EG+AAQCISGF ALDVPPPRGPLWILGD+FMGRYHTVFDYG +RVGFAEAA
Sbjct  463   EGAAAQCISGFIALDVPPPRGPLWILGDIFMGRYHTVFDYGNLRVGFAEAA  513



>sp|P40782.2|CYPR1_CYNCA RecName: Full=Cyprosin; Flags: Precursor, partial [Cynara cardunculus]
 prf||2124255A cyprosin
Length=473

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/482 (68%), Positives = 395/482 (82%), Gaps = 11/482 (2%)
 Frame = -2

Query  1606  LKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTD--IVGLKNYMDAQYF  1433
             LKK K++  N         AG +   + RKY    G  G+ +D+D  ++ LKNYMDAQYF
Sbjct  1     LKKRKVNILNHPGEH----AGSNDANARRKY----GVRGNFRDSDGELIALKNYMDAQYF  52

Query  1432  GEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKNGKSAEIH  1253
             GEIG+GTPPQKFTVIFDTGSSNLWVPSSKCYFSV C FHSKY S+ S+TY+KNGKSA I 
Sbjct  53    GEIGIGTPPQKFTVIFDTGSSNLWVPSSKCYFSVACLFHSKYRSTDSTTYKKNGKSAAIQ  112

Query  1252  YGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQEISVGDAX  1073
             YGTGSISGFFSQDSV++GDL+VK Q FIEAT EPG+TFL AKFDGILGLGFQEISVGDA 
Sbjct  113   YGTGSISGFFSQDSVKLGDLLVKEQDFIEATKEPGITFLAAKFDGILGLGFQEISVGDAV  172

Query  1072  XXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVTQKGYWQF  893
                  M+NQGLVQ+P+FSFWLNRN  EQEGGELVFGGVDP H+KGEHTYVPVTQKGYWQF
Sbjct  173   PVWYTMLNQGLVQEPVFSFWLNRNADEQEGGELVFGGVDPNHFKGEHTYVPVTQKGYWQF  232

Query  892   DMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKECKAVVEN  713
             +MG+VLI  K TGFC+ GC+AIADSGTSL+AG ++I+T IN AIGA GV+S++CK++V+ 
Sbjct  233   EMGDVLIGDKTTGFCASGCAAIADSGTSLLAGTTTIVTQINQAIGAAGVMSQQCKSLVDQ  292

Query  712   YGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHDAMCSACE  533
             YG+ MI++L+ E +P+KICSQ+ LC+F+G+   SM IESVVD+  G S+ L    C  C 
Sbjct  293   YGKSMIEMLLSEEQPEKICSQMKLCSFDGSHDTSMIIESVVDKSKGKSSGL-PMRCVPCA  351

Query  532   MTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFD  353
               VVWMQNQ+ +N+T+ENI++YV++LC RLPSPMGES VDC  LS+MP+++F++GGK F+
Sbjct  352   RWVVWMQNQIRQNETEENIINYVDKLCERLPSPMGESAVDCSSLSSMPNIAFTVGGKTFN  411

Query  352   LSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAE  173
             LSP +Y+LKVGEG+ AQCISGFTA+DV PP GPLWILGDVFMG+YHTVFDYG +RVGFAE
Sbjct  412   LSPEQYVLKVGEGATAQCISGFTAMDVAPPHGPLWILGDVFMGQYHTVFDYGNLRVGFAE  471

Query  172   AA  167
             AA
Sbjct  472   AA  473



>gb|AFK46704.1| unknown [Medicago truncatula]
Length=510

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/491 (67%), Positives = 404/491 (82%), Gaps = 10/491 (2%)
 Frame = -2

Query  1630  NDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYY--NLHGRNGDLQDTDIVGLK  1457
             N+G  RIGLKK K++  N     L +K  +S  +S+R Y   N+ G  G+    D+V LK
Sbjct  27    NEGLRRIGLKKNKLEPKNL----LGSKGCESSWSSIRNYASKNILGGAGE---ADVVALK  79

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+GEI +GTPPQ FTVIFDTGSSN WVPS KCYFS+ C  H+KY SSQSSTY+ 
Sbjct  80    NYLDAQYYGEISIGTPPQTFTVIFDTGSSNTWVPSVKCYFSLACLVHAKYKSSQSSTYKP  139

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NG  A I YGTG++SGFFS D+V+VGD+VVK   FIEAT EPG+TF+ AKFDG+LGLGFQ
Sbjct  140   NGTHAAIQYGTGAVSGFFSYDNVKVGDVVVKDVEFIEATREPGLTFVAAKFDGLLGLGFQ  199

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG+A      MV QGLV+DP+FSFWLNRNP E++GGELVFGGVDP H+KGEHTYVPV
Sbjct  200   EISVGNAVPIWYKMVKQGLVKDPVFSFWLNRNPNEEQGGELVFGGVDPAHFKGEHTYVPV  259

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T+KGYWQF MG+VLI+GKPTG+C+  CSAIADSGTSL+AGP+++ITMIN AIGA GV S+
Sbjct  260   TRKGYWQFAMGDVLIDGKPTGYCANDCSAIADSGTSLLAGPTTVITMINQAIGASGVYSQ  319

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             EC+ VV+ YG  ++ LLV EA+PKK+CSQIGLCTF+G +G+SMGI+SVV++ + +S+  H
Sbjct  320   ECRTVVDQYGHSILQLLVAEAQPKKVCSQIGLCTFDGTQGISMGIQSVVEQTDRISSGGH  379

Query  556   -DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
              DA C  CEM VVWMQNQL +NQT+E I++Y + LC+++P+P+G+S VDC K+S+MP VS
Sbjct  380   QDATCFVCEMAVVWMQNQLKQNQTEERIINYADSLCDKMPNPLGQSSVDCAKISSMPKVS  439

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGK FDL+P EYILKVGEG+AAQCISGFTALDVPPPRGPLWI GD+FMGRYHTVFDY
Sbjct  440   FTIGGKKFDLAPEEYILKVGEGAAAQCISGFTALDVPPPRGPLWIPGDIFMGRYHTVFDY  499

Query  199   GKMRVGFAEAA  167
             GK+RVGFAEAA
Sbjct  500   GKLRVGFAEAA  510



>ref|NP_001190671.1| aspartic proteinase A3 [Arabidopsis thaliana]
 gb|AEE82391.1| aspartic proteinase A3 [Arabidopsis thaliana]
Length=504

 Score =   687 bits (1772),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/490 (65%), Positives = 404/490 (82%), Gaps = 12/490 (2%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             ++ DG +RIGLKK K+D++NR+A++L  K   S   S + Y+ L+  N D+     V LK
Sbjct  27    RNGDGTIRIGLKKRKLDRSNRLASQLFLKNRGS-HWSPKHYFRLNDENADM-----VPLK  80

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+G+I +GTPPQKFTVIFDTGSSNLW+PS+KCY SV C+FHSKY +SQSS+Y K
Sbjct  81    NYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSKYKASQSSSYRK  140

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISG+FS D V+VGD+VVK Q FIEATSEPG+TFL+AKFDGILGLGF+
Sbjct  141   NGKPASIRYGTGAISGYFSNDDVKVGDIVVKEQEFIEATSEPGITFLLAKFDGILGLGFK  200

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG++      MV +GLV++PIFSFWLNRNP++ EGGE+VFGGVDPKH+KGEHT+VPV
Sbjct  201   EISVGNSTPVWYNMVEKGLVKEPIFSFWLNRNPKDPEGGEIVFGGVDPKHFKGEHTFVPV  260

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T KGYWQFDMG++ I GKPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA G+VS+
Sbjct  261   THKGYWQFDMGDLQIAGKPTGYCAKGCSAIADSGTSLLTGPSTVITMINHAIGAQGIVSR  320

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             ECKAVV+ YG+ M++ L+ +    K+CSQIG+C ++G + VSMGI+SVVD+  G S  L+
Sbjct  321   ECKAVVDQYGKTMLNSLLAQ----KVCSQIGVCAYDGTQSVSMGIQSVVDD--GTSGLLN  374

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
              AMCSACEM  VWM+++L++NQTQE IL+Y  ELC+ +P+   +S VDCG++S+MP V+F
Sbjct  375   QAMCSACEMAAVWMESELTQNQTQERILAYAAELCDHIPTQNQQSAVDCGRVSSMPIVTF  434

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             SIGG+ FDL+P +YI K+GEG  +QC SGFTA+D+ PPRGPLWILGD+FMG YHTVFDYG
Sbjct  435   SIGGRSFDLTPQDYIFKIGEGVESQCTSGFTAMDIAPPRGPLWILGDIFMGPYHTVFDYG  494

Query  196   KMRVGFAEAA  167
             K RVGFA+AA
Sbjct  495   KGRVGFAKAA  504



>ref|XP_006396692.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
 gb|ESQ38145.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
Length=507

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/490 (66%), Positives = 397/490 (81%), Gaps = 8/490 (2%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             K  DG +RI LKK K+D+ NR+A+ L  K       S + Y  L   N     +DIV LK
Sbjct  26    KQGDGTLRIALKKSKLDRANRLASELFLK-NRGASWSFKDYLRLSDGN-----SDIVPLK  79

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+G+I +GTPPQKFT IFDTGSSNLW+PSS+CY SV C+FH+KY +SQSSTY+K
Sbjct  80    NYLDAQYYGDITIGTPPQKFTAIFDTGSSNLWIPSSQCYLSVACYFHTKYKASQSSTYKK  139

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISG+FS D V+VGDLV+K Q FIEATSEPG+TFLVAKFDGILGLGF+
Sbjct  140   NGKPASIRYGTGAISGYFSNDDVKVGDLVIKDQEFIEATSEPGITFLVAKFDGILGLGFK  199

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EI+VG++      MV++GLV++PIFSFWLNRNPQ+  GGE+VFGG+DPKH+ GEHTYVPV
Sbjct  200   EIAVGNSTPVWYNMVDKGLVKEPIFSFWLNRNPQDPAGGEIVFGGLDPKHFIGEHTYVPV  259

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T KGYWQFDMG++ I GKPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA GV S+
Sbjct  260   THKGYWQFDMGDLNIAGKPTGYCAQGCSAIADSGTSLLTGPSTVITMINHAIGAVGVASQ  319

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             ECKAVV  YG+ M++ L+ +  P+K+CSQIGLC ++G   VSMGI SV++  NG S  L+
Sbjct  320   ECKAVVGQYGKTMLNSLLSQTDPRKVCSQIGLCGYDGAHSVSMGIRSVIE--NGTSDLLN  377

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             +AMC+ACEM  VWMQ++L++NQTQE ILSY  ELC+ +P+P  +S V+C K+S+MP V+F
Sbjct  378   EAMCNACEMAAVWMQSELTQNQTQERILSYAAELCDHIPNPNQQSAVNCEKVSSMPIVTF  437

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK FDLSP +YI K+G+G  AQC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYG
Sbjct  438   TIGGKSFDLSPQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYG  497

Query  196   KMRVGFAEAA  167
             K RVGFA+AA
Sbjct  498   KARVGFAKAA  507



>emb|CDX94554.1| BnaC09g22820D [Brassica napus]
Length=507

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/490 (66%), Positives = 399/490 (81%), Gaps = 9/490 (2%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             +  DG +RIGLKK K+D+ NR+A++L  K   S   S + Y+ L+  N     +DIV LK
Sbjct  27    QKGDGTLRIGLKKRKLDRANRLASQLFLKNRGSW--SPKDYFCLNDAN-----SDIVPLK  79

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+GEI +GTPPQKFT IFDTGSSNLWVPSS CYFS+ C+FHSKY +  SSTY++
Sbjct  80    NYLDAQYYGEITIGTPPQKFTAIFDTGSSNLWVPSSNCYFSIACYFHSKYKARDSSTYKR  139

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISG+FS D V+VG LV+K Q FIEATSEPG+TFL+AKFDGILGLGF+
Sbjct  140   NGKPASIRYGTGAISGYFSNDDVKVGGLVIKDQEFIEATSEPGITFLLAKFDGILGLGFK  199

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EI+VG++      MV +GLV++PIFSFWLNRNP++ EGG++VFGGVDPKH+KGEHTYVPV
Sbjct  200   EIAVGNSTPVWYNMVEKGLVKEPIFSFWLNRNPEDPEGGQIVFGGVDPKHFKGEHTYVPV  259

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T+KGYWQFDMG++ I  KPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA G+ S+
Sbjct  260   TRKGYWQFDMGDLNIADKPTGYCAKGCSAIADSGTSLLTGPSTVITMINHAIGAVGIASQ  319

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             ECK V+  YGQ M+D LV +  P+K+CS IGLC F+G   VSMGI+SVV++  GVS  L+
Sbjct  320   ECKTVIGQYGQTMLDSLVSQVDPRKVCSHIGLCGFDGTHSVSMGIKSVVED--GVSGLLN  377

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             +AMCSACEM  VWMQ++LS+NQTQE IL+Y  ELC+ +P+P  +S VDC ++S+MP V+F
Sbjct  378   EAMCSACEMASVWMQSELSQNQTQERILAYAAELCDHIPNPNQQSAVDCERVSSMPIVTF  437

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK FDLSP +YI K+G+G  AQC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYG
Sbjct  438   TIGGKPFDLSPQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYG  497

Query  196   KMRVGFAEAA  167
             K RVGFA+A 
Sbjct  498   KTRVGFAKAT  507



>ref|XP_006396693.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
 gb|ESQ38146.1| hypothetical protein EUTSA_v10028587mg [Eutrema salsugineum]
Length=512

 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/490 (66%), Positives = 397/490 (81%), Gaps = 8/490 (2%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             K  DG +RI LKK K+D+ NR+A+ L  K       S + Y  L   N     +DIV LK
Sbjct  31    KQGDGTLRIALKKSKLDRANRLASELFLK-NRGASWSFKDYLRLSDGN-----SDIVPLK  84

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+G+I +GTPPQKFT IFDTGSSNLW+PSS+CY SV C+FH+KY +SQSSTY+K
Sbjct  85    NYLDAQYYGDITIGTPPQKFTAIFDTGSSNLWIPSSQCYLSVACYFHTKYKASQSSTYKK  144

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISG+FS D V+VGDLV+K Q FIEATSEPG+TFLVAKFDGILGLGF+
Sbjct  145   NGKPASIRYGTGAISGYFSNDDVKVGDLVIKDQEFIEATSEPGITFLVAKFDGILGLGFK  204

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EI+VG++      MV++GLV++PIFSFWLNRNPQ+  GGE+VFGG+DPKH+ GEHTYVPV
Sbjct  205   EIAVGNSTPVWYNMVDKGLVKEPIFSFWLNRNPQDPAGGEIVFGGLDPKHFIGEHTYVPV  264

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T KGYWQFDMG++ I GKPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA GV S+
Sbjct  265   THKGYWQFDMGDLNIAGKPTGYCAQGCSAIADSGTSLLTGPSTVITMINHAIGAVGVASQ  324

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             ECKAVV  YG+ M++ L+ +  P+K+CSQIGLC ++G   VSMGI SV++  NG S  L+
Sbjct  325   ECKAVVGQYGKTMLNSLLSQTDPRKVCSQIGLCGYDGAHSVSMGIRSVIE--NGTSDLLN  382

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             +AMC+ACEM  VWMQ++L++NQTQE ILSY  ELC+ +P+P  +S V+C K+S+MP V+F
Sbjct  383   EAMCNACEMAAVWMQSELTQNQTQERILSYAAELCDHIPNPNQQSAVNCEKVSSMPIVTF  442

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK FDLSP +YI K+G+G  AQC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYG
Sbjct  443   TIGGKSFDLSPQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYG  502

Query  196   KMRVGFAEAA  167
             K RVGFA+AA
Sbjct  503   KARVGFAKAA  512



>gb|KDO78302.1| hypothetical protein CISIN_1g010233mg [Citrus sinensis]
Length=471

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/447 (77%), Positives = 390/447 (87%), Gaps = 8/447 (2%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY---YNLHGRNGDLQDTDI  1469
             S SNDG VRIGLKKMK+D NNR+AARLE++ G++LRASV+KY    NL     D +DTDI
Sbjct  24    SVSNDGLVRIGLKKMKLDPNNRLAARLESEHGEALRASVKKYGFPNNLR----DSEDTDI  79

Query  1468  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSS  1289
             V LKNYMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+ CYFSV C+FHSKY SSQSS
Sbjct  80    VALKNYMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTNCYFSVACYFHSKYKSSQSS  139

Query  1288  TYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILG  1109
             TY+KNG+SA I YGTG+I+GFFS DSV+VGDLVVK Q FIEAT EPGVTF+VAKFDGILG
Sbjct  140   TYKKNGESASIQYGTGAIAGFFSYDSVKVGDLVVKDQEFIEATREPGVTFMVAKFDGILG  199

Query  1108  LGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHT  929
             LGFQEISVG+A      MV QGL+QDP+FSFWLNRN QE EGGE+VFGGVDP HYKG+HT
Sbjct  200   LGFQEISVGNAVPVWYNMVKQGLIQDPVFSFWLNRNQQEDEGGEIVFGGVDPNHYKGKHT  259

Query  928   YVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADG  749
             YVPVTQKGYWQF+MG+VLI GKPTG+C+GGCSAIADSGTSL+AGP+++ITMINHAIGA G
Sbjct  260   YVPVTQKGYWQFNMGDVLIGGKPTGYCAGGCSAIADSGTSLLAGPTTVITMINHAIGASG  319

Query  748   VVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS  569
             VVS++CKAVVE YGQ ++DLL+ EA PKKICSQ+GLCTF+G RGVSMGIESVVDE N  S
Sbjct  320   VVSQQCKAVVEQYGQTILDLLLFEAHPKKICSQMGLCTFDGKRGVSMGIESVVDESNDKS  379

Query  568   AD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             +  L++AMCSACEM VVWMQNQL +NQTQENIL YVNELC+R+PSPMGES VDCGKLS+M
Sbjct  380   SGVLNNAMCSACEMAVVWMQNQLQQNQTQENILQYVNELCDRMPSPMGESAVDCGKLSSM  439

