BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9612

Length=793
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009606938.1|  PREDICTED: chlorophyll synthase, chloroplastic     272   1e-85   Nicotiana tomentosiformis
gb|EYU41922.1|  hypothetical protein MIMGU_mgv1a007461mg                273   1e-85   Erythranthe guttata [common monkey flower]
ref|XP_008243417.1|  PREDICTED: chlorophyll synthase, chloroplastic     272   1e-85   Prunus mume [ume]
gb|EYU41923.1|  hypothetical protein MIMGU_mgv1a007461mg                273   1e-85   Erythranthe guttata [common monkey flower]
gb|ACQ44245.1|  chlorophyll synthase                                    272   1e-85   Nicotiana tabacum [American tobacco]
ref|XP_009762729.1|  PREDICTED: chlorophyll synthase, chloroplastic     271   1e-85   Nicotiana sylvestris
ref|XP_006366338.1|  PREDICTED: chlorophyll synthase, chloroplast...    271   2e-85   Solanum tuberosum [potatoes]
gb|AJB84630.1|  chlorophyll synthase                                    269   1e-84   Camellia sinensis [black tea]
gb|AEI83422.1|  chlorophyll synthase                                    269   1e-84   Camellia sinensis [black tea]
ref|XP_004148612.1|  PREDICTED: chlorophyll synthase, chloroplastic     269   1e-84   Cucumis sativus [cucumbers]
gb|ACQ44244.1|  chlorophyll synthase                                    269   2e-84   Nicotiana tabacum [American tobacco]
ref|XP_011019083.1|  PREDICTED: chlorophyll synthase, chloroplast...    269   2e-84   Populus euphratica
ref|XP_008464210.1|  PREDICTED: chlorophyll synthase, chloroplastic     269   2e-84   Cucumis melo [Oriental melon]
gb|KHN18037.1|  Chlorophyll synthase, chloroplastic                     268   5e-84   Glycine soja [wild soybean]
ref|NP_001239633.1|  uncharacterized protein LOC100787459               267   7e-84   Glycine max [soybeans]
ref|XP_004246318.1|  PREDICTED: chlorophyll synthase, chloroplastic     267   8e-84   Solanum lycopersicum
ref|XP_009338147.1|  PREDICTED: chlorophyll synthase, chloroplast...    267   1e-83   Pyrus x bretschneideri [bai li]
emb|CDP06461.1|  unnamed protein product                                267   1e-83   Coffea canephora [robusta coffee]
ref|XP_009348552.1|  PREDICTED: chlorophyll synthase, chloroplast...    267   1e-83   Pyrus x bretschneideri [bai li]
gb|KHN42901.1|  Chlorophyll synthase, chloroplastic                     266   2e-83   Glycine soja [wild soybean]
ref|XP_009115884.1|  PREDICTED: chlorophyll synthase, chloroplast...    266   2e-83   Brassica rapa
ref|XP_006403878.1|  hypothetical protein EUTSA_v10010408mg             268   2e-83   
ref|XP_011095035.1|  PREDICTED: chlorophyll synthase, chloroplastic     266   2e-83   Sesamum indicum [beniseed]
ref|XP_011004741.1|  PREDICTED: chlorophyll synthase, chloroplast...    264   2e-83   Populus euphratica
ref|XP_009115885.1|  PREDICTED: chlorophyll synthase, chloroplast...    266   2e-83   Brassica rapa
ref|XP_002308227.1|  chlorophyll synthetase family protein              266   2e-83   Populus trichocarpa [western balsam poplar]
gb|KFK34425.1|  hypothetical protein AALP_AA5G143300                    266   3e-83   Arabis alpina [alpine rockcress]
ref|XP_002530507.1|  bacteriochlorophyll synthase, putative             265   3e-83   
ref|XP_010515617.1|  PREDICTED: chlorophyll synthase, chloroplast...    266   3e-83   Camelina sativa [gold-of-pleasure]
ref|XP_004302558.1|  PREDICTED: chlorophyll synthase, chloroplastic     266   3e-83   Fragaria vesca subsp. vesca
gb|EEC79019.1|  hypothetical protein OsI_19554                          265   3e-83   Oryza sativa Indica Group [Indian rice]
ref|XP_011004739.1|  PREDICTED: chlorophyll synthase, chloroplast...    266   3e-83   Populus euphratica
emb|CDX78042.1|  BnaA09g32370D                                          266   3e-83   
emb|CDX73689.1|  BnaC08g23140D                                          266   4e-83   
ref|XP_010503882.1|  PREDICTED: chlorophyll synthase, chloroplast...    266   4e-83   Camelina sativa [gold-of-pleasure]
gb|KDO56701.1|  hypothetical protein CISIN_1g017282mg                   265   4e-83   Citrus sinensis [apfelsine]
ref|XP_010426759.1|  PREDICTED: chlorophyll synthase, chloroplastic     266   4e-83   Camelina sativa [gold-of-pleasure]
ref|XP_006429429.1|  hypothetical protein CICLE_v10011985mg             265   4e-83   Citrus clementina [clementine]
ref|XP_010515616.1|  PREDICTED: chlorophyll synthase, chloroplast...    266   4e-83   Camelina sativa [gold-of-pleasure]
ref|NP_001055272.1|  Os05g0349700                                       265   5e-83   
ref|XP_006292505.1|  hypothetical protein CARUB_v10018735mg             266   5e-83   Capsella rubella
gb|KHN20314.1|  Chlorophyll synthase, chloroplastic                     265   5e-83   Glycine soja [wild soybean]
ref|XP_003552261.1|  PREDICTED: chlorophyll synthase, chloroplast...    265   6e-83   Glycine max [soybeans]
ref|NP_190750.1|  chlorophyll synthase                                  265   8e-83   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877826.1|  ATG4/CHLG/G4                                       265   8e-83   Arabidopsis lyrata subsp. lyrata
ref|XP_003547859.1|  PREDICTED: chlorophyll synthase, chloroplast...    265   9e-83   
ref|XP_009123759.1|  PREDICTED: chlorophyll synthase, chloroplastic     265   1e-82   Brassica rapa
ref|XP_003547860.1|  PREDICTED: chlorophyll synthase, chloroplast...    263   1e-82   
ref|XP_002263271.1|  PREDICTED: chlorophyll synthase, chloroplastic     264   1e-82   Vitis vinifera
gb|KJB76988.1|  hypothetical protein B456_012G116000                    264   2e-82   Gossypium raimondii
gb|KJB76987.1|  hypothetical protein B456_012G116000                    264   2e-82   Gossypium raimondii
gb|KJB76985.1|  hypothetical protein B456_012G116000                    264   2e-82   Gossypium raimondii
ref|XP_008388266.1|  PREDICTED: chlorophyll synthase, chloroplast...    263   5e-82   
emb|CDY16289.1|  BnaC01g23240D                                          263   5e-82   Brassica napus [oilseed rape]
ref|NP_001142204.1|  hypothetical protein                               261   1e-81   Zea mays [maize]
ref|XP_010264596.1|  PREDICTED: chlorophyll synthase, chloroplast...    261   2e-81   Nelumbo nucifera [Indian lotus]
ref|XP_009376426.1|  PREDICTED: chlorophyll synthase, chloroplast...    261   2e-81   Pyrus x bretschneideri [bai li]
ref|XP_009376427.1|  PREDICTED: chlorophyll synthase, chloroplast...    261   3e-81   Pyrus x bretschneideri [bai li]
ref|XP_010264595.1|  PREDICTED: chlorophyll synthase, chloroplast...    261   3e-81   Nelumbo nucifera [Indian lotus]
gb|ADK95060.1|  chloroplast chlorophyll synthase                        261   3e-81   Gossypium hirsutum [American cotton]
gb|KHG08192.1|  Chlorophyll synthase, chloroplastic -like protein       260   4e-81   Gossypium arboreum [tree cotton]
gb|EPS69266.1|  hypothetical protein M569_05500                         260   4e-81   Genlisea aurea
ref|XP_008362312.1|  PREDICTED: chlorophyll synthase, chloroplast...    260   5e-81   Malus domestica [apple tree]
ref|XP_008362316.1|  PREDICTED: chlorophyll synthase, chloroplast...    260   6e-81   Malus domestica [apple tree]
ref|XP_007205301.1|  hypothetical protein PRUPE_ppa006764mg             260   6e-81   
gb|KEH23213.1|  bacteriochlorophyll synthase, putative                  259   1e-80   Medicago truncatula
gb|KEH23212.1|  bacteriochlorophyll synthase, putative                  259   1e-80   Medicago truncatula
gb|ABR18193.1|  unknown                                                 259   1e-80   Picea sitchensis
gb|ACN41022.1|  unknown                                                 259   1e-80   Picea sitchensis
ref|XP_008792890.1|  PREDICTED: chlorophyll synthase, chloroplastic     258   2e-80   Phoenix dactylifera
ref|XP_006655220.1|  PREDICTED: chlorophyll synthase, chloroplast...    257   2e-80   
ref|XP_009421398.1|  PREDICTED: chlorophyll synthase, chloroplastic     258   4e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009348553.1|  PREDICTED: chlorophyll synthase, chloroplast...    257   5e-80   
ref|XP_009338148.1|  PREDICTED: chlorophyll synthase, chloroplast...    257   5e-80   
ref|XP_006843631.1|  PREDICTED: chlorophyll synthase, chloroplastic     258   6e-80   Amborella trichopoda
ref|XP_010920818.1|  PREDICTED: chlorophyll synthase, chloroplastic     257   9e-80   Elaeis guineensis
ref|XP_010253787.1|  PREDICTED: chlorophyll synthase, chloroplast...    257   2e-79   Nelumbo nucifera [Indian lotus]
ref|XP_010253788.1|  PREDICTED: chlorophyll synthase, chloroplast...    255   2e-79   Nelumbo nucifera [Indian lotus]
ref|XP_004492465.1|  PREDICTED: chlorophyll synthase, chloroplast...    255   5e-79   
ref|XP_004492466.1|  PREDICTED: chlorophyll synthase, chloroplast...    255   6e-79   Cicer arietinum [garbanzo]
ref|XP_010528999.1|  PREDICTED: chlorophyll synthase, chloroplastic     255   6e-79   Tarenaya hassleriana [spider flower]
ref|XP_012089823.1|  PREDICTED: chlorophyll synthase, chloroplastic     254   1e-78   Jatropha curcas
ref|XP_007026650.1|  UbiA prenyltransferase family protein isoform 2    254   2e-78   
ref|XP_002322990.2|  chlorophyll synthetase family protein              250   6e-78   
gb|KJB76986.1|  hypothetical protein B456_012G116000                    252   9e-78   Gossypium raimondii
gb|KCW88147.1|  hypothetical protein EUGRSUZ_A00535                     249   6e-77   Eucalyptus grandis [rose gum]
ref|XP_010032647.1|  PREDICTED: chlorophyll synthase, chloroplastic     249   7e-77   Eucalyptus grandis [rose gum]
ref|XP_007140250.1|  hypothetical protein PHAVU_008G096500g             247   5e-76   Phaseolus vulgaris [French bean]
ref|XP_010676771.1|  PREDICTED: chlorophyll synthase, chloroplastic     245   4e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002440929.1|  hypothetical protein SORBIDRAFT_09g016840          244   7e-75   Sorghum bicolor [broomcorn]
ref|XP_004971327.1|  PREDICTED: chlorophyll synthase, chloroplast...    244   9e-75   Setaria italica
ref|XP_007026649.1|  UbiA prenyltransferase family protein isoform 1    239   1e-72   
ref|XP_003568641.1|  PREDICTED: chlorophyll synthase, chloroplastic     238   3e-72   Brachypodium distachyon [annual false brome]
sp|Q9M3W5.1|CHLG_AVESA  RecName: Full=Chlorophyll synthase, chlor...    237   6e-72   Avena sativa [cultivated oat]
ref|XP_001752661.1|  predicted protein                                  225   9e-68   
gb|ADI46575.1|  chlorophyll synthase subunit G                          218   5e-66   Vaucheria litorea
ref|XP_003058729.1|  chlorophyll synthetase                             220   1e-65   Micromonas pusilla CCMP1545
ref|XP_002503017.1|  chlorophyll synthetase                             220   2e-65   Micromonas commoda
ref|XP_005650372.1|  chlorophyll synthase                               220   3e-65   Coccomyxa subellipsoidea C-169
gb|AAP79186.1|  chlorophyll synthetase                                  222   6e-65   Bigelowiella natans
ref|XP_005849286.1|  hypothetical protein CHLNCDRAFT_34863              218   2e-64   Chlorella variabilis
ref|XP_005718121.1|  chlorophyll a synthase                             216   2e-64   Chondrus crispus [carageen]
emb|CBJ27235.1|  Chlorophyll synthase, putative chloroplast precu...    215   3e-63   Ectocarpus siliculosus
ref|XP_001701588.1|  chlorophyll synthetase                             213   1e-62   Chlamydomonas reinhardtii
emb|CEG01395.1|  UbiA prenyltransferase family                          212   3e-62   Ostreococcus tauri
ref|XP_002949134.1|  hypothetical protein VOLCADRAFT_80530              211   3e-62   Volvox carteri f. nagariensis
ref|XP_005822237.1|  Chl synthetase                                     209   4e-61   Guillardia theta CCMP2712
ref|XP_007513709.1|  bacteriochlorophyll/chlorophyll a synthase         209   6e-61   Bathycoccus prasinos
ref|XP_001419298.1|  predicted protein                                  205   2e-60   Ostreococcus lucimarinus CCE9901
ref|XP_002985965.1|  hypothetical protein SELMODRAFT_424937             207   2e-60   
ref|WP_041443765.1|  chitin-binding protein                             205   4e-60   Synechococcus
ref|WP_015170443.1|  chlorophyll synthase                               205   6e-60   Geitlerinema sp. PCC 7407
gb|ACA98555.1|  chlorophyll synthase, ChlG                              204   1e-59   Synechococcus sp. PCC 7002
ref|WP_024545961.1|  chitin-binding protein                             204   1e-59   Synechococcus sp. NKBG15041c
dbj|BAD80199.1|  chlorophyll a synthase                                 201   3e-59   Synechococcus elongatus PCC 6301
gb|EMT28841.1|  Chlorophyll synthase, chloroplastic                     209   3e-59   
ref|WP_012161617.1|  chitin-binding protein                             202   4e-59   Acaryochloris marina
ref|WP_011378308.1|  MULTISPECIES: chitin-binding protein               202   6e-59   Synechococcus
ref|WP_011057379.1|  chitin-binding protein                             201   2e-58   Thermosynechococcus elongatus
ref|XP_009040163.1|  hypothetical protein AURANDRAFT_54854              202   3e-58   Aureococcus anophagefferens
gb|AFY38262.1|  chlorophyll synthase                                    199   5e-58   Leptolyngbya sp. PCC 7376
ref|WP_026787959.1|  MULTISPECIES: chitin-binding protein               199   6e-58   Planktothrix
ref|WP_027249928.1|  chitin-binding protein                             199   6e-58   Planktothrix agardhii
ref|WP_041765408.1|  chitin-binding protein                             199   6e-58   
ref|WP_010482257.1|  chitin-binding protein                             199   7e-58   Acaryochloris sp. CCMEE 5410
ref|WP_006633316.1|  chitin-binding protein                             199   8e-58   Microcoleus vaginatus
ref|WP_024124597.1|  chlorophyll a synthase ChlG                        199   1e-57   Thermosynechococcus sp. NK55a
ref|WP_015219607.1|  chlorophyll synthase                               198   1e-57   Cyanobacterium aponinum
ref|WP_023073156.1|  chlorophyll synthase                               198   2e-57   Leptolyngbya sp. Heron Island J
ref|WP_044198109.1|  chitin-binding protein                             198   2e-57   
gb|AFY85093.1|  chlorophyll synthase                                    198   3e-57   Oscillatoria acuminata PCC 6304
ref|WP_015174728.1|  chlorophyll synthase                               197   3e-57   Oscillatoria nigro-viridis
ref|WP_041462639.1|  chitin-binding protein                             198   3e-57   Cyanobacteria [blue-green bacteria]
ref|WP_039715227.1|  chitin-binding protein                             197   3e-57   
ref|WP_006457120.1|  chitin-binding protein                             197   4e-57   Synechococcus sp. PCC 7335
ref|WP_010873507.1|  chitin-binding protein                             197   4e-57   Synechocystis
ref|WP_012595181.1|  chitin-binding protein                             197   5e-57   Cyanothece sp. PCC 8801
gb|AFY90621.1|  chlorophyll synthase                                    197   5e-57   Chroococcidiopsis thermalis PCC 7203
ref|WP_006517291.1|  chlorophyll synthase                               197   5e-57   Leptolyngbya sp. PCC 7375
ref|WP_019508778.1|  chitin-binding protein                             196   6e-57   Pleurocapsa sp. PCC 7319
ref|WP_015783871.1|  chitin-binding protein                             196   6e-57   Cyanothece sp. PCC 8802
ref|WP_041238043.1|  chitin-binding protein                             197   7e-57   
ref|WP_006619293.1|  chitin-binding protein                             196   7e-57   Arthrospira platensis
ref|WP_007356666.1|  MULTISPECIES: chitin-binding protein               196   8e-57   Kamptonema
gb|ACK69684.1|  chlorophyll synthase, ChlG                              196   8e-57   Cyanothece sp. PCC 7424
ref|WP_006625329.1|  MULTISPECIES: chitin-binding protein               196   9e-57   Arthrospira
ref|WP_015131375.1|  chlorophyll synthase                               196   9e-57   Calothrix sp. PCC 7507
ref|WP_015193819.1|  chlorophyll synthase                               196   1e-56   Stanieria cyanosphaera
ref|XP_002180392.1|  predicted protein                                  198   2e-56   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_017300287.1|  chitin-binding protein                             196   2e-56   Nodosilinea nodulosa
ref|WP_017713266.1|  chitin-binding protein                             194   5e-56   Prochlorothrix hollandica
ref|WP_045869649.1|  chitin-binding protein                             194   5e-56   Nostocales
ref|WP_041933762.1|  chitin-binding protein                             194   5e-56   
gb|ADN15009.1|  bacteriochlorophyll/chlorophyll synthetase              194   6e-56   Cyanothece sp. PCC 7822
ref|WP_023069149.1|  chlorophyll synthase ChlG                          194   8e-56   Lyngbya aestuarii
ref|XP_005706451.1|  chlorophyll synthase                               195   9e-56   Galdieria sulphuraria
dbj|BAQ60651.1|  chlorophyll a synthase ChlG                            193   1e-55   Geminocystis sp. NIES-3708
ref|WP_028090839.1|  chitin-binding protein                             194   1e-55   Dolichospermum circinale
ref|WP_041234707.1|  chitin-binding protein                             193   1e-55   
ref|WP_028083999.1|  chitin-binding protein                             194   1e-55   Dolichospermum circinale
gb|AFZ46570.1|  chlorophyll synthase                                    193   1e-55   Cyanobacterium stanieri PCC 7202
ref|WP_015206937.1|  chlorophyll synthase                               193   1e-55   Cylindrospermum stagnale
ref|WP_016953206.1|  chitin-binding protein                             193   1e-55   Anabaena sp. PCC 7108
dbj|BAQ66905.1|  chlorophyll a synthase ChlG                            193   1e-55   Geminocystis sp. NIES-3709
ref|WP_015125859.1|  chlorophyll synthase                               193   1e-55   Synechococcus sp. PCC 6312
ref|WP_009344052.1|  chitin-binding protein                             193   2e-55   Raphidiopsis brookii
ref|WP_009783796.1|  chitin-binding protein                             192   2e-55   Lyngbya sp. PCC 8106
ref|WP_010998613.1|  chitin-binding protein                             193   2e-55   Nostocaceae
ref|WP_017293898.1|  chitin-binding protein                             192   2e-55   Geminocystis herdmanii
ref|WP_015079848.1|  chlorophyll synthase                               193   2e-55   Anabaena sp. 90
ref|WP_017655867.1|  chitin-binding protein                             193   2e-55   Fortiea contorta
ref|WP_035152982.1|  chitin-binding protein                             192   2e-55   Calothrix sp. 336/3
ref|WP_011320065.1|  chitin-binding protein                             192   2e-55   Trichormus variabilis
ref|WP_039729123.1|  MULTISPECIES: chitin-binding protein               192   2e-55   Lyngbya confervoides
gb|EKF03432.1|  chlorophyll synthase                                    194   3e-55   Tolypothrix sp. PCC 7601
ref|WP_043695934.1|  chitin-binding protein                             191   3e-55   Synechococcus sp. KORDI-49
ref|XP_002289474.1|  predicted protein                                  194   3e-55   Thalassiosira pseudonana CCMP1335
ref|WP_015111698.1|  chlorophyll synthase                               192   4e-55   Nostoc sp. PCC 7107
ref|WP_015185029.1|  chlorophyll synthase                               191   4e-55   Microcoleus sp. PCC 7113
ref|WP_028946405.1|  chitin-binding protein                             191   5e-55   Synechocystis sp. PCC 6714
ref|WP_043326699.1|  chitin-binding protein                             191   6e-55   
ref|WP_036487712.1|  chitin-binding protein                             191   6e-55   Myxosarcina sp. GI1
ref|WP_002802683.1|  chitin-binding protein                             191   6e-55   Microcystis aeruginosa
ref|WP_002781907.1|  Genome sequencing data, contig C311                191   7e-55   Microcystis aeruginosa
ref|WP_024970493.1|  chitin-binding protein                             191   7e-55   Microcystis aeruginosa
ref|WP_004158757.1|  chitin-binding protein                             191   7e-55   Microcystis aeruginosa
ref|WP_045361424.1|  chitin-binding protein                             191   7e-55   Microcystis aeruginosa
ref|WP_008196576.1|  chitin-binding protein                             191   7e-55   Microcystis sp. T1-4
ref|WP_017288009.1|  chitin-binding protein                             191   7e-55   Leptolyngbya boryana
ref|WP_027404157.1|  chitin-binding protein                             191   7e-55   Aphanizomenon flos-aquae
ref|WP_043369672.1|  chitin-binding protein                             190   8e-55   
ref|WP_043705085.1|  chitin-binding protein                             190   1e-54   
gb|EJK49881.1|  hypothetical protein THAOC_31201                        193   1e-54   Thalassiosira oceanica
gb|AFY28552.1|  chlorophyll synthase, ChlG                              191   1e-54   Cyanobium gracile PCC 6307
ref|WP_017304623.1|  chitin-binding protein                             190   1e-54   Spirulina subsalsa
ref|WP_002789018.1|  chitin-binding protein                             190   1e-54   Microcystis aeruginosa
ref|WP_002766585.1|  chitin-binding protein                             190   1e-54   Microcystis aeruginosa
ref|WP_040896611.1|  chitin-binding protein                             190   1e-54   
ref|WP_002742486.1|  chlorophyll synthase, ChlG                         190   1e-54   Microcystis aeruginosa
gb|ELS04995.1|  chlorophyll synthase                                    190   1e-54   Xenococcus sp. PCC 7305
ref|WP_004266754.1|  chitin-binding protein                             190   1e-54   Microcystis aeruginosa
gb|EDY39225.1|  chlorophyll synthase, ChlG                              190   2e-54   Cyanobium sp. PCC 7001
ref|WP_035986122.1|  chitin-binding protein                             191   2e-54   Leptolyngbya sp. KIOST-1
ref|WP_002776168.1|  chitin-binding protein                             190   2e-54   Microcystis aeruginosa
ref|WP_043717019.1|  chitin-binding protein                             189   2e-54   
ref|WP_015202439.1|  chlorophyll synthase                               190   2e-54   Crinalium epipsammum
ref|WP_011933674.1|  chitin-binding protein                             189   2e-54   Synechococcus sp. WH 7803
ref|WP_040934684.1|  chitin-binding protein                             190   2e-54   
ref|XP_005767761.1|  hypothetical protein EMIHUDRAFT_421924             190   2e-54   Emiliania huxleyi CCMP1516
ref|WP_008318168.1|  chlorophyll synthase                               190   3e-54   Leptolyngbya sp. PCC 6406
ref|WP_040943923.1|  chitin-binding protein                             190   3e-54   
ref|WP_040939572.1|  chitin-binding protein                             189   3e-54   
ref|WP_042503728.1|  chitin-binding protein                             189   3e-54   Synechococcus
gb|ABA55504.1|  chloroplast chlorophyll synthase                        191   3e-54   Isochrysis galbana
ref|WP_015216855.1|  chlorophyll synthase                               190   3e-54   Anabaena cylindrica
ref|WP_002796856.1|  chitin-binding protein                             189   3e-54   Microcystis aeruginosa
ref|WP_002733514.1|  chlorophyll synthase, ChlG                         189   4e-54   Microcystis aeruginosa
ref|WP_006041997.1|  chitin-binding protein                             189   4e-54   Synechococcus sp. WH 7805
ref|WP_011610670.1|  chitin-binding protein                             189   4e-54   Trichodesmium erythraeum
ref|WP_002791418.1|  chitin-binding protein                             189   4e-54   Microcystis aeruginosa
ref|WP_008274923.1|  chitin-binding protein                             189   5e-54   Cyanothece sp. CCY0110
ref|WP_007100447.1|  chitin-binding protein                             189   5e-54   Synechococcus sp. RS9917
ref|WP_006276267.1|  chitin-binding protein                             189   5e-54   Cylindrospermopsis raciborskii
ref|XP_002984907.1|  hypothetical protein SELMODRAFT_423983             190   6e-54   
emb|CAE08192.1|  chlorophyll synthase 33 kD subunit                     189   6e-54   Synechococcus sp. WH 8102
ref|WP_009543798.1|  MULTISPECIES: chitin-binding protein               188   6e-54   Cyanothece
ref|WP_009789357.1|  chitin-binding protein                             188   7e-54   Synechococcus sp. BL107
ref|WP_015138788.1|  chlorophyll synthase                               189   7e-54   Nostoc sp. PCC 7524
ref|WP_006854672.1|  chitin-binding protein                             188   8e-54   Synechococcus sp. WH 8016