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGS  311
             P VSF+IGGKVFDLSP E + +   GS
Sbjct  440   PIVSFTIGGKVFDLSPEEDLGRRLHGS  466



>ref|XP_011006458.1| PREDICTED: cyprosin-like isoform X1 [Populus euphratica]
Length=536

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/522 (66%), Positives = 407/522 (78%), Gaps = 35/522 (7%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAAR-------LEAKAGDSLRASVRKYYNLHGRNGDL  1484
              S  +DG +RIGLKK K+D+  R            E   G S  A+ +KYYNL    G+ 
Sbjct  20    LSARDDGLMRIGLKKKKLDQLGRRVVPGPVNFIPKEEGGGASKPAATKKYYNL----GE-  74

Query  1483  QDTDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYT  1304
              + DIV LKNY+DAQY+GEI +GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHSKY 
Sbjct  75    TEADIVALKNYLDAQYYGEIAIGTPPQTFTVIFDTGSSNLWVPSSKCYFSLACYFHSKYK  134

Query  1303  SSQSSTYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKF  1124
             SS S+TY KNG SA I YGTGSISGFFSQDSV+VGDLVVK+Q FIEAT EPGVTFL +KF
Sbjct  135   SSASTTYVKNGTSAAIQYGTGSISGFFSQDSVEVGDLVVKNQDFIEATKEPGVTFLASKF  194

Query  1123  DGILGLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHY  944
             DGILGLGFQEISVG+A      MVNQGLV++ +FSFWLNRN + +EGGE+VFGGVDP HY
Sbjct  195   DGILGLGFQEISVGNAVPVWYNMVNQGLVKEKVFSFWLNRNVEGEEGGEIVFGGVDPNHY  254

Query  943   KGEHTYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPS---------  791
             KGEHTYVPVT KGYWQFDMG++LI  + TG C+GGC AIADSGTSL+AGP+         
Sbjct  255   KGEHTYVPVTHKGYWQFDMGDLLIGTETTGLCAGGCKAIADSGTSLLAGPTMMLYTIQKF  314

Query  790   -------------SIITMINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQ  650
                          ++IT IN+AIGA G+VS+ECK VV  YG+ ++++LV +A+P+K+CSQ
Sbjct  315   RVNYYCFILPGNMTVITQINNAIGASGIVSEECKTVVAQYGKIILEMLVAQAQPRKVCSQ  374

Query  649   IGLCTFNGNRGVSMGIESVVDEKNGVSAD-LHDAMCSACEMTVVWMQNQLSENQTQENIL  473
             I  CTF+G +GVSM IESVV+E +  S+D LHDAMC+ACEM VVWM+N+L  N T++ IL
Sbjct  375   ISFCTFDGTQGVSMNIESVVEESSDKSSDGLHDAMCTACEMIVVWMENRLRLNDTKDQIL  434

Query  472   SYVNELCNRLPSPMGESGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCIS  293
              YVN+LC+RLPSP GES V+C  LS+M SVSF IGGK+F+LSP +Y+LKVGEG +AQCIS
Sbjct  435   DYVNDLCDRLPSPNGESAVECSSLSSMSSVSFEIGGKLFELSPEQYVLKVGEGVSAQCIS  494

Query  292   GFTALDVPPPRGPLWILGDVFMGRYHTVFDYGKMRVGFAEAA  167
             GFTALDVPPPRGPLWILGDVFMGRYHTVFDYG + VGFA+AA
Sbjct  495   GFTALDVPPPRGPLWILGDVFMGRYHTVFDYGNLTVGFADAA  536



>ref|XP_010432806.1| PREDICTED: aspartic proteinase A3-like isoform X2 [Camelina sativa]
Length=504

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/491 (65%), Positives = 401/491 (82%), Gaps = 14/491 (3%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAK-AGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             +  DG +RIGLKK K+D++NR+A++L  K  G S     + ++ L+  N D+     V L
Sbjct  27    RKGDGTIRIGLKKRKLDRSNRLASQLFLKNRGGSWFP--KDHFRLNDANADM-----VPL  79

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+G+I +GTPPQKFTVIFDTGSSNLW+PS+KCY SV C+FHSKY +SQSSTY 
Sbjct  80    KNYLDAQYYGDITIGTPPQKFTVIFDTGSSNLWIPSTKCYLSVACYFHSKYKASQSSTYR  139

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGK A I YGTG+I+G+FS D V+VGDLVVK Q FIEATSEPG+TFL+AKFDGILGLGF
Sbjct  140   KNGKPASIRYGTGAIAGYFSYDDVKVGDLVVKEQEFIEATSEPGITFLLAKFDGILGLGF  199

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EI+VG++      MV +GLV++PIFSFWLNRNP++ EGGE+VFGG+DPKH+KGEHTYVP
Sbjct  200   KEIAVGNSTPVWYNMVEKGLVKEPIFSFWLNRNPKDPEGGEIVFGGLDPKHFKGEHTYVP  259

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VT KGYWQFDMG++ I GKPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA G+VS
Sbjct  260   VTHKGYWQFDMGDLQIAGKPTGYCAKGCSAIADSGTSLLTGPSTVITMINHAIGAQGIVS  319

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECKAVV+ YG+ M++ L+ +    K+CSQIG+C F+G   VSMGI+SVVD+  G S  L
Sbjct  320   RECKAVVDQYGKTMLNSLLAQ----KVCSQIGVCAFDGTDSVSMGIQSVVDD--GASGLL  373

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
             + AMCSAC+M  VWM+++L++N+TQE IL+Y  ELC+ +P+   +S VDC K+S+MP VS
Sbjct  374   NQAMCSACQMAAVWMESELTQNKTQERILAYAAELCDHIPTQNQQSAVDCEKVSSMPIVS  433

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGG+ FDLSP +YI K+GEG   QC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDY
Sbjct  434   FTIGGRTFDLSPQDYIFKIGEGVETQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDY  493

Query  199   GKMRVGFAEAA  167
             GK RVGFA+AA
Sbjct  494   GKARVGFAKAA  504



>ref|XP_010529449.1| PREDICTED: aspartic proteinase A3 [Tarenaya hassleriana]
Length=507

 Score =   681 bits (1756),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/491 (65%), Positives = 392/491 (80%), Gaps = 10/491 (2%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             +S+DG +RIGL+K++ D NN +AARL +K          +   L G      D+ I+ LK
Sbjct  26    ESDDGILRIGLRKIRQDWNNGLAARLGSK---------NRAPPLEGYRPSNGDSGIIALK  76

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPSSKCYFS+ CFFHSKY SS+S TY+K
Sbjct  77    NYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSSKCYFSIACFFHSKYKSSESETYQK  136

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISGFFS D + VG+LVVK++ FIEATSEPG+TF++AKFDGILGLGFQ
Sbjct  137   NGKPASIRYGTGAISGFFSNDDITVGNLVVKNEEFIEATSEPGITFMMAKFDGILGLGFQ  196

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG+A      MVNQGLV++P+FSFWLNRN  ++EGGE+VFGGVDPKH+ G+HTYVPV
Sbjct  197   EISVGNATPVWYNMVNQGLVKEPVFSFWLNRNTIDKEGGEIVFGGVDPKHFTGQHTYVPV  256

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             TQ+GYWQFDMG+VLI+GKPTG+C  GCSAIADSGTSL+ GP++II MIN AIGA+GVVS 
Sbjct  257   TQRGYWQFDMGDVLIDGKPTGYCGKGCSAIADSGTSLLTGPTTIIAMINQAIGAEGVVSH  316

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADL  560
             ECK VV+ YG+ ++ LL  E  P K+C ++ LC F+G R VS  IE VVD+ K+  S   
Sbjct  317   ECKTVVDQYGKTILKLLQAEVHPSKVCFEMDLCLFDGTRSVSPDIEMVVDKNKDRKSGGK  376

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
               AMC+ACEM VVW+++QL +N T E IL+Y ++LC+R+P+    S VDCGK+ TMP+VS
Sbjct  377   KGAMCTACEMAVVWIRHQLKQNHTAERILNYADQLCSRIPTANLPSAVDCGKIPTMPTVS  436

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGK FDLSP  YI KVGEG+ AQC SGFTA+D+PPP GPLWILGD+FMG YHTVFDY
Sbjct  437   FTIGGKAFDLSPQHYIFKVGEGAEAQCTSGFTAMDIPPPHGPLWILGDIFMGPYHTVFDY  496

Query  199   GKMRVGFAEAA  167
             GK RVGFA+AA
Sbjct  497   GKARVGFAKAA  507



>ref|XP_009421489.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=520

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/500 (65%), Positives = 400/500 (80%), Gaps = 14/500 (3%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNL--------HGRNGDLQ-  1481
             S +G VRIGLKK  +D+N R+AARL       + A+ RKY  L        HG +G  + 
Sbjct  24    SANGLVRIGLKKRPLDRNGRLAARLSHPEELGVLAA-RKYGPLLRDSLGLEHGPDGPAEP  82

Query  1480  -DTDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYT  1304
              D +IV LKNYM+AQYFGEIG+G+PPQ FTV+FDTGSSNLWVPSSKCYFSV CFFH+KY 
Sbjct  83    DDGNIVALKNYMNAQYFGEIGIGSPPQNFTVVFDTGSSNLWVPSSKCYFSVACFFHAKYK  142

Query  1303  SSQSSTYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKF  1124
             S +SSTY+KNGK+A IHYGTGS+SGFFSQD V +GD+V+K QAFIEAT EP +TFLVAKF
Sbjct  143   SGRSSTYQKNGKTANIHYGTGSVSGFFSQDHVTIGDIVIKDQAFIEATREPSITFLVAKF  202

Query  1123  DGILGLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHY  944
             DGILGLGF+EISVG+A      MVNQ LV++PIFSFW NRN  E EGGE+VFGG D +HY
Sbjct  203   DGILGLGFEEISVGNAVPIWYNMVNQSLVKEPIFSFWFNRNANEGEGGEIVFGGTDREHY  262

Query  943   KGEHTYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHA  764
             KGEH YVPVT+KGYWQFD+ +VL+ G+ TGFCSGGC+AI DSGTSLIAGP+++I  +N  
Sbjct  263   KGEHVYVPVTKKGYWQFDVEDVLVGGQTTGFCSGGCAAIVDSGTSLIAGPTTVIAEVNQK  322

Query  763   IGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE  584
             IGADGVVS++CKAVV  YG+ ++++++ +  P KICS+IGLC FNG +GVS+GI+SVVD 
Sbjct  323   IGADGVVSQQCKAVVAQYGETIMNMILAKEEPAKICSKIGLCAFNGTQGVSLGIKSVVDN  382

Query  583   K-NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCG  407
             +   + + L + MCS CEM VVWMQ+QL++N+T E +L+Y++ELC R+PSPMGES VDC 
Sbjct  383   QVEKLDSGLSNGMCSYCEMAVVWMQSQLTQNKTLEQVLNYLDELCERIPSPMGESAVDCN  442

Query  406   KLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFM  227
              LS+MP ++F+IGG+ FDL P +YILKV  G + QCISGFTALDV  P+GPLW+LGDVFM
Sbjct  443   SLSSMPVITFNIGGRNFDLRPEQYILKVASGGSEQCISGFTALDV--PQGPLWVLGDVFM  500

Query  226   GRYHTVFDYGKMRVGFAEAA  167
             G YHTVFDYG +RVGFAEAA
Sbjct  501   GAYHTVFDYGNLRVGFAEAA  520



>ref|XP_009134301.1| PREDICTED: aspartic proteinase A3-like [Brassica rapa]
Length=503

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/490 (65%), Positives = 402/490 (82%), Gaps = 13/490 (3%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             +  DG +RIGLKK K+++ NR+A++L  K   S   S + +++L+  N     +D V LK
Sbjct  27    QKGDGTLRIGLKKRKLNRANRLASQLFLKNRGSW--SSKGFFHLNDGN-----SDAVPLK  79

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+G+I +GTPPQKFT IFDTGSSNLW+PSSKCY SV C+FHSKYT+S+SSTY+K
Sbjct  80    NYLDAQYYGDITIGTPPQKFTAIFDTGSSNLWMPSSKCYLSVACYFHSKYTASESSTYKK  139

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISG+FS D V++GDLV+K Q FIEAT+EPG+TFLVAKFDGILGLGF+
Sbjct  140   NGKPASIRYGTGAISGYFSNDDVKIGDLVIKDQEFIEATNEPGITFLVAKFDGILGLGFK  199

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EI+VG++      MV +GLV++ IFSFWLNRNPQ+QEGGE+VFGGVDPKH+KGEHTYVPV
Sbjct  200   EIAVGNSTPVWYNMVEKGLVKEQIFSFWLNRNPQDQEGGEIVFGGVDPKHFKGEHTYVPV  259

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T+KGYWQFDMG++ I GKPTG+CS GCSAIADSGTSL+ GP+S+ITMINHAIGA GV SK
Sbjct  260   TRKGYWQFDMGDLHIAGKPTGYCSNGCSAIADSGTSLLTGPTSVITMINHAIGAVGVASK  319

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             ECK V+  YG+ M++ L+ +A P+K+CSQIGLC FN      MGI+SV+D+  G S  ++
Sbjct  320   ECKTVIGQYGKTMLNSLLSQADPRKVCSQIGLCGFNER----MGIKSVLDD--GTSDLIN  373

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             +AMCS CEM  VWMQ++L++N+TQE ILSY  ELC+ +PSP  +S V+C K+S+MP V+F
Sbjct  374   EAMCSVCEMATVWMQSELNQNETQERILSYAAELCDHIPSPNQQSAVNCEKVSSMPIVTF  433

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK FDLSP +YI K+G+G  +QC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYG
Sbjct  434   TIGGKPFDLSPQDYIFKIGDGVQSQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYG  493

Query  196   KMRVGFAEAA  167
             K RVGFA++A
Sbjct  494   KARVGFAKSA  503



>emb|CDX90864.1| BnaA03g25440D [Brassica napus]
Length=503

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/490 (65%), Positives = 402/490 (82%), Gaps = 13/490 (3%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             +  DG +RIGLKK K+++ NR+A++L  K   S   S + +++L+  N     +D V LK
Sbjct  27    QKGDGTLRIGLKKRKLNRANRLASQLFLKNRGSW--SSKGFFHLNDGN-----SDAVPLK  79

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+G+I +GTPPQKFT IFDTGSSNLW+PSSKCY SV C+FHSKYT+S+SSTY+K
Sbjct  80    NYLDAQYYGDITIGTPPQKFTAIFDTGSSNLWMPSSKCYLSVACYFHSKYTASESSTYKK  139

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISG+FS D +++GDLV+K Q FIEAT+EPG+TFLVAKFDGILGLGF+
Sbjct  140   NGKPASIRYGTGAISGYFSNDDIKIGDLVIKDQEFIEATNEPGITFLVAKFDGILGLGFK  199

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EI+VG++      MV +GLV++ IFSFWLNRNPQ+QEGGE+VFGGVDPKH+KGEHTYVPV
Sbjct  200   EIAVGNSTPVWYNMVEKGLVKEQIFSFWLNRNPQDQEGGEIVFGGVDPKHFKGEHTYVPV  259

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T+KGYWQFDMG++ I GKPTG+CS GCSAIADSGTSL+ GP+S+ITMINHAIGA GV SK
Sbjct  260   TRKGYWQFDMGDLHIAGKPTGYCSNGCSAIADSGTSLLTGPTSVITMINHAIGAVGVASK  319

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             ECK V+  YG+ M++ L+ +A P+K+CSQIGLC FN      MGI+SV+D+  G S  ++
Sbjct  320   ECKTVIGQYGKTMLNSLLSQADPRKVCSQIGLCGFNER----MGIKSVLDD--GTSDLIN  373

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             +AMCS CEM  VWMQ++L++N+TQE ILSY  ELC+ +PSP  +S V+C K+S+MP V+F
Sbjct  374   EAMCSVCEMATVWMQSELNQNETQERILSYAAELCDHIPSPNQQSAVNCEKVSSMPIVTF  433

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK FDLSP +YI K+G+G  +QC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYG
Sbjct  434   TIGGKPFDLSPQDYIFKIGDGVQSQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYG  493

Query  196   KMRVGFAEAA  167
             K RVGFA++A
Sbjct  494   KARVGFAKSA  503



>gb|KDO62073.1| hypothetical protein CISIN_1g010230mg [Citrus sinensis]
Length=458

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/436 (72%), Positives = 372/436 (85%), Gaps = 2/436 (0%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS  N G  RIGLKK K D NNR+AARL++K G+S R S+RKY +L G  G+  D DIV 
Sbjct  23    FSTPNGGLYRIGLKKRKFDLNNRVAARLDSKEGESFRTSIRKY-SLRGNLGESGDADIVA  81

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHSKY S +SSTY
Sbjct  82    LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYRSGRSSTY  141

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSA+IHYGTG+ISGFFS+D V++GDLVVK Q FIEAT EP +TFL+AKFDGILGLG
Sbjct  142   KKNGKSADIHYGTGAISGFFSEDHVKIGDLVVKDQEFIEATREPSLTFLLAKFDGILGLG  201

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG A      MVNQGLV +P+FSFW NRN  E+EGGE+VFGG+DP HYKGEHTYV
Sbjct  202   FQEISVGKAVPVWYNMVNQGLVNEPVFSFWFNRNADEEEGGEIVFGGMDPDHYKGEHTYV  261

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVTQKGYWQFDMG+V+I+G+ TGFC+GGC+AIADSGTSL+AGP++IIT +NHAIGA G+V
Sbjct  262   PVTQKGYWQFDMGDVMIDGQTTGFCAGGCAAIADSGTSLLAGPTTIITQVNHAIGATGIV  321

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S+ECKAVV  YG+ +I++L+ +  P+KICSQIGLCTF+G+RGVSMGIESVV E N   S 
Sbjct  322   SQECKAVVSQYGEEIINMLLAKDEPQKICSQIGLCTFDGSRGVSMGIESVVPENNHRASG  381

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
               HDAMCS CEM VVWMQNQL +NQTQE IL+YVNELC+RLPSPMGES VDC +LS++P 
Sbjct  382   GFHDAMCSTCEMAVVWMQNQLKQNQTQERILNYVNELCDRLPSPMGESAVDCSRLSSLPI  441

Query  385   VSFSIGGKVFDLSPNE  338
             VSF+IGGK+FDL+P++
Sbjct  442   VSFTIGGKIFDLTPDQ  457



>ref|XP_010916100.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
 ref|XP_010916101.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
 ref|XP_010916102.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
Length=518

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/499 (66%), Positives = 400/499 (80%), Gaps = 8/499 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY----YNLHGRNGDLQD  1478
             AF  S DG  RIGLKK  +D+N+R+AARL  +   +   + RKY        G  G  ++
Sbjct  19    AFPVSADGVFRIGLKKKALDQNSRLAARLAVRKEAAAALAARKYGFFEPGPVGPVGPGEE  78

Query  1477  TDIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSS  1298
              ++V LKNYM+AQYFGEIG+G+P Q FTVIFDTGSSNLWVPSSKCYFSV C+FHSKY S+
Sbjct  79    GNVVALKNYMNAQYFGEIGLGSPAQNFTVIFDTGSSNLWVPSSKCYFSVACYFHSKYKST  138

Query  1297  QSSTYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDG  1118
              SSTYEKNG SA IHYGTGS+SGFFSQD V VG+L +K+Q FIEAT EP +TF+VAKFDG
Sbjct  139   LSSTYEKNGGSANIHYGTGSVSGFFSQDYVTVGELTIKNQVFIEATREPSITFMVAKFDG  198

Query  1117  ILGLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKG  938
             ILGLGF+EISVG+       MVNQ LV++P+FSFW NRN +E EGGE++FGG+D KH++G
Sbjct  199   ILGLGFKEISVGNVVPVWDNMVNQSLVKEPVFSFWFNRNAEEGEGGEIMFGGMDRKHFRG  258

Query  937   EHTYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIG  758
             EHTYVPVTQKGYWQF+MG+VLI G+ TGFCS GC AIADSGTSLIAGP++II  +N  IG
Sbjct  259   EHTYVPVTQKGYWQFEMGDVLIGGQTTGFCSDGCQAIADSGTSLIAGPTTIIAEVNQKIG  318

Query  757   ADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVD-EK  581
             A GVVS++CKA+V  YG++++++L+ +  P KICS++GLC F+G  GVSMGI+SVV+ ++
Sbjct  319   AAGVVSQQCKAMVSQYGEKIMEMLMEKEEPAKICSRVGLCAFDGTHGVSMGIKSVVNGKR  378

Query  580   NGVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKL  401
             +G +  L + MC+ CEM VVWMQNQL +NQT E +L+Y+N+LC RLPSP GES VDC  L
Sbjct  379   DGSTGGLGNGMCTYCEMAVVWMQNQLVQNQTLEQVLNYINQLCERLPSPTGESAVDCDSL  438

Query  400   STMPSVSFSIGGKVFDLSPNEYILKVGEGSAA-QCISGFTALDVPPPRGPLWILGDVFMG  224
              +MP+VSF+IGGK FDL P +YILKV  GS+A QCISGFTALDV  P+GPLWILGDVFMG
Sbjct  439   PSMPTVSFTIGGKRFDLKPEQYILKVDVGSSATQCISGFTALDV--PQGPLWILGDVFMG  496

Query  223   RYHTVFDYGKMRVGFAEAA  167
              YHTVFDYGK+RVGFAEAA
Sbjct  497   AYHTVFDYGKLRVGFAEAA  515



>ref|XP_009390744.1| PREDICTED: aspartic proteinase oryzasin-1-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   676 bits (1744),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/506 (66%), Positives = 394/506 (78%), Gaps = 18/506 (4%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY-YNLHGRNGDLQDT---  1475
             F+ S DG VRIGLKK  +D+N R+A RL    G  L  + RKY   LH R+G   D    
Sbjct  23    FAVSADGLVRIGLKKRPLDQNGRLATRLSRDEG-LLAPAARKYGLPLH-RDGLRLDPGLD  80

Query  1474  --------DIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFF  1319
                     D+V LKNYM+AQYFGEIG+G+PPQ FTV+FDTGSSNLWVPSSKCYFSV C+F
Sbjct  81    GPAGPDAGDVVALKNYMNAQYFGEIGIGSPPQNFTVVFDTGSSNLWVPSSKCYFSVACYF  140

Query  1318  HSKYTSSQSSTYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTF  1139
             H KY SSQSSTY+KNGKSA IHYGTGSISGF SQD V +GD+V+K Q F+EAT EP +TF
Sbjct  141   HPKYKSSQSSTYQKNGKSANIHYGTGSISGFCSQDYVTIGDIVIKDQVFVEATREPSITF  200

Query  1138  LVAKFDGILGLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGV  959
             L AKFDGI+GLGF+EISVG+       +VNQ LV++PIFSFW NRN  E  GGE+VFGGV
Sbjct  201   LAAKFDGIIGLGFEEISVGNVTPIWYNIVNQSLVKEPIFSFWFNRNVNEGAGGEIVFGGV  260

Query  958   DPKHYKGEHTYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIIT  779
             D +HYKGEH YVPVTQKGYWQF+M +VL+  + TGFCSGGCSAIADSGTSLIAGP+++IT
Sbjct  261   DSQHYKGEHIYVPVTQKGYWQFNMEDVLVGSQTTGFCSGGCSAIADSGTSLIAGPTTVIT  320

Query  778   MINHAIGADGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIE  599
              IN  IGA GVVS++CKAVV  YG++++D+L+ E  P KICSQIGLC++N  +G S+GI+
Sbjct  321   EINQKIGASGVVSQQCKAVVAQYGEKIMDMLLAEEEPSKICSQIGLCSYNSTQGASLGIK  380

Query  598   SVVDEK-NGVSADLHD-AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGE  425
             SVVD K   ++  L+D  MCS CEM V+WMQ+QL  NQT E ILSY+NELC R+PSPMGE
Sbjct  381   SVVDNKVEKLATGLNDGGMCSYCEMAVIWMQSQLRLNQTLEQILSYLNELCERIPSPMGE  440

Query  424   SGVDCGKLSTMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWI  245
             S +DC  LS MP +SF+IGGK FDL+P +Y LKV  G + QCISGFTA+DV  P+GPLWI
Sbjct  441   SAIDCDSLSFMPVISFNIGGKNFDLTPEQYTLKVATGGSEQCISGFTAIDV--PQGPLWI  498

Query  244   LGDVFMGRYHTVFDYGKMRVGFAEAA  167
             LGDVFMG YHTVFDYG +RVGFAEAA
Sbjct  499   LGDVFMGVYHTVFDYGNLRVGFAEAA  524



>ref|NP_001043786.1| Os01g0663400 [Oryza sativa Japonica Group]
 dbj|BAF05700.1| Os01g0663400 [Oryza sativa Japonica Group]
 dbj|BAG92907.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71223.1| hypothetical protein OsI_03158 [Oryza sativa Indica Group]
 gb|EEE55128.1| hypothetical protein OsJ_02912 [Oryza sativa Japonica Group]
 gb|AFI71272.1| unnamed protein [Oryza sativa Japonica Group]
Length=522

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/496 (64%), Positives = 389/496 (78%), Gaps = 11/496 (2%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHG--------RNGDLQDTD  1472
             +G VRI LKK ++D+  R+   L  +  D+ R   R++  L          +     + D
Sbjct  29    EGVVRIALKKRQVDETGRVGGHLAGE--DAQRLLARRHGFLTNDAARAASRKARAEAEGD  86

Query  1471  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQS  1292
             IV LKNY++AQY+GEI +GTPPQ FTVIFDTGSSNLWVPSSKC+ S+ C+FHS+Y + QS
Sbjct  87    IVALKNYLNAQYYGEIAIGTPPQMFTVIFDTGSSNLWVPSSKCHLSIACYFHSRYKAGQS  146

Query  1291  STYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGIL  1112
             STY+KNGK A IHYGTG+ISG+FSQDSV+VGD+ VK+Q FIEAT EP +TF+VAKFDGIL
Sbjct  147   STYKKNGKPASIHYGTGAISGYFSQDSVKVGDVAVKNQDFIEATREPSITFMVAKFDGIL  206

Query  1111  GLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEH  932
             GLGF+EISVG+A      MV QGLV DP+FSFW NR+  E +GGE+VFGG+DP HYKG H
Sbjct  207   GLGFKEISVGNAVPIWYNMVRQGLVVDPVFSFWFNRHADEGQGGEIVFGGIDPNHYKGNH  266

Query  931   TYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGAD  752
             TYVPVT+KGYWQF+MG+VLI G  TGFC+ GC+AIADSGTSL+ GP++IIT IN  IGA 
Sbjct  267   TYVPVTRKGYWQFNMGDVLIGGNSTGFCAAGCAAIADSGTSLLTGPTAIITQINEKIGAT  326

Query  751   GVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGV  572
             GVVS+ECKAVV  YGQ+++D L  E +P K+CS +GLCTF+G  GVS GI SVVD++ G 
Sbjct  327   GVVSQECKAVVSQYGQQILDQLRAETKPAKVCSSVGLCTFDGTHGVSAGIRSVVDDEVGK  386

Query  571   SAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLST  395
             S+     AMC+ACE  VVWM  QL++NQTQ+ +L Y+++LC+RLPSPMGES VDC  L++
Sbjct  387   SSGPFSSAMCNACETAVVWMHTQLAQNQTQDLVLQYIDQLCDRLPSPMGESSVDCSSLAS  446

Query  394   MPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYH  215
             MP ++F+IGG  F L P +YILKVGEG+A QCISGFTA+D+PPPRGPLWILGDVFMG YH
Sbjct  447   MPDIAFTIGGNKFVLKPEQYILKVGEGTATQCISGFTAMDIPPPRGPLWILGDVFMGAYH  506

Query  214   TVFDYGKMRVGFAEAA  167
             TVFDYG ++VGFAEAA
Sbjct  507   TVFDYGNLKVGFAEAA  522



>gb|KJB67250.1| hypothetical protein B456_010G182400 [Gossypium raimondii]
Length=465

 Score =   671 bits (1732),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/435 (72%), Positives = 371/435 (85%), Gaps = 1/435 (0%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             SNDG VRIGLKKMK+D NNR+AA+L++K  ++LRAS+ + Y      GD ++TDIV LKN
Sbjct  25    SNDGLVRIGLKKMKLDPNNRLAAQLDSKDREALRASIARKYRFRNDLGDSEETDIVALKN  84

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YMDAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCYFSV CFFHSKY +S+SSTY+KN
Sbjct  85    YMDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSTKCYFSVACFFHSKYKASESSTYKKN  144

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKSA I YGTG+ISGFFS D+V+VG+LVVK Q FIEAT EPGVTF+ AKFDGILGLGF+E
Sbjct  145   GKSASIQYGTGAISGFFSNDNVKVGNLVVKDQEFIEATKEPGVTFMAAKFDGILGLGFKE  204

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVGDA      MV QGL++D  FSFWLNRN  E+ GGE+VFGGVDP HYKG+HTYVP+T
Sbjct  205   ISVGDAVPVWYNMVEQGLIKDQEFSFWLNRNVGEEMGGEIVFGGVDPNHYKGKHTYVPIT  264

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQFDMG+VLI  KPTG+C+GGC+AIADSGTSL+AGP+++ITMIN AIGA GV S+E
Sbjct  265   QKGYWQFDMGDVLIGDKPTGYCAGGCAAIADSGTSLLAGPTTVITMINQAIGASGVASQE  324

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD-LH  557
             CKAVV+ YGQ +IDLLV +A P KICSQIGLC F+G+ GVSMGIE+VVDE NG S+  LH
Sbjct  325   CKAVVQQYGQTIIDLLVSQAEPMKICSQIGLCAFDGSHGVSMGIENVVDESNGKSSGILH  384

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
              AMC ACEM VVWMQNQL ENQTQ+ IL Y N+LC+R+P+PMGES VDCG LS+MP++SF
Sbjct  385   SAMCPACEMAVVWMQNQLMENQTQDRILDYANQLCDRVPNPMGESTVDCGSLSSMPTISF  444

Query  376   SIGGKVFDLSPNEYI  332
             +IGGK F+L+P E +
Sbjct  445   TIGGKAFELTPEEVL  459



>ref|XP_009114573.1| PREDICTED: aspartic proteinase A3 isoform X2 [Brassica rapa]
Length=499

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/490 (65%), Positives = 395/490 (81%), Gaps = 17/490 (3%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             +  DG +RIGLKK K+D+ NR+A++L  K   S   S + Y+ L+  N     +DIV LK
Sbjct  27    QKGDGTLRIGLKKRKLDRANRLASQLFLKNRGSW--SPKDYFRLNDAN-----SDIVPLK  79

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+GEI +GTPPQKFT IFDTGSSNLWVPSS CYFS        Y +  SSTY++
Sbjct  80    NYLDAQYYGEITIGTPPQKFTAIFDTGSSNLWVPSSNCYFS--------YKARDSSTYKR  131

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISG+FS D V+VG LV+K Q FIEATSEPG+TFL+AKFDGILGLGF+
Sbjct  132   NGKPASIRYGTGAISGYFSNDDVKVGGLVIKDQVFIEATSEPGITFLLAKFDGILGLGFK  191

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EI+VG++      MV +GLV++PIFSFWLNRNP++ EGG++VFGGVDPKH+KGEHTYVPV
Sbjct  192   EIAVGNSTPVWYNMVEKGLVKEPIFSFWLNRNPEDPEGGQIVFGGVDPKHFKGEHTYVPV  251

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T+KGYWQFDMG++ I GKPTG+C+ GCSAIADSGTSL+ GPS++ITMINHAIGA G+ S+
Sbjct  252   TRKGYWQFDMGDLNIAGKPTGYCANGCSAIADSGTSLLTGPSTVITMINHAIGAVGIASQ  311

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH  557
             ECK V+  YGQ M++ LV +  P+K+CSQIGLC F+G   VSMGI+SVV++  GVS+ L+
Sbjct  312   ECKTVIGQYGQTMLESLVSQVDPRKVCSQIGLCGFDGTHSVSMGIKSVVED--GVSSLLN  369

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             +AMCSACEM  VWMQ++LS+NQTQE IL+Y  ELC+ +P+P  +S VDC ++S+MP V+F
Sbjct  370   EAMCSACEMASVWMQSELSQNQTQERILAYAAELCDHIPNPNQQSAVDCERVSSMPIVTF  429

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IGGK FDLSP +YI K+G+G  AQC SGFTA+D+PPPRGPLWILGD+FMG YHTVFDYG
Sbjct  430   TIGGKPFDLSPQDYIFKIGDGVQAQCTSGFTAMDIPPPRGPLWILGDIFMGPYHTVFDYG  489

Query  196   KMRVGFAEAA  167
             K RVGFA+A 
Sbjct  490   KTRVGFAKAT  499



>ref|XP_006644474.1| PREDICTED: aspartic proteinase oryzasin-1-like [Oryza brachyantha]
Length=517

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/496 (64%), Positives = 392/496 (79%), Gaps = 11/496 (2%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQ--------DTD  1472
             +G VRI LK+  +D++ R+A  L     D+ R   R++  L                + D
Sbjct  24    EGVVRITLKRRPVDESGRVAGHLAGD--DTQRLLARRHGFLSNEAAARASSKAAAVAEGD  81

Query  1471  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQS  1292
             IV LKNY++AQY+GEI +GTPPQ FTVIFDTGSSNLWVPSSKC+ S+ C+FHS+Y + QS
Sbjct  82    IVALKNYLNAQYYGEIAIGTPPQMFTVIFDTGSSNLWVPSSKCHLSIACYFHSRYKAGQS  141

Query  1291  STYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGIL  1112
             STY+KNGKSA IHYGTG+ISG+FSQDSV+VG +VVK+Q FIEAT EP +TF+VAKFDGIL
Sbjct  142   STYKKNGKSASIHYGTGAISGYFSQDSVKVGGVVVKNQDFIEATREPSITFMVAKFDGIL  201

Query  1111  GLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEH  932
             GLGF+EISVG+A      MV QGLV DP+FSFW NR+  E +GGE+VFGG+DP HYKG H
Sbjct  202   GLGFKEISVGNAVPIWYNMVRQGLVVDPVFSFWFNRHADEGQGGEIVFGGIDPNHYKGNH  261

Query  931   TYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGAD  752
             T+VPVT+KGYWQFDMG+VLI GK TGFC+ GC+AIADSGTSL+ GP++IIT IN  IGA 
Sbjct  262   TFVPVTRKGYWQFDMGDVLIGGKSTGFCAAGCAAIADSGTSLLTGPTAIITQINEKIGAT  321

Query  751   GVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGV  572
             GVVS+ECK VV  YGQ+++D L+ E++P ++CS +GLCTF+G  GVS GI SVVD++NG 
Sbjct  322   GVVSQECKTVVSQYGQQILDQLLAESKPAQVCSSVGLCTFDGIHGVSAGIRSVVDDENGK  381

Query  571   SAD-LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLST  395
             S+     AMC+ACE  VVWM  QL++NQTQ+ IL Y+N+LC+RLPSPMGES VDC  L++
Sbjct  382   SSSPFSSAMCNACETAVVWMHTQLAQNQTQDLILQYINQLCDRLPSPMGESSVDCSSLAS  441

Query  394   MPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYH  215
             MP ++F+IGGK F L P +YILKV EG A QCISGFTA+D+PPPRGPLWILGDVFMG YH
Sbjct  442   MPDIAFTIGGKKFVLKPEQYILKVSEGDATQCISGFTAMDIPPPRGPLWILGDVFMGAYH  501

Query  214   TVFDYGKMRVGFAEAA  167
             TVFDYGK++VGFAEAA
Sbjct  502   TVFDYGKLKVGFAEAA  517



>ref|XP_004134774.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
 ref|XP_011658133.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
 ref|XP_011658134.1| PREDICTED: aspartic proteinase-like [Cucumis sativus]
 gb|KGN49091.1| hypothetical protein Csa_6G513550 [Cucumis sativus]
Length=516