gb|ABI45755.1|  chlorophyll synthase, ChlG                              187   1e-53   Synechococcus sp. CC9311
ref|WP_041426374.1|  chitin-binding protein                             187   1e-53   Synechococcus sp. CC9311
ref|WP_018399831.1|  chitin-binding protein                             188   1e-53   filamentous cyanobacterium ESFC-1
ref|WP_015226341.1|  chlorophyll synthase                               188   1e-53   Halothece sp. PCC 7418
ref|WP_017720164.1|  chitin-binding protein                             188   1e-53   Oscillatoria sp. PCC 10802
ref|WP_041237226.1|  chitin-binding protein                             187   1e-53   
ref|WP_013189701.1|  chitin-binding protein                             188   1e-53   Trichormus azollae
gb|ACL46162.1|  chlorophyll synthase, ChlG                              188   1e-53   Cyanothece sp. PCC 7425
ref|WP_008188082.1|  chitin-binding protein                             187   1e-53   Moorea producens
ref|WP_021831402.1|  Chlorophyll a synthase ChlG                        187   2e-53   Crocosphaera watsonii
ref|WP_017325563.1|  hypothetical protein                               188   2e-53   Synechococcus sp. PCC 7336
ref|WP_015190495.1|  chlorophyll synthase                               187   2e-53   Gloeocapsa sp. PCC 7428
ref|WP_036003752.1|  chitin-binding protein                             187   3e-53   [Leptolyngbya] sp. JSC-1
ref|XP_011396726.1|  Chlorophyll synthase, chloroplastic                189   3e-53   Auxenochlorella protothecoides
ref|WP_007303080.1|  chitin-binding protein                             186   3e-53   Crocosphaera watsonii
ref|WP_007311921.1|  chitin-binding protein                             186   4e-53   Crocosphaera watsonii
ref|WP_016515091.1|  bacteriochlorophyll/chlorophyll a synthase         186   5e-53   Microcystis aeruginosa
ref|WP_017661464.1|  chitin-binding protein                             186   5e-53   Cyanobacteria [blue-green bacteria]
gb|AII50024.1|  chitin-binding protein                                  186   5e-53   Synechococcus sp. KORDI-52
ref|WP_015141839.1|  chlorophyll synthase                               186   6e-53   Pleurocapsa minor
ref|WP_038556134.1|  chitin-binding protein                             186   6e-53   Synechococcus sp. KORDI-52
gb|KDO56703.1|  hypothetical protein CISIN_1g017282mg                   186   7e-53   Citrus sinensis [apfelsine]
ref|WP_019489273.1|  chitin-binding protein                             186   1e-52   Calothrix sp. PCC 7103
ref|WP_023172858.1|  bacteriochlorophyll/chlorophyll a synthase         186   1e-52   Gloeobacter kilaueensis
ref|WP_026721230.1|  chitin-binding protein                             186   1e-52   Fischerella sp. PCC 9431
ref|WP_006529881.1|  chlorophyll synthase                               185   1e-52   Gloeocapsa sp. PCC 73106
gb|AHF64249.1|  chlorophyll synthase, ChlG                              184   1e-52   Synechococcus sp. WH 8109
ref|WP_017322055.1|  chitin-binding protein                             186   1e-52   cyanobacterium PCC 7702
ref|WP_016860449.1|  chitin-binding protein                             185   2e-52   Fischerella muscicola
ref|WP_015229388.1|  chlorophyll synthase, ChlG                         185   2e-52   Dactylococcopsis salina
ref|WP_011363799.1|  chitin-binding protein                             184   2e-52   Synechococcus sp. CC9605
ref|WP_006850250.1|  chitin-binding protein                             184   2e-52   Synechococcus sp. WH 8109
ref|WP_041038358.1|  chitin-binding protein                             185   3e-52   Tolypothrix campylonemoides
gb|KDO56702.1|  hypothetical protein CISIN_1g017282mg                   185   3e-52   Citrus sinensis [apfelsine]
gb|KIJ80640.1|  chitin-binding protein                                  184   4e-52   Scytonema tolypothrichoides VB-61278
ref|WP_015160454.1|  chlorophyll synthase, ChlG                         183   7e-52   Chamaesiphon minutus
ref|WP_012410852.1|  chitin-binding protein                             184   7e-52   Nostoc punctiforme
ref|WP_037219446.1|  chitin-binding protein                             183   9e-52   
ref|WP_028952522.1|  chitin-binding protein                             182   9e-52   Synechococcus sp. CC9616
ref|WP_011934995.1|  chitin-binding protein                             182   1e-51   Synechococcus sp. RCC307
ref|WP_007098477.1|  chitin-binding protein                             182   2e-51   Synechococcus sp. RS9916
ref|WP_011141807.1|  chitin-binding protein                             182   2e-51   Gloeobacter violaceus
ref|WP_012194978.1|  chitin-binding protein                             182   2e-51   Prochlorococcus marinus
ref|WP_040054337.1|  chitin-binding protein                             182   2e-51   
ref|WP_009555481.1|  chlorophyll synthase                               182   3e-51   Oscillatoriales cyanobacterium JSC-12
ref|WP_017311299.1|  MULTISPECIES: chitin-binding protein               182   3e-51   Hapalosiphonaceae
ref|WP_038545866.1|  chitin-binding protein                             181   3e-51   Synechococcus sp. KORDI-100
ref|WP_006103362.1|  chitin-binding protein                             181   4e-51   Coleofasciculus chthonoplastes
ref|XP_005539244.1|  chlorophyll a synthase                             183   4e-51   Cyanidioschyzon merolae strain 10D
ref|XP_009348554.1|  PREDICTED: chlorophyll synthase, chloroplast...    181   4e-51   Pyrus x bretschneideri [bai li]
ref|XP_009338149.1|  PREDICTED: chlorophyll synthase, chloroplast...    181   4e-51   
ref|WP_026103435.1|  chitin-binding protein                             181   4e-51   
ref|WP_009627523.1|  chlorophyll synthase                               181   5e-51   
ref|WP_026085821.1|  chitin-binding protein                             181   8e-51   
ref|WP_015121817.1|  chlorophyll synthase                               181   8e-51   
ref|WP_011360348.1|  chitin-binding protein                             180   1e-50   
ref|WP_017319080.1|  chitin-binding protein                             180   1e-50   
gb|EJK55102.1|  hypothetical protein THAOC_25196                        177   2e-50   
ref|WP_039752491.1|  chitin-binding protein                             180   2e-50   
ref|WP_037979983.1|  chitin-binding protein                             179   2e-50   
ref|WP_016874739.1|  chitin-binding protein                             179   3e-50   
gb|KIZ05447.1|  chlorophyll synthase                                    179   3e-50   
ref|WP_026086513.1|  MULTISPECIES: chitin-binding protein               179   5e-50   
gb|EMS66844.1|  Chlorophyll synthase, chloroplastic                     172   5e-50   
ref|WP_035832640.1|  chitin-binding protein                             178   5e-50   
gb|EAQ74303.1|  bacteriochlorophyll a synthase                          178   5e-50   
gb|KGG16533.1|  Chlorophyll a synthase ChlG                             177   8e-50   
gb|KEF41359.1|  chitin-binding protein                                  178   8e-50   
gb|EHC19402.1|  chlorophyll synthase, ChlG                              179   9e-50   
gb|KGG16991.1|  Chlorophyll a synthase ChlG                             177   1e-49   
ref|WP_036918118.1|  MULTISPECIES: chitin-binding protein               177   1e-49   
ref|WP_025962234.1|  chitin-binding protein                             174   1e-49   
ref|WP_009634454.1|  chlorophyll synthase                               178   1e-49   
ref|WP_038651451.1|  chitin-binding protein                             177   1e-49   
ref|WP_025969068.1|  chitin-binding protein                             173   1e-49   
ref|YP_002048738.1|  bacteriochlorophyll a synthase                     177   1e-49   
ref|WP_019478505.1|  chitin-binding protein                             177   1e-49   
ref|WP_041699146.1|  chitin-binding protein                             177   2e-49   
gb|AFY69515.1|  chlorophyll synthase                                    178   2e-49   
ref|WP_029633826.1|  chitin-binding protein [                           177   2e-49   
ref|WP_036901256.1|  chitin-binding protein                             176   2e-49   
ref|WP_025975725.1|  chitin-binding protein                             172   3e-49   
ref|WP_026134660.1|  chitin-binding protein                             176   4e-49   
ref|WP_011432183.1|  chitin-binding protein                             175   5e-49   
ref|WP_022608605.1|  chlorophyll synthase, chlG                         176   5e-49   
ref|WP_036897354.1|  chitin-binding protein                             175   6e-49   
ref|WP_008224889.1|  Chlorophyll a synthase ChlG                        176   7e-49   
emb|CCH67976.1|  Chlorophyll a synthase ChlG                            176   7e-49   
ref|WP_019474377.1|  chitin-binding protein                             175   7e-49   
ref|WP_044304899.1|  chitin-binding protein                             176   8e-49   
gb|EWM27825.1|  chlorophyll synthase                                    169   8e-49   
ref|WP_025974940.1|  chitin-binding protein                             174   1e-48   
ref|WP_015168364.1|  chlorophyll synthase                               175   1e-48   
ref|WP_015200978.1|  chlorophyll synthase                               175   1e-48   
gb|KIE13408.1|  chitin-binding protein                                  175   1e-48   
ref|WP_011430952.1|  chitin-binding protein                             174   2e-48   
ref|WP_036921595.1|  chitin-binding protein                             174   2e-48   
ref|WP_019477774.1|  chitin-binding protein                             174   3e-48   
gb|KGG01713.1|  Chlorophyll a synthase ChlG                             173   3e-48   
ref|WP_041374879.1|  chitin-binding protein                             173   3e-48   
gb|AIQ94493.1|  Chlorophyll a synthase ChlG                             172   3e-48   
ref|WP_025941375.1|  chitin-binding protein                             173   3e-48   
ref|WP_041384262.1|  chitin-binding protein                             173   3e-48   
ref|WP_025981216.1|  chitin-binding protein                             173   3e-48   
ref|WP_025887592.1|  MULTISPECIES: chitin-binding protein               173   4e-48   
ref|WP_025978806.1|  chitin-binding protein                             173   4e-48   
ref|WP_025960892.1|  chitin-binding protein                             173   4e-48   
ref|WP_025956523.1|  chitin-binding protein                             173   4e-48   
ref|WP_025945052.1|  MULTISPECIES: chitin-binding protein               173   4e-48   
gb|ABM78802.1|  chlorophyll synthase 33 kD subunit                      174   4e-48   
ref|WP_025922998.1|  chitin-binding protein                             173   4e-48   
ref|WP_011817939.1|  MULTISPECIES: chitin-binding protein               173   5e-48   
ref|WP_025924224.1|  chitin-binding protein                             173   5e-48   
ref|WP_032515728.1|  chitin-binding protein                             173   5e-48   
emb|CAE20447.1|  chlorophyll synthase 33 kD subunit                     173   5e-48   
ref|WP_012954260.1|  chitin-binding protein                             173   5e-48   
ref|WP_032517555.1|  chitin-binding protein                             172   6e-48   
ref|WP_025929206.1|  MULTISPECIES: chitin-binding protein               172   6e-48   
ref|WP_025931458.1|  MULTISPECIES: chitin-binding protein               172   6e-48   
ref|WP_025922206.1|  MULTISPECIES: chitin-binding protein               172   6e-48   
ref|WP_025955272.1|  chitin-binding protein                             172   8e-48   
ref|WP_025914254.1|  chitin-binding protein                             172   8e-48   
gb|KGF97373.1|  Chlorophyll a synthase ChlG                             171   9e-48   
ref|WP_006195466.1|  chitin-binding protein                             173   9e-48   
ref|WP_002805241.1|  chitin-binding protein                             172   1e-47   
ref|WP_011375987.1|  chitin-binding protein                             172   1e-47   
ref|WP_032521301.1|  chitin-binding protein                             172   1e-47   
ref|WP_011132064.1|  chitin-binding protein                             172   1e-47   
ref|WP_025880719.1|  MULTISPECIES: chitin-binding protein               172   1e-47   
ref|WP_032524143.1|  chitin-binding protein                             172   1e-47   
ref|WP_025928106.1|  MULTISPECIES: chitin-binding protein               172   1e-47   
ref|WP_011819807.1|  chitin-binding protein                             172   1e-47   
gb|AHJ26545.1|  Chlorophyll a synthase ChlG                             173   1e-47   
ref|WP_012007256.1|  chitin-binding protein                             172   1e-47   
ref|WP_032526735.1|  chitin-binding protein                             172   1e-47   
ref|WP_032513333.1|  chitin-binding protein                             172   1e-47   
ref|WP_034417252.1|  chitin-binding protein                             171   2e-47   
ref|WP_025906385.1|  MULTISPECIES: chitin-binding protein               171   2e-47   
ref|WP_025934879.1|  chitin-binding protein                             171   2e-47   
ref|WP_025945712.1|  chitin-binding protein                             171   2e-47   
ref|WP_027842479.1|  chitin-binding protein                             172   3e-47   
ref|WP_026732961.1|  chitin-binding protein                             170   8e-47   
ref|WP_036910793.1|  MULTISPECIES: chitin-binding protein               169   1e-46   
ref|WP_011294392.1|  chitin-binding protein                             167   5e-46   
ref|WP_036906775.1|  chitin-binding protein                             167   5e-46   
dbj|BAH84855.1|  putative chlorophyll synthetase                        161   3e-45   
ref|WP_019475923.1|  chitin-binding protein                             166   3e-45   
ref|WP_011124579.1|  MULTISPECIES: chitin-binding protein               166   3e-45   
ref|WP_025929851.1|  chitin-binding protein                             162   6e-44   
gb|ABC24961.1|  plastid chlorophyll synthase                            149   3e-40   
ref|WP_025961808.1|  chitin-binding protein                             148   6e-39   
ref|XP_010104247.1|  Chlorophyll synthase                               141   3e-36   
gb|KDO56704.1|  hypothetical protein CISIN_1g017282mg                   135   7e-34   
ref|WP_025892821.1|  hypothetical protein                               126   1e-32   
ref|WP_041466303.1|  bacteriochlorophyll/chlorophyll a synthase         117   2e-27   
gb|ACF11674.1|  bacteriochlorophyll/chlorophyll synthetase              118   3e-27   
ref|WP_025980247.1|  hypothetical protein                               112   5e-27   
gb|ADD60154.1|  chlorophyll synthetase                                  110   6e-27   
ref|WP_010932939.1|  bacteriochlorophyll/chlorophyll a synthase         114   8e-26   
ref|WP_025965401.1|  hypothetical protein                               108   9e-26   
emb|CDX93950.1|  BnaC04g21090D                                          105   5e-25   
ref|WP_011362131.1|  bacteriochlorophyll/chlorophyll a synthase         110   1e-24   
ref|WP_011504133.1|  bacteriochlorophyll/chlorophyll a synthase         107   8e-24   
ref|WP_012474514.1|  bacteriochlorophyll/chlorophyll a synthase         106   3e-23   
ref|WP_025973179.1|  hypothetical protein                               101   3e-23   
ref|WP_011745293.1|  bacteriochlorophyll/chlorophyll a synthase         105   9e-23   
gb|ACB83457.1|  bacteriochlorophyll/chlorophyll synthetase              103   2e-22   
ref|WP_012257954.1|  MULTISPECIES: bacteriochlorophyll synthase         103   2e-22   
ref|WP_006366517.1|  bacteriochlorophyll/chlorophyll synthetase         104   2e-22   
ref|WP_041371788.1|  bacteriochlorophyll/chlorophyll a synthase         103   2e-22   
ref|WP_012507912.1|  bacteriochlorophyll/chlorophyll a synthase         102   1e-21   
ref|WP_012255852.1|  bacteriochlorophyll/chlorophyll a synthase         101   2e-21   
ref|WP_015941358.1|  bacteriochlorophyll synthase                       101   2e-21   
ref|WP_015824821.1|  geranylgeranyl bacteriochlorophyll synthase        100   2e-21   
ref|WP_015952897.1|  bacteriochlorophyll/chlorophyll a synthase         100   2e-21   
ref|WP_006563673.1|  bacteriochlorophyll synthase                       100   2e-21   
ref|WP_015857654.1|  geranylgeranyl bacteriochlorophyll synthase        100   2e-21   
ref|WP_003603763.1|  bacteriochlorophyll/chlorophyll synthetase         100   3e-21   
ref|WP_012567253.1|  bacteriochlorophyll/chlorophyll a synthase         100   3e-21   
ref|WP_029059939.1|  bacteriochlorophyll/chlorophyll a synthase         100   4e-21   
ref|WP_031458028.1|  bacteriochlorophyll synthase                     99.4    8e-21   
ref|WP_041595555.1|  bacteriochlorophyll/chlorophyll a synthase       99.0    8e-21   
gb|ABM62364.1|  chlorophyll synthase                                  99.4    8e-21   
ref|WP_028458409.1|  bacteriochlorophyll synthase                     99.4    8e-21   
gb|AAC84024.1|  bacteriochlorophyll synthase BchG                     99.4    9e-21   
ref|WP_037238677.1|  bacteriochlorophyll/chlorophyll a synthase       99.0    1e-20   
ref|WP_013418680.1|  bacteriochlorophyll/chlorophyll synthetase       98.6    1e-20   
ref|WP_041335627.1|  bacteriochlorophyll synthase                     97.8    3e-20   
gb|ABQ91627.1|  chlorophyll synthase                                  97.4    4e-20   
ref|WP_041332176.1|  bacteriochlorophyll synthase                     96.7    5e-20   
ref|WP_023409380.1|  hypothetical protein                             97.1    5e-20   
dbj|BAC76416.1|  geranylgeranyl bacteriochlorophyll synthase          96.7    7e-20   
ref|WP_041314834.1|  hypothetical protein                             96.3    8e-20   
ref|WP_012505945.1|  bacteriochlorophyll/chlorophyll a synthase       96.7    8e-20   
gb|ABZ83860.1|  bacteriochlorophyll synthetase bchg                   96.3    9e-20   
gb|EWY36028.1|  bacteriochlorophyll/chlorophyll a synthase            95.1    2e-19   
ref|WP_035399966.1|  bacteriochlorophyll/chlorophyll a synthase       95.1    2e-19   
ref|WP_037461452.1|  bacteriochlorophyll/chlorophyll a synthase       95.1    2e-19   
ref|WP_009150715.1|  bacteriochlorophyll/chlorophyll synthetase       95.1    3e-19   
ref|WP_011453291.1|  bacteriochlorophyll/chlorophyll a synthase       94.7    3e-19   
ref|WP_043795674.1|  bacteriochlorophyll/chlorophyll a synthase       94.4    4e-19   
ref|WP_011357647.1|  bacteriochlorophyll/chlorophyll a synthase       94.4    4e-19   
ref|WP_043764539.1|  bacteriochlorophyll/chlorophyll a synthase       94.0    5e-19   
gb|ADC63554.1|  bacteriochlorophyll/chlorophyll synthetase            94.0    6e-19   
ref|WP_025311359.1|  bacteriochlorophyll/chlorophyll a synthase       94.0    6e-19   
ref|WP_040452975.1|  bacteriochlorophyll/chlorophyll a synthase       93.6    7e-19   
gb|EEE45911.1|  bacteriochlorophyll/chlorophyll synthetase subfamily  93.6    7e-19   
ref|WP_029976093.1|  chitin-binding protein                           89.4    8e-19   
ref|WP_020086061.1|  hypothetical protein                             93.2    9e-19   
ref|WP_009857133.1|  bacteriochlorophyll/chlorophyll a synthase       92.8    1e-18   
ref|WP_042458879.1|  bacteriochlorophyll/chlorophyll a synthase       92.8    2e-18   
ref|WP_023838539.1|  bacteriochlorophyll/chlorophyll a synthase       92.4    2e-18   
ref|WP_017483262.1|  bacteriochlorophyll/chlorophyll a synthase       92.4    2e-18   
ref|WP_038007406.1|  MULTISPECIES: bacteriochlorophyll/chlorophyl...  92.0    2e-18   
ref|WP_018260067.1|  MULTISPECIES: bacteriochlorophyll/chlorophyl...  92.0    3e-18   
ref|WP_041465923.1|  bacteriochlorophyll/chlorophyll a synthase       92.4    3e-18   
gb|AEO47113.1|  bacteriochlorophyll/chlorophyll a synthase            91.7    3e-18   
gb|ACD90224.1|  bacteriochlorophyll/chlorophyll synthetase            92.4    3e-18   
gb|ACA18094.1|  bacteriochlorophyll/chlorophyll synthetase            92.0    3e-18   
ref|WP_020095245.1|  MULTISPECIES: bacteriochlorophyll/chlorophyl...  91.7    3e-18   
ref|WP_011388385.1|  bacteriochlorophyll/chlorophyll a synthase       91.7    3e-18   
ref|WP_036267194.1|  bacteriochlorophyll/chlorophyll a synthase       91.7    4e-18   
ref|WP_037256434.1|  bacteriochlorophyll/chlorophyll a synthase       90.9    6e-18   
dbj|BAQ67378.1|  bacteriochlorophyll synthase BchG                    90.9    7e-18   
ref|WP_027285643.1|  bacteriochlorophyll/chlorophyll a synthase       90.5    8e-18   
dbj|BAL75140.1|  bacteriochlorophyll synthase BchG                    89.7    8e-18   
ref|WP_011566500.1|  bacteriochlorophyll/chlorophyll a synthase       90.5    9e-18   
ref|XP_009146102.1|  PREDICTED: chlorophyll synthase, chloroplast...  86.7    9e-18   
ref|WP_013984621.1|  bacteriochlorophyll synthase BchG                90.1    1e-17   
ref|WP_043360852.1|  bacteriochlorophyll/chlorophyll a synthase       90.1    1e-17   
ref|WP_009031264.1|  bacteriochlorophyll synthase                     90.1    1e-17   
gb|EHQ52654.1|  bacteriochlorophyll/chlorophyll a synthase            89.7    1e-17   
ref|WP_018406848.1|  bacteriochlorophyll/chlorophyll a synthase       89.7    1e-17   
ref|WP_011924742.1|  bacteriochlorophyll/chlorophyll a synthase       89.7    1e-17   
ref|WP_040405525.1|  bacteriochlorophyll/chlorophyll a synthase       89.7    1e-17   
ref|WP_041748135.1|  bacteriochlorophyll/chlorophyll a synthase       89.4    1e-17   
ref|WP_008944408.1|  bacteriochlorophyll/chlorophyll a synthase       89.7    1e-17   
ref|WP_029648435.1|  bacteriochlorophyll/chlorophyll a synthase       89.4    2e-17   
gb|KJB90227.1|  bacteriochlorophyll/chlorophyll a synthase            89.4    2e-17   
ref|XP_009107276.1|  PREDICTED: chlorophyll synthase, chloroplast...  85.5    2e-17   
ref|WP_007560937.1|  bacteriochlorophyll/chlorophyll a synthase       89.4    2e-17   
ref|WP_044437530.1|  bacteriochlorophyll/chlorophyll a synthase       89.4    2e-17   
ref|WP_017672661.1|  hypothetical protein                             89.4    2e-17   
ref|WP_010686363.1|  Bacteriochlorophyll/chlorophyll synthetase       89.0    3e-17   
ref|WP_012318833.1|  MULTISPECIES: bacteriochlorophyll/chlorophyl...  89.0    3e-17   
ref|WP_026623614.1|  bacteriochlorophyll/chlorophyll a synthase       88.6    3e-17   
gb|AHK79148.1|  bacteriochlorophyll/chlorophyll a synthase            88.6    3e-17   
ref|WP_011889985.1|  bacteriochlorophyll/chlorophyll a synthase       88.6    4e-17   
ref|WP_033927027.1|  bacteriochlorophyll/chlorophyll synthetase       88.6    4e-17   
ref|XP_009107275.1|  PREDICTED: chlorophyll synthase, chloroplast...  84.3    5e-17   
ref|WP_007206070.1|  bacteriochlorophyll synthase                     88.2    6e-17   
ref|XP_009107273.1|  PREDICTED: chlorophyll synthase, chloroplast...  84.3    6e-17   
ref|XP_009107274.1|  PREDICTED: chlorophyll synthase, chloroplast...  84.0    6e-17   
ref|WP_026039361.1|  bacteriochlorophyll/chlorophyll a synthase       87.0    1e-16   
ref|WP_023666157.1|  bacteriochlorophyll/chlorophyll a synthase       87.0    1e-16   
ref|WP_037269021.1|  bacteriochlorophyll/chlorophyll a synthase       87.0    1e-16   
gb|KGM86923.1|  chlorophyll synthase                                  87.0    1e-16   
ref|WP_008280363.1|  chlorophyll a synthase                           86.7    1e-16   
ref|WP_024812823.1|  bacteriochlorophyll/chlorophyll a synthase       86.7    2e-16   
ref|WP_036302546.1|  bacteriochlorophyll/chlorophyll a synthase       86.3    2e-16   
ref|WP_026352449.1|  bacteriochlorophyll/chlorophyll a synthase       86.7    2e-16   
ref|WP_041570058.1|  bacteriochlorophyll/chlorophyll a synthase       86.3    2e-16   
gb|AAR38262.1|  bacteriochlorophyll synthase                          86.3    2e-16   
gb|AEP13045.1|  bacteriochlorophyll/chlorophyll synthetase            86.3    3e-16   
ref|WP_029207956.1|  bacteriochlorophyll/chlorophyll a synthase       85.9    3e-16   
ref|WP_040482148.1|  hypothetical protein                             85.9    3e-16   
ref|WP_009758357.1|  bacteriochlorophyll synthase                     85.9    3e-16   
gb|AAL76374.1|  geranylgeranyl bacteriochlorophyll synthase           85.5    3e-16   
gb|EAW41200.1|  bacteriochlorophyll a synthase                        85.9    3e-16   
ref|WP_011908055.1|  bacteriochlorophyll/chlorophyll a synthase       85.9    3e-16   
ref|WP_040812015.1|  bacteriochlorophyll/chlorophyll synthetase       85.5    3e-16   