 Score =   665 bits (1716),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/494 (64%), Positives = 401/494 (81%), Gaps = 2/494 (0%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S SN+GF+RIGLKK+K D+N+R  A LE+K G+ L +SV K+        + ++ DIV
Sbjct  24    ATSASNEGFLRIGLKKIKYDQNSRFKALLESKKGEFLGSSVGKHNQWGNNLEESKNADIV  83

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KC FS+ CFFH+KY S +SST
Sbjct  84    PLKNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSAKCIFSLACFFHAKYQSGRSST  143

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y++NG SA I YG+G+ISGFFS D+VQVGD++V++Q  IEATS   +TF+ AKFDGILGL
Sbjct  144   YKRNGTSAAIQYGSGAISGFFSYDNVQVGDVIVRNQELIEATSMSTMTFMAAKFDGILGL  203

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEI+ G A      MV Q LV++ +FSFWLNRN +E+EGGELVFGGVDPKH+KG+HTY
Sbjct  204   GFQEIATGGAVPVWYNMVKQKLVKEQVFSFWLNRNAEEKEGGELVFGGVDPKHFKGQHTY  263

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVT KGYWQFD+G++LI G+ T +C+GGCSAIADSGTSL+AGPS+I+  IN AIGA  V
Sbjct  264   VPVTDKGYWQFDIGDILIGGETTKYCAGGCSAIADSGTSLLAGPSNIVVSINRAIGAAAV  323

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
                ECKA+V  YG+ ++DLL+ +A+P+KICS+IG+CTF+    VS+ IE+VV +K+G S+
Sbjct  324   AHPECKAIVSQYGRAIMDLLLAKAQPEKICSKIGVCTFDETHDVSLKIENVVSDKDGRSS  383

Query  565   -DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
                 +AMCSACEM V+W+Q++L +N+TQE+I+  VNELC+R  +   E+ VDCG++S MP
Sbjct  384   GGFSEAMCSACEMAVLWIQDELKQNKTQEDIIENVNELCDRGLN-QDETLVDCGRISQMP  442

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +VSF+IG ++F+L+  +YILKVGEGSAAQCISGF   D+PPPRGPLWILGDVFMG YHTV
Sbjct  443   NVSFTIGDRLFELTSKDYILKVGEGSAAQCISGFIPFDIPPPRGPLWILGDVFMGPYHTV  502

Query  208   FDYGKMRVGFAEAA  167
             FD+GK RVGFAEAA
Sbjct  503   FDFGKARVGFAEAA  516



>ref|XP_010473444.1| PREDICTED: LOW QUALITY PROTEIN: aspartic proteinase A2-like [Camelina 
sativa]
Length=498

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/495 (67%), Positives = 390/495 (79%), Gaps = 25/495 (5%)
 Frame = -2

Query  1645  AFSKSND-GFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKY-YNLHGRNGDLQDTD  1472
             A S+SND G  R+GLKK+        A R  +   ++LR+S R Y  NL G +GD    D
Sbjct  25    ASSESNDDGTFRVGLKKL--------ATRFGSSQEEALRSSFRSYNINLGGDSGD---AD  73

Query  1471  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQS  1292
             IV LKNY+DAQY+GEI +GTPPQKFTVIFDTGSSNLWVPS KC+ S+ CFFH+KY SS+S
Sbjct  74    IVALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSSNLWVPSGKCFLSISCFFHAKYKSSRS  133

Query  1291  STYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGIL  1112
             STY+K+GK A IHYG+GSISGFFS D+V VGDLVVK Q FIEATSEPG+TF+VAKFDG+L
Sbjct  134   STYKKDGKRAAIHYGSGSISGFFSYDAVTVGDLVVKDQEFIEATSEPGITFVVAKFDGLL  193

Query  1111  GLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEH  932
             GLGFQEISVG+A    X       VQ    SF             +VFGGVDP H++GEH
Sbjct  194   GLGFQEISVGNATSVWX------CVQFXFVSFL-----DXXXXXXIVFGGVDPNHFRGEH  242

Query  931   TYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGAD  752
             TYVPVTQ+GYWQFDMGEVLI+G+ TG+C  GCSAIADSGTSL+AGP+++I MIN AIGA 
Sbjct  243   TYVPVTQRGYWQFDMGEVLIDGESTGYCGSGCSAIADSGTSLLAGPTAVIAMINKAIGAS  302

Query  751   GVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-G  575
             GVVS++CK VV+ YGQ ++DLL+ E +PKKICSQIGLC F+G  GVSMGIESVVD++N  
Sbjct  303   GVVSQQCKTVVDQYGQIILDLLLAETQPKKICSQIGLCDFDGTEGVSMGIESVVDKENMK  362

Query  574   VSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLST  395
              S+ L DA C  CEM VVW+Q+QL +N TQE I++YVNE+C R+P+P GES VDC KLST
Sbjct  363   SSSSLRDAGCLPCEMAVVWIQSQLRQNMTQERIVNYVNEICERMPNPNGESAVDCSKLST  422

Query  394   MPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYH  215
             MP+VSF+IGGKVFDL+P EYILK+GEG  AQCISGFTA D+PPPRGPLWILGDVFMG+YH
Sbjct  423   MPTVSFTIGGKVFDLAPEEYILKIGEGPVAQCISGFTAFDIPPPRGPLWILGDVFMGKYH  482

Query  214   TVFDYGKMRVGFAEA  170
             TVFD+G  RVGFAEA
Sbjct  483   TVFDFGNERVGFAEA  497



>ref|XP_008440022.1| PREDICTED: aspartic proteinase-like isoform X2 [Cucumis melo]
 ref|XP_008440023.1| PREDICTED: aspartic proteinase-like isoform X2 [Cucumis melo]
 ref|XP_008440024.1| PREDICTED: aspartic proteinase-like isoform X2 [Cucumis melo]
 ref|XP_008440026.1| PREDICTED: aspartic proteinase-like isoform X2 [Cucumis melo]
Length=516

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/494 (64%), Positives = 399/494 (81%), Gaps = 2/494 (0%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S SN+GF+RIGLKK++ D+N+R  A LE+K G+ L  SV K+       G+ ++ D V
Sbjct  24    ATSASNEGFLRIGLKKIRSDQNSRFKALLESKKGEFLGPSVGKHNQWGNNLGESKNADNV  83

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKC FS+ CFFH++Y S +SST
Sbjct  84    PLKNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCVFSLACFFHARYQSGRSST  143

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+KNG SA I YG+G+I+GFFS D+V+VGD+VV++Q  IEATS   +TF+ AKFDGILGL
Sbjct  144   YKKNGTSAAIQYGSGAIAGFFSSDNVRVGDVVVRNQDLIEATSMSSMTFMAAKFDGILGL  203

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEIS G A      MV Q LV++ +FSFWLNRN +E+EGGELVFGGVDPKH+KG+HTY
Sbjct  204   GFQEISTGGAVPVWYNMVKQKLVKEQVFSFWLNRNAKEEEGGELVFGGVDPKHFKGQHTY  263

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVT KGYWQFD+G++LI G+ T +C+ GCSAIADSGTSL+AGPS I+ +IN AIGA  V
Sbjct  264   VPVTNKGYWQFDIGDILIGGETTKYCASGCSAIADSGTSLLAGPSDIVVLINRAIGAAAV  323

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
                ECKA+V  +G+ ++DLL+ +A+P+KICS IG+CTF+  R VS+ IE+VV +K+G S+
Sbjct  324   AHPECKAIVSQHGRAIMDLLLAKAQPEKICSIIGVCTFDQTRDVSLKIENVVSDKDGRSS  383

Query  565   -DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
                 +AMCSACEM V W+Q++L +N+TQE+I+  VNELC+R  S   E+ VDCG++S MP
Sbjct  384   GGFSEAMCSACEMAVSWIQDELRQNKTQEDIIDNVNELCDR-GSNQEETLVDCGRISQMP  442

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             SVSF+IG +VF+LS  +YILKVGEGSAAQCISGF  LD+PPPRGPLWILGDVFMG YHTV
Sbjct  443   SVSFTIGDRVFELSSKDYILKVGEGSAAQCISGFIPLDIPPPRGPLWILGDVFMGPYHTV  502

Query  208   FDYGKMRVGFAEAA  167
             FD+GK RVGFA+AA
Sbjct  503   FDFGKARVGFADAA  516



>ref|XP_008440021.1| PREDICTED: aspartic proteinase-like isoform X1 [Cucumis melo]
Length=548

 Score =   664 bits (1714),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/494 (64%), Positives = 399/494 (81%), Gaps = 2/494 (0%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A S SN+GF+RIGLKK++ D+N+R  A LE+K G+ L  SV K+       G+ ++ D V
Sbjct  56    ATSASNEGFLRIGLKKIRSDQNSRFKALLESKKGEFLGPSVGKHNQWGNNLGESKNADNV  115

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPSSKC FS+ CFFH++Y S +SST
Sbjct  116   PLKNYLDAQYYGEIGIGTPPQKFTVIFDTGSSNLWVPSSKCVFSLACFFHARYQSGRSST  175

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y+KNG SA I YG+G+I+GFFS D+V+VGD+VV++Q  IEATS   +TF+ AKFDGILGL
Sbjct  176   YKKNGTSAAIQYGSGAIAGFFSSDNVRVGDVVVRNQDLIEATSMSSMTFMAAKFDGILGL  235

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEIS G A      MV Q LV++ +FSFWLNRN +E+EGGELVFGGVDPKH+KG+HTY
Sbjct  236   GFQEISTGGAVPVWYNMVKQKLVKEQVFSFWLNRNAKEEEGGELVFGGVDPKHFKGQHTY  295

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVT KGYWQFD+G++LI G+ T +C+ GCSAIADSGTSL+AGPS I+ +IN AIGA  V
Sbjct  296   VPVTNKGYWQFDIGDILIGGETTKYCASGCSAIADSGTSLLAGPSDIVVLINRAIGAAAV  355

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
                ECKA+V  +G+ ++DLL+ +A+P+KICS IG+CTF+  R VS+ IE+VV +K+G S+
Sbjct  356   AHPECKAIVSQHGRAIMDLLLAKAQPEKICSIIGVCTFDQTRDVSLKIENVVSDKDGRSS  415

Query  565   -DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
                 +AMCSACEM V W+Q++L +N+TQE+I+  VNELC+R  S   E+ VDCG++S MP
Sbjct  416   GGFSEAMCSACEMAVSWIQDELRQNKTQEDIIDNVNELCDR-GSNQEETLVDCGRISQMP  474

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             SVSF+IG +VF+LS  +YILKVGEGSAAQCISGF  LD+PPPRGPLWILGDVFMG YHTV
Sbjct  475   SVSFTIGDRVFELSSKDYILKVGEGSAAQCISGFIPLDIPPPRGPLWILGDVFMGPYHTV  534

Query  208   FDYGKMRVGFAEAA  167
             FD+GK RVGFA+AA
Sbjct  535   FDFGKARVGFADAA  548



>ref|XP_010418214.1| PREDICTED: aspartic proteinase A2 isoform X2 [Camelina sativa]
Length=479

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/494 (64%), Positives = 385/494 (78%), Gaps = 39/494 (8%)
 Frame = -2

Query  1645  AFSKSND-GFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDI  1469
             A S+SND G +R+GLKK+K+D NNR+A R  +   ++LR+S R Y N  G  GD  D DI
Sbjct  22    ATSESNDDGTIRVGLKKLKLDPNNRLATRFGSSQEEALRSSFRSYNNNLG--GDSGDADI  79

Query  1468  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSS  1289
             V LKNY+DAQY+GEI +GTPPQKFTVIFDTGS+NLWVPS KC+ S+ CFFH+KY SS+SS
Sbjct  80    VALKNYLDAQYYGEIAIGTPPQKFTVIFDTGSANLWVPSGKCFLSISCFFHAKYKSSRSS  139

Query  1288  TYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILG  1109
             TY+K+GK A IHYG+GSISGFFS D+V VGDLVVK Q FIEATSEPG+TF+VAKFDG+LG
Sbjct  140   TYKKDGKRAAIHYGSGSISGFFSYDAVTVGDLVVKDQEFIEATSEPGITFVVAKFDGLLG  199

Query  1108  LGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHT  929
             LGFQEISVG+A      M+ QGL++ P+FSFWLNR+P+ +EGGE+VFGGVDP H++GEHT
Sbjct  200   LGFQEISVGNATPVWYNMLTQGLIKKPVFSFWLNRDPKSEEGGEIVFGGVDPNHFRGEHT  259

Query  928   YVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADG  749
             YVPVTQ+GYWQ                                   ++I MIN AIGA G
Sbjct  260   YVPVTQRGYWQ-----------------------------------AVIAMINKAIGASG  284

Query  748   VVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKN-GV  572
             VVS++CK VV+ YGQ ++DLL+ E +P+KICSQIGLC F+G +GVSMGI+SVVD++N   
Sbjct  285   VVSQQCKTVVDQYGQIILDLLLAETQPQKICSQIGLCGFDGTQGVSMGIDSVVDKENMKS  344

Query  571   SADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             S+ L  A C  CEM VVW+Q+QL +N TQE I++YVNE+C R+P+P GES VDC KLSTM
Sbjct  345   SSGLRGAGCPPCEMAVVWIQSQLRQNMTQERIVNYVNEICERMPNPNGESAVDCSKLSTM  404

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P+VSF+IGGKVFDL+P EYILK+GEG  AQCISGFTALD+PPPRGPLWILGDVFMG+YHT
Sbjct  405   PTVSFTIGGKVFDLAPEEYILKIGEGPVAQCISGFTALDIPPPRGPLWILGDVFMGKYHT  464

Query  211   VFDYGKMRVGFAEA  170
             VFD+G  RVGFAEA
Sbjct  465   VFDFGNERVGFAEA  478



>ref|XP_004969436.1| PREDICTED: aspartic proteinase oryzasin-1-like [Setaria italica]
Length=507

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/493 (64%), Positives = 394/493 (80%), Gaps = 16/493 (3%)
 Frame = -2

Query  1627  DGFVRIGLKKMKIDKNNRIAARLEAKAG-----DSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             +G VR+ LKK   D+N R+    E + G     D+  AS +      G        DIV 
Sbjct  25    EGLVRVPLKKRPADENGRL--HDERRRGFLGNDDAAAASKKAEAEEEG--------DIVA  74

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY++AQY+GEIG+GTP QKFTVIFDTGSSNLWVPSSKCY S+ C+FH++Y + QS++Y
Sbjct  75    LKNYLNAQYYGEIGIGTPQQKFTVIFDTGSSNLWVPSSKCYLSMACYFHARYKAGQSNSY  134

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGK A I YGTG+ISG+FS DSV++GD+VV++Q FIEAT EPG+TF+VAKFDGILGLG
Sbjct  135   KKNGKPASIRYGTGAISGYFSLDSVKIGDVVVRNQDFIEATREPGITFMVAKFDGILGLG  194

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             F+EISVG A      MV QGLV DP+FSFW NR+  E +GGE+VFGG+DP HYKG HTYV
Sbjct  195   FKEISVGAAVPVWYNMVKQGLVDDPVFSFWFNRHAGEGQGGEIVFGGIDPNHYKGNHTYV  254

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQF MG+VLI GK TGFC+ GC+AIADSGTSL+ GP++IIT+IN  IGA GVV
Sbjct  255   PVTRKGYWQFGMGDVLIGGKSTGFCASGCAAIADSGTSLLTGPTAIITLINEKIGAAGVV  314

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S+ECKAVV  YGQ++ID L+ E +P KICS +GLCTF+G  GVS GI SVVD++ G S  
Sbjct  315   SQECKAVVSQYGQQIIDQLLAETQPSKICSSVGLCTFDGAHGVSAGIRSVVDDEAGESNG  374

Query  562   L-HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
             L ++AMC+ACE  VVW+++QL++NQTQ+ +L Y+N+LC +LPSPMGES VDC ++++MP 
Sbjct  375   LFNEAMCNACETAVVWIRSQLAQNQTQDLVLQYINQLCEKLPSPMGESSVDCSRVASMPD  434

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             ++F+IGG+ F L P +YILKVGEG+AAQCISGFTA+D+PPPRGPLWILGD+FMG YHTVF
Sbjct  435   IAFTIGGRKFALKPEQYILKVGEGTAAQCISGFTAMDIPPPRGPLWILGDIFMGAYHTVF  494

Query  205   DYGKMRVGFAEAA  167
             DYG ++VGFAEAA
Sbjct  495   DYGNLKVGFAEAA  507



>ref|XP_010539213.1| PREDICTED: aspartic proteinase A3-like isoform X2 [Tarenaya hassleriana]
 ref|XP_010539218.1| PREDICTED: aspartic proteinase A3-like isoform X2 [Tarenaya hassleriana]
 ref|XP_010539226.1| PREDICTED: aspartic proteinase A3-like isoform X2 [Tarenaya hassleriana]
Length=507

 Score =   662 bits (1707),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/491 (64%), Positives = 388/491 (79%), Gaps = 10/491 (2%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             K++DG +RIGLKK+K+D+NN +  +      + L A   ++ +    NG     DIV LK
Sbjct  26    KNDDGMLRIGLKKIKLDRNNWVGLK------NWLLAPGARHRDYRMSNGA---ADIVALK  76

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+GEI VGTPPQKF VIFDTGSSNLWVPSSKCYFS+ CFFHSK+ SS+S TY K
Sbjct  77    NYLDAQYYGEISVGTPPQKFEVIFDTGSSNLWVPSSKCYFSIACFFHSKFKSSESETYRK  136

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISGFFS D + +GDLVVK++ FIEATSEPG+TF++AKFDGILGLGFQ
Sbjct  137   NGKPASIRYGTGAISGFFSNDDITIGDLVVKNEEFIEATSEPGITFVMAKFDGILGLGFQ  196

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG+A      MV QGLV++P+FSFWLNR+  ++EGGE+VFGGVDPKH+KG+HT+VPV
Sbjct  197   EISVGNATPVWYNMVKQGLVKEPVFSFWLNRDTDDEEGGEIVFGGVDPKHFKGQHTFVPV  256