>ref|XP_009606938.1| PREDICTED: chlorophyll synthase, chloroplastic [Nicotiana tomentosiformis]
Length=373

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYS+AGLGIAIVNDFKSIEG
Sbjct  218  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSVAGLGIAIVNDFKSIEG  277

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFGSE AKWICVGAID+TQ+SVAGYL   GKPYYALALLGL APQ+FFQ
Sbjct  278  DRAMGLQSLPVAFGSEAAKWICVGAIDITQISVAGYLLGAGKPYYALALLGLIAPQVFFQ  337

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  338  FKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH  373



>gb|EYU41922.1| hypothetical protein MIMGU_mgv1a007461mg [Erythranthe guttata]
Length=406

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYS+AGLGIAIVNDFKSIEG
Sbjct  251  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSVAGLGIAIVNDFKSIEG  310

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR MGLQSLPVAFGSETAKWICVGAID+TQLSVAGYL   GKPYYALAL+GL APQ+FFQ
Sbjct  311  DRQMGLQSLPVAFGSETAKWICVGAIDITQLSVAGYLLGAGKPYYALALVGLIAPQVFFQ  370

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  371  FKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH  406



>ref|XP_008243417.1| PREDICTED: chlorophyll synthase, chloroplastic [Prunus mume]
Length=374

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  219  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFGSETAKWICVGAID+TQLS+AGYL   GKPYYALAL+ L APQ+FFQ
Sbjct  279  DRAMGLQSLPVAFGSETAKWICVGAIDITQLSIAGYLLGAGKPYYALALVALIAPQVFFQ  338

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALA SH
Sbjct  339  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALAMSH  374



>gb|EYU41923.1| hypothetical protein MIMGU_mgv1a007461mg [Erythranthe guttata]
Length=404

 Score =   273 bits (698),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYS+AGLGIAIVNDFKSIEG
Sbjct  249  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSVAGLGIAIVNDFKSIEG  308

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR MGLQSLPVAFGSETAKWICVGAID+TQLSVAGYL   GKPYYALAL+GL APQ+FFQ
Sbjct  309  DRQMGLQSLPVAFGSETAKWICVGAIDITQLSVAGYLLGAGKPYYALALVGLIAPQVFFQ  368

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  369  FKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH  404



>gb|ACQ44245.1| chlorophyll synthase [Nicotiana tabacum]
Length=373

 Score =   272 bits (695),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYS+AGLGIAIVNDFKSIEG
Sbjct  218  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSVAGLGIAIVNDFKSIEG  277

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFGSE AKWICVGAID+TQ+SVAGYL   GKPYYALALLGL APQ+FFQ
Sbjct  278  DRAMGLQSLPVAFGSEAAKWICVGAIDITQISVAGYLLGAGKPYYALALLGLIAPQVFFQ  337

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  338  FKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH  373



>ref|XP_009762729.1| PREDICTED: chlorophyll synthase, chloroplastic [Nicotiana sylvestris]
Length=373

 Score =   271 bits (694),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYS+AGLGIAIVNDFKSIEG
Sbjct  218  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSVAGLGIAIVNDFKSIEG  277

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFGSE AKWICVGAID+TQ+SVAGYL   GKPYYALALLGL APQ+FFQ
Sbjct  278  DRAMGLQSLPVAFGSEAAKWICVGAIDITQISVAGYLLGAGKPYYALALLGLIAPQVFFQ  337

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  338  FKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH  373



>ref|XP_006366338.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Solanum 
tuberosum]
Length=369

 Score =   271 bits (694),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  214  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  273

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFGSE AKWICVGAID+TQ+SVAGYL   GKPYYA ALLGL APQ+FFQ
Sbjct  274  DRAMGLQSLPVAFGSEAAKWICVGAIDITQISVAGYLLGAGKPYYAFALLGLIAPQVFFQ  333

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  334  FKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH  369



>gb|AJB84630.1| chlorophyll synthase [Camellia sinensis]
Length=374

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  219  LKQNGWLGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFGSETAKWICVGAID+TQLSVAGYL   GKP+YALALLGL  PQ+FFQ
Sbjct  279  DRALGLQSLPVAFGSETAKWICVGAIDVTQLSVAGYLLGAGKPFYALALLGLILPQVFFQ  338

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  339  FKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH  374



>gb|AEI83422.1| chlorophyll synthase [Camellia sinensis]
Length=374

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  219  LKQNGWLGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFGSETAKWICVGAID+TQLSVAGYL   GKP+YALALLGL  PQ+FFQ
Sbjct  279  DRALGLQSLPVAFGSETAKWICVGAIDVTQLSVAGYLLGAGKPFYALALLGLILPQVFFQ  338

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  339  FKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH  374



>ref|XP_004148612.1| PREDICTED: chlorophyll synthase, chloroplastic [Cucumis sativus]
 gb|KGN54387.1| hypothetical protein Csa_4G311220 [Cucumis sativus]
Length=373

 Score =   269 bits (688),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  218  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  277

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL   GKPYYALALL L  PQ+FFQ
Sbjct  278  DRALGLQSLPVAFGAETAKWICVGAIDITQLSVAGYLLGAGKPYYALALLALIGPQVFFQ  337

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  338  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  373



>gb|ACQ44244.1| chlorophyll synthase [Nicotiana tabacum]
Length=373

 Score =   269 bits (688),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYS+AGLGIAIVNDFKSIEG
Sbjct  218  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSVAGLGIAIVNDFKSIEG  277

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAM LQSLPVAFGSE AKWICVGAID+TQ+SVAGYL   GKPYYALALLGL APQ+FFQ
Sbjct  278  DRAMRLQSLPVAFGSEAAKWICVGAIDITQISVAGYLLGAGKPYYALALLGLIAPQVFFQ  337

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  338  FKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH  373



>ref|XP_011019083.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Populus 
euphratica]
Length=372

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  217  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSIEG  276

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL + GKPYYALAL+GLT PQI FQ
Sbjct  277  DRALGLQSLPVAFGAETAKWICVGAIDITQLSVAGYLLADGKPYYALALVGLTIPQIVFQ  336

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  337  FQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  372



>ref|XP_008464210.1| PREDICTED: chlorophyll synthase, chloroplastic [Cucumis melo]
Length=373

 Score =   269 bits (687),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  218  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  277

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL   GKPYYALALL L  PQ+FFQ
Sbjct  278  DRALGLQSLPVAFGAETAKWICVGAIDITQLSVAGYLLGAGKPYYALALLALIGPQVFFQ  337

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  338  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  373



>gb|KHN18037.1| Chlorophyll synthase, chloroplastic [Glycine soja]
Length=377

 Score =   268 bits (684),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  222  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  281

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFGSETAKWICVGAID+TQLSVAGYL    KP+YALALLGL  PQ+FFQ
Sbjct  282  DRALGLQSLPVAFGSETAKWICVGAIDITQLSVAGYLLGADKPFYALALLGLIIPQVFFQ  341

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  342  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  377



>ref|NP_001239633.1| uncharacterized protein LOC100787459 [Glycine max]
 gb|ACU24159.1| unknown [Glycine max]
Length=377

 Score =   267 bits (683),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  222  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  281

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFGSETAKWICVGAID+TQLSVAGYL    KP+YALALLGL  PQ+FFQ
Sbjct  282  DRALGLQSLPVAFGSETAKWICVGAIDITQLSVAGYLLGADKPFYALALLGLIIPQVFFQ  341

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  342  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  377



>ref|XP_004246318.1| PREDICTED: chlorophyll synthase, chloroplastic [Solanum lycopersicum]
Length=369

 Score =   267 bits (683),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLT DVIVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  214  LKQNGWIGNFALGASYISLPWWAGQALFGTLTLDVIVLTLLYSIAGLGIAIVNDFKSIEG  273

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFGSE AKWICVGAID+TQ+SVAGYL   GKPYYA ALLGL APQ+FFQ
Sbjct  274  DRAMGLQSLPVAFGSEAAKWICVGAIDITQISVAGYLLGAGKPYYAFALLGLIAPQVFFQ  333

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  334  FKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH  369



>ref|XP_009338147.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X1 
[Pyrus x bretschneideri]
Length=374

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  219  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFGSETAKWICVGAID+TQLS+ GYL   GKPYYALALL L  PQ+FFQ
Sbjct  279  DRELGLQSLPVAFGSETAKWICVGAIDITQLSIVGYLLGAGKPYYALALLALIGPQVFFQ  338

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  339  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  374



>emb|CDP06461.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  225  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  284

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQ+SVAGYL   GKPYYALALLGL  PQ+FFQ
Sbjct  285  DRALGLQSLPVAFGTETAKWICVGAIDVTQISVAGYLLGGGKPYYALALLGLIIPQVFFQ  344

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FKYFLKDPVKYDVKYQASAQPF
Sbjct  345  FKYFLKDPVKYDVKYQASAQPF  366



>ref|XP_009348552.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X1 
[Pyrus x bretschneideri]
Length=374

 Score =   267 bits (682),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  219  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFGSETAKWICVGAID+TQLS+ GYL   GKPYYALALL L  PQ+FFQ
Sbjct  279  DRELGLQSLPVAFGSETAKWICVGAIDITQLSIVGYLLGAGKPYYALALLALIGPQVFFQ  338

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  339  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  374



>gb|KHN42901.1| Chlorophyll synthase, chloroplastic [Glycine soja]
Length=377

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  222  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  281

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL    KP+YALALLGL  PQ+FFQ
Sbjct  282  DRALGLQSLPVAFGAETAKWICVGAIDITQLSVAGYLLGADKPFYALALLGLIIPQVFFQ  341

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  342  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  377



>ref|XP_009115884.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X1 
[Brassica rapa]
Length=386

 Score =   266 bits (681),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  231  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  290

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG+E AKWICVGAID+TQLSVAGYL + GKPYYALALL L  PQI FQ
Sbjct  291  DRAMGLQSLPVAFGTEAAKWICVGAIDVTQLSVAGYLLASGKPYYALALLALIIPQIVFQ  350

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLG+ VTALA+SH
Sbjct  351  FKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASSH  386



>ref|XP_006403878.1| hypothetical protein EUTSA_v10010408mg [Eutrema salsugineum]
 gb|ESQ45331.1| hypothetical protein EUTSA_v10010408mg [Eutrema salsugineum]
Length=420

 Score =   268 bits (684),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  265  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  324

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG+E AKWICVGAID+TQLSVAGYL + GKPYYALALL L  PQI FQ
Sbjct  325  DRAMGLQSLPVAFGTEAAKWICVGAIDITQLSVAGYLLASGKPYYALALLALIIPQIVFQ  384

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLG+ VTALA+SH
Sbjct  385  FKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASSH  420



>ref|XP_011095035.1| PREDICTED: chlorophyll synthase, chloroplastic [Sesamum indicum]
Length=373

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  218  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  277

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR MGLQSLPVAFGSETAKWICVGAID+TQ+SVAGYL  +GKP YA ALLGL  PQ+FFQ
Sbjct  278  DRKMGLQSLPVAFGSETAKWICVGAIDITQISVAGYLLGLGKPLYASALLGLIVPQVFFQ  337

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  338  FKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH  373



>ref|XP_011004741.1| PREDICTED: chlorophyll synthase, chloroplastic isoform X2 [Populus 
euphratica]
Length=305

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  150  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSIEG  209

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFG+ETAKWICVGAID+TQ+SVAGYL   GKPYYALALLGL  PQ+FFQ
Sbjct  210  DRLLGLQSLPVAFGAETAKWICVGAIDVTQISVAGYLLGAGKPYYALALLGLIIPQVFFQ  269

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  270  FQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  305



>ref|XP_009115885.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X2 
[Brassica rapa]
Length=376

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  221  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  280

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG+E AKWICVGAID+TQLSVAGYL + GKPYYALALL L  PQI FQ
Sbjct  281  DRAMGLQSLPVAFGTEAAKWICVGAIDVTQLSVAGYLLASGKPYYALALLALIIPQIVFQ  340

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLG+ VTALA+SH
Sbjct  341  FKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASSH  376



>ref|XP_002308227.1| chlorophyll synthetase family protein [Populus trichocarpa]
 gb|ABK95029.1| unknown [Populus trichocarpa]
 gb|EEE91750.1| chlorophyll synthetase family protein [Populus trichocarpa]
Length=372

 Score =   266 bits (680),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  217  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSIEG  276

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLS+AGYL + GKPYYALAL+GL  PQI FQ
Sbjct  277  DRALGLQSLPVAFGAETAKWICVGAIDITQLSIAGYLLADGKPYYALALVGLIIPQIVFQ  336

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  337  FQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  372



>gb|KFK34425.1| hypothetical protein AALP_AA5G143300 [Arabis alpina]
Length=372

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  217  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  276

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG+E AKWICVGAID+TQLSVAGYL + GKPYYALALL L  PQI FQ
Sbjct  277  DRAMGLQSLPVAFGTENAKWICVGAIDVTQLSVAGYLLASGKPYYALALLALIIPQIVFQ  336

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLG+ VTALA+SH
Sbjct  337  FKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASSH  372



>ref|XP_002530507.1| bacteriochlorophyll synthase, putative [Ricinus communis]
 gb|EEF31891.1| bacteriochlorophyll synthase, putative [Ricinus communis]
Length=344

 Score =   265 bits (677),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  189  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSIEG  248

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG+ETAKWICVGAID+TQ+SVAGYL   GKPYYALALL L  PQ+ FQ
Sbjct  249  DRAMGLQSLPVAFGAETAKWICVGAIDITQISVAGYLLGAGKPYYALALLALIIPQVVFQ  308

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  309  FQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  344



>ref|XP_010515617.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X2 
[Camelina sativa]
Length=379

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  224  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  283

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL + GKPYYALALL L  PQI FQ
Sbjct  284  DRALGLQSLPVAFGTETAKWICVGAIDVTQLSVAGYLLASGKPYYALALLALIIPQIVFQ  343

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FKYFLKDPVKYDVKYQASAQPF
Sbjct  344  FKYFLKDPVKYDVKYQASAQPF  365



>ref|XP_004302558.1| PREDICTED: chlorophyll synthase, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=374

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYI LPWWAGQALFGTLTPD++VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  219  LKQNGWIGNFALGASYIGLPWWAGQALFGTLTPDIVVLTLLYSIAGLGIAIVNDFKSVEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG ETAKWICVGAID+TQLSVAGYL   GKPYYALAL+ L APQ+FFQ
Sbjct  279  DRALGLQSLPVAFGPETAKWICVGAIDITQLSVAGYLLGAGKPYYALALVALIAPQVFFQ  338

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLG+LVTALATSH
Sbjct  339  FKYFLKDPVKYDVKYQASAQPFLVLGILVTALATSH  374



>gb|EEC79019.1| hypothetical protein OsI_19554 [Oryza sativa Indica Group]
Length=359

 Score =   265 bits (678),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYI LPWWAGQALFGTLTPD++VLT LYSIAGLGIAIVNDFKS+EG
Sbjct  204  LKQNGWIGNFALGASYIGLPWWAGQALFGTLTPDIVVLTSLYSIAGLGIAIVNDFKSVEG  263

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG ETAKWICVGAID+TQLSVAGYLFS GKPYYALALLGLT PQ+ FQ
Sbjct  264  DRALGLQSLPVAFGMETAKWICVGAIDITQLSVAGYLFSSGKPYYALALLGLTIPQVVFQ  323

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPF VLGLLVTALATSH
Sbjct  324  FQYFLKDPVKYDVKYQASAQPFFVLGLLVTALATSH  359



>ref|XP_011004739.1| PREDICTED: chlorophyll synthase, chloroplastic isoform X1 [Populus 
euphratica]
 ref|XP_011004740.1| PREDICTED: chlorophyll synthase, chloroplastic isoform X1 [Populus 
euphratica]
Length=374

 Score =   266 bits (679),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  219  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSIEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFG+ETAKWICVGAID+TQ+SVAGYL   GKPYYALALLGL  PQ+FFQ
Sbjct  279  DRLLGLQSLPVAFGAETAKWICVGAIDVTQISVAGYLLGAGKPYYALALLGLIIPQVFFQ  338

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  339  FQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  374



>emb|CDX78042.1| BnaA09g32370D [Brassica napus]
Length=387

 Score =   266 bits (680),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  232  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  291

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG+E AKWICVGAID+TQLSVAGYL + GKPYYALALL L  PQI FQ
Sbjct  292  DRAMGLQSLPVAFGTEAAKWICVGAIDVTQLSVAGYLLASGKPYYALALLALIIPQIVFQ  351

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLG+ VTALA+SH
Sbjct  352  FKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASSH  387



>emb|CDX73689.1| BnaC08g23140D [Brassica napus]
Length=387

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  232  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  291

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG+E AKWICVGAID+TQLSVAGYL + GKPYYALALL L  PQI FQ
Sbjct  292  DRAMGLQSLPVAFGTEAAKWICVGAIDVTQLSVAGYLLASGKPYYALALLALIIPQIVFQ  351

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLG+ VTALA+SH
Sbjct  352  FKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASSH  387



>ref|XP_010503882.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Camelina 
sativa]
Length=389

 Score =   266 bits (680),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  234  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  293

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL + GKPYYALALL L  PQI FQ
Sbjct  294  DRALGLQSLPVAFGTETAKWICVGAIDVTQLSVAGYLLASGKPYYALALLALIIPQIVFQ  353

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FKYFLKDPVKYDVKYQASAQPF
Sbjct  354  FKYFLKDPVKYDVKYQASAQPF  375



>gb|KDO56701.1| hypothetical protein CISIN_1g017282mg [Citrus sinensis]
Length=374

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  219  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG ETAKWICVGAID+TQ+SVAGYL   GKPYYALALL L  PQI FQ
Sbjct  279  DRAMGLQSLPVAFGPETAKWICVGAIDITQISVAGYLLGAGKPYYALALLALIVPQIVFQ  338

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDP+KYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  339  FQYFLKDPIKYDVKYQASAQPFLILGLLVTALATSH  374



>ref|XP_010426759.1| PREDICTED: chlorophyll synthase, chloroplastic [Camelina sativa]
Length=389

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  234  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  293

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL + GKPYYALALL L  PQI FQ
Sbjct  294  DRALGLQSLPVAFGTETAKWICVGAIDVTQLSVAGYLLASGKPYYALALLALIIPQIVFQ  353

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FKYFLKDPVKYDVKYQASAQPF
Sbjct  354  FKYFLKDPVKYDVKYQASAQPF  375



>ref|XP_006429429.1| hypothetical protein CICLE_v10011985mg [Citrus clementina]
 ref|XP_006481064.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Citrus sinensis]
 gb|ESR42669.1| hypothetical protein CICLE_v10011985mg [Citrus clementina]
Length=374

 Score =   265 bits (678),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  219  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG ETAKWICVGAID+TQ+SVAGYL   GKPYYALALL L  PQI FQ
Sbjct  279  DRAMGLQSLPVAFGPETAKWICVGAIDITQISVAGYLLGAGKPYYALALLALIVPQIVFQ  338

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDP+KYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  339  FQYFLKDPIKYDVKYQASAQPFLILGLLVTALATSH  374



>ref|XP_010515616.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X1 
[Camelina sativa]
Length=389

 Score =   266 bits (679),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  234  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  293

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL + GKPYYALALL L  PQI FQ
Sbjct  294  DRALGLQSLPVAFGTETAKWICVGAIDVTQLSVAGYLLASGKPYYALALLALIIPQIVFQ  353

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FKYFLKDPVKYDVKYQASAQPF
Sbjct  354  FKYFLKDPVKYDVKYQASAQPF  375



>ref|NP_001055272.1| Os05g0349700 [Oryza sativa Japonica Group]
 sp|Q5W6H5.1|CHLG_ORYSJ RecName: Full=Chlorophyll synthase, chloroplastic; AltName: Full=Polyprenyl 
transferase; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAV44065.1| putative chlorophyll synthase [Oryza sativa Japonica Group]
 dbj|BAF17186.1| Os05g0349700 [Oryza sativa Japonica Group]
 gb|ABO31092.1| chlorophyll synthase [Oryza sativa Indica Group]
 dbj|BAG93860.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE63355.1| hypothetical protein OsJ_18166 [Oryza sativa Japonica Group]
Length=376

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYI LPWWAGQALFGTLTPD++VLT LYSIAGLGIAIVNDFKS+EG
Sbjct  221  LKQNGWIGNFALGASYIGLPWWAGQALFGTLTPDIVVLTSLYSIAGLGIAIVNDFKSVEG  280

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG ETAKWICVGAID+TQLSVAGYLFS GKPYYALALLGLT PQ+ FQ
Sbjct  281  DRALGLQSLPVAFGMETAKWICVGAIDITQLSVAGYLFSSGKPYYALALLGLTIPQVVFQ  340

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPF VLGLLVTALATSH
Sbjct  341  FQYFLKDPVKYDVKYQASAQPFFVLGLLVTALATSH  376



>ref|XP_006292505.1| hypothetical protein CARUB_v10018735mg [Capsella rubella]
 gb|EOA25403.1| hypothetical protein CARUB_v10018735mg [Capsella rubella]
Length=389

 Score =   266 bits (679),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  234  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  293

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL + GKPYYALALL L  PQI FQ
Sbjct  294  DRALGLQSLPVAFGTETAKWICVGAIDVTQLSVAGYLLASGKPYYALALLALIIPQIVFQ  353

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FKYFLKDPVKYDVKYQASAQPF
Sbjct  354  FKYFLKDPVKYDVKYQASAQPF  375



>gb|KHN20314.1| Chlorophyll synthase, chloroplastic [Glycine soja]
Length=377

 Score =   265 bits (678),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  222  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  281

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL    KP+YALALLGL  PQ+FFQ
Sbjct  282  DRALGLQSLPVAFGAETAKWICVGAIDITQLSVAGYLLGADKPFYALALLGLIIPQVFFQ  341

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFL+DPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  342  FKYFLQDPVKYDVKYQASAQPFLVLGLLVTALATSH  377



>ref|XP_003552261.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Glycine 
max]
Length=377

 Score =   265 bits (677),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  222  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  281

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL    KP+YALALLGL  PQ+FFQ
Sbjct  282  DRALGLQSLPVAFGAETAKWICVGAIDITQLSVAGYLLGADKPFYALALLGLIIPQVFFQ  341

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFL+DPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  342  FKYFLQDPVKYDVKYQASAQPFLVLGLLVTALATSH  377



>ref|NP_190750.1| chlorophyll synthase [Arabidopsis thaliana]
 sp|Q38833.1|CHLG_ARATH RecName: Full=Chlorophyll synthase, chloroplastic; AltName: Full=Polyprenyl 
transferase; AltName: Full=Protein G4; Short=AtG4; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAA96740.1| putative chlorophyll synthetase [Arabidopsis thaliana]
 gb|AAC14409.1| putative chlorophyll synthetase [Arabidopsis thaliana]
 gb|AAK68761.1| putative chlorophyll synthetase [Arabidopsis thaliana]
 gb|AAM10043.1| chlorophyll synthetase [Arabidopsis thaliana]
 gb|AEE78848.1| chlorophyll synthase [Arabidopsis thaliana]
Length=387

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  232  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  291

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL + GKPYYALAL+ L  PQI FQ
Sbjct  292  DRALGLQSLPVAFGTETAKWICVGAIDITQLSVAGYLLASGKPYYALALVALIIPQIVFQ  351

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FKYFLKDPVKYDVKYQASAQPF
Sbjct  352  FKYFLKDPVKYDVKYQASAQPF  373



>ref|XP_002877826.1| ATG4/CHLG/G4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54085.1| ATG4/CHLG/G4 [Arabidopsis lyrata subsp. lyrata]
Length=387

 Score =   265 bits (677),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  232  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  291

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL + GKPYYALAL+ L  PQI FQ
Sbjct  292  DRALGLQSLPVAFGTETAKWICVGAIDVTQLSVAGYLLASGKPYYALALVALIIPQIVFQ  351

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FKYFLKDPVKYDVKYQASAQPF
Sbjct  352  FKYFLKDPVKYDVKYQASAQPF  373



>ref|XP_003547859.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform 1 
[Glycine max]
Length=378

 Score =   265 bits (676),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  223  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  282

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL    KP+YALALLGL  PQ+FFQ
Sbjct  283  DRALGLQSLPVAFGAETAKWICVGAIDITQLSVAGYLLGADKPFYALALLGLIIPQVFFQ  342

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYF KDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  343  FKYFRKDPVKYDVKYQASAQPFLVLGLLVTALATSH  378



>ref|XP_009123759.1| PREDICTED: chlorophyll synthase, chloroplastic [Brassica rapa]
 emb|CDY33261.1| BnaA01g19280D [Brassica napus]
Length=388

 Score =   265 bits (676),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  233  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  292

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG+E AKWICV AID+TQLSVAGYL + GKPYYALALL L  PQI FQ
Sbjct  293  DRAMGLQSLPVAFGTEAAKWICVSAIDVTQLSVAGYLLASGKPYYALALLALIIPQIVFQ  352

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLG+ VTALA+SH
Sbjct  353  FKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASSH  388



>ref|XP_003547860.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform 2 
[Glycine max]
Length=342

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  187  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  246

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL    KP+YALALLGL  PQ+FFQ
Sbjct  247  DRALGLQSLPVAFGAETAKWICVGAIDITQLSVAGYLLGADKPFYALALLGLIIPQVFFQ  306

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYF KDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  307  FKYFRKDPVKYDVKYQASAQPFLVLGLLVTALATSH  342



>ref|XP_002263271.1| PREDICTED: chlorophyll synthase, chloroplastic [Vitis vinifera]
 emb|CBI22813.3| unnamed protein product [Vitis vinifera]
Length=370

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTL PD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  215  LKQNGWIGNFALGASYISLPWWAGQALFGTLNPDIIVLTLLYSIAGLGIAIVNDFKSVEG  274

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL   GKPYYALAL+GL  PQ+ FQ
Sbjct  275  DRALGLQSLPVAFGAETAKWICVGAIDITQLSVAGYLLGAGKPYYALALVGLIIPQVIFQ  334

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  335  FQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  370



>gb|KJB76988.1| hypothetical protein B456_012G116000 [Gossypium raimondii]
Length=379

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD++VLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  224  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIVVLTLLYSIAGLGIAIVNDFKSIEG  283

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+A+GLQSLPVAFG+ETAKWICVGAID+TQLS+AGYL   GKPYYALAL+GL  PQ+ FQ
Sbjct  284  DKALGLQSLPVAFGAETAKWICVGAIDITQLSIAGYLLGAGKPYYALALVGLIVPQVVFQ  343

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  344  FQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  379



>gb|KJB76987.1| hypothetical protein B456_012G116000 [Gossypium raimondii]
Length=380

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD++VLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  225  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIVVLTLLYSIAGLGIAIVNDFKSIEG  284

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+A+GLQSLPVAFG+ETAKWICVGAID+TQLS+AGYL   GKPYYALAL+GL  PQ+ FQ
Sbjct  285  DKALGLQSLPVAFGAETAKWICVGAIDITQLSIAGYLLGAGKPYYALALVGLIVPQVVFQ  344

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  345  FQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  380



>gb|KJB76985.1| hypothetical protein B456_012G116000 [Gossypium raimondii]
Length=379

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD++VLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  224  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIVVLTLLYSIAGLGIAIVNDFKSIEG  283

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+A+GLQSLPVAFG+ETAKWICVGAID+TQLS+AGYL   GKPYYALAL+GL  PQ+ FQ
Sbjct  284  DKALGLQSLPVAFGAETAKWICVGAIDITQLSIAGYLLGAGKPYYALALVGLIVPQVVFQ  343

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  344  FQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  379



>ref|XP_008388266.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Malus domestica]
Length=374

 Score =   263 bits (671),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+I LTLLYSIAGLGIAIVNDFKS+EG
Sbjct  219  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIXLTLLYSIAGLGIAIVNDFKSVEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFGSETAKWICV AID+TQLS+AGYL   GKPY+ALALL L  PQ+FFQ
Sbjct  279  DRELGLQSLPVAFGSETAKWICVXAIDITQLSIAGYLLGAGKPYHALALLALIGPQVFFQ  338

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  339  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  374



>emb|CDY16289.1| BnaC01g23240D [Brassica napus]
Length=389

 Score =   263 bits (672),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  234  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  293

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+E AKWICV AID+TQLSVAGYL + GKPYYALALL L  PQI FQ
Sbjct  294  DRALGLQSLPVAFGTEAAKWICVSAIDVTQLSVAGYLLASGKPYYALALLALIIPQIVFQ  353

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLG+ VTALA+SH
Sbjct  354  FKYFLKDPVKYDVKYQASAQPFLVLGIFVTALASSH  389



>ref|NP_001142204.1| hypothetical protein [Zea mays]
 gb|ACF87878.1| unknown [Zea mays]
 gb|AFW77737.1| hypothetical protein ZEAMMB73_088631 [Zea mays]
Length=378

 Score =   261 bits (668),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLT LYSIAGLGIAIVNDFKSIEG
Sbjct  223  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTTLYSIAGLGIAIVNDFKSIEG  282

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFG ETAKWICVGAID+TQLSVAGYL S GK YYAL LLGLT PQ+FFQ
Sbjct  283  DRTLGLQSLPVAFGMETAKWICVGAIDITQLSVAGYLLSTGKLYYALVLLGLTIPQVFFQ  342

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPF VLGLLVTALATSH
Sbjct  343  FQYFLKDPVKYDVKYQASAQPFFVLGLLVTALATSH  378



>ref|XP_010264596.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X2 
[Nelumbo nucifera]
Length=375

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  220  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSIEG  279

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG +TAKWICVGAID+TQ+SVAGYL   GKPYYALALL L  PQ+ FQ
Sbjct  280  DRALGLQSLPVAFGVDTAKWICVGAIDITQISVAGYLLGSGKPYYALALLALIIPQVVFQ  339

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDP+KYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  340  FQYFLKDPIKYDVKYQASAQPFLVLGLLVTALATSH  375



>ref|XP_009376426.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X1 
[Pyrus x bretschneideri]
Length=374

 Score =   261 bits (667),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  219  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFGSETAKWICVGAID+TQLSVAGYL   GKPYYALALL L APQ+FFQ
Sbjct  279  DRAMGLQSLPVAFGSETAKWICVGAIDITQLSVAGYLLGAGKPYYALALLALIAPQVFFQ  338

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  339  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  374



>ref|XP_009376427.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X2 
[Pyrus x bretschneideri]
Length=373

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  218  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  277

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFGSETAKWICVGAID+TQLSVAGYL   GKPYYALALL L APQ+FFQ
Sbjct  278  DRAMGLQSLPVAFGSETAKWICVGAIDITQLSVAGYLLGAGKPYYALALLALIAPQVFFQ  337

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  338  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  373



>ref|XP_010264595.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X1 
[Nelumbo nucifera]
Length=376

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  221  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSIEG  280

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG +TAKWICVGAID+TQ+SVAGYL   GKPYYALALL L  PQ+ FQ
Sbjct  281  DRALGLQSLPVAFGVDTAKWICVGAIDITQISVAGYLLGSGKPYYALALLALIIPQVVFQ  340

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDP+KYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  341  FQYFLKDPIKYDVKYQASAQPFLVLGLLVTALATSH  376



>gb|ADK95060.1| chloroplast chlorophyll synthase [Gossypium hirsutum]
Length=379

 Score =   261 bits (666),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD++VLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  224  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIVVLTLLYSIAGLGIAIVNDFKSIEG  283

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+A+GLQSLPVAFG+ETAKWICVGAID+TQLS+AGYL   GKPYYALAL+ L  PQ+ FQ
Sbjct  284  DKALGLQSLPVAFGAETAKWICVGAIDITQLSIAGYLLGAGKPYYALALVALIFPQVVFQ  343

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  344  FQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  379



>gb|KHG08192.1| Chlorophyll synthase, chloroplastic -like protein [Gossypium 
arboreum]
Length=379

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD++VLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  224  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIVVLTLLYSIAGLGIAIVNDFKSIEG  283

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+A+GLQSLPVAFG+ETAKWICVGAID+TQLS+AGYL   GKPYYALAL+ L  PQ+ FQ
Sbjct  284  DKALGLQSLPVAFGAETAKWICVGAIDITQLSIAGYLLGAGKPYYALALVALIFPQVVFQ  343

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  344  FQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  379



>gb|EPS69266.1| hypothetical protein M569_05500, partial [Genlisea aurea]
Length=383

 Score =   260 bits (665),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 141/161 (88%), Positives = 149/161 (93%), Gaps = 5/161 (3%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+I+LTLLYSIAGLGIAIVNDFKSIEG
Sbjct  223  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIILTLLYSIAGLGIAIVNDFKSIEG  282

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAG-----YLFSVGKPYYALALLGLTAP  447
            D  MGLQSLPVAFG ETAKWICVGAIDLTQ+SVAG     YL   GKPYYALALLGL AP
Sbjct  283  DTKMGLQSLPVAFGIETAKWICVGAIDLTQISVAGMNQSCYLLGSGKPYYALALLGLIAP  342

Query  446  QIFFQFKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            Q+FFQFKYFL+DPVKYDVKYQASAQPFL++GLLVTALATSH
Sbjct  343  QVFFQFKYFLRDPVKYDVKYQASAQPFLIMGLLVTALATSH  383



>ref|XP_008362312.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X1 
[Malus domestica]
Length=374

 Score =   260 bits (664),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  219  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFGSETAKWICVGAID+TQLSVAGYL + GKPYYALALL L APQ+FFQ
Sbjct  279  DRALGLQSLPVAFGSETAKWICVGAIDITQLSVAGYLLAAGKPYYALALLALIAPQVFFQ  338

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  339  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  374



>ref|XP_008362316.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X2 
[Malus domestica]
Length=373

 Score =   260 bits (664),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  218  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  277

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFGSETAKWICVGAID+TQLSVAGYL + GKPYYALALL L APQ+FFQ
Sbjct  278  DRALGLQSLPVAFGSETAKWICVGAIDITQLSVAGYLLAAGKPYYALALLALIAPQVFFQ  337

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  338  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  373



>ref|XP_007205301.1| hypothetical protein PRUPE_ppa006764mg [Prunus persica]
 gb|EMJ06500.1| hypothetical protein PRUPE_ppa006764mg [Prunus persica]
Length=396

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 132/140 (94%), Gaps = 0/140 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  251  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  310

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFGSETAKWICVGAID+TQLS+AGYL   GKPYYALAL+ L APQ+FFQ
Sbjct  311  DRAMGLQSLPVAFGSETAKWICVGAIDITQLSIAGYLLGAGKPYYALALVALIAPQVFFQ  370

Query  431  FKYFLKDPVKYDVKYQASAQ  372
            FKYFLKDPVKYDVKYQ   Q
Sbjct  371  FKYFLKDPVKYDVKYQVLLQ  390



>gb|KEH23213.1| bacteriochlorophyll synthase, putative [Medicago truncatula]
Length=378

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  223  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSVEG  282