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T+KGYWQFDMG+VLI+G+PTG+C  GCSAIADSGTSL+ GP+S+ITMIN AIGA+GV S 
Sbjct  257   TRKGYWQFDMGDVLIDGEPTGYCEEGCSAIADSGTSLLTGPTSVITMINEAIGAEGVASH  316

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADL  560
             ECK +VE+YG+ ++ LL  +  P K+C  +G C F+  R V   IE VVD+ +  VS   
Sbjct  317   ECKMIVEHYGKTILKLLRAQVHPLKVCFLMGFCLFDRTRSVIPDIEMVVDKNEERVSGGE  376

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
             +  MC ACEM VVWM+++L  NQT+E IL+Y + LC+++P+    S VDC  + TMP+VS
Sbjct  377   NGLMCVACEMVVVWMRHELKRNQTEERILNYADRLCSQIPAAGLPSTVDCNNIPTMPTVS  436

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGK FDLSP +YI KVGEG  AQC SGFTA+DVPPPRGPLWILGD+FMG YHTVFDY
Sbjct  437   FTIGGKAFDLSPQDYIFKVGEGIEAQCTSGFTAMDVPPPRGPLWILGDIFMGSYHTVFDY  496

Query  199   GKMRVGFAEAA  167
             GK+RVGFA+AA
Sbjct  497   GKVRVGFAKAA  507



>ref|XP_010539208.1| PREDICTED: aspartic proteinase A3-like isoform X1 [Tarenaya hassleriana]
Length=518

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/491 (64%), Positives = 388/491 (79%), Gaps = 10/491 (2%)
 Frame = -2

Query  1636  KSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLK  1457
             K++DG +RIGLKK+K+D+NN +  +      + L A   ++ +    NG     DIV LK
Sbjct  37    KNDDGMLRIGLKKIKLDRNNWVGLK------NWLLAPGARHRDYRMSNGA---ADIVALK  87

Query  1456  NYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEK  1277
             NY+DAQY+GEI VGTPPQKF VIFDTGSSNLWVPSSKCYFS+ CFFHSK+ SS+S TY K
Sbjct  88    NYLDAQYYGEISVGTPPQKFEVIFDTGSSNLWVPSSKCYFSIACFFHSKFKSSESETYRK  147

Query  1276  NGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQ  1097
             NGK A I YGTG+ISGFFS D + +GDLVVK++ FIEATSEPG+TF++AKFDGILGLGFQ
Sbjct  148   NGKPASIRYGTGAISGFFSNDDITIGDLVVKNEEFIEATSEPGITFVMAKFDGILGLGFQ  207

Query  1096  EISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPV  917
             EISVG+A      MV QGLV++P+FSFWLNR+  ++EGGE+VFGGVDPKH+KG+HT+VPV
Sbjct  208   EISVGNATPVWYNMVKQGLVKEPVFSFWLNRDTDDEEGGEIVFGGVDPKHFKGQHTFVPV  267

Query  916   TQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSK  737
             T+KGYWQFDMG+VLI+G+PTG+C  GCSAIADSGTSL+ GP+S+ITMIN AIGA+GV S 
Sbjct  268   TRKGYWQFDMGDVLIDGEPTGYCEEGCSAIADSGTSLLTGPTSVITMINEAIGAEGVASH  327

Query  736   ECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDE-KNGVSADL  560
             ECK +VE+YG+ ++ LL  +  P K+C  +G C F+  R V   IE VVD+ +  VS   
Sbjct  328   ECKMIVEHYGKTILKLLRAQVHPLKVCFLMGFCLFDRTRSVIPDIEMVVDKNEERVSGGE  387

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
             +  MC ACEM VVWM+++L  NQT+E IL+Y + LC+++P+    S VDC  + TMP+VS
Sbjct  388   NGLMCVACEMVVVWMRHELKRNQTEERILNYADRLCSQIPAAGLPSTVDCNNIPTMPTVS  447

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IGGK FDLSP +YI KVGEG  AQC SGFTA+DVPPPRGPLWILGD+FMG YHTVFDY
Sbjct  448   FTIGGKAFDLSPQDYIFKVGEGIEAQCTSGFTAMDVPPPRGPLWILGDIFMGSYHTVFDY  507

Query  199   GKMRVGFAEAA  167
             GK+RVGFA+AA
Sbjct  508   GKVRVGFAKAA  518



>ref|XP_010926196.1| PREDICTED: aspartic proteinase oryzasin-1-like [Elaeis guineensis]
Length=518

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/497 (63%), Positives = 388/497 (78%), Gaps = 6/497 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARL-EAKAGDSLRASVRKYYNLHGRNGDL--QDT  1475
             AF  S DG VRI LKK  +D N+R+AARL + + G +L A    Y+           ++ 
Sbjct  22    AFPVSADGVVRIRLKKRALDPNSRLAARLADREEGTALAARKYGYFEPGPVGPVGPGKEG  81

Query  1474  DIVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQ  1295
             D++  KNYM+A+YFGEIG+G+PPQ FTVIFDTGSSN WVPSSKCY SV C+FHS Y SS 
Sbjct  82    DVIARKNYMNARYFGEIGLGSPPQNFTVIFDTGSSNFWVPSSKCYISVACYFHSAYKSSL  141

Query  1294  SSTYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGI  1115
              STY++NG SA IHYGTGS++GF SQD V VGDL +++Q FIEAT EP +TF+  KFDGI
Sbjct  142   LSTYQENGTSAYIHYGTGSVAGFLSQDHVTVGDLTIENQVFIEATREPSITFMARKFDGI  201

Query  1114  LGLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGE  935
             LGLGF+ ISVG+       MV+Q LV++P+FSFW NRN ++ EGGE+VFGG DPKHY+GE
Sbjct  202   LGLGFKAISVGNVVPIWDNMVSQSLVKEPVFSFWFNRNTEDGEGGEIVFGGTDPKHYRGE  261

Query  934   HTYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGA  755
             HTYVPVTQKGYWQF+MG+VL+ G+ TGFC+ GC AIADSGTSLIAGP+ II  +N  IGA
Sbjct  262   HTYVPVTQKGYWQFEMGDVLVGGQTTGFCAEGCQAIADSGTSLIAGPTVIIAEVNQKIGA  321

Query  754   DGVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVD-EKN  578
              GVVS++CKAVV  YG++++++L+ +  P KICS+IGLC F+G  GVSMGI+SVV+  ++
Sbjct  322   AGVVSQQCKAVVSQYGEKIMEMLMEKEEPTKICSRIGLCAFDGTHGVSMGIKSVVNGRRD  381

Query  577   GVSADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLS  398
               +  L D MCS CEM VVWMQNQ  ++QT + +L Y++ELC RLPSPMGES VDC  L+
Sbjct  382   RFTGGLGDGMCSYCEMAVVWMQNQFMQSQTVQQVLDYISELCERLPSPMGESAVDCSSLA  441

Query  397   TMPSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRY  218
             +MP VSF+IGGK FDL P +YILKVG+GS AQCISGFTALDV  P+GPLWILGDVFMG Y
Sbjct  442   SMPVVSFTIGGKRFDLKPEQYILKVGDGSLAQCISGFTALDV--PQGPLWILGDVFMGVY  499

Query  217   HTVFDYGKMRVGFAEAA  167
             HTVFDYG++RVGFAEAA
Sbjct  500   HTVFDYGQLRVGFAEAA  516



>ref|XP_006428329.1| hypothetical protein CICLE_v10011525mg [Citrus clementina]
 ref|XP_006480355.1| PREDICTED: aspartic proteinase-like [Citrus sinensis]
 gb|ESR41569.1| hypothetical protein CICLE_v10011525mg [Citrus clementina]
Length=506

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/489 (64%), Positives = 392/489 (80%), Gaps = 6/489 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             S++G  RIGLKK ++D ++  AAR+  K      A V     +H R GD  D DI+ LKN
Sbjct  24    SSNGLRRIGLKKRRLDLHSLNAARITRKERYMGGAGVS---GVHHRLGD-SDEDILPLKN  79

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             +MDAQYFGEIG+G+PPQ F+VIFDTGSSNLWVPSSKCYFS+ C+FHS+Y S +S+TY + 
Sbjct  80    FMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSRYKSRKSNTYTEI  139

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKS EI+YG+GSISGFFSQD+V+VGD+VVK Q FIEAT E  +TFL+A+FDGI+GLGF+E
Sbjct  140   GKSCEINYGSGSISGFFSQDNVEVGDVVVKDQVFIEATREGSLTFLLARFDGIIGLGFRE  199

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             I+VGDA      MV QGLV + +FSFWLNR+P  +EGGE+VFGGVDPKH+KG+HTYVPVT
Sbjct  200   IAVGDAVPVWDNMVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVT  259

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             +KGYWQF++G++LI  + TG C GGC+AI DSGTSL+AGP+ ++T INHAIG +GVVS E
Sbjct  260   KKGYWQFNLGDILIGNQSTGVCEGGCAAIVDSGTSLLAGPTPVVTEINHAIGGEGVVSAE  319

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHD  554
             CK VV  YG  + DLLV    P+K+C QIGLC FNG   VS GI++VV+++N  + D   
Sbjct  320   CKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVSAGD--S  377

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
             A+CSACEMTVVW+QNQL + QT+E +LSY+NELC+ LP+PMGES +DCG++ TMP+VSF+
Sbjct  378   AVCSACEMTVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCGRIPTMPNVSFT  437

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IG K+F+LSP +YILK GEG A  CISGF A D+PPPRGPLWILGDVFMG YHTVFD GK
Sbjct  438   IGDKIFNLSPEQYILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGK  497

Query  193   MRVGFAEAA  167
             +R+GFAEAA
Sbjct  498   LRIGFAEAA  506



>gb|KCW46980.1| hypothetical protein EUGRSUZ_K00787 [Eucalyptus grandis]
Length=462

 Score =   658 bits (1698),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/435 (71%), Positives = 363/435 (83%), Gaps = 2/435 (0%)
 Frame = -2

Query  1639  SKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGL  1460
             S S+DG VRIGLKK K+D  NR+A +  +K G + R  +RKYY LH   GD +D DIV L
Sbjct  24    SSSSDGMVRIGLKKRKLDHVNRVAEQGNSKEGGTPRGPLRKYY-LHNNLGDSEDIDIVSL  82

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNYMDAQYFGEIG+GTP QKFTVIFDTGSSNLWVPSSKCY SV C+FHSK+ SS SSTY+
Sbjct  83    KNYMDAQYFGEIGIGTPSQKFTVIFDTGSSNLWVPSSKCYLSVACYFHSKFKSSDSSTYK  142

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
             KNGKSAEIHYGTG+ISGFFSQD V+VGDLVVK Q FIEAT EP +TFL AKFDGILGLGF
Sbjct  143   KNGKSAEIHYGTGAISGFFSQDHVKVGDLVVKGQEFIEATREPSITFLAAKFDGILGLGF  202

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             +EISVGDA      MVNQGL+++P+FSFWLNRN + +EGGE+VFGG D  HYKGEHTYVP
Sbjct  203   KEISVGDATPVWYNMVNQGLIKEPVFSFWLNRNTEGEEGGEIVFGGADSSHYKGEHTYVP  262

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VTQKGYWQF M +VLI  + TGFC+ GCSAIADSGTSL+AGP+++IT INHAIGA GVVS
Sbjct  263   VTQKGYWQFKMADVLIGNETTGFCASGCSAIADSGTSLLAGPTTVITQINHAIGASGVVS  322

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA-D  563
             +ECK +V  YG+ ++++L+ EA+P+KICSQIG CTF+G  GV MGIESVVDE  G S+  
Sbjct  323   QECKTIVGQYGKTILEMLMTEAKPQKICSQIGFCTFDGTHGVRMGIESVVDETKGKSSGG  382

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
             LHDAMCSACEM VVWMQNQL+ NQT++ IL+YVNELC+R+PSPMGES VDC  LS+MP V
Sbjct  383   LHDAMCSACEMAVVWMQNQLTRNQTEDQILNYVNELCDRIPSPMGESAVDCNSLSSMPRV  442

Query  382   SFSIGGKVFDLSPNE  338
             SF+IGGKVFDL+P +
Sbjct  443   SFTIGGKVFDLAPEQ  457



>ref|XP_006447588.1| hypothetical protein CICLE_v10017754mg [Citrus clementina]
 gb|ESR60828.1| hypothetical protein CICLE_v10017754mg [Citrus clementina]
Length=486

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/495 (65%), Positives = 394/495 (80%), Gaps = 32/495 (6%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AF+  NDG VRIGL+K K+D+ NR+  +  +K  +++R  VR+Y NLHG  GD  DTDIV
Sbjct  22    AFALPNDGLVRIGLRKKKLDQINRLVGQTVSKEEETMRTPVRRY-NLHGSLGD-SDTDIV  79

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              L N+MDAQYFGE+ +GTP Q FTVIFDTGSSNLWVPS+KCYFSV C+FHSKY SS SST
Sbjct  80    ALNNFMDAQYFGEVSIGTPSQTFTVIFDTGSSNLWVPSAKCYFSVSCYFHSKYKSSHSST  139

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y++NG SA I YGTG+ISGFFSQD+V+VGDLVVK+Q FIEAT E  +TFL AKFDGILGL
Sbjct  140   YKRNGTSAAIQYGTGAISGFFSQDNVKVGDLVVKNQDFIEATKEASITFLAAKFDGILGL  199

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEIS+G A      M++QGLV++P+FSFWLNR+ + +EGGE+VFGGVDP HYKG    
Sbjct  200   GFQEISIGKAIPVWYNMLDQGLVKEPVFSFWLNRDIEGEEGGEIVFGGVDPDHYKG----  255

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
                                     +CS GC+AIADSGTSL+AGP++IIT INHAIGA GV
Sbjct  256   ------------------------YCSTGCNAIADSGTSLLAGPTTIITQINHAIGASGV  291

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             +S+ECK +V+ YG+ ++++L+ E +P+KICSQ+GLCTF+G RG SMGIESV+D+ +  S+
Sbjct  292   ISQECKTLVDQYGKTILEMLIAETQPQKICSQMGLCTFDGTRGFSMGIESVIDKSSDKSS  351

Query  565   D-LHD-AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             D +HD AMCSACEM V+WMQN+L  N+T + IL+YVN+LC+RLPSP GES VDC  LS+M
Sbjct  352   DGVHDSAMCSACEMAVIWMQNKLRRNETADQILNYVNQLCDRLPSPNGESAVDCDNLSSM  411

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P+VSF+IGGKVFDL+PNEY+L+VGEG AAQCISGFTA DV PPRGPLWILGDVFMGRYHT
Sbjct  412   PNVSFTIGGKVFDLAPNEYVLEVGEGVAAQCISGFTAFDVAPPRGPLWILGDVFMGRYHT  471

Query  211   VFDYGKMRVGFAEAA  167
             VFDYG + +GFAEAA
Sbjct  472   VFDYGNLSIGFAEAA  486



>ref|XP_009416572.1| PREDICTED: aspartic proteinase-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=505

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/495 (61%), Positives = 386/495 (78%), Gaps = 18/495 (4%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQ------DTD  1472
             S+DG +R+ LKK  +D+N   AAR+           VRK  N+H +N          D D
Sbjct  23    SSDGLLRVKLKKRPLDRNTLDAARI-----------VRKE-NMHSQNNAFHHNLEDSDID  70

Query  1471  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQS  1292
             IV LKNYMDAQYFGEIG+G+PPQ F+VIFDTGSSNLWVPSSKC+FSVPC+FH KY S  S
Sbjct  71    IVSLKNYMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCFFSVPCYFHHKYKSGSS  130

Query  1291  STYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGIL  1112
             STY KNGKS +I YG+G+ISGFFSQDSVQVGDLVVK Q FIEAT E  ++FL+AKFDGIL
Sbjct  131   STYRKNGKSCKITYGSGTISGFFSQDSVQVGDLVVKDQIFIEATKESSLSFLLAKFDGIL  190

Query  1111  GLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEH  932
             GLGFQEISVG+       M  QGL+++ +FSFWLNR+  +  GGE+VFGGVD KHYKG+H
Sbjct  191   GLGFQEISVGNYPPIWYNMAKQGLIENKVFSFWLNRDTDDMNGGEIVFGGVDSKHYKGDH  250

Query  931   TYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGAD  752
             TYV V+ KGYWQF+MG+ LI+G+ TGFCSGGCSAI DSGTSL+ GP++II  +NHAIGA+
Sbjct  251   TYVSVSHKGYWQFEMGDFLIDGQSTGFCSGGCSAIVDSGTSLLTGPTTIIAQVNHAIGAE  310

Query  751   GVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGV  572
             G+VS ECK +V  YG+ +++LL+ E RP K+C +IGLC F+G + VS  I+SV++++   
Sbjct  311   GIVSMECKEIVNEYGEMILELLIAETRPVKVCRKIGLCEFDGAQYVSTDIQSVLEKQKDK  370

Query  571   SADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             ++   D +C+ CEM V+W++NQL +NQT+E+IL+Y NE+C RLPSPMGES VDC ++++M
Sbjct  371   TSVNQDVLCTFCEMAVIWIENQLRQNQTKEHILAYANEICERLPSPMGESAVDCNQIASM  430

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P+V+F+IG + F L+P EY+LKV +G  A CISGFTA+D+PPP+GPLWILGDVFMG YHT
Sbjct  431   PNVAFTIGKRTFSLTPKEYVLKVEQGGTAVCISGFTAIDIPPPQGPLWILGDVFMGAYHT  490

Query  211   VFDYGKMRVGFAEAA  167
             VFD+G   +GFA++A
Sbjct  491   VFDFGNNSIGFAKSA  505



>gb|KDO45247.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=506

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/489 (64%), Positives = 389/489 (80%), Gaps = 6/489 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             S++G  RIGLKK ++D ++  AAR+  K      A V     +  R GD  D DI+ LKN
Sbjct  24    SSNGLRRIGLKKRRLDLHSLNAARITRKERYMGGAGVS---GVRHRLGD-SDEDILPLKN  79