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFGSETAKWICVGAID+TQLSVAGYL   GKPYYALALL L APQ+FFQ
Sbjct  283  DRALGLQSLPVAFGSETAKWICVGAIDITQLSVAGYLLGAGKPYYALALLALIAPQVFFQ  342

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  343  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  378



>gb|KEH23212.1| bacteriochlorophyll synthase, putative [Medicago truncatula]
Length=377

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  222  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSVEG  281

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFGSETAKWICVGAID+TQLSVAGYL   GKPYYALALL L APQ+FFQ
Sbjct  282  DRALGLQSLPVAFGSETAKWICVGAIDITQLSVAGYLLGAGKPYYALALLALIAPQVFFQ  341

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  342  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  377



>gb|ABR18193.1| unknown [Picea sitchensis]
Length=388

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALGSSYI LPWWAGQALFGTL PD++VLT+LYSIAGLGIAI+NDFKSIEG
Sbjct  233  LKQNGWIGNFALGSSYICLPWWAGQALFGTLKPDIMVLTVLYSIAGLGIAIINDFKSIEG  292

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG +TAKWICVGAID+TQLS+AGYLF+ GK YYALALLGL  PQI  Q
Sbjct  293  DRAMGLQSLPVAFGVDTAKWICVGAIDITQLSIAGYLFATGKQYYALALLGLITPQIILQ  352

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDP+KYDVKYQASAQPFLVLGLL TALATSH
Sbjct  353  FQYFLKDPIKYDVKYQASAQPFLVLGLLCTALATSH  388



>gb|ACN41022.1| unknown [Picea sitchensis]
Length=388

 Score =   259 bits (662),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALGSSYI LPWWAGQALFGTL PD++VLT+LYSIAGLGIAI+NDFKSIEG
Sbjct  233  LKQNGWIGNFALGSSYICLPWWAGQALFGTLKPDIMVLTVLYSIAGLGIAIINDFKSIEG  292

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG +TAKWICVGAID+TQLS+AGYLF+ GK YYALALLGL  PQI  Q
Sbjct  293  DRAMGLQSLPVAFGVDTAKWICVGAIDITQLSIAGYLFATGKQYYALALLGLITPQIILQ  352

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDP+KYDVKYQASAQPFLVLGLL TALATSH
Sbjct  353  FQYFLKDPIKYDVKYQASAQPFLVLGLLCTALATSH  388



>ref|XP_008792890.1| PREDICTED: chlorophyll synthase, chloroplastic [Phoenix dactylifera]
Length=374

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQ+LFGTLTPD+IVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  219  LKQNGWIGNFALGASYISLPWWAGQSLFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSIEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG +TAKWIC GAID+TQLS+AGYL   GKP YALALLGL  PQ+ FQ
Sbjct  279  DRALGLQSLPVAFGIDTAKWICAGAIDITQLSIAGYLLGAGKPLYALALLGLIIPQVVFQ  338

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  339  FQYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH  374



>ref|XP_006655220.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Oryza brachyantha]
Length=337

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYI LPWWAGQALFGTLTPD+++LT LYSIAGLGIAIVNDFKS+EG
Sbjct  182  LKQNGWIGNFALGASYIGLPWWAGQALFGTLTPDIVILTSLYSIAGLGIAIVNDFKSVEG  241

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG ETAKWICVGAID+TQLSVAGYL+  GKPYYALALLGLT PQ+ FQ
Sbjct  242  DRALGLQSLPVAFGMETAKWICVGAIDITQLSVAGYLWITGKPYYALALLGLTIPQVVFQ  301

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
             +YFLKDPVKYDVKYQASAQPF VLGLLVTALATSH
Sbjct  302  VQYFLKDPVKYDVKYQASAQPFFVLGLLVTALATSH  337



>ref|XP_009421398.1| PREDICTED: chlorophyll synthase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=385

 Score =   258 bits (659),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTL PD+IVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  230  LKQNGWIGNFALGASYISLPWWAGQALFGTLNPDIIVLTLLYSIAGLGIAIVNDFKSIEG  289

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG +TAKWICVGAID+TQLSVAGYL    KP+YALALLGL  PQ++FQ
Sbjct  290  DRAMGLQSLPVAFGIDTAKWICVGAIDITQLSVAGYLLGADKPFYALALLGLILPQVYFQ  349

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVK DVKYQASAQPFL+LGLLVTALA SH
Sbjct  350  FQYFLKDPVKNDVKYQASAQPFLILGLLVTALAISH  385



>ref|XP_009348553.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X2 
[Pyrus x bretschneideri]
Length=370

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 146/156 (94%), Gaps = 4/156 (3%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  219  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFGSETAKWICVGAID+TQLS+ G     GKPYYALALL L  PQ+FFQ
Sbjct  279  DRELGLQSLPVAFGSETAKWICVGAIDITQLSIVG----AGKPYYALALLALIGPQVFFQ  334

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  335  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  370



>ref|XP_009338148.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X2 
[Pyrus x bretschneideri]
Length=370

 Score =   257 bits (657),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 146/156 (94%), Gaps = 4/156 (3%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  219  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFGSETAKWICVGAID+TQLS+ G     GKPYYALALL L  PQ+FFQ
Sbjct  279  DRELGLQSLPVAFGSETAKWICVGAIDITQLSIVG----AGKPYYALALLALIGPQVFFQ  334

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  335  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  370



>ref|XP_006843631.1| PREDICTED: chlorophyll synthase, chloroplastic [Amborella trichopoda]
 gb|ERN05306.1| hypothetical protein AMTR_s00007p00156370 [Amborella trichopoda]
Length=390

 Score =   258 bits (658),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPDVIVLT+LYSIAGLGIAI+NDFKSIEG
Sbjct  235  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDVIVLTVLYSIAGLGIAIINDFKSIEG  294

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG +TAKWICVGAID+TQ+SVAGYL + GK YYALAL+GL  PQ+ FQ
Sbjct  295  DRALGLQSLPVAFGVDTAKWICVGAIDITQISVAGYLLATGKTYYALALMGLVIPQMIFQ  354

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDP+KYDVKYQASAQPFLVLG+LVTALA SH
Sbjct  355  FQYFLKDPIKYDVKYQASAQPFLVLGILVTALAYSH  390



>ref|XP_010920818.1| PREDICTED: chlorophyll synthase, chloroplastic [Elaeis guineensis]
Length=373

 Score =   257 bits (656),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLT D+IVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  218  LKQNGWIGNFALGASYISLPWWAGQALFGTLTSDIIVLTLLYSIAGLGIAIVNDFKSIEG  277

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+A+GLQSLPVAFG +TAKWICVGAID+TQLS+AGYL   GKP YALALLGL  PQ+ FQ
Sbjct  278  DKALGLQSLPVAFGMDTAKWICVGAIDVTQLSIAGYLLGAGKPLYALALLGLIIPQVVFQ  337

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  338  FQYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH  373



>ref|XP_010253787.1| PREDICTED: chlorophyll synthase, chloroplastic isoform X1 [Nelumbo 
nucifera]
Length=395

 Score =   257 bits (656),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  240  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSIEG  299

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFG +TAKWICVGAID+TQ+SVAGYL   GK YYALALL L  PQ+ FQ
Sbjct  300  DRVLGLQSLPVAFGVDTAKWICVGAIDITQISVAGYLLGSGKSYYALALLALVIPQVVFQ  359

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDP+KYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  360  FQYFLKDPIKYDVKYQASAQPFLVLGLLVTALATSH  395



>ref|XP_010253788.1| PREDICTED: chlorophyll synthase, chloroplastic isoform X2 [Nelumbo 
nucifera]
Length=350

 Score =   255 bits (651),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  195  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSIEG  254

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFG +TAKWICVGAID+TQ+SVAGYL   GK YYALALL L  PQ+ FQ
Sbjct  255  DRVLGLQSLPVAFGVDTAKWICVGAIDITQISVAGYLLGSGKSYYALALLALVIPQVVFQ  314

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDP+KYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  315  FQYFLKDPIKYDVKYQASAQPFLVLGLLVTALATSH  350



>ref|XP_004492465.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X1 
[Cicer arietinum]
Length=379

 Score =   255 bits (651),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  224  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  283

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL   GKPYYALALL L APQ+ FQ
Sbjct  284  DRALGLQSLPVAFGAETAKWICVGAIDITQLSVAGYLLGAGKPYYALALLALIAPQVIFQ  343

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  344  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  379



>ref|XP_004492466.1| PREDICTED: chlorophyll synthase, chloroplastic-like isoform X2 
[Cicer arietinum]
Length=378

 Score =   255 bits (651),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  223  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSVEG  282

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL   GKPYYALALL L APQ+ FQ
Sbjct  283  DRALGLQSLPVAFGAETAKWICVGAIDITQLSVAGYLLGAGKPYYALALLALIAPQVIFQ  342

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  343  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  378



>ref|XP_010528999.1| PREDICTED: chlorophyll synthase, chloroplastic [Tarenaya hassleriana]
Length=388

 Score =   255 bits (651),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GNFALG+SYISLPWWAGQALFGTLTPDV+VLTLLYSIAGLGIAIVNDFKS+EG
Sbjct  233  LKQNGWVGNFALGASYISLPWWAGQALFGTLTPDVVVLTLLYSIAGLGIAIVNDFKSVEG  292

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLS+AGYL + GKPYYALALL LT PQ+FFQ
Sbjct  293  DRALGLQSLPVAFGTETAKWICVGAIDITQLSIAGYLLASGKPYYALALLALTLPQVFFQ  352

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPV+YDVKYQASAQPFLVLG+ VTALATSH
Sbjct  353  FKYFLKDPVQYDVKYQASAQPFLVLGIFVTALATSH  388



>ref|XP_012089823.1| PREDICTED: chlorophyll synthase, chloroplastic [Jatropha curcas]
 gb|KDP22871.1| hypothetical protein JCGZ_00458 [Jatropha curcas]
Length=373

 Score =   254 bits (648),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  218  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSIEG  277

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQ+S+AGYL   GKPYYALALL L  PQ+FFQ
Sbjct  278  DRALGLQSLPVAFGAETAKWICVGAIDITQISIAGYLLGAGKPYYALALLALILPQVFFQ  337

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDP KYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  338  FQYFLKDPAKYDVKYQASAQPFLVLGLLVTALATSH  373



>ref|XP_007026650.1| UbiA prenyltransferase family protein isoform 2 [Theobroma cacao]
 gb|EOY07152.1| UbiA prenyltransferase family protein isoform 2 [Theobroma cacao]
Length=381

 Score =   254 bits (648),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 146/157 (93%), Gaps = 1/157 (1%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW GNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAG GIAIVNDFKS+EG
Sbjct  225  LKQNGWFGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGFGIAIVNDFKSVEG  284

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFF-  435
            D+A+GLQS+PVAFG+ETAKWICVGAID+TQ+SVAGYL   GKPYYALALL L  PQ+ F 
Sbjct  285  DKALGLQSIPVAFGAETAKWICVGAIDITQISVAGYLLGAGKPYYALALLALIVPQVVFQ  344

Query  434  QFKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            QF+YFLKDPVKYDVKYQASAQPFLVLGLLVTALA SH
Sbjct  345  QFQYFLKDPVKYDVKYQASAQPFLVLGLLVTALAMSH  381



>ref|XP_002322990.2| chlorophyll synthetase family protein, partial [Populus trichocarpa]
 gb|EEF04751.2| chlorophyll synthetase family protein, partial [Populus trichocarpa]
Length=319

 Score =   250 bits (639),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLG+AIVNDFKSIEG
Sbjct  184  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGVAIVNDFKSIEG  243

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFG+ETAKWICVGAID+TQ+SVAGYL   GKPYYALALLGL  PQ+FFQ
Sbjct  244  DRLLGLQSLPVAFGAETAKWICVGAIDITQISVAGYLLGAGKPYYALALLGLIIPQVFFQ  303

Query  431  FKYFLKDPVKYDVKYQ  384
            F+YFLKDPVKYDV+YQ
Sbjct  304  FQYFLKDPVKYDVRYQ  319



>gb|KJB76986.1| hypothetical protein B456_012G116000 [Gossypium raimondii]
 gb|KJB76989.1| hypothetical protein B456_012G116000 [Gossypium raimondii]
Length=373

 Score =   252 bits (643),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 131/138 (95%), Gaps = 0/138 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD++VLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  224  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIVVLTLLYSIAGLGIAIVNDFKSIEG  283

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+A+GLQSLPVAFG+ETAKWICVGAID+TQLS+AGYL   GKPYYALAL+GL  PQ+ FQ
Sbjct  284  DKALGLQSLPVAFGAETAKWICVGAIDITQLSIAGYLLGAGKPYYALALVGLIVPQVVFQ  343

Query  431  FKYFLKDPVKYDVKYQAS  378
            F+YFLKDPVKYDVKYQ +
Sbjct  344  FQYFLKDPVKYDVKYQVN  361



>gb|KCW88147.1| hypothetical protein EUGRSUZ_A00535 [Eucalyptus grandis]
Length=376

 Score =   249 bits (637),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYS+AGLGIAIVNDFKS+EG
Sbjct  221  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSLAGLGIAIVNDFKSVEG  280

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQS+PVAFG+ETAKWICVGAID+TQLSVAGYL   GKP+YALALL L APQ+  Q
Sbjct  281  DRAMGLQSIPVAFGAETAKWICVGAIDITQLSVAGYLLGAGKPFYALALLALIAPQVVLQ  340

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  341  FQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  376



>ref|XP_010032647.1| PREDICTED: chlorophyll synthase, chloroplastic [Eucalyptus grandis]
 gb|KCW88145.1| hypothetical protein EUGRSUZ_A00535 [Eucalyptus grandis]
 gb|KCW88146.1| hypothetical protein EUGRSUZ_A00535 [Eucalyptus grandis]
Length=378

 Score =   249 bits (637),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYS+AGLGIAIVNDFKS+EG
Sbjct  223  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSLAGLGIAIVNDFKSVEG  282

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQS+PVAFG+ETAKWICVGAID+TQLSVAGYL   GKP+YALALL L APQ+  Q
Sbjct  283  DRAMGLQSIPVAFGAETAKWICVGAIDITQLSVAGYLLGAGKPFYALALLALIAPQVVLQ  342

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  343  FQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  378



>ref|XP_007140250.1| hypothetical protein PHAVU_008G096500g [Phaseolus vulgaris]
 gb|ESW12244.1| hypothetical protein PHAVU_008G096500g [Phaseolus vulgaris]
Length=377

 Score =   247 bits (631),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD+IVLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  222  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIIVLTLLYSIAGLGIAIVNDFKSIEG  281

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG+ETAKWICVGAID+TQLSVAGYL    KP YALALL L  PQ+ FQ
Sbjct  282  DRALGLQSLPVAFGAETAKWICVGAIDITQLSVAGYLLGADKPLYALALLALIIPQVIFQ  341

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH
Sbjct  342  FKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH  377



>ref|XP_010676771.1| PREDICTED: chlorophyll synthase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   245 bits (625),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 146/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPD++VLTLLYSIAGLGIAIVNDFKSIEG
Sbjct  219  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDIVVLTLLYSIAGLGIAIVNDFKSIEG  278

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQS+PVAFG E AKWICVGAID+TQLSVAGYL   GKPYYALALLGL  PQ++FQ
Sbjct  279  DRAMGLQSIPVAFGIEAAKWICVGAIDITQLSVAGYLLGAGKPYYALALLGLLLPQVYFQ  338

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
             +Y L DP+KYDVKYQASAQPFL+LGLLVTALATSH
Sbjct  339  TQYVLTDPIKYDVKYQASAQPFLILGLLVTALATSH  374



>ref|XP_002440929.1| hypothetical protein SORBIDRAFT_09g016840 [Sorghum bicolor]
 gb|EES19359.1| hypothetical protein SORBIDRAFT_09g016840 [Sorghum bicolor]
Length=382

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD++VLT LYSIAGLGIAIVNDFKSIEG
Sbjct  227  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIVVLTTLYSIAGLGIAIVNDFKSIEG  286

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFG ETAKWICVGAID+TQLSVAGYL S GK YYALALLGLT PQ+FFQ
Sbjct  287  DRTLGLQSLPVAFGMETAKWICVGAIDITQLSVAGYLLSTGKLYYALALLGLTIPQVFFQ  346

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPF V GLLVTALATSH
Sbjct  347  FQYFLKDPVKYDVKYQASAQPFFVFGLLVTALATSH  382



>ref|XP_004971327.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Setaria 
italica]
Length=380

 Score =   244 bits (623),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYISLPWWAGQALFGTLTPD++VLT LYSIAGLGIAIVNDFKSIEG
Sbjct  225  LKQNGWIGNFALGASYISLPWWAGQALFGTLTPDIVVLTTLYSIAGLGIAIVNDFKSIEG  284

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG ETAKWICVGAID+TQLSVAGYL S GK YYALALLGLT PQ+ FQ
Sbjct  285  DRALGLQSLPVAFGMETAKWICVGAIDITQLSVAGYLLSTGKLYYALALLGLTIPQVVFQ  344

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPF VLGLLVTALATSH
Sbjct  345  FQYFLKDPVKYDVKYQASAQPFFVLGLLVTALATSH  380



>ref|XP_007026649.1| UbiA prenyltransferase family protein isoform 1 [Theobroma cacao]
 gb|EOY07151.1| UbiA prenyltransferase family protein isoform 1 [Theobroma cacao]
Length=407

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 145/183 (79%), Gaps = 27/183 (15%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPW---------------------------WAGQALFGTLTP  693
            LKQNGW GNFALG+SYISLP                            WAGQALFGTLTP
Sbjct  225  LKQNGWFGNFALGASYISLPCLFTLFGYVLKYVTYILDFHFVPNLANRWAGQALFGTLTP  284

Query  692  DVIVLTLLYSIAGLGIAIVNDFKSIEGDRAMGLQSLPVAFGSETAKWICVGAIDLTQLSV  513
            D+IVLTLLYSIAG GIAIVNDFKS+EGD+A+GLQS+PVAFG+ETAKWICVGAID+TQ+SV
Sbjct  285  DIIVLTLLYSIAGFGIAIVNDFKSVEGDKALGLQSIPVAFGAETAKWICVGAIDITQISV  344

Query  512  AGYLFSVGKPYYALALLGLTAPQIFFQFKYFLKDPVKYDVKYQASAQPFlvlgllvtala  333
            AGYL   GKPYYALALL L  PQ+ FQF+YFLKDPVKYDVKYQASAQPFLVLGLLVTALA
Sbjct  345  AGYLLGAGKPYYALALLALIVPQVVFQFQYFLKDPVKYDVKYQASAQPFLVLGLLVTALA  404

Query  332  TSH  324
             SH
Sbjct  405  MSH  407



>ref|XP_003568641.1| PREDICTED: chlorophyll synthase, chloroplastic [Brachypodium 
distachyon]
Length=377

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYI LPWWAGQALFGTLTPD++VLT LYSIAGLGIAIVNDFKSIEG
Sbjct  222  LKQNGWIGNFALGASYIGLPWWAGQALFGTLTPDIVVLTCLYSIAGLGIAIVNDFKSIEG  281

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFG +TAKWICVGAID+TQLSVAGYL S GK YYALALLGLT PQ+  Q
Sbjct  282  DRTLGLQSLPVAFGMDTAKWICVGAIDITQLSVAGYLLSTGKLYYALALLGLTIPQVILQ  341

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPF V GLLVTALATSH
Sbjct  342  FQYFLKDPVKYDVKYQASAQPFFVFGLLVTALATSH  377



>sp|Q9M3W5.1|CHLG_AVESA RecName: Full=Chlorophyll synthase, chloroplastic; AltName: Full=Polyprenyl 
transferase; Flags: Precursor [Avena sativa]
 emb|CAB85464.1| chlorophyll synthase [Avena sativa]
Length=378

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYI LPWWAGQALFGTLTPD++VLT LYSIAGLGIAIVNDFKSIEG
Sbjct  223  LKQNGWIGNFALGASYIGLPWWAGQALFGTLTPDIVVLTCLYSIAGLGIAIVNDFKSIEG  282

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFG ETAKWICVGAID+TQLSVA YL S GK YYALALLGLT PQ+  Q
Sbjct  283  DRTLGLQSLPVAFGMETAKWICVGAIDITQLSVAAYLLSTGKLYYALALLGLTIPQVILQ  342

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            F+YFLKDPVKYDVKYQASAQPF V GLLVTALATSH
Sbjct  343  FQYFLKDPVKYDVKYQASAQPFFVFGLLVTALATSH  378



>ref|XP_001752661.1| predicted protein [Physcomitrella patens]
 gb|EDQ82532.1| predicted protein [Physcomitrella patens]
Length=342

 Score =   225 bits (573),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQ+GWIGN+ALGSSYISLPWWAGQALFGTL+ DV++LTLLYS AGLGIAIVNDFKSIEG
Sbjct  187  LKQSGWIGNYALGSSYISLPWWAGQALFGTLSWDVVILTLLYSTAGLGIAIVNDFKSIEG  246

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR MGLQSLPVAFG +TAK+IC  +ID+TQL+VA Y+   GK YY L LL L  PQI  Q
Sbjct  247  DRQMGLQSLPVAFGIDTAKYICAASIDVTQLAVAAYILYQGKTYYGLGLLALIIPQIILQ  306

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            FKY L DPVKYDVKYQASAQPF V GLL+TALATSH
Sbjct  307  FKYLLVDPVKYDVKYQASAQPFFVFGLLLTALATSH  342



>gb|ADI46575.1| chlorophyll synthase subunit G [Vaucheria litorea]
 gb|ADI46576.1| chlorophyll synthase subunit G [Elysia chlorotica]
Length=266

 Score =   218 bits (555),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW GNFALGSSYISLPWW GQA+FG L   V+VLTLLYS AGLGIAIVNDFKS+EG
Sbjct  120  LKQNGWAGNFALGSSYISLPWWCGQAMFGELNLQVVVLTLLYSWAGLGIAIVNDFKSVEG  179

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG E AKWICV +ID+TQL +A +L+ +G+P YA  LLGL  PQI+ Q
Sbjct  180  DRAMGLQSLPVAFGIEKAKWICVSSIDITQLGIAAWLYYIGEPTYAFVLLGLILPQIYAQ  239

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FKYFL DPV+ DVKYQ  AQPF
Sbjct  240  FKYFLPDPVENDVKYQGFAQPF  261



>ref|XP_003058729.1| chlorophyll synthetase [Micromonas pusilla CCMP1545]
 gb|EEH57184.1| chlorophyll synthetase [Micromonas pusilla CCMP1545]
Length=361

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQ GW GN+ALG+SYI+LPWWAGQA+FG L+ DV+VLT+LYSIAGLGIAIVNDFKSIEG
Sbjct  199  LKQEGWRGNYALGASYIALPWWAGQAVFGELSLDVMVLTVLYSIAGLGIAIVNDFKSIEG  258

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR  GL SLPVAFG E AKWICVG+ID TQL+VAGYL ++G+  Y+ ALL L  PQIFFQ
Sbjct  259  DRQCGLMSLPVAFGVEKAKWICVGSIDATQLAVAGYLRTIGEVGYSNALLALIFPQIFFQ  318

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FK+FL DPVK DVKYQASAQPF
Sbjct  319  FKFFLPDPVKNDVKYQASAQPF  340



>ref|XP_002503017.1| chlorophyll synthetase [Micromonas sp. RCC299]
 gb|ACO64275.1| chlorophyll synthetase [Micromonas sp. RCC299]
Length=395

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQ GW GN+ALG+SYI+LPWWAGQA+FG L+ DV+V+T+LYSIAGLGIAIVNDFKSIEG
Sbjct  233  LKQEGWRGNYALGASYIALPWWAGQAVFGELSLDVMVMTVLYSIAGLGIAIVNDFKSIEG  292

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR MGL SLPVAFG E AKWICVG+ID TQL+VAGYL ++G+  Y+  LL L  PQIFFQ
Sbjct  293  DRQMGLMSLPVAFGVEKAKWICVGSIDATQLAVAGYLRAIGEVGYSNMLLALIFPQIFFQ  352

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FK+FL DP+K DVKYQASAQPF
Sbjct  353  FKFFLPDPIKNDVKYQASAQPF  374



>ref|XP_005650372.1| chlorophyll synthase [Coccomyxa subellipsoidea C-169]
 gb|EIE25828.1| chlorophyll synthase [Coccomyxa subellipsoidea C-169]
Length=395

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQ+GW GN+ALGSSYISLPWWAGQALFG LT DVIVLT+LYS AGLGIAIVNDFKSIEG
Sbjct  234  LKQSGWAGNYALGSSYISLPWWAGQALFGNLTLDVIVLTMLYSTAGLGIAIVNDFKSIEG  293

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLF-SVGKPYYALALLGLTAPQIFF  435
            DR MGL+SLPVAFG ETAKWI VG ID+TQ +VA YLF  + +P Y   L  L  PQIFF
Sbjct  294  DRKMGLESLPVAFGVETAKWITVGTIDVTQAAVAAYLFLGLNEPLYGAILTALILPQIFF  353

Query  434  QFKYFLKDPVKYDVKYQASAQPF  366
            Q+KYF+ DP+K DVKYQASAQPF
Sbjct  354  QYKYFIPDPIKNDVKYQASAQPF  376



>gb|AAP79186.1| chlorophyll synthetase [Bigelowiella natans]
Length=498

 Score =   222 bits (565),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQ+GW GN+ALGSSYI+LPWW GQA+FGTL   VIVL+LLYSIAGLGIAIVNDFKSIEG
Sbjct  340  LKQSGWAGNYALGSSYIALPWWCGQAMFGTLNAPVIVLSLLYSIAGLGIAIVNDFKSIEG  399

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFG +TAKW+C G+ID+TQL VA YL+S+G+  YA  L+ L  PQ+FFQ
Sbjct  400  DRKLGLQSLPVAFGVDTAKWLCAGSIDVTQLGVAAYLYSIGETTYANILIALILPQMFFQ  459

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
             KY LKDP+KYDV YQA++QPF
Sbjct  460  NKYLLKDPIKYDVNYQAASQPF  481



>ref|XP_005849286.1| hypothetical protein CHLNCDRAFT_34863 [Chlorella variabilis]
 gb|EFN57184.1| hypothetical protein CHLNCDRAFT_34863 [Chlorella variabilis]
Length=409

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 4/146 (3%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQ+GW GN+ALGSSYI+LPWWAGQALFGTLT DV+VLT+LYSIAGLGIAIVNDFKSIEG
Sbjct  217  LKQSGWAGNYALGSSYIALPWWAGQALFGTLTLDVMVLTVLYSIAGLGIAIVNDFKSIEG  276

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYL-FSVGKPYYALALLGLTAPQ---  444
            DRAMGLQSLPVAFG +TAKWICVG+ID+TQL+VA YL F + +P Y   LL L  PQ   
Sbjct  277  DRAMGLQSLPVAFGVDTAKWICVGSIDVTQLAVAAYLAFGLDEPVYGAVLLALILPQASR  336

Query  443  IFFQFKYFLKDPVKYDVKYQASAQPF  366
            I+ Q KYFL DPV  DVKYQASAQPF
Sbjct  337  IYAQIKYFLPDPVANDVKYQASAQPF  362



>ref|XP_005718121.1| chlorophyll a synthase [Chondrus crispus]
 emb|CDF38236.1| chlorophyll a synthase [Chondrus crispus]
Length=342

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW G++ALG+SYISLPWWAGQALFGTL    +VLTL YS AGLGIAI+NDFKS+EG
Sbjct  183  LKQNGWTGSYALGASYISLPWWAGQALFGTLDWKTMVLTLFYSFAGLGIAIINDFKSVEG  242

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA G+QSLPV FG +TAKWICVG ID+ QL VAG LF VG+  YA A++ L APQ+F Q
Sbjct  243  DRATGMQSLPVMFGIDTAKWICVGMIDIFQLLVAGILFGVGEKGYAAAIVALVAPQMFLQ  302

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
             KYFLKDPVKYDVKYQASAQPF
Sbjct  303  QKYFLKDPVKYDVKYQASAQPF  324



>emb|CBJ27235.1| Chlorophyll synthase, putative chloroplast precursor [Ectocarpus 
siliculosus]
Length=417

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYISLPWW GQA+FG L   V++LTLLYS AGLGIAIVNDFKS+EG
Sbjct  259  LKQNGWLGNYALGSSYISLPWWCGQAMFGELNIQVVILTLLYSWAGLGIAIVNDFKSVEG  318

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR MGLQSLPVAFG E AKW+CVG+ID TQL +A +L+ +G+P YA  L  L  PQ+F Q
Sbjct  319  DREMGLQSLPVAFGVEKAKWLCVGSIDATQLGIAAWLYYIGEPTYAAILTALVLPQVFAQ  378

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FKYFL DPV  DVKYQA+AQPF
Sbjct  379  FKYFLPDPVGNDVKYQATAQPF  400



>ref|XP_001701588.1| chlorophyll synthetase [Chlamydomonas reinhardtii]
 gb|EDO97346.1| chlorophyll synthetase [Chlamydomonas reinhardtii]
Length=383

 Score =   213 bits (541),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 119/143 (83%), Gaps = 1/143 (1%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQ+GW GN+ALGSSYI+LPWWAGQALFGTLT DV+ LT+ YS+AGLGIAIVNDFKSIEG
Sbjct  212  LKQSGWAGNYALGSSYIALPWWAGQALFGTLTLDVMALTIAYSLAGLGIAIVNDFKSIEG  271

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYL-FSVGKPYYALALLGLTAPQIFF  435
            DR MGLQSLPVAFG +TAKWICV  ID+TQL VA YL + + +  Y   LL L  PQI+F
Sbjct  272  DRQMGLQSLPVAFGVDTAKWICVSTIDVTQLGVAAYLAWGLHEELYGAVLLALILPQIYF  331

Query  434  QFKYFLKDPVKYDVKYQASAQPF  366
            Q+KYFL DP+  DVKYQASAQPF
Sbjct  332  QYKYFLPDPIANDVKYQASAQPF  354



>emb|CEG01395.1| UbiA prenyltransferase family, partial [Ostreococcus tauri]
Length=379

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK  GW G +ALG+SYI+LPWWAGQA FGTLTPDV+VLT+LYSIAGLGIAIVNDFKSIEG
Sbjct  218  LKAEGWKGCYALGASYIALPWWAGQATFGTLTPDVMVLTVLYSIAGLGIAIVNDFKSIEG  277

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFG E AKWI VG ID+TQL VA YL ++G+ +Y+  L  + APQI+ Q
Sbjct  278  DRKLGLQSLPVAFGVEKAKWITVGTIDITQLFVAFYLRAIGEEFYSNVLFCMIAPQIYAQ  337

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FK+FL DP+K DVKYQASAQPF
Sbjct  338  FKFFLPDPIKNDVKYQASAQPF  359



>ref|XP_002949134.1| hypothetical protein VOLCADRAFT_80530 [Volvox carteri f. nagariensis]
 gb|EFJ49627.1| hypothetical protein VOLCADRAFT_80530 [Volvox carteri f. nagariensis]
Length=380

 Score =   211 bits (538),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQ+GW GN+ALGSSYI+LPWWAGQALFGTLT DV+ LT+ YS+AGLGIAIVNDFKSIEG
Sbjct  212  LKQSGWAGNYALGSSYIALPWWAGQALFGTLTLDVMALTVAYSLAGLGIAIVNDFKSIEG  271

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYL-FSVGKPYYALALLGLTAPQIFF  435
            DR MGLQSLPVAFG +TAKWICV  ID+TQL VA YL F + +  YA  LLGL  PQ++F
Sbjct  272  DRKMGLQSLPVAFGVDTAKWICVSTIDVTQLGVAAYLAFGLHQYTYAGVLLGLILPQMYF  331

Query  434  QFKYFLKDPVKYDVKYQASAQPF  366
            Q KYF+ DP+  DVKYQASAQPF
Sbjct  332  QAKYFIPDPIANDVKYQASAQPF  354



>ref|XP_005822237.1| Chl synthetase [Guillardia theta CCMP2712]
 gb|EKX35257.1| Chl synthetase [Guillardia theta CCMP2712]
Length=405

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 117/144 (81%), Gaps = 2/144 (1%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFG--TLTPDVIVLTLLYSIAGLGIAIVNDFKSI  618
            LKQ+GWIGN+ALGSSYI+LPWW GQ  F   +  P V +LT+LYS AGLGIAIVNDFKSI
Sbjct  244  LKQSGWIGNYALGSSYIALPWWCGQVFFNQASFNPTVAILTILYSWAGLGIAIVNDFKSI  303

Query  617  EGDRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIF  438
            EGDR +GLQSLPV FG +TAKWICVG+ID TQL VAGYL S+G+  YAL LLGL  PQI+
Sbjct  304  EGDRELGLQSLPVQFGVDTAKWICVGSIDFTQLGVAGYLASIGETNYALVLLGLILPQIY  363

Query  437  FQFKYFLKDPVKYDVKYQASAQPF  366
             QF  FLKDP+  DVKYQA+AQPF
Sbjct  364  LQFTTFLKDPIANDVKYQAAAQPF  387



>ref|XP_007513709.1| bacteriochlorophyll/chlorophyll a synthase [Bathycoccus prasinos]
 emb|CCO16234.1| bacteriochlorophyll/chlorophyll a synthase [Bathycoccus prasinos]
Length=424

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK  GW G +ALGSSYI+LPWWAG A FG LTPDV+VLT+LYSIAGLGIAIVNDFKSIEG
Sbjct  262  LKAEGWKGCYALGSSYIALPWWAGMATFGQLTPDVMVLTVLYSIAGLGIAIVNDFKSIEG  321

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG E AKWI VG ID TQL VA YL  +G+ +Y+  L  L APQIF Q
Sbjct  322  DRALGLQSLPVAFGVEKAKWITVGTIDATQLFVAFYLRGIGEDFYSNVLFCLIAPQIFAQ  381

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FK+FL DP+K DVKYQA+AQPF
Sbjct  382  FKFFLPDPIKNDVKYQAAAQPF  403



>ref|XP_001419298.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97591.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=317

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK  GW G +ALGSSYI+LPWWAG A FG LTPDV+ LT+LYSIAGLGIAIVNDFKSIEG
Sbjct  155  LKAEGWKGCYALGSSYIALPWWAGMATFGQLTPDVMFLTVLYSIAGLGIAIVNDFKSIEG  214

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFG E AKWI V  ID+TQL VA YL ++G+  Y+  L  L  PQIFFQ
Sbjct  215  DRELGLQSLPVAFGIEKAKWITVSTIDITQLFVACYLRAIGEETYSNVLFCLIFPQIFFQ  274

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            FK+FL DP+K DVKYQASAQPF
Sbjct  275  FKFFLPDPIKNDVKYQASAQPF  296



>ref|XP_002985965.1| hypothetical protein SELMODRAFT_424937 [Selaginella moellendorffii]
 gb|EFJ13142.1| hypothetical protein SELMODRAFT_424937 [Selaginella moellendorffii]
Length=374

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 120/156 (77%), Positives = 129/156 (83%), Gaps = 16/156 (10%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQ+GWIGN+ALGSSYI+LPWWA QALFGTL+ DV+VLTLLYS AGLGIAIVNDFKSIEG
Sbjct  235  LKQSGWIGNYALGSSYIALPWWASQALFGTLSWDVVVLTLLYSTAGLGIAIVNDFKSIEG  294

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG +TAKWIC+G+IDLTQLSVAGYLF+ GK YYAL LLGL  PQI F 
Sbjct  295  DRAMGLQSLPVAFGIDTAKWICIGSIDLTQLSVAGYLFATGKLYYALTLLGLITPQIIF-  353

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
                           QASAQPF VLGLLVTALATSH
Sbjct  354  ---------------QASAQPFFVLGLLVTALATSH  374



>ref|WP_041443765.1| chitin-binding protein [Synechococcus sp. PCC 7002]
Length=333

 Score =   205 bits (521),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFGTLTP V+V+TL+YS AGLGIA+VNDFKS+EG
Sbjct  174  LKQNGWLGNYALGASYIALPWWAGHALFGTLTPTVMVVTLIYSFAGLGIAVVNDFKSVEG  233

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID+ Q+ +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  234  DRQLGLKSLPVMFGVGTAAWICVLMIDIFQVGIAGYLVSIHEQLYATILLLLVIPQITFQ  293

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  294  DMYFLRDPLKNDVKYQASAQPF  315



>ref|WP_015170443.1| chlorophyll synthase [Geitlerinema sp. PCC 7407]
 gb|AFY64875.1| chlorophyll synthase [Geitlerinema sp. PCC 7407]
Length=347

 Score =   205 bits (521),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LTP ++V+TL YS+AGLGIA+VNDFKS+EG
Sbjct  189  LKQNGWMGNYALGASYIALPWWAGQALFGELTPTIVVVTLFYSLAGLGIAVVNDFKSVEG  248

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG ++A WICV  IDL Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  249  DRQLGLKSLPVMFGIQSAAWICVLMIDLFQAGIAGYLISIQQNLYAAILLLLVIPQITFQ  308

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  309  DMYFLRDPLKNDVKYQASAQPF  330



>gb|ACA98555.1| chlorophyll synthase, ChlG [Synechococcus sp. PCC 7002]
Length=355

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFGTLTP V+V+TL+YS AGLGIA+VNDFKS+EG
Sbjct  196  LKQNGWLGNYALGASYIALPWWAGHALFGTLTPTVMVVTLIYSFAGLGIAVVNDFKSVEG  255

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID+ Q+ +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  256  DRQLGLKSLPVMFGVGTAAWICVLMIDIFQVGIAGYLVSIHEQLYATILLLLVIPQITFQ  315

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  316  DMYFLRDPLKNDVKYQASAQPF  337



>ref|WP_024545961.1| chitin-binding protein [Synechococcus sp. NKBG15041c]
Length=333

 Score =   204 bits (518),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFGTLTP V+V+TL+YS AGLGIA+VNDFKS+EG
Sbjct  174  LKQNGWLGNYALGASYIALPWWAGHALFGTLTPTVMVVTLIYSFAGLGIAVVNDFKSVEG  233

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID+ Q+ +AGYL S+ +  YA  LL    PQI FQ
Sbjct  234  DRQLGLKSLPVMFGVSTAAWICVLMIDIFQVGIAGYLISIHQQLYATILLLFVIPQITFQ  293

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  294  DMYFLRDPLKNDVKYQASAQPF  315



>dbj|BAD80199.1| chlorophyll a synthase [Synechococcus elongatus PCC 6301]
Length=291

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG L+  ++V+TL+YS+AGLGIA+VNDFKS+EG
Sbjct  129  LKQNGWLGNYALGASYIALPWWAGQALFGQLSWTIVVVTLVYSLAGLGIAVVNDFKSVEG  188

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GL+SLPV+FG +TA WICV  IDL QL+ AGYL ++G+  YA  L+ L  PQI FQ
Sbjct  189  DRALGLKSLPVSFGIQTASWICVLMIDLFQLAAAGYLVAIGQNLYAAILVLLIIPQITFQ  248

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  249  DMYFLRDPLGNDVKYQASAQPF  270



>gb|EMT28841.1| Chlorophyll synthase, chloroplastic [Aegilops tauschii]
Length=635

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/121 (84%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGWIGNFALG+SYI LPWWAGQALFGTLTPD++VLT LYSIAGLGIAIVNDFKSIEG
Sbjct  375  LKQNGWIGNFALGASYIGLPWWAGQALFGTLTPDIVVLTTLYSIAGLGIAIVNDFKSIEG  434

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPVAFG ETAKWICVGAID+TQLSVA YL S GK YYALAL+GLT PQ+  Q
Sbjct  435  DRTLGLQSLPVAFGMETAKWICVGAIDITQLSVAAYLLSTGKLYYALALVGLTIPQVILQ  494

Query  431  F  429
             
Sbjct  495  M  495


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = -3

Query  434  QFKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            QF+YFLKDPVKYDVKYQASAQPF V GLLVTALATSH
Sbjct  599  QFQYFLKDPVKYDVKYQASAQPFFVFGLLVTALATSH  635



>ref|WP_012161617.1| chitin-binding protein [Acaryochloris marina]
 gb|ABW26059.1| chlorophyll synthase, ChlG [Acaryochloris marina MBIC11017]
Length=350

 Score =   202 bits (515),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW GNFALG+SYI+LPWWAGQALFGTLTP V+VLTL YS++GLGIAI+NDFK++EG
Sbjct  192  LKQNGWTGNFALGASYIALPWWAGQALFGTLTPKVMVLTLAYSLSGLGIAIINDFKAVEG  251

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG E A WICV  ID+ Q+ +A +L S+ +  YA+ L  L  PQI FQ
Sbjct  252  DRELGLKSLPVVFGIEKAAWICVLMIDVFQIGMALFLISIHENLYAVILFLLVIPQITFQ  311

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DPVK DVKYQASAQPF
Sbjct  312  DMYFLRDPVKNDVKYQASAQPF  333



>ref|WP_011378308.1| MULTISPECIES: chitin-binding protein [Synechococcus]
 gb|ABB58114.1| chlorophyll synthase [Synechococcus elongatus PCC 7942]
 gb|AJD57410.1| chitin-binding protein [Synechococcus sp. UTEX 2973]
Length=339

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG L+  ++V+TL+YS+AGLGIA+VNDFKS+EG
Sbjct  177  LKQNGWLGNYALGASYIALPWWAGQALFGQLSWTIVVVTLVYSLAGLGIAVVNDFKSVEG  236

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GL+SLPV+FG +TA WICV  IDL QL+ AGYL ++G+  YA  L+ L  PQI FQ
Sbjct  237  DRALGLKSLPVSFGIQTASWICVLMIDLFQLAAAGYLVAIGQNLYAAILVLLIIPQITFQ  296

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  297  DMYFLRDPLGNDVKYQASAQPF  318



>ref|WP_011057379.1| chitin-binding protein [Thermosynechococcus elongatus]
 ref|NP_682329.1| bacteriochlorophyll/chlorophyll a synthase [Thermosynechococcus 
elongatus BP-1]
 dbj|BAC09091.1| chlorophyll a synthase [Thermosynechococcus elongatus BP-1]
Length=350

 Score =   201 bits (511),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWWAG ALFG LTP +++LTL+YS+AGLGIAIVNDFKS+EG
Sbjct  192  LKKNGWLGNYALGASYIALPWWAGHALFGELTPTIVILTLIYSLAGLGIAIVNDFKSVEG  251

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL SLPV FG  TA WICV  ID+ QL +AGYL ++    YA+ L+ L  PQI FQ
Sbjct  252  DRQLGLASLPVMFGITTAAWICVLMIDIFQLGIAGYLMAIHANLYAVLLILLIIPQIVFQ  311

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  312  DMYFLRDPLKNDVKYQASAQPF  333



>ref|XP_009040163.1| hypothetical protein AURANDRAFT_54854 [Aureococcus anophagefferens]
 gb|EGB05034.1| hypothetical protein AURANDRAFT_54854 [Aureococcus anophagefferens]
Length=410

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 112/165 (68%), Positives = 130/165 (79%), Gaps = 9/165 (5%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGT---------LTPDVIVLTLLYSIAGLGIAI  639
            LK  GW G+FALG+SYI+LPWW GQA+FG          LTPDV+VLT+LYS AGLGIAI
Sbjct  237  LKAEGWRGSFALGASYIALPWWCGQAMFGEVGAGAAGGELTPDVVVLTVLYSFAGLGIAI  296