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             +MDAQYFGEIG+G+PPQ F+VIFDTGSSNLWVPSSKCYFS+ C+FHS+Y S +S+TY + 
Sbjct  80    FMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSRYKSRKSNTYTEI  139

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKS EI+YG+GSISGFFSQD+V+VGD+VVK Q FIEAT E  +TFL+A+FDGI+GLGF+E
Sbjct  140   GKSCEINYGSGSISGFFSQDNVEVGDVVVKDQVFIEATREGSLTFLLARFDGIIGLGFRE  199

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             I+VGDA      MV QGLV + +FSFWLNR+P  +EGGE+VFGGVDPKH+KG+HTYVPVT
Sbjct  200   IAVGDAVPVWDNMVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVT  259

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             +KGYWQF++G++LI  + TG C GGC+AI DSGTSL+AGP+ ++T INHAIG +GVVS E
Sbjct  260   KKGYWQFELGDILIGNQSTGVCEGGCAAIVDSGTSLLAGPTPVVTEINHAIGGEGVVSAE  319

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHD  554
             CK VV  YG  + DLLV    P+K+C QIGLC FNG   VS GI++VV+++N  + D   
Sbjct  320   CKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVSAGD--S  377

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
             A+CSACEM VVW+QNQL + QT+E +LSY+NELC+ LP+PMGES +DC ++ TMP+VSF+
Sbjct  378   AVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNVSFT  437

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IG K+F+LSP +YILK GEG A  CISGF A D+PPPRGPLWILGDVFMG YHTVFD GK
Sbjct  438   IGDKIFNLSPEQYILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFDSGK  497

Query  193   MRVGFAEAA  167
             +R+GFAEAA
Sbjct  498   LRIGFAEAA  506



>gb|KJB13726.1| hypothetical protein B456_002G091100 [Gossypium raimondii]
Length=456

 Score =   651 bits (1679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/436 (70%), Positives = 364/436 (83%), Gaps = 3/436 (1%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             FS SNDG  RIGLKK K D+NN +AA+L++K G++LR S RKY  LHG   + +D DIV 
Sbjct  22    FSTSNDGLFRIGLKKRKFDRNNLLAAQLDSKEGEALRGSFRKY--LHGNLQESKDIDIVA  79

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNYMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHS+Y SS SSTY
Sbjct  80    LKNYMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSRYKSSHSSTY  139

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
               NGK A+I YGTG ISGFFS+D V VGDLVVK+Q FIEATSEP +TFL+AKFDGILGLG
Sbjct  140   NANGKPADIKYGTGQISGFFSEDHVTVGDLVVKNQEFIEATSEPSLTFLLAKFDGILGLG  199

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             FQEISVG+A      MVNQGLV++P+FSFWL+RN ++  GGELVFGG+DPKH+KG HTYV
Sbjct  200   FQEISVGNAVPVWYNMVNQGLVKEPVFSFWLSRNSEDNLGGELVFGGMDPKHFKGNHTYV  259

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+ LI  + TGFC+GGCSAIADSGTSL+AGP+ IIT INHAIGA GVV
Sbjct  260   PVTRKGYWQFDMGDFLIGNETTGFCAGGCSAIADSGTSLLAGPTGIITQINHAIGASGVV  319

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSA  566
             S+ECKAVV  YG++++D+L+ +  PKKICSQIGLC F+G +GVSM IES+V+E  G  S 
Sbjct  320   SQECKAVVSEYGEKILDMLLAKDEPKKICSQIGLCLFDGTQGVSMEIESIVNENAGKASG  379

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L DAMCS CEM V+WMQNQL +NQTQ++I+ YVNELC+RLPSPMGES +DC  LS+MPS
Sbjct  380   SLRDAMCSTCEMAVIWMQNQLKQNQTQDHIIDYVNELCDRLPSPMGESSIDCKSLSSMPS  439

Query  385   VSFSIGGKVFDLSPNE  338
             VSF+I GK+F+L P +
Sbjct  440   VSFTIAGKLFELRPEQ  455



>ref|XP_009416564.1| PREDICTED: aspartic proteinase-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=527

 Score =   654 bits (1686),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/495 (61%), Positives = 386/495 (78%), Gaps = 18/495 (4%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQ------DTD  1472
             S+DG +R+ LKK  +D+N   AAR+           VRK  N+H +N          D D
Sbjct  45    SSDGLLRVKLKKRPLDRNTLDAARI-----------VRKE-NMHSQNNAFHHNLEDSDID  92

Query  1471  IVGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQS  1292
             IV LKNYMDAQYFGEIG+G+PPQ F+VIFDTGSSNLWVPSSKC+FSVPC+FH KY S  S
Sbjct  93    IVSLKNYMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCFFSVPCYFHHKYKSGSS  152

Query  1291  STYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGIL  1112
             STY KNGKS +I YG+G+ISGFFSQDSVQVGDLVVK Q FIEAT E  ++FL+AKFDGIL
Sbjct  153   STYRKNGKSCKITYGSGTISGFFSQDSVQVGDLVVKDQIFIEATKESSLSFLLAKFDGIL  212

Query  1111  GLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEH  932
             GLGFQEISVG+       M  QGL+++ +FSFWLNR+  +  GGE+VFGGVD KHYKG+H
Sbjct  213   GLGFQEISVGNYPPIWYNMAKQGLIENKVFSFWLNRDTDDMNGGEIVFGGVDSKHYKGDH  272

Query  931   TYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGAD  752
             TYV V+ KGYWQF+MG+ LI+G+ TGFCSGGCSAI DSGTSL+ GP++II  +NHAIGA+
Sbjct  273   TYVSVSHKGYWQFEMGDFLIDGQSTGFCSGGCSAIVDSGTSLLTGPTTIIAQVNHAIGAE  332

Query  751   GVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGV  572
             G+VS ECK +V  YG+ +++LL+ E RP K+C +IGLC F+G + VS  I+SV++++   
Sbjct  333   GIVSMECKEIVNEYGEMILELLIAETRPVKVCRKIGLCEFDGAQYVSTDIQSVLEKQKDK  392

Query  571   SADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             ++   D +C+ CEM V+W++NQL +NQT+E+IL+Y NE+C RLPSPMGES VDC ++++M
Sbjct  393   TSVNQDVLCTFCEMAVIWIENQLRQNQTKEHILAYANEICERLPSPMGESAVDCNQIASM  452

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P+V+F+IG + F L+P EY+LKV +G  A CISGFTA+D+PPP+GPLWILGDVFMG YHT
Sbjct  453   PNVAFTIGKRTFSLTPKEYVLKVEQGGTAVCISGFTAIDIPPPQGPLWILGDVFMGAYHT  512

Query  211   VFDYGKMRVGFAEAA  167
             VFD+G   +GFA++A
Sbjct  513   VFDFGNNSIGFAKSA  527



>ref|XP_008800325.1| PREDICTED: aspartic proteinase-like isoform X1 [Phoenix dactylifera]
 ref|XP_008800326.1| PREDICTED: aspartic proteinase-like isoform X1 [Phoenix dactylifera]
Length=507

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/489 (62%), Positives = 381/489 (78%), Gaps = 7/489 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             S+DG +RIGLKK  +D     AA++  K    ++ +      LH    D  D DI+ LKN
Sbjct  24    SSDGLLRIGLKKKPLDTETLNAAKIARKMMIHMQKN-----GLHHSLAD-SDVDIISLKN  77

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FH +Y +S S+TY KN
Sbjct  78    YMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHHRYRASSSATYTKN  137

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             G+S EI YG+G+ISGFFSQD+VQVGDL VK Q FIE T E  +TF++AKFDGILGLGF E
Sbjct  138   GESCEITYGSGAISGFFSQDNVQVGDLAVKDQVFIETTRESSLTFVLAKFDGILGLGFPE  197

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVGD       MV Q L+   +FSFWLNR+  +  GGEL+FGGVDP+H+KGEH+YVPVT
Sbjct  198   ISVGDCPPLWYSMVEQDLIDKKVFSFWLNRDADDVNGGELIFGGVDPRHFKGEHSYVPVT  257

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
              +GYWQFDMG+ LI+G+ TG+C+ GC+AI DSGTSL+AGP++I+T INHAIGA+GVVS E
Sbjct  258   SEGYWQFDMGDFLIDGQSTGYCADGCAAIVDSGTSLLAGPTTIVTQINHAIGAEGVVSME  317

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-  557
             CK VV+ YG+ +++LLV + RP K+CS+IGLC F+G R V  GI+SVVD++    + L+ 
Sbjct  318   CKEVVKQYGELILELLVAQTRPDKVCSKIGLCIFDGARYVGTGIDSVVDKQKEEDSSLNQ  377

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             D +C+ACEM VVW++NQL EN+T+E IL+Y NELC RLPSP GES V C ++++MP++SF
Sbjct  378   DVLCTACEMAVVWIENQLRENKTKERILAYANELCERLPSPSGESTVSCDQIASMPNISF  437

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +I  KVF L+P EY+LKV +G  + CISGF A DVPPPRGPLWILGDVFMG YHTVFD+G
Sbjct  438   TIAEKVFSLTPEEYVLKVEQGYTSVCISGFMAFDVPPPRGPLWILGDVFMGAYHTVFDFG  497

Query  196   KMRVGFAEA  170
               R+GFA+A
Sbjct  498   NKRIGFAKA  506



>ref|XP_008800328.1| PREDICTED: aspartic proteinase-like isoform X2 [Phoenix dactylifera]
Length=507

 Score =   653 bits (1684),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/490 (62%), Positives = 381/490 (78%), Gaps = 7/490 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             S+DG +RIGLKK  +D     AA++  K    ++ +      LH    D  D DI+ LKN
Sbjct  24    SSDGLLRIGLKKKPLDTETLNAAKIARKMMIHMQKN-----GLHHSLAD-SDVDIISLKN  77

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             YMDAQYFGEIG+GTPPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FH +Y +S S+TY KN
Sbjct  78    YMDAQYFGEIGIGTPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHHRYRASSSATYTKN  137

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             G+S EI YG+G+ISGFFSQD+VQVGDL VK Q FIE T E  +TF++AKFDGILGLGF E
Sbjct  138   GESCEITYGSGAISGFFSQDNVQVGDLAVKDQVFIETTRESSLTFVLAKFDGILGLGFPE  197

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVGD       MV Q L+   +FSFWLNR+  +  GGEL+FGGVDP+H+KGEH+YVPVT
Sbjct  198   ISVGDCPPLWYIMVEQDLIDKKVFSFWLNRDADDVNGGELIFGGVDPRHFKGEHSYVPVT  257

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
              +GYWQFDMG+ LI+G+ TG+C+ GC+AI DSGTSL+AGP++I+T INHAIGA+GVVS E
Sbjct  258   SEGYWQFDMGDFLIDGQSTGYCADGCAAIVDSGTSLLAGPTTIVTQINHAIGAEGVVSME  317

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLH-  557
             CK VV+ YG+ +++LLV + RP K+CS+IGLC F+G R V  GI+SVVD++    + L+ 
Sbjct  318   CKEVVKQYGELILELLVAQTRPDKVCSKIGLCIFDGARYVGTGIDSVVDKQKEEDSSLNQ  377

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             D +C+ACEM VVW++NQL EN+T+E IL+Y NELC RLPSP GES V C ++++MP++SF
Sbjct  378   DVLCTACEMAVVWIENQLRENKTKERILAYANELCERLPSPSGESTVSCDQIASMPNISF  437

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +I  KVF L+P EY+LKV +G  + CISGF A DVPPPRGPLWILGDVFMG YHTVFD+G
Sbjct  438   TIAEKVFSLTPEEYVLKVEQGYTSVCISGFMAFDVPPPRGPLWILGDVFMGAYHTVFDFG  497

Query  196   KMRVGFAEAA  167
               R+GFA+A 
Sbjct  498   NKRIGFAKAV  507



>dbj|BAG16519.1| putative aspartic protease [Capsicum chinense]
Length=506

 Score =   652 bits (1682),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/489 (63%), Positives = 378/489 (77%), Gaps = 5/489 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             S+D  +RIGLKK  +D N+  AAR+       L+    K+ N   +  D  D DIV LKN
Sbjct  23    SSDNLLRIGLKKHHVDVNSINAARVA-----RLQDRYGKHLNGLEKKSDGSDVDIVPLKN  77

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             Y+DAQY+GEIG+G+PPQKF VIFDTGSSNLWVPSS+CYFS+ C+FH KY + +SSTY +N
Sbjct  78    YLDAQYYGEIGIGSPPQKFKVIFDTGSSNLWVPSSRCYFSIACWFHHKYKAGKSSTYTRN  137

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKS  I YGTGSISG FSQD+VQVGDLVVK Q FIEAT EP +TF++ KFDGILGLGFQE
Sbjct  138   GKSCSIRYGTGSISGHFSQDNVQVGDLVVKDQVFIEATREPSITFIIGKFDGILGLGFQE  197

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG+A      MV+QGLV++P+FSFW NR+   +EGGELVFGGVDPKH+KG HTYVP+T
Sbjct  198   ISVGNATPVWYNMVDQGLVKEPVFSFWFNRDASTKEGGELVFGGVDPKHFKGNHTYVPLT  257

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQF+MG+ LI    TG+C+GGC+AI DSGTSL+AGP++I+T +NHAIGA+GVVS E
Sbjct  258   QKGYWQFNMGDFLIGNTSTGYCAGGCAAIVDSGTSLLAGPTTIVTQLNHAIGAEGVVSAE  317

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHD  554
             CK +V  YG+ + DLLV   RP ++CSQ GLC FNG   VS  I +VV+ +N  S+    
Sbjct  318   CKTIVSQYGEVLWDLLVSGVRPDQVCSQAGLCFFNGAEHVSSNIRTVVERENEGSSVGEA  377

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
              +C+ CEM VVW+QNQL +  T+E +L YV++LC +LPSPMGES VDC  +S++P+++F+
Sbjct  378   PLCTVCEMAVVWIQNQLKQQGTKERVLEYVDQLCEKLPSPMGESVVDCNSISSLPNITFT  437

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             I  K F L+P +YILK GEG A+ CISGF A DVPPPRGPLWILGDVFMG YHTVFDYG 
Sbjct  438   IKDKAFVLTPEQYILKTGEGIASICISGFAAFDVPPPRGPLWILGDVFMGPYHTVFDYGN  497

Query  193   MRVGFAEAA  167
              +VGFAEAA
Sbjct  498   SQVGFAEAA  506



>ref|XP_011039044.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011039045.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
 ref|XP_011039046.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=506

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/489 (63%), Positives = 378/489 (77%), Gaps = 5/489 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             ++ G VRIGLKK +ID +   AAR+  + G S   +   +++L        D DI+ LKN
Sbjct  23    NSSGLVRIGLKKRRIDLDTIKAARIARQEGKSGAGANSLFHDL-----GTSDADIIPLKN  77

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             Y+DAQY GEIG+G+PPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHSKY SS SSTY KN
Sbjct  78    YLDAQYVGEIGIGSPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYKSSLSSTYIKN  137

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             G S EIHYG+GSISGF SQD+VQVG LVVK Q FIE T E  ++F++ KFDGILGLGFQE
Sbjct  138   GNSCEIHYGSGSISGFLSQDNVQVGGLVVKHQVFIEVTKEGSLSFVLGKFDGILGLGFQE  197

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG+       MV Q LV D +FSFWLNRNP+ +EGGELVFGGVDPKH+KG+HTYVPVT
Sbjct  198   ISVGNVVPVWYNMVQQDLVDDEVFSFWLNRNPEAKEGGELVFGGVDPKHFKGKHTYVPVT  257

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             +KGYWQ +MG+ LI    TG C  GC+AI DSGTSL+AGP+ IIT INHAIGA+GVVS E
Sbjct  258   KKGYWQINMGDFLIGNHSTGLCEEGCAAIVDSGTSLLAGPTPIITEINHAIGAEGVVSAE  317

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHD  554
             CK VV  YG  + +LL+   +P K+C+Q+GLC FNG+  VS GIESVV+++N  S+   D
Sbjct  318   CKEVVSQYGDLIWELLISGVKPNKVCAQLGLCIFNGDEYVSTGIESVVEKENEGSSAGDD  377

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
              +C+ACEM V+W+QNQL E +T+E  ++Y+++LC  LPSPMGES +DC  +S+MP++SF+
Sbjct  378   LLCTACEMLVIWVQNQLREKETKEAAINYLDKLCESLPSPMGESVIDCNSISSMPNISFT  437

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             IG K F L+P +Y+LK GEG A  CISGF ALDVPPPRGPLWILGDVFMG YHTVFDYG 
Sbjct  438   IGDKPFSLTPEQYVLKTGEGIAQVCISGFMALDVPPPRGPLWILGDVFMGVYHTVFDYGN  497

Query  193   MRVGFAEAA  167
             + VGFAEAA
Sbjct  498   LEVGFAEAA  506



>gb|KGN56078.1| hypothetical protein Csa_3G066750 [Cucumis sativus]
Length=535

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/493 (65%), Positives = 374/493 (76%), Gaps = 41/493 (8%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVG  1463
             F  SNDG VRIGLK+ K  +NNR+A+++  K G SL+ SV KY       GD  D DIVG
Sbjct  83    FCASNDGKVRIGLKRRKFGQNNRVASKIATKEGISLKNSVEKY-QPSANLGDSDDFDIVG  141

Query  1462  LKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTY  1283
             LKNY++AQYFGEIG+GTPPQKF VIFDTGSSNLWVPSSKC FSV C  HSKY S +SSTY
Sbjct  142   LKNYLNAQYFGEIGIGTPPQKFAVIFDTGSSNLWVPSSKC-FSVACLLHSKYKSKRSSTY  200

Query  1282  EKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLG  1103
             +KNGKSA I YGTG+ISG+FS+D+V+VGDL+VK Q FIEAT EP +TF++A+FDGILGLG
Sbjct  201   KKNGKSASIKYGTGAISGYFSEDNVKVGDLIVKKQDFIEATREPSLTFVLAQFDGILGLG  260

Query  1102  FQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYV  923
             F+EISVGDA      MV+Q LV++P+FSFW NRN  E++GGE+VFGGVDP HYKGEHTYV
Sbjct  261   FKEISVGDAVPVWYNMVDQNLVKEPVFSFWFNRNADEEQGGEIVFGGVDPDHYKGEHTYV  320

Query  922   PVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             PVT+KGYWQFDMG+VLI G  TGFCSGGCSAIADSGTSL+AGP+                
Sbjct  321   PVTKKGYWQFDMGDVLINGSTTGFCSGGCSAIADSGTSLLAGPTD---------------  365

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
                                    +PKKICS +GLC F+G RGVSMGIESVVD     S++
Sbjct  366   -----------------------QPKKICSTLGLCAFDGERGVSMGIESVVDNTTQKSSN  402

Query  562   -LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
              L D MC+ACEM VVW Q+QL E +TQ+ IL+Y++ LC +LPSPMGES +DC  LST+PS
Sbjct  403   GLRDVMCNACEMAVVWAQSQLKEEKTQDQILNYIDGLCEKLPSPMGESVIDCDSLSTLPS  462

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             +SF+IGGKVF+L P +Y+LKV EG   +CISGF ALDVPPPRGPLWILGDVFMG YHTVF
Sbjct  463   ISFTIGGKVFELKPEQYVLKVTEGPVTECISGFAALDVPPPRGPLWILGDVFMGSYHTVF  522

Query  205   DYGKMRVGFAEAA  167
             DYG  RVGFAEAA
Sbjct  523   DYGNSRVGFAEAA  535



>gb|KDO45246.1| hypothetical protein CISIN_1g010486mg [Citrus sinensis]
Length=509

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/492 (63%), Positives = 389/492 (79%), Gaps = 9/492 (2%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             S++G  RIGLKK ++D ++  AAR+  K      A V     +  R GD  D DI+ LKN
Sbjct  24    SSNGLRRIGLKKRRLDLHSLNAARITRKERYMGGAGVS---GVRHRLGD-SDEDILPLKN  79

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             +MDAQYFGEIG+G+PPQ F+VIFDTGSSNLWVPSSKCYFS+ C+FHS+Y S +S+TY + 
Sbjct  80    FMDAQYFGEIGIGSPPQNFSVIFDTGSSNLWVPSSKCYFSISCYFHSRYKSRKSNTYTEI  139

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             GKS EI+YG+GSISGFFSQD+V+VGD+VVK Q FIEAT E  +TFL+A+FDGI+GLGF+E
Sbjct  140   GKSCEINYGSGSISGFFSQDNVEVGDVVVKDQVFIEATREGSLTFLLARFDGIIGLGFRE  199

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             I+VGDA      MV QGLV + +FSFWLNR+P  +EGGE+VFGGVDPKH+KG+HTYVPVT
Sbjct  200   IAVGDAVPVWDNMVEQGLVSEEVFSFWLNRDPDAEEGGEIVFGGVDPKHFKGKHTYVPVT  259

Query  913   QKGYWQ---FDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVV  743
             +KGYWQ   F++G++LI  + TG C GGC+AI DSGTSL+AGP+ ++T INHAIG +GVV
Sbjct  260   KKGYWQVNKFELGDILIGNQSTGVCEGGCAAIVDSGTSLLAGPTPVVTEINHAIGGEGVV  319

Query  742   SKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSAD  563
             S ECK VV  YG  + DLLV    P+K+C QIGLC FNG   VS GI++VV+++N  + D
Sbjct  320   SAECKLVVSQYGDLIWDLLVSGLLPEKVCQQIGLCAFNGAEYVSTGIKTVVEKENVSAGD  379

Query  562   LHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSV  383
                A+CSACEM VVW+QNQL + QT+E +LSY+NELC+ LP+PMGES +DC ++ TMP+V
Sbjct  380   --SAVCSACEMAVVWVQNQLKQKQTKEKVLSYINELCDSLPNPMGESIIDCDRIPTMPNV  437

Query  382   SFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFD  203
             SF+IG K+F+LSP +YILK GEG A  CISGF A D+PPPRGPLWILGDVFMG YHTVFD
Sbjct  438   SFTIGDKIFNLSPEQYILKTGEGIAEVCISGFMAFDLPPPRGPLWILGDVFMGVYHTVFD  497

Query  202   YGKMRVGFAEAA  167
              GK+R+GFAEAA
Sbjct  498   SGKLRIGFAEAA  509



>gb|KDO54710.1| hypothetical protein CISIN_1g009634mg [Citrus sinensis]
Length=490

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/495 (64%), Positives = 389/495 (79%), Gaps = 44/495 (9%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AF+  NDG VRIGL+K K+D+ NR+  +  +K  +++R  VR+Y NLHG           
Sbjct  38    AFALPNDGLVRIGLRKKKLDQINRLVGQTVSKEEETMRTPVRRY-NLHG-----------  85

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
                                           SSNLWVPS+KCYFSV C+FHSKY SS SST
Sbjct  86    ------------------------------SSNLWVPSAKCYFSVSCYFHSKYKSSHSST  115

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y++NG SA I YGTG+ISGFFSQD+V+VGDLVVK+Q FIEAT E  +TFL AKFDGILGL
Sbjct  116   YKRNGTSAAIQYGTGAISGFFSQDNVKVGDLVVKNQDFIEATKEASITFLAAKFDGILGL  175

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEIS+G A      M++QGLV++P+FSFWLNR+ + +EGGE+VFGGVDP HYKGEHTY
Sbjct  176   GFQEISIGKAIPVWYNMLDQGLVKEPVFSFWLNRDIEGEEGGEIVFGGVDPDHYKGEHTY  235

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPVT+KGYWQF+MG+VLI+G+ TG+CS GC+AIADSGTSL+AGP++IIT INHAIGA GV
Sbjct  236   VPVTKKGYWQFEMGDVLIDGETTGYCSTGCNAIADSGTSLLAGPTTIITQINHAIGASGV  295

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             +S+ECK +V+ YG+ ++++L+ E +P+KICSQ+GLCTF+G RG SMGIESV+D+ +  S+
Sbjct  296   ISQECKTLVDQYGKTILEMLIAETQPQKICSQMGLCTFDGTRGFSMGIESVIDKSSDKSS  355

Query  565   D-LHD-AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             D +HD AMCSACEM V+WMQN+L  N+T + IL+YVN+LC+RLPSP GES VDC  LS+M
Sbjct  356   DGVHDSAMCSACEMAVIWMQNKLRRNETADQILNYVNQLCDRLPSPNGESAVDCDNLSSM  415

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P+VSF+IGGKVFDL+PNEY+L+VGEG AAQCISGFTA DV PPRGPLWILGDVFMGRYHT
Sbjct  416   PNVSFTIGGKVFDLAPNEYVLEVGEGVAAQCISGFTAFDVAPPRGPLWILGDVFMGRYHT  475

Query  211   VFDYGKMRVGFAEAA  167
             VFDYG + +GFAEAA
Sbjct  476   VFDYGNLSIGFAEAA  490



>ref|NP_001275049.1| Asp precursor [Solanum tuberosum]
 gb|ABB87123.1| aspartic protease precursor-like [Solanum tuberosum]
Length=506

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/493 (62%), Positives = 376/493 (76%), Gaps = 5/493 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             A   S+   +RIGLKK ++D N+  AAR+       L+    K+ N   +     D DIV
Sbjct  19    ALPASSGDLLRIGLKKHRLDVNSIKAARVA-----KLQDRYGKHVNGIEKKSSDSDIDIV  73

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              LKNY+DAQY+GEIG+G+PPQKF VIFDTGSSNLWVPSSKCYFS+ C+ HSKY +S+SST
Sbjct  74    PLKNYLDAQYYGEIGIGSPPQKFKVIFDTGSSNLWVPSSKCYFSIACWIHSKYKASKSST  133

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y ++G+S  I YGTGSISG FS D+VQVGDLVVK Q FIEAT EP +TF+VAKFDGILGL
Sbjct  134   YTRDGESCSIRYGTGSISGHFSMDNVQVGDLVVKDQVFIEATREPSITFIVAKFDGILGL  193

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISVG+       MV QGLV++ +FSFW NR+   +EGGELVFGGVDPKH+KG HTY
Sbjct  194   GFQEISVGNTTPVWYNMVGQGLVKESVFSFWFNRDANAKEGGELVFGGVDPKHFKGNHTY  253

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VP+TQKGYWQF+MG+ LI    TG+C+GGC+AI DSGTSL+AGP++I+T INHAIGA+G+
Sbjct  254   VPLTQKGYWQFNMGDFLIGNTSTGYCAGGCAAIVDSGTSLLAGPTTIVTQINHAIGAEGI  313

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             VS ECK +V  YG+ + DLLV   RP ++CSQ GLC  +G + VS  I +VV+ +   S+
Sbjct  314   VSMECKTIVSQYGEMIWDLLVSGVRPDQVCSQAGLCFVDGAQHVSSNIRTVVERETEGSS  373

Query  565   DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPS  386
                  +C+ACEM VVWMQNQL +  T+E +L YVN+LC ++PSPMGES +DC  +S+MP 
Sbjct  374   VGEAPLCTACEMAVVWMQNQLKQAGTKEKVLEYVNQLCEKIPSPMGESTIDCNSISSMPD  433

Query  385   VSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVF  206
             +SF+I  K F L+P +YILK GEG A  C+SGF ALDVPPPRGPLWILGDVFMG YHTVF
Sbjct  434   ISFTIKDKAFVLTPEQYILKTGEGVATICVSGFAALDVPPPRGPLWILGDVFMGPYHTVF  493

Query  205   DYGKMRVGFAEAA  167
             DYGK +VGFAEAA
Sbjct  494   DYGKSQVGFAEAA  506



>gb|AGE15495.1| preprosilpepsin 2 [Silybum marianum]
Length=509

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/494 (62%), Positives = 381/494 (77%), Gaps = 7/494 (1%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIV  1466
             AFS SN G +R+GLKK K+D+++++        G   + + RK +   G   D  DT I+
Sbjct  22    AFSASNGGLIRVGLKKRKVDRSDQLHG-----LGVHTKRNGRKDFGFRGTLRD-SDTGII  75

Query  1465  GLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSST  1286
              L N  D  YFGEIG+GTP Q FTVIFDTGSS+LWVPSSKCY SV C+ HS+Y SS SST
Sbjct  76    VLTNERDTTYFGEIGIGTPLQNFTVIFDTGSSDLWVPSSKCYSSVSCWVHSRYKSSDSST  135

Query  1285  YEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGL  1106
             Y++NG S  I YGTGSI+GF+SQDSV+VGDLVVK Q FIEAT E    FL A FDGILGL
Sbjct  136   YKENGTSGAIQYGTGSIAGFYSQDSVEVGDLVVKEQDFIEATKEADNVFLRAHFDGILGL  195

Query  1105  GFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTY  926
             GFQEISV  A      MV+QGLVQ+P+FSFWLNRN  E+EGGELVFGGVDP H++G HTY
Sbjct  196   GFQEISVRKAVPVWYNMVDQGLVQEPVFSFWLNRNVNEEEGGELVFGGVDPNHFRGNHTY  255

Query  925   VPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGV  746
             VPV QKG+WQFDMG+VLI  K TGFC+ GC+AIADSGT+L+ GP++I+T IN AIGA+ V
Sbjct  256   VPVIQKGHWQFDMGDVLIGDKSTGFCANGCAAIADSGTTLLTGPTAIVTQINQAIGANRV  315

Query  745   VSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSA  566
             ++++CK +V  YG+ ++ +L+ EA+P KICS + LCTF+G   VS  IESVVD KN  S+
Sbjct  316   MNQQCKTLVSRYGKNIMQMLMSEAQPDKICSHMNLCTFDGAHDVSSIIESVVDMKNDKSS  375

Query  565   -DLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
               +HD MC+ CEM VVWMQ ++  N+ ++NI++YV ELC+ LPS  GES VDC  LS+MP
Sbjct  376   GGVHDEMCTFCEMAVVWMQKEIKRNEIEDNIINYVTELCDHLPSSSGESVVDCNSLSSMP  435

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             + +F+IGGK+F+L+P +YI K+GEG AAQCISGFT +DVPPPRGPLWILGD+FMG YHTV
Sbjct  436   NTAFTIGGKIFELTPEQYIFKLGEGEAAQCISGFTTMDVPPPRGPLWILGDIFMGPYHTV  495

Query  208   FDYGKMRVGFAEAA  167
             FDYGK+RVGFAEAA
Sbjct  496   FDYGKLRVGFAEAA  509



>ref|XP_011023864.1| PREDICTED: aspartic proteinase-like [Populus euphratica]
Length=526

 Score =   645 bits (1663),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/490 (62%), Positives = 379/490 (77%), Gaps = 6/490 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             S++G VRIGLKK  +D      AR+  + G +   +  + ++L   +GD     I+ LKN
Sbjct  42    SSNGLVRIGLKKRHLDLQTIKDARIARQEGKAGVGASSRVHDLGSSDGD-----IIPLKN  96

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             Y+DAQY GEIG+G+PPQ FTVIFDTGSSNLWVPSSKCYFS+ C+FHSKY SS+SSTY KN
Sbjct  97    YLDAQYLGEIGIGSPPQNFTVIFDTGSSNLWVPSSKCYFSIACYFHSKYKSSRSSTYTKN  156

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             G   EIHYG+GS+SGFFSQD+VQVGDLVVK Q F+EAT E  ++FL+ KFDGILGLGFQE
Sbjct  157   GNFCEIHYGSGSVSGFFSQDNVQVGDLVVKDQVFVEATKEGSLSFLLGKFDGILGLGFQE  216

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISV +       M+ Q LV D +FSFWLNRNP+ ++GGELVFGGVDPKH+KG+HTYVPVT
Sbjct  217   ISVENVVPLWYNMMQQDLVDDEVFSFWLNRNPEAKDGGELVFGGVDPKHFKGKHTYVPVT  276

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQ +MG+ LI    TG C GGC+AI DSGTSL+AGP+ IIT INHAIGA+G+VS E
Sbjct  277   QKGYWQINMGDFLIGKHSTGLCEGGCAAIVDSGTSLLAGPTPIITEINHAIGAEGLVSAE  336

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLH  557
             CK VV +YG  + +L++   +P K+C+Q+GLC FNG +  S GIESVV+++N   S+  +
Sbjct  337   CKEVVSHYGDLIWELIISGVQPSKVCAQLGLCIFNGAKSASTGIESVVEKENKEKSSAGN  396

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             D  C+AC+M V+W+QNQL E  T+E  ++Y+++LC  LPSPMG+S +DC  +STMP+++F
Sbjct  397   DLPCTACQMLVIWVQNQLREKATKETAINYLDKLCESLPSPMGQSSIDCNSISTMPNITF  456

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IG K F L+P +YILK GEG A  CISGF ALDVPPPRGPLWILGDVFMG YHT+FDYG
Sbjct  457   TIGDKPFSLTPEQYILKTGEGIAQVCISGFVALDVPPPRGPLWILGDVFMGAYHTIFDYG  516

Query  196   KMRVGFAEAA  167
              + VGFAEAA
Sbjct  517   NLEVGFAEAA  526



>gb|ABR16259.1| unknown [Picea sitchensis]
Length=509

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/491 (61%), Positives = 379/491 (77%), Gaps = 3/491 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHG--RNGDLQDTDIVGL  1460
             +ND   RI LKK  +D+    AAR+ A+ G  L   V + Y L G     +    + V L
Sbjct  20    ANDCLARIELKKKGLDQKTLQAARIVAREG-GLSNEVNRKYGLRGGLSYSESARGEYVPL  78

Query  1459  KNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYE  1280
             KNY+DAQY+GEIG+GTPPQKFTVIFDTGSSNLWVPS+KCY S+ C+FHSKY +SQSS+Y 
Sbjct  79    KNYLDAQYYGEIGLGTPPQKFTVIFDTGSSNLWVPSTKCYLSIACYFHSKYKASQSSSYC  138

Query  1279  KNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGF  1100
              NGK   I YG+GS+SG+  QD V  GDLVVK Q F E T EPG+TFL AKFDGILGLGF
Sbjct  139   VNGKPFNIQYGSGSVSGYLGQDHVTAGDLVVKDQVFAEVTQEPGLTFLAAKFDGILGLGF  198

Query  1099  QEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVP  920
             Q+ISVG+       MVNQGL+++P+FSFW+NR   ++EGGE+VFGGVDP H+KG+HTYVP
Sbjct  199   QKISVGNVVPVWYNMVNQGLIKEPVFSFWMNRKVGDEEGGEIVFGGVDPNHFKGKHTYVP  258

Query  919   VTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVS  740
             VT++GYWQF+MG+ LI G+ TGFCSGGC+AI DSGTSL+AGPS I+  IN AIGA G+ S
Sbjct  259   VTREGYWQFNMGDFLIGGQSTGFCSGGCAAIVDSGTSLLAGPSGIVAQINEAIGASGLAS  318

Query  739   KECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADL  560
             +ECK+VV  YG  +++LL+ +  P+K+CSQIGLC  +G R V M I SV+++ N  ++  
Sbjct  319   QECKSVVSQYGDLIMELLMAQTNPQKVCSQIGLCLSDGTRDVGMRIASVLEKGNEATSTS  378

Query  559   HDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVS  380
                MC+ACEM VVW +NQ++ N +++ I++Y+N+LC+RLP+P G++ VDC  LS+MP+VS
Sbjct  379   SSGMCAACEMAVVWAKNQIARNASKDQIMTYLNQLCDRLPNPNGQAAVDCNNLSSMPTVS  438

Query  379   FSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDY  200
             F+IG + FDL+P++YILKVGEGSAAQCISGF  LDVPPP GP+WILGDVFMG YHTVFD+
Sbjct  439   FTIGDRSFDLTPDQYILKVGEGSAAQCISGFMGLDVPPPMGPIWILGDVFMGVYHTVFDF  498