Query  638  VNDFKSIEGDRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLG  459
            VNDFKSIEGDR +GL+SLPVAFG + AK+IC G ID+TQ+SVA YL  +G+  YAL L G
Sbjct  297  VNDFKSIEGDRELGLKSLPVAFGIDGAKYICAGMIDVTQISVAAYLAYIGETTYALILGG  356

Query  458  LTAPQIFFQFKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
            L APQI+ Q +Y LKDPVKYDVKYQ +AQPFLV G+L TALA SH
Sbjct  357  LIAPQIWAQTQYLLKDPVKYDVKYQGTAQPFLVFGILTTALAVSH  401



>gb|AFY38262.1| chlorophyll synthase [Leptolyngbya sp. PCC 7376]
Length=331

 Score =   199 bits (507),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFGTLTP V+V+TL+YS AGLGIA+VNDFKS+EG
Sbjct  173  LKQNGWLGNYALGASYIALPWWAGHALFGTLTPTVMVVTLIYSFAGLGIAVVNDFKSVEG  232

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID  Q  +AGYL S+ +  YAL LL L  PQI FQ
Sbjct  233  DEELGLKSLPVMFGVGTAAWICVIMIDAFQAGIAGYLVSIHEQIYALILLLLVIPQITFQ  292

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL DP+  DVKYQASAQPF
Sbjct  293  NIYFLPDPLNNDVKYQASAQPF  314



>ref|WP_026787959.1| MULTISPECIES: chitin-binding protein [Planktothrix]
Length=337

 Score =   199 bits (507),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG LTP ++VLTL YS+AGLGIAIVNDFKS+EG
Sbjct  177  LKQNGWLGNYALGASYIALPWWAGHALFGELTPTLMVLTLFYSLAGLGIAIVNDFKSVEG  236

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  ID+ Q  +A YL S+ +  YA  LL +  PQI FQ
Sbjct  237  DRQLGLQSLPVMFGITTAAWICVLMIDIFQAGMAVYLVSIKQNLYATVLLLMIIPQITFQ  296

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++PV+ DVKYQASAQPF
Sbjct  297  DMYFLRNPVENDVKYQASAQPF  318



>ref|WP_027249928.1| chitin-binding protein [Planktothrix agardhii]
 gb|KEI67606.1| ChlG [Planktothrix agardhii NIVA-CYA 126/8]
Length=337

 Score =   199 bits (506),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG LTP ++VLTL YS+AGLGIAIVNDFKS+EG
Sbjct  177  LKQNGWLGNYALGASYIALPWWAGHALFGELTPTLMVLTLFYSLAGLGIAIVNDFKSVEG  236

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  ID+ Q  +A YL S+ +  YA  LL +  PQI FQ
Sbjct  237  DRQLGLQSLPVMFGITTAAWICVLMIDIFQAGMAVYLVSIKQNLYATVLLLMIIPQITFQ  296

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++PV+ DVKYQASAQPF
Sbjct  297  DMYFLRNPVENDVKYQASAQPF  318



>ref|WP_041765408.1| chitin-binding protein [Leptolyngbya sp. PCC 7376]
Length=324

 Score =   199 bits (505),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFGTLTP V+V+TL+YS AGLGIA+VNDFKS+EG
Sbjct  166  LKQNGWLGNYALGASYIALPWWAGHALFGTLTPTVMVVTLIYSFAGLGIAVVNDFKSVEG  225

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID  Q  +AGYL S+ +  YAL LL L  PQI FQ
Sbjct  226  DEELGLKSLPVMFGVGTAAWICVIMIDAFQAGIAGYLVSIHEQIYALILLLLVIPQITFQ  285

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL DP+  DVKYQASAQPF
Sbjct  286  NIYFLPDPLNNDVKYQASAQPF  307



>ref|WP_010482257.1| chitin-binding protein [Acaryochloris sp. CCMEE 5410]
Length=347

 Score =   199 bits (507),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW GNFALG+SYI+LPWWAGQALFGTLTP V+VLTL YS++GLGIAI+NDFK++EG
Sbjct  189  LKQNGWTGNFALGASYIALPWWAGQALFGTLTPKVMVLTLAYSLSGLGIAIINDFKAVEG  248

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG E A WICV  ID+ Q+ +A +L S+ +  YA+ L  L  PQI  Q
Sbjct  249  DRELGLKSLPVVFGIEKAAWICVLMIDVFQIGMALFLISIHENLYAVILFLLVIPQITLQ  308

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DPV+ DVKYQASAQPF
Sbjct  309  DMYFLRDPVENDVKYQASAQPF  330



>ref|WP_006633316.1| chitin-binding protein [Microcoleus vaginatus]
 gb|EGK87760.1| chlorophyll synthase, ChlG [Microcoleus vaginatus FGP-2]
Length=336

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFGTL P +++LTL YS+AGLGIAIVNDFKS+EG
Sbjct  179  LKQNGWLGNYALGASYIALPWWAGQALFGTLDPTIMILTLFYSLAGLGIAIVNDFKSVEG  238

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA+ LL L  PQI FQ
Sbjct  239  DRQLGLKSLPVMFGISTAAWICVLMIDIFQAGIAGYLISIHQNLYAVILLLLIIPQITFQ  298

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  299  DMYFLRNPLENDVKYQASAQPF  320



>ref|WP_024124597.1| chlorophyll a synthase ChlG [Thermosynechococcus sp. NK55a]
 gb|AHB88191.1| chlorophyll a synthase ChlG [Thermosynechococcus sp. NK55a]
Length=331

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SY++LPWWAG ALFG LTP +++LTL+YS+AGLGIAIVNDFKS+EG
Sbjct  173  LKKNGWLGNYALGASYMALPWWAGHALFGELTPTIVILTLIYSLAGLGIAIVNDFKSVEG  232

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL SLPV FG  TA WICV  ID+ QL +AGYL ++    YA+ L+ L  PQI FQ
Sbjct  233  DRQLGLASLPVMFGITTAAWICVLMIDVFQLGIAGYLMAIHANLYAVLLILLIIPQIVFQ  292

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  293  DMYFLRDPLKNDVKYQASAQPF  314



>ref|WP_015219607.1| chlorophyll synthase [Cyanobacterium aponinum]
 gb|AFZ53880.1| chlorophyll synthase [Cyanobacterium aponinum PCC 10605]
Length=332

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYI+LPWWAG ALFG L   V++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  174  LKQNGWLGNYALGSSYIALPWWAGHALFGELNWTVVILTLVYSMAGLGIAVVNDFKSVEG  233

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID+ Q+++ GYL  +G+  YA  LL L  PQI FQ
Sbjct  234  DRTLGLKSLPVMFGVTTAAWICVIMIDVFQIAMGGYLIYLGQNLYATILLLLVIPQITFQ  293

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  294  DMYFLRDPLKNDVKYQASAQPF  315



>ref|WP_023073156.1| chlorophyll synthase [Leptolyngbya sp. Heron Island J]
 gb|ESA36105.1| chlorophyll synthase [Leptolyngbya sp. Heron Island J]
Length=338

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L P VIVLTL+YS+AGLGIA+VNDFKS+EG
Sbjct  177  LKQNGWLGNYALGASYIALPWWAGHALFGQLNPTVIVLTLIYSMAGLGIAVVNDFKSVEG  236

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+A+GL+SLPV FG  TA WICV  ID+ Q  +A YL ++ K  YA+ L+ +  PQI FQ
Sbjct  237  DKALGLKSLPVMFGVGTAAWICVLMIDIFQAGMAAYLIAIHKNLYAVLLILMIIPQITFQ  296

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  297  DMYFLRDPLANDVKYQASAQPF  318



>ref|WP_044198109.1| chitin-binding protein [Oscillatoria acuminata]
Length=345

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWWAGQALFG + P ++V+TL+YS+AGLGIAIVNDFKS+EG
Sbjct  186  LKKNGWLGNYALGASYIALPWWAGQALFGEIGPKIMVITLIYSMAGLGIAIVNDFKSVEG  245

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+ +GLQSLPV FG  TA WICV  ID+ QL +AGYL S+ +  YA  L+ L  PQI FQ
Sbjct  246  DKQLGLQSLPVMFGVGTAAWICVLMIDIFQLGIAGYLISIHQNLYAAILILLVIPQITFQ  305

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  306  DMYFLRNPLENDVKYQASAQPF  327



>gb|AFY85093.1| chlorophyll synthase [Oscillatoria acuminata PCC 6304]
Length=355

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWWAGQALFG + P ++V+TL+YS+AGLGIAIVNDFKS+EG
Sbjct  196  LKKNGWLGNYALGASYIALPWWAGQALFGEIGPKIMVITLIYSMAGLGIAIVNDFKSVEG  255

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+ +GLQSLPV FG  TA WICV  ID+ QL +AGYL S+ +  YA  L+ L  PQI FQ
Sbjct  256  DKQLGLQSLPVMFGVGTAAWICVLMIDIFQLGIAGYLISIHQNLYAAILILLVIPQITFQ  315

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  316  DMYFLRNPLENDVKYQASAQPF  337



>ref|WP_015174728.1| chlorophyll synthase [Oscillatoria nigro-viridis]
 gb|AFZ05399.1| chlorophyll synthase [Oscillatoria nigro-viridis PCC 7112]
Length=336

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFGTL P +++LTL YS+AGLGIAIVNDFKS+EG
Sbjct  179  LKQNGWLGNYALGASYIALPWWAGQALFGTLDPTIMILTLFYSLAGLGIAIVNDFKSVEG  238

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID+ Q  +AGYL ++ +  YA+ LL L  PQI FQ
Sbjct  239  DRQLGLKSLPVMFGISTAAWICVLMIDIFQAGIAGYLIAIHQNLYAVILLLLIIPQITFQ  298

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  299  DMYFLRNPLENDVKYQASAQPF  320



>ref|WP_041462639.1| chitin-binding protein [Chroococcidiopsis thermalis]
Length=350

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWW G ALFG L   + +LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  192  LKQNGWLGNYALGASYIALPWWTGHALFGDLNWTIAILTLIYSMAGLGIAVVNDFKSVEG  251

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV AID+ Q+ +A YL S+G+  YA  L+ L  PQI FQ
Sbjct  252  DRQLGLKSLPVMFGISTAAWICVLAIDIFQMGIAAYLVSIGENLYATILIFLVIPQIVFQ  311

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  312  DMYFLRDPLKNDVKYQASAQPF  333



>ref|WP_039715227.1| chitin-binding protein [Scytonema millei]
 gb|KIF17671.1| chitin-binding protein [Scytonema millei VB511283]
Length=350

 Score =   197 bits (502),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWW G ALFG L   + +LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  192  LKQNGWLGNYALGASYIALPWWTGHALFGDLNWTIAILTLIYSMAGLGIAVVNDFKSVEG  251

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV AID+ Q+ +A YL S+G+  YA  L+ L  PQI FQ
Sbjct  252  DRQLGLKSLPVMFGISTAAWICVLAIDIFQMGIAAYLVSIGENLYATILIFLVIPQIVFQ  311

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  312  DMYFLRDPLKNDVKYQASAQPF  333



>ref|WP_006457120.1| chitin-binding protein [Synechococcus sp. PCC 7335]
 gb|EDX87313.1| chlorophyll synthase, ChlG [Synechococcus sp. PCC 7335]
Length=344

 Score =   197 bits (502),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L P VIVLTL+YS+AGLGIAIVNDFK++EG
Sbjct  184  LKQNGWLGNYALGASYIALPWWAGHALFGELNPTVIVLTLIYSMAGLGIAIVNDFKAVEG  243

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG +TA WICV  ID+ Q  +A YL ++ K  YA+ L+ L  PQI FQ
Sbjct  244  DRELGLKSLPVMFGVQTAAWICVLMIDIFQGGMAAYLIAIHKNLYAVLLILLIIPQITFQ  303

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP++ DVKYQASAQPF
Sbjct  304  DMYFLRDPLENDVKYQASAQPF  325



>ref|WP_010873507.1| chitin-binding protein [Synechocystis sp. PCC 6803]
 dbj|BAA10281.1| chlorophyll a synthase [Synechocystis sp. PCC 6803]
 dbj|BAK51065.1| chlorophyll a synthase [Synechocystis sp. PCC 6803]
 dbj|BAL30063.1| chlorophyll a synthase [Synechocystis sp. PCC 6803 substr. GT-I]
 dbj|BAL33232.1| chlorophyll a synthase [Synechocystis sp. PCC 6803 substr. PCC-N]
 dbj|BAL36401.1| chlorophyll a synthase [Synechocystis sp. PCC 6803 substr. PCC-P]
 dbj|BAM54370.1| bacteriochlorophyll/chlorophyll a synthase [Bacillus subtilis 
BEST7613]
 gb|AGF52573.1| chlorophyll a synthase [Synechocystis sp. PCC 6803]
Length=324

 Score =   197 bits (500),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFGTL P ++VLTL+YS+AGLGIA+VNDFKS+EG
Sbjct  166  LKQNGWLGNYALGASYIALPWWAGHALFGTLNPTIMVLTLIYSLAGLGIAVVNDFKSVEG  225

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID+ Q  +AGYL  V +  YA  +L L  PQI FQ
Sbjct  226  DRQLGLKSLPVMFGIGTAAWICVIMIDVFQAGIAGYLIYVHQQLYATIVLLLLIPQITFQ  285

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  286  DMYFLRNPLENDVKYQASAQPF  307



>ref|WP_012595181.1| chitin-binding protein [Cyanothece sp. PCC 8801]
 gb|ACK65909.1| chlorophyll synthase, ChlG [Cyanothece sp. PCC 8801]
Length=326

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYI+LPWWAG ALFG L   +++LTL YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGSSYIALPWWAGHALFGQLNWTIVILTLFYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG +TA WICV  ID+ Q  +AGYL  V +  YA  LL L  PQI FQ
Sbjct  228  DRQLGLKSLPVMFGIDTAAWICVIMIDVFQAGIAGYLIYVNQNLYAAILLLLVIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>gb|AFY90621.1| chlorophyll synthase [Chroococcidiopsis thermalis PCC 7203]
Length=363

 Score =   197 bits (502),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWW G ALFG L   + +LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  205  LKQNGWLGNYALGASYIALPWWTGHALFGDLNWTIAILTLIYSMAGLGIAVVNDFKSVEG  264

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV AID+ Q+ +A YL S+G+  YA  L+ L  PQI FQ
Sbjct  265  DRQLGLKSLPVMFGISTAAWICVLAIDIFQMGIAAYLVSIGENLYATILIFLVIPQIVFQ  324

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  325  DMYFLRDPLKNDVKYQASAQPF  346



>ref|WP_006517291.1| chlorophyll synthase [Leptolyngbya sp. PCC 7375]
 gb|EKV02919.1| chlorophyll synthase [Leptolyngbya sp. PCC 7375]
Length=338

 Score =   197 bits (500),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L P V+VLTLLYS+AGLGIA+VNDFKS+EG
Sbjct  177  LKQNGWLGNYALGASYIALPWWAGHALFGQLNPTVVVLTLLYSMAGLGIAVVNDFKSVEG  236

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D A+GL+SLPV FG  TA WICV  ID+ Q  +A YL ++ K  YA+ L+ +  PQI FQ
Sbjct  237  DEALGLKSLPVMFGVGTAAWICVLMIDIFQGGMAAYLIAIHKNLYAVLLILMIIPQITFQ  296

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  297  DMYFLRDPLANDVKYQASAQPF  318



>ref|WP_019508778.1| chitin-binding protein [Pleurocapsa sp. PCC 7319]
Length=330

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+G +ALGSSYI+LPWW G ALFG L   +++LTL+YS AGLGIAIVNDFKS+EG
Sbjct  172  LKQNGWLGTYALGSSYIALPWWTGHALFGHLNWTIVILTLIYSFAGLGIAIVNDFKSVEG  231

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GL+SLPV FG  TA WICV AID+ QL +  YL ++ +  YA+ +  L  PQI FQ
Sbjct  232  DRALGLKSLPVMFGVTTAAWICVIAIDIFQLGIGSYLVAIHENIYAIIVFCLVVPQIVFQ  291

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFLK+P++YDVKYQASAQPF
Sbjct  292  NIYFLKNPLEYDVKYQASAQPF  313



>ref|WP_015783871.1| chitin-binding protein [Cyanothece sp. PCC 8802]
 gb|ACV00789.1| chlorophyll synthase, ChlG [Cyanothece sp. PCC 8802]
Length=326

 Score =   196 bits (499),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYI+LPWWAG ALFG L   +++LTL YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGSSYIALPWWAGHALFGQLNWTIVILTLFYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG +TA WICV  ID+ Q  +AGYL  V +  YA  LL L  PQI FQ
Sbjct  228  DRQLGLKSLPVMFGIDTAAWICVIMIDVFQAGIAGYLIYVHQNLYAAILLLLVIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>ref|WP_041238043.1| chitin-binding protein [Cyanothece sp. PCC 7424]
Length=340

 Score =   197 bits (500),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWWAG ALFG L   +I+LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  182  LKKNGWLGNYALGASYIALPWWAGHALFGELNSTIIILTLIYSLAGLGIAVVNDFKSVEG  241

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  242  DRQLGLQSLPVMFGVTTAAWICVIMIDVFQAGIAGYLISIHENLYATILLLLVIPQITFQ  301

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+ P++ DVKYQASAQPF
Sbjct  302  DMYFLRAPLENDVKYQASAQPF  323



>ref|WP_006619293.1| chitin-binding protein [Arthrospira platensis]
 dbj|BAI89082.1| chlorophyll synthase [Arthrospira platensis NIES-39]
 gb|KDR55879.1| chitin-binding protein [Arthrospira platensis str. Paraca]
Length=330

 Score =   196 bits (499),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWWAG ALFG L P ++VLTL YS+AGLGIAIVNDFKS+EG
Sbjct  173  LKKNGWLGNYALGASYIALPWWAGHALFGELNPTIVVLTLFYSLAGLGIAIVNDFKSVEG  232

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  ID+ Q  VA YL S+ +  YA  LL L  PQI FQ
Sbjct  233  DRQLGLQSLPVMFGVTTAAWICVLMIDIFQAGVALYLISIQQNLYATILLLLVIPQITFQ  292

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  293  DMYFLRNPLENDVKYQASAQPF  314



>ref|WP_007356666.1| MULTISPECIES: chitin-binding protein [Kamptonema]
 emb|CBN57466.1| bacteriochlorophyll/chlorophyll a synthase [ [[Oscillatoria] 
sp. PCC 6506]
Length=338

 Score =   196 bits (499),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYI+LPWWAGQALFG L   +++LTL YS+AGLGIAIVNDFKS+EG
Sbjct  180  LKQNGWLGNYALGSSYIALPWWAGQALFGKLDATIMILTLFYSMAGLGIAIVNDFKSVEG  239

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG + A WICV AID+ QL +A YL S+ +  YA+ L+ L  PQI FQ
Sbjct  240  DRQLGLQSLPVMFGVDKAAWICVCAIDIFQLGIAAYLISIHQNLYAVLLVLLVIPQITFQ  299

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  300  DMYFLRNPLENDVKYQASAQPF  321



>gb|ACK69684.1| chlorophyll synthase, ChlG [Cyanothece sp. PCC 7424]
Length=318

 Score =   196 bits (497),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWWAG ALFG L   +I+LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  160  LKKNGWLGNYALGASYIALPWWAGHALFGELNSTIIILTLIYSLAGLGIAVVNDFKSVEG  219

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  220  DRQLGLQSLPVMFGVTTAAWICVIMIDVFQAGIAGYLISIHENLYATILLLLVIPQITFQ  279

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+ P++ DVKYQASAQPF
Sbjct  280  DMYFLRAPLENDVKYQASAQPF  301



>ref|WP_006625329.1| MULTISPECIES: chitin-binding protein [Arthrospira]
 gb|EDZ92978.1| chlorophyll synthase, ChlG [Arthrospira maxima CS-328]
 emb|CCE16892.1| Chlorophyll a synthase ChlG [Arthrospira sp. PCC 8005]
 gb|EKD06442.1| chlorophyll synthase ChlG [Arthrospira platensis C1]
 emb|CDM95497.1| Chlorophyll a synthase ChlG [Arthrospira sp. PCC 8005]
Length=330

 Score =   196 bits (498),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWWAG ALFG L P ++VLTL YS+AGLGIAIVNDFKS+EG
Sbjct  173  LKKNGWLGNYALGASYIALPWWAGHALFGELNPTIVVLTLFYSLAGLGIAIVNDFKSVEG  232

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  ID+ Q  VA YL S+ +  YA  LL L  PQI FQ
Sbjct  233  DRQLGLQSLPVMFGVTTAAWICVLMIDIFQAGVALYLISIKQNLYATILLLLVIPQITFQ  292

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YF+++P++ DVKYQASAQPF
Sbjct  293  DMYFIRNPLENDVKYQASAQPF  314



>ref|WP_015131375.1| chlorophyll synthase [Calothrix sp. PCC 7507]
 gb|AFY35584.1| chlorophyll synthase [Calothrix sp. PCC 7507]
Length=348

 Score =   196 bits (499),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L+  +++LTL YS+AGLGIAIVNDFKS+EG
Sbjct  190  LKQNGWLGNYALGASYIALPWWAGHALFGELSWQIVILTLFYSLAGLGIAIVNDFKSVEG  249

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  IDL Q  VA YL S+ +  YA  L+ L  PQI FQ
Sbjct  250  DRQLGLQSLPVMFGITTAAWICVVMIDLFQGLVAAYLVSIHENLYAAILVLLILPQITFQ  309

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  310  DMYFLRDPLKNDVKYQASAQPF  331



>ref|WP_015193819.1| chlorophyll synthase [Stanieria cyanosphaera]
 gb|AFZ36151.1| chlorophyll synthase [Stanieria cyanosphaera PCC 7437]
Length=331

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALGSSYI+LPWWAG ALFG L   +++LTL+YS AGLGIA+VNDFKS+EG
Sbjct  173  LKKNGWLGNYALGSSYIALPWWAGHALFGELNWTIVILTLIYSFAGLGIAVVNDFKSVEG  232

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  IDL Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  233  DRTLGLKSLPVMFGVTTAAWICVIMIDLFQAGIAGYLISIHQNLYATILLLLVIPQITFQ  292

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  293  DMYFLRDPLNNDVKYQASAQPF  314



>ref|XP_002180392.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47800.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=423

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTL-TPDVIVLTLLYSIAGLGIAIVNDFKSIE  615
            LKQNGW GN+ALG+SYISLPWW GQA+FGTL  P   +L +LYSIAGLGIAIVNDFKSIE
Sbjct  262  LKQNGWAGNYALGASYISLPWWCGQAVFGTLDKPVYFILPILYSIAGLGIAIVNDFKSIE  321

Query  614  GDRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFF  435
            GDRA+GLQSLPVAFG + AKWIC G++ LTQL VA YL ++G+  YA  L+ L  PQ++F
Sbjct  322  GDRALGLQSLPVAFGIDKAKWICAGSVTLTQLGVAAYLQTLGESLYAGILIALILPQMYF  381

Query  434  QFKYFLKDPVKYDVKYQASAQPF  366
            Q    L DPV+ DVKYQASAQPF
Sbjct  382  QATLLLPDPVENDVKYQASAQPF  404



>ref|WP_017300287.1| chitin-binding protein [Nodosilinea nodulosa]
Length=349

 Score =   196 bits (497),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG LT  ++VLTL YS+AGLGIA+VNDFKS+EG
Sbjct  191  LKQNGWLGNYALGASYIALPWWAGHALFGELTWQIVVLTLFYSLAGLGIAVVNDFKSVEG  250

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR MGL+SLPV FG  TA WICV AID+ Q  VA YL ++ +  YA+ L+ L  PQI FQ
Sbjct  251  DRQMGLKSLPVMFGVTTAAWICVLAIDIFQGGVAAYLMAIHQNLYAVLLVLLIIPQITFQ  310

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  311  DMYFLRDPLGNDVKYQASAQPF  332



>ref|WP_017713266.1| chitin-binding protein [Prochlorothrix hollandica]
Length=339

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYI+LPWWAGQALFG L   ++++TL+YS+AGLGIA+VNDFKS+EG
Sbjct  180  LKQNGWVGNYALGSSYIALPWWAGQALFGHLNFTIVIVTLVYSMAGLGIAVVNDFKSVEG  239

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GLQSLPV FG   A W+CV  ID  QL++A YL S+ + +YA+ L+ L  PQI FQ
Sbjct  240  DSQLGLQSLPVMFGINKAAWVCVLMIDTFQLAIALYLVSIHQNFYAVLLVLLVIPQITFQ  299

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  300  DMYFLRDPLKNDVKYQASAQPF  321



>ref|WP_045869649.1| chitin-binding protein [Tolypothrix sp. PCC 7601]
Length=346

 Score =   194 bits (494),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   ++VLTL+YS+AGLGIAIVNDFKS+EG
Sbjct  188  LKQNGWLGNYALGASYIALPWWAGHALFGELNWKIMVLTLVYSLAGLGIAIVNDFKSVEG  247

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  ID+ Q  +A YL S+ +  YA  L+ L  PQI FQ
Sbjct  248  DRQLGLQSLPVMFGVTTAAWICVVMIDVFQGFIAAYLVSIHENLYAAILVLLILPQITFQ  307

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  308  DMYFLRDPLKNDVKYQASAQPF  329



>ref|WP_041933762.1| chitin-binding protein [Cyanothece sp. PCC 7822]
Length=329

 Score =   194 bits (493),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWWAG ALFG L   +I+LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  171  LKKNGWLGNYALGASYIALPWWAGHALFGELNLTIIILTLIYSLAGLGIAVVNDFKSVEG  230

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  231  DRQLGLKSLPVMFGVSTAAWICVIMIDVFQAGIAGYLISIHENLYATILLLLVIPQITFQ  290

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+ P++ DVKYQASAQPF
Sbjct  291  DMYFLRSPLENDVKYQASAQPF  312



>gb|ADN15009.1| bacteriochlorophyll/chlorophyll synthetase [Cyanothece sp. PCC 
7822]
Length=334

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWWAG ALFG L   +I+LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  176  LKKNGWLGNYALGASYIALPWWAGHALFGELNLTIIILTLIYSLAGLGIAVVNDFKSVEG  235

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  236  DRQLGLKSLPVMFGVSTAAWICVIMIDVFQAGIAGYLISIHENLYATILLLLVIPQITFQ  295

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+ P++ DVKYQASAQPF
Sbjct  296  DMYFLRSPLENDVKYQASAQPF  317



>ref|WP_023069149.1| chlorophyll synthase ChlG [Lyngbya aestuarii]
 gb|ERT04588.1| chlorophyll synthase ChlG [Lyngbya aestuarii BL J]
Length=330

 Score =   194 bits (492),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWW G ALFG LT  ++VLTL YS+AGLGIAIVNDFKS+EG
Sbjct  173  LKKNGWLGNYALGASYIALPWWTGHALFGNLTSTIVVLTLFYSLAGLGIAIVNDFKSVEG  232

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  ID+ Q  VA YL S+ +  YA  LL L  PQI FQ
Sbjct  233  DRQLGLQSLPVMFGVGTAAWICVLMIDIFQAGVAVYLISIQQNLYATILLLLVIPQITFQ  292

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  293  DMYFLRNPLENDVKYQASAQPF  314



>ref|XP_005706451.1| chlorophyll synthase [Galdieria sulphuraria]
 gb|EME29931.1| chlorophyll synthase [Galdieria sulphuraria]
Length=393

 Score =   195 bits (496),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK++GWIGN+ALG+SYISLPWWAGQ+LFGTL   V++LTLLYS+AGLGIA+VNDFKS+EG
Sbjct  233  LKRSGWIGNYALGASYISLPWWAGQSLFGTLDYKVMLLTLLYSLAGLGIAVVNDFKSVEG  292

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+S+PV FG E AKWI V  ID  Q  +A  LFS+ +  YA  ++    PQ++FQ
Sbjct  293  DRKLGLRSIPVEFGIEGAKWISVFLIDTFQALIAAVLFSIHETPYACGVVACILPQVYFQ  352

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
            F+ FLKDP+KYDV+YQASAQPF
Sbjct  353  FRLFLKDPLKYDVQYQASAQPF  374



>dbj|BAQ60651.1| chlorophyll a synthase ChlG [Geminocystis sp. NIES-3708]
Length=331

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  174  LKQNGWLGNYALGSSYIALPWWAGHALFGELNWTIVILTLIYSMAGLGIAVVNDFKSVEG  233

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID+ Q+ +  YL  + +  YA  LL L  PQI FQ
Sbjct  234  DRQLGLKSLPVMFGVTTAAWICVIMIDVFQIGMGAYLIYLNQNLYATILLLLVIPQITFQ  293

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  294  DMYFLRDPLKNDVKYQASAQPF  315



>ref|WP_028090839.1| chitin-binding protein [Dolichospermum circinale]
Length=345

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   ++VLTL YS+AGLGIAIVNDFKS+EG
Sbjct  187  LKQNGWLGNYALGASYIALPWWAGHALFGELNWKIVVLTLFYSLAGLGIAIVNDFKSVEG  246

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG +TA  ICV  IDL Q  VAGYL S+ +  YA  L+ L  PQI FQ
Sbjct  247  DRQLGLQSLPVMFGVQTAALICVVMIDLFQGLVAGYLVSIHENLYAAILVLLIIPQITFQ  306

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  307  DMYFLRDPIANDVKYQASAQPF  328



>ref|WP_041234707.1| chitin-binding protein [Cyanobacterium stanieri]
Length=319

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYI+LPWWAG ALFG L   ++VLTL+YS+AGLGIA+VNDFKS+EG
Sbjct  163  LKQNGWLGNYALGSSYIALPWWAGHALFGELNWTIVVLTLIYSMAGLGIAVVNDFKSVEG  222

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID+ Q  +  YL S+ K  YA  L  L  PQI FQ
Sbjct  223  DRTLGLKSLPVMFGVTTAAWICVIMIDVFQAGMGLYLVSIHKNLYATILFLLIIPQITFQ  282

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  283  DMYFLRDPLKNDVKYQASAQPF  304



>ref|WP_028083999.1| chitin-binding protein [Dolichospermum circinale]
Length=345

 Score =   194 bits (492),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   ++VLTL YS+AGLGIAIVNDFKS+EG
Sbjct  187  LKQNGWLGNYALGASYIALPWWAGHALFGELNWKIVVLTLFYSLAGLGIAIVNDFKSVEG  246

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG +TA  ICV  IDL Q  VAGYL S+ +  YA  L+ L  PQI FQ
Sbjct  247  DRQLGLQSLPVMFGVQTAALICVVMIDLFQGLVAGYLVSIHENLYAAILVLLIIPQITFQ  306

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  307  DMYFLRDPIANDVKYQASAQPF  328



>gb|AFZ46570.1| chlorophyll synthase [Cyanobacterium stanieri PCC 7202]
Length=330

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYI+LPWWAG ALFG L   ++VLTL+YS+AGLGIA+VNDFKS+EG
Sbjct  174  LKQNGWLGNYALGSSYIALPWWAGHALFGELNWTIVVLTLIYSMAGLGIAVVNDFKSVEG  233

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID+ Q  +  YL S+ K  YA  L  L  PQI FQ
Sbjct  234  DRTLGLKSLPVMFGVTTAAWICVIMIDVFQAGMGLYLVSIHKNLYATILFLLIIPQITFQ  293

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  294  DMYFLRDPLKNDVKYQASAQPF  315



>ref|WP_015206937.1| chlorophyll synthase [Cylindrospermum stagnale]
 gb|AFZ23681.1| chlorophyll synthase [Cylindrospermum stagnale PCC 7417]
Length=348

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   ++VLTL YS+AGLGIAIVNDFKS+EG
Sbjct  190  LKQNGWLGNYALGASYIALPWWAGHALFGDLNWKIVVLTLFYSLAGLGIAIVNDFKSVEG  249

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  IDL Q  VA YL S+ +  YA  L+ L  PQI  Q
Sbjct  250  DRQLGLQSLPVMFGITTASWICVVMIDLFQGLVAAYLVSIHENLYAAILVLLIIPQITLQ  309

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DPV  DVKYQASAQPF
Sbjct  310  DMYFLRDPVANDVKYQASAQPF  331



>ref|WP_016953206.1| chitin-binding protein [Anabaena sp. PCC 7108]
Length=344

 Score =   193 bits (491),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL YS+AGLGIAIVNDFKS+EG
Sbjct  186  LKQNGWLGNYALGASYIALPWWAGHALFGELNWKIVILTLFYSLAGLGIAIVNDFKSVEG  245

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG +TA  ICV  IDL Q  VAGYL S+ +  YA  L+ L  PQI FQ
Sbjct  246  DRQLGLQSLPVMFGVQTAALICVVMIDLFQGLVAGYLVSIHENLYAAILVLLIIPQITFQ  305

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  306  DMYFLRDPIANDVKYQASAQPF  327



>dbj|BAQ66905.1| chlorophyll a synthase ChlG [Geminocystis sp. NIES-3709]
Length=332

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYI+LPWWAG ALFG L   ++++TL+YS+AGLGIA+VNDFKS+EG
Sbjct  174  LKQNGWLGNYALGSSYIALPWWAGHALFGELNWTIVIITLIYSMAGLGIAVVNDFKSVEG  233

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+ +GL+SLPV FG  TA WICV  ID+ Q+++ GYL  + +  YA  LL L  PQI FQ
Sbjct  234  DQQLGLKSLPVMFGVTTAAWICVIMIDVFQIAMGGYLIYIHQNLYATILLLLVIPQITFQ  293

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  294  DMYFLRDPLKNDVKYQASAQPF  315



>ref|WP_015125859.1| chlorophyll synthase [Synechococcus sp. PCC 6312]
 gb|AFY62319.1| chlorophyll synthase [Synechococcus sp. PCC 6312]
Length=334

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWWAG ALFG L P +IVLTL YS+AGLGIAIVNDFKS+EG
Sbjct  178  LKKNGWLGNYALGASYIALPWWAGHALFGELNPTLIVLTLFYSLAGLGIAIVNDFKSVEG  237

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+ +GL SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA+ L+ L  PQI FQ
Sbjct  238  DQKLGLASLPVMFGIGTAAWICVLMIDIFQAGIAGYLISIQQNLYAVILILLIIPQITFQ  297

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  298  DMYFLRDPLKNDVKYQASAQPF  319



>ref|WP_009344052.1| chitin-binding protein [Raphidiopsis brookii]
 gb|EFA71978.1| chlorophyll synthetase [Raphidiopsis brookii D9]
Length=337

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   ++VLTL YS+AGLGIAIVNDFKS+EG
Sbjct  179  LKQNGWLGNYALGASYIALPWWAGHALFGELNWKIVVLTLFYSLAGLGIAIVNDFKSVEG  238

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL SLPV FG ETA  ICV  IDL Q  VAGYL S+ +  YA  L  L  PQI FQ
Sbjct  239  DRQLGLNSLPVMFGIETAALICVVMIDLFQGLVAGYLVSIHENLYAAILALLIIPQITFQ  298

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  299  DMYFLRDPIANDVKYQASAQPF  320



>ref|WP_009783796.1| chitin-binding protein [Lyngbya sp. PCC 8106]
 gb|EAW37647.1| bacteriochlorophyll a synthase [Lyngbya sp. PCC 8106]
Length=332

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWW G ALFG LT  ++VLTL YS+AGLGIAIVNDFKS+EG
Sbjct  175  LKKNGWLGNYALGASYIALPWWTGHALFGDLTSTIVVLTLFYSLAGLGIAIVNDFKSVEG  234

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  ID+ Q  VA YL S+ +  YA  LL L  PQI FQ
Sbjct  235  DRQLGLQSLPVMFGVGTAAWICVLMIDIFQAGVAVYLISIQQNLYATILLLLVIPQITFQ  294

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  295  DMYFLRNPLENDVKYQASAQPF  316



>ref|WP_010998613.1| chitin-binding protein [Nostoc sp. PCC 7120]
 dbj|BAB76179.1| chlorophyll synthase 33 kD subunit [Nostoc sp. PCC 7120]
Length=344

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   + VLTL+YS+AGLGIAIVNDFKS+EG
Sbjct  186  LKQNGWLGNYALGASYIALPWWAGHALFGELNWKIAVLTLIYSLAGLGIAIVNDFKSVEG  245

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  ID+ Q  +A YL ++ +  YA  L+ L  PQI FQ
Sbjct  246  DRQLGLQSLPVMFGINTAAWICVVMIDVFQGLIAAYLVTIHENLYAAILVLLIIPQITFQ  305

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  306  DMYFLRDPLKNDVKYQASAQPF  327



>ref|WP_017293898.1| chitin-binding protein [Geminocystis herdmanii]
Length=332

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALGSSYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  174  LKKNGWLGNYALGSSYIALPWWAGHALFGELNWTIVILTLIYSMAGLGIAVVNDFKSVEG  233

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+ +GL+SLPV FG  TA WICV  ID+ Q+ +  YL S+ +  YA  LL L  PQI FQ
Sbjct  234  DQELGLKSLPVMFGVTTAAWICVIMIDVFQIGMGAYLISIHQNLYATILLLLVIPQITFQ  293

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  294  DMYFLRDPLKNDVKYQASAQPF  315



>ref|WP_015079848.1| chlorophyll synthase [Anabaena sp. 90]
 gb|AFW94687.1| chlorophyll synthase [Anabaena sp. 90]
Length=344

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL YS+AGLGIAIVNDFKS+EG
Sbjct  186  LKQNGWLGNYALGASYIALPWWAGHALFGELNWKIVILTLFYSLAGLGIAIVNDFKSVEG  245

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG +TA  ICV  IDL Q  VAGYL S+ +  YA  L+ L  PQI FQ
Sbjct  246  DRQLGLQSLPVMFGIQTAALICVVMIDLFQGLVAGYLVSIHENLYAAILVLLIIPQITFQ  305

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  306  DMYFLRDPIANDVKYQASAQPF  327



>ref|WP_017655867.1| chitin-binding protein [Microchaete sp. PCC 7126]
Length=348

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   ++VLTL+YS+AGLGIAIVNDFKS+EG
Sbjct  190  LKQNGWLGNYALGASYIALPWWAGHALFGELNWKIVVLTLIYSLAGLGIAIVNDFKSVEG  249

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  ID+ Q  +A YL S+ +  YA  L  L  PQI  Q
Sbjct  250  DRQLGLQSLPVMFGVTTAAWICVLMIDVFQGFIAAYLVSIHENLYAAILALLILPQIVLQ  309

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  310  EMYFLRDPLKNDVKYQASAQPF  331



>ref|WP_035152982.1| chitin-binding protein [Calothrix sp. 336/3]
 gb|KFB83433.1| chitin-binding protein [Calothrix sp. 336/3]
Length=333

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPW AG ALFG L   ++VLT++YS+AGLGIA+VNDFKS+EG
Sbjct  174  LKQNGWLGNYALGASYIALPWCAGHALFGELNWKIVVLTVVYSLAGLGIAVVNDFKSVEG  233

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG +TA WICV  ID+ Q ++AGYL  + +  YA+ LL L  PQI FQ
Sbjct  234  DRQLGLKSLPVMFGVQTAAWICVIMIDVFQAAIAGYLIYINEKIYAVILLLLVIPQITFQ  293

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  294  EMYFLRDPLNNDVKYQASAQPF  315



>ref|WP_011320065.1| chitin-binding protein [Anabaena variabilis]
 gb|ABA22948.1| chlorophyll synthase [Anabaena variabilis ATCC 29413]
Length=337

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   + +LTL+YS+AGLGIAIVNDFKS+EG
Sbjct  179  LKQNGWLGNYALGASYIALPWWAGHALFGELNWKIAILTLIYSLAGLGIAIVNDFKSVEG  238

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  ID+ Q  +A YL ++ +  YA  L+ L  PQI FQ
Sbjct  239  DRQLGLQSLPVMFGINTAAWICVVMIDVFQGLIAAYLVTIHENLYAAILVLLIIPQITFQ  298

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  299  DMYFLRDPLKNDVKYQASAQPF  320



>ref|WP_039729123.1| MULTISPECIES: chitin-binding protein [Oscillatoriophycideae]
 gb|KIF24618.1| chitin-binding protein [Aphanocapsa montana BDHKU210001]
 gb|KIF41483.1| chitin-binding protein [Lyngbya confervoides BDU141951]
Length=332

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL YS+AGLGIAIVNDFKS+EG
Sbjct  173  LKQNGWLGNYALGASYIALPWWAGHALFGELNLTIVLLTLFYSLAGLGIAIVNDFKSVEG  232

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  IDL Q  VA YL S+ +  YA+ L+ L  PQI FQ
Sbjct  233  DRQLGLKSLPVMFGVGTAAWICVLMIDLFQGGVAAYLMSIHQNLYAVILVLLIIPQITFQ  292

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  293  DMYFLRNPLENDVKYQASAQPF  314



>gb|EKF03432.1| chlorophyll synthase [Tolypothrix sp. PCC 7601]
Length=394

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   ++VLTL+YS+AGLGIAIVNDFKS+EG
Sbjct  236  LKQNGWLGNYALGASYIALPWWAGHALFGELNWKIMVLTLVYSLAGLGIAIVNDFKSVEG  295

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG  TA WICV  ID+ Q  +A YL S+ +  YA  L+ L  PQI FQ
Sbjct  296  DRQLGLQSLPVMFGVTTAAWICVVMIDVFQGFIAAYLVSIHENLYAAILVLLILPQITFQ  355

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  356  DMYFLRDPLKNDVKYQASAQPF  377



>ref|WP_043695934.1| chitin-binding protein [Synechococcus sp. KORDI-49]
 gb|AII47343.1| chitin-binding protein [Synechococcus sp. KORDI-49]
Length=317

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFGTLT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  155  LKQNGWLGNYALGASYIALPWWAGQALFGTLTWSTALLTLAYSLAGLGIAVVNDFKSVEG  214

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG E A WI  G IDL QL++   L ++G+ + A+ L+ L  PQI FQ
Sbjct  215  DRELGLQSLPVVFGIERASWISAGMIDLFQLAMVAVLIAIGQHFAAVLLVLLIVPQITFQ  274

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV +DVKYQASAQPF
Sbjct  275  DIWLLRDPVAFDVKYQASAQPF  296



>ref|XP_002289474.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED93011.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=399

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTL-TPDVIVLTLLYSIAGLGIAIVNDFKSIE  615
            LKQNGW GN+ALG SYISLPWW GQA+FG L  P   VL +LYSIAGLGIAIVNDFKSIE
Sbjct  238  LKQNGWAGNYALGCSYISLPWWCGQAVFGELDRPVYFVLPILYSIAGLGIAIVNDFKSIE  297

Query  614  GDRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFF  435
            GDR +GLQSLPVAFG + AK+IC G++ LTQL VA YL S+G+  YA  LLGL  PQI+F
Sbjct  298  GDRELGLQSLPVAFGVDGAKYICAGSVTLTQLGVAAYLQSIGETTYAAILLGLLLPQIYF  357

Query  434  QFKYFLKDPVKYDVKYQASAQPF  366
            Q    L DPV  DVKYQAS+QPF
Sbjct  358  QATLLLPDPVANDVKYQASSQPF  380



>ref|WP_015111698.1| chlorophyll synthase [Nostoc sp. PCC 7107]
 gb|AFY41458.1| chlorophyll synthase [Nostoc sp. PCC 7107]
Length=349

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG LT  V++LTL+YS AGLGIAIVNDFKS+EG
Sbjct