Query  199   GKMRVGFAEAA  167
             G MRVGF EAA
Sbjct  499   GNMRVGFTEAA  509



>ref|XP_002319454.2| aspartic proteinase 2 [Populus trichocarpa]
 gb|EEE95377.2| aspartic proteinase 2 [Populus trichocarpa]
Length=507

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/490 (61%), Positives = 378/490 (77%), Gaps = 6/490 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             S++G VRIGLKK  +D      AR+  + G +   +  + ++L   +GD     I+ LKN
Sbjct  23    SSNGLVRIGLKKRHLDLQTIKDARIARQEGKAGVGASSRVHDLGSSDGD-----IIPLKN  77

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             Y+DAQY GEIG+G+PPQ FTV+FDTGSSNLWVPSSKCYFS+ C+FHSKY SS+SSTY KN
Sbjct  78    YLDAQYLGEIGIGSPPQNFTVVFDTGSSNLWVPSSKCYFSIACYFHSKYKSSRSSTYTKN  137

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             G   EIHYG+GS+SGFFSQD+VQVGDLVVK Q F+EAT E  ++F++ KFDGILGLGFQE
Sbjct  138   GNFCEIHYGSGSVSGFFSQDNVQVGDLVVKDQVFVEATKEGSLSFILGKFDGILGLGFQE  197

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG+       M+ Q LV D +FSFWLNRNP+ +EGGELVFGGVDPKH+KG+HTYVPVT
Sbjct  198   ISVGNVVPLWYNMIQQDLVDDEVFSFWLNRNPEAKEGGELVFGGVDPKHFKGKHTYVPVT  257

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQ +MG+ LI    TG C GGC+AI DSGTSL+AGP+ IIT INHAIGA+G+VS E
Sbjct  258   QKGYWQINMGDFLIGKHSTGLCEGGCAAIVDSGTSLLAGPTPIITEINHAIGAEGLVSAE  317

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNG-VSADLH  557
             CK VV +YG  + +L++   +P K+C+Q+GLC FN  +    GIESVV+++N   S+  +
Sbjct  318   CKEVVSHYGDLIWELIISGVQPSKVCTQLGLCIFNEAKSARTGIESVVEKENKEKSSAGN  377

Query  556   DAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSF  377
             D  C+AC+M V+W+QNQL E  T+E  ++Y+++LC  LPSPMG+S +DC  +STMP+++F
Sbjct  378   DLPCTACQMLVIWVQNQLREKATKETAINYLDKLCESLPSPMGQSSIDCNSISTMPNITF  437

Query  376   SIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYG  197
             +IG K F L+P +YILK GEG A  CISGF ALDVPPPRGPLWILGDVFMG YHT+FDYG
Sbjct  438   TIGDKPFSLTPEQYILKTGEGIAQVCISGFMALDVPPPRGPLWILGDVFMGAYHTIFDYG  497

Query  196   KMRVGFAEAA  167
              + VGFAEAA
Sbjct  498   NLEVGFAEAA  507



>gb|ADE74632.1| aspartic protease 1 [Nicotiana tabacum]
Length=506

 Score =   642 bits (1657),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/488 (62%), Positives = 378/488 (77%), Gaps = 5/488 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             S+D  +R+GLKK  +D N+  AAR+ A+  D    +V     +  + GD  D DIV LKN
Sbjct  23    SSDNLLRVGLKKQSLDVNSINAARV-ARLQDRYGKNVN---GIEKKLGD-SDLDIVSLKN  77

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             Y+DAQY+GEIGVG+PPQKF VIFDTGSSNLWVPSS+CYFS+ C+FHSKY +S+S+TY +N
Sbjct  78    YLDAQYYGEIGVGSPPQKFKVIFDTGSSNLWVPSSRCYFSIACWFHSKYKASKSTTYTRN  137

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             G+S  I YGTGSISG FSQD+VQVGDLVVK Q FIEAT EP +TF++AKFDGILGLGFQE
Sbjct  138   GESCSIRYGTGSISGHFSQDNVQVGDLVVKDQVFIEATREPSITFIIAKFDGILGLGFQE  197

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG+A      MV QGLV++ +FSFW+NR+   +EGGELVFGGVD  H+KG HTYVP+T
Sbjct  198   ISVGNATPVWYNMVGQGLVKEQVFSFWINRDATAKEGGELVFGGVDSNHFKGNHTYVPLT  257

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQF+MG+ LI    TG C+GGC+AI DSGTSL+AGP++++T INHAIGA+G+VS E
Sbjct  258   QKGYWQFNMGDFLIGNASTGVCAGGCAAIVDSGTSLLAGPTTVVTQINHAIGAEGIVSME  317

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHD  554
             CK +V  YG+ + +LLV   +P ++CSQ GLC FNG + VS  I +VV+ +   S+    
Sbjct  318   CKTIVSQYGEMIWNLLVSGVKPDQVCSQAGLCYFNGAQHVSSNIRTVVERETEGSSVGEA  377

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
              +C+ACEM VVWMQNQL + +T+E +L YVN+LC +LPSPMGES +DC  +S MP+++F+
Sbjct  378   PLCTACEMAVVWMQNQLKQKETKERVLEYVNQLCEKLPSPMGESVIDCSMISAMPNITFT  437

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             I  K + L+P +YILK GEG    C+SGF ALDVPPPRGPLWILGDVFMG YHTVFDYG 
Sbjct  438   IKDKAYVLTPEQYILKTGEGITTICMSGFAALDVPPPRGPLWILGDVFMGVYHTVFDYGN  497

Query  193   MRVGFAEA  170
              R+GFAEA
Sbjct  498   SRLGFAEA  505



>ref|XP_009608676.1| PREDICTED: cyprosin-like [Nicotiana tomentosiformis]
Length=506

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/488 (62%), Positives = 379/488 (78%), Gaps = 5/488 (1%)
 Frame = -2

Query  1633  SNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDIVGLKN  1454
             S+D  +R+GLKK  +D N+  AAR+ A+  D    +V     +  + GD  D D+V LKN
Sbjct  23    SSDNLLRVGLKKQPLDVNSINAARV-ARLQDRYGKNVN---GIEKKLGD-SDLDVVSLKN  77

Query  1453  YMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSSTYEKN  1274
             Y+DAQY+GEIGVG+PPQKF VIFDTGSSNLWVPSS+CYFS+ C+FHSKY +S+S+TY +N
Sbjct  78    YLDAQYYGEIGVGSPPQKFKVIFDTGSSNLWVPSSRCYFSIACWFHSKYKASKSTTYTRN  137

Query  1273  GKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILGLGFQE  1094
             G+S  I YGTGSISG FSQD+VQVGDLVVK Q FIEAT EP +TF++AKFDGILGLGFQE
Sbjct  138   GESCSIRYGTGSISGHFSQDNVQVGDLVVKDQVFIEATREPSITFIIAKFDGILGLGFQE  197

Query  1093  ISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHTYVPVT  914
             ISVG+A      MV QGLV++ +FSFW+NR+   +EGGELVFGGV+  H+KG HTYVP+T
Sbjct  198   ISVGNATPVWYNMVGQGLVKEQVFSFWINRDATAKEGGELVFGGVNSNHFKGNHTYVPLT  257

Query  913   QKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADGVVSKE  734
             QKGYWQF+MG+ LI    TG C+GGC+AI DSGTSL+AGP++++T INHAIGA+G+VS E
Sbjct  258   QKGYWQFNMGDFLIGNASTGVCAGGCAAIVDSGTSLLAGPTTVVTQINHAIGAEGIVSME  317

Query  733   CKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVSADLHD  554
             CK +V  YG+ + +LLV   +P ++CSQ GLC FNG + VS  I +VV+ +   S+    
Sbjct  318   CKTIVSQYGEMIWNLLVSGVKPDQVCSQAGLCYFNGAQHVSSNIRTVVERETEGSSVGEA  377

Query  553   AMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMPSVSFS  374
              +C+ACEM VVWMQNQL + +T+E +L YVN+LC +LPSPMGES +DC  +S MP+++F+
Sbjct  378   PLCTACEMAVVWMQNQLKQKETKERVLEYVNQLCEKLPSPMGESVIDCSMISAMPNITFT  437

Query  373   IGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTVFDYGK  194
             I  K + L+P +YILK GEG A  CISGF ALDVPPPRGPLWILGDVFMG YHTVFDYG 
Sbjct  438   IKDKAYVLTPEQYILKTGEGIATICISGFAALDVPPPRGPLWILGDVFMGVYHTVFDYGN  497

Query  193   MRVGFAEA  170
              R+GFAEA
Sbjct  498   SRLGFAEA  505



>gb|AAC34854.1| senescence-associated protein 4 [Hemerocallis hybrid cultivar]
Length=517

 Score =   642 bits (1656),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/471 (66%), Positives = 371/471 (79%), Gaps = 8/471 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQD-TDI  1469
             A S S +G VRI LKK   D+ +R+++RL A   + L+A     Y L G   D  D TDI
Sbjct  22    ALSASAEGLVRINLKKKPFDEKSRVSSRLSADEDEPLKAR----YGLRGGLNDGADSTDI  77

Query  1468  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSS  1289
             + LKNYM+AQYFGEIGVGTPPQKFTVIFDTGSSNLWVPS+KCYFS+ C  H+KY S +SS
Sbjct  78    ISLKNYMNAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSAKCYFSIACLLHTKYKSGRSS  137

Query  1288  TYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILG  1109
             TY KNGK A IHYGTG+I+G+FS+D V++GD VVK Q FIEAT EPGVTFLVAKFDGILG
Sbjct  138   TYHKNGKPAAIHYGTGAIAGYFSEDHVELGDFVVKGQEFIEATKEPGVTFLVAKFDGILG  197

Query  1108  LGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHT  929
             LGF+EISVG A      MV QGLV++ +FSFWLNR  ++ EGGE+VFGGVDP H+KGEH 
Sbjct  198   LGFKEISVGGAVPLWYNMVEQGLVKEAVFSFWLNRKSEDGEGGEIVFGGVDPSHHKGEHV  257

Query  928   YVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADG  749
             YVPVTQKGYWQFDMG+VL+ G+ TGFC GGC+AIADSGTSLIAGP+++IT INH IGA G
Sbjct  258   YVPVTQKGYWQFDMGDVLVGGQSTGFCEGGCAAIADSGTSLIAGPTTVITEINHKIGAAG  317

Query  748   VVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS  569
             VVS+ECKAVV+ YGQ+++D+L+ + +P KICSQIGLCTF+G RGVSMGIESVV+  N   
Sbjct  318   VVSQECKAVVQQYGQQILDMLIAQTQPMKICSQIGLCTFDGTRGVSMGIESVVN-GNVDK  376

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
             +   DAMCSACEM VVWMQNQ+  N+TQ+ IL+Y+N+LC RLPSPMGES VDC  LSTMP
Sbjct  377   SVASDAMCSACEMAVVWMQNQIKHNKTQDLILNYINQLCERLPSPMGESAVDCSVLSTMP  436

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGP--LWIL  242
             S+SF+IGGK FDL+  +Y+LKVGEG AAQCI     L     RG    W++
Sbjct  437   SISFTIGGKQFDLTAEQYVLKVGEGPAAQCIKWIHCLGHSSSRGHSGYWVM  487



>ref|NP_001234702.1| aspartic protease precursor [Solanum lycopersicum]
 gb|AAB18280.1| aspartic protease precursor [Solanum lycopersicum]
Length=506

 Score =   641 bits (1654),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/495 (62%), Positives = 380/495 (77%), Gaps = 9/495 (2%)
 Frame = -2

Query  1645  AFSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTDI-  1469
             A   S+    RIGLKK ++D ++  AAR+ AK  D      R   +++G      D+DI 
Sbjct  19    ALPASSGDLFRIGLKKHRLDVDSIKAARV-AKLQD------RYGKHVNGIEKKSSDSDIY  71

Query  1468  -VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQS  1292
              V LKNY+DAQY+GEIG+G+PPQKF VIFDTGSSNLWVPSSKCYFS+ C+ HSKY +S+S
Sbjct  72    KVPLKNYLDAQYYGEIGIGSPPQKFKVIFDTGSSNLWVPSSKCYFSIACWIHSKYQASKS  131

Query  1291  STYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGIL  1112
             STY ++G+S  I YGTGSISG FS D+VQVGDLVVK Q FIEAT EP +TF+VAKFDGIL
Sbjct  132   STYTRDGESCSIRYGTGSISGHFSMDNVQVGDLVVKDQVFIEATREPSITFIVAKFDGIL  191

Query  1111  GLGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEH  932
             GLGFQEISVG+       MV QGLV++P+FSFW NR+   +EGGELVFGGVDPKH+KG H
Sbjct  192   GLGFQEISVGNTTPVWYNMVGQGLVKEPVFSFWFNRDANAKEGGELVFGGVDPKHFKGNH  251

Query  931   TYVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGAD  752
             T VP+TQKGYWQF+MG+ LI    TG+C+GGC+AI DSGTSL+AGP++I+T INHAIGA+
Sbjct  252   TCVPLTQKGYWQFNMGDFLIGNTSTGYCAGGCAAIVDSGTSLLAGPTTIVTQINHAIGAE  311

Query  751   GVVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGV  572
             G+VS ECK +V  YG+ + DLLV   RP ++CSQ GLC  +G++ VS  I +VV+ +   
Sbjct  312   GIVSMECKTIVSQYGEMIWDLLVSGIRPDQVCSQAGLCFLDGSQHVSSNIRTVVERETEG  371

Query  571   SADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTM  392
             S+     +C+ACEM VVWMQNQL + QT+E +L YVN+LC ++PSPMGES +DC ++S+M
Sbjct  372   SSVGEAPLCTACEMAVVWMQNQLKQEQTKEKVLEYVNQLCEKIPSPMGESAIDCNRISSM  431

Query  391   PSVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHT  212
             P ++F+I    F L+P +YILK GEG A  C+SGF ALDVPPPRGPLWILGDVFMG YHT
Sbjct  432   PDITFTIKDTAFVLTPEQYILKTGEGVATICVSGFAALDVPPPRGPLWILGDVFMGPYHT  491

Query  211   VFDYGKMRVGFAEAA  167
             VFDYGK +VGFAEAA
Sbjct  492   VFDYGKSQVGFAEAA  506



>ref|XP_009801963.1| PREDICTED: cyprosin-like [Nicotiana sylvestris]
Length=506

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/493 (61%), Positives = 377/493 (76%), Gaps = 9/493 (2%)
 Frame = -2

Query  1642  FSKSNDGFVRIGLKKMKIDKNNRIAARLEAKAGDSLRASVRKYYNLHGRNGDLQDTD--I  1469
              S S +  +R+GLKK  +D N+  AAR+        R   R   N++G    L D+D  I
Sbjct  20    LSASCENLLRVGLKKQPLDVNSINAARVA-------RQQDRYGKNMNGIEKKLGDSDLDI  72

Query  1468  VGLKNYMDAQYFGEIGVGTPPQKFTVIFDTGSSNLWVPSSKCYFSVPCFFHSKYTSSQSS  1289
             V LKNY+DAQY+GEIGVG+PPQKF VIFDTGSSNLWVPSS+CYFS+ C+ HSKY + +SS
Sbjct  73    VSLKNYLDAQYYGEIGVGSPPQKFKVIFDTGSSNLWVPSSRCYFSIACWIHSKYKAGKSS  132

Query  1288  TYEKNGKSAEIHYGTGSISGFFSQDSVQVGDLVVKSQAFIEATSEPGVTFLVAKFDGILG  1109
             TY +NG+S  I YGTGSISG FSQD+VQVGDLVVK Q FIEAT EP +TF++AKFDGILG
Sbjct  133   TYTRNGESCSIRYGTGSISGHFSQDNVQVGDLVVKDQVFIEATREPSITFIIAKFDGILG  192

Query  1108  LGFQEISVGDAXXXXXXMVNQGLVQDPIFSFWLNRNPQEQEGGELVFGGVDPKHYKGEHT  929
             LGFQEISVG+A      M+ QGLV++P+FSFW+NR+   +EGGELVFGGVD  H+KG HT
Sbjct  193   LGFQEISVGNATPVWYNMMGQGLVKEPVFSFWINRDATAKEGGELVFGGVDSNHFKGNHT  252

Query  928   YVPVTQKGYWQFDMGEVLIEGKPTGFCSGGCSAIADSGTSLIAGPSSIITMINHAIGADG  749
             YVP+TQKGYWQF+MG+ LI    TG C+GGC+AI DSGTSL+AGP++++T INHAIGA+G
Sbjct  253   YVPLTQKGYWQFNMGDFLIGNASTGVCAGGCAAIVDSGTSLLAGPTTVVTQINHAIGAEG  312

Query  748   VVSKECKAVVENYGQRMIDLLVMEARPKKICSQIGLCTFNGNRGVSMGIESVVDEKNGVS  569
             VVS ECK +V  YG+ + +LLV   +P ++CSQ GLC F+G + VS  I SVV+ +   S
Sbjct  313   VVSMECKTIVSQYGEMIWNLLVSGVKPDQVCSQAGLCYFSGAQHVSSNIRSVVERETEGS  372

Query  568   ADLHDAMCSACEMTVVWMQNQLSENQTQENILSYVNELCNRLPSPMGESGVDCGKLSTMP  389
             +     +C+ACEM VVWMQNQL + +T+E +L YVN+LC +LPSPMGES +DC  +S MP
Sbjct  373   SVGEAPLCTACEMAVVWMQNQLKQKETKERVLEYVNQLCEKLPSPMGESVIDCSMISAMP  432

Query  388   SVSFSIGGKVFDLSPNEYILKVGEGSAAQCISGFTALDVPPPRGPLWILGDVFMGRYHTV  209
             +++F+I  K + L+P +YILK+GEG    C+SGF ALDVPPPRGPLWILGDVFMG YHTV
Sbjct  433   NITFTIKDKAYVLTPEQYILKIGEGITTICMSGFAALDVPPPRGPLWILGDVFMGVYHTV  492

Query  208   FDYGKMRVGFAEA  170
             FDYG  R+GFAEA
Sbjct  493   FDYGNSRLGFAEA  505



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5719555223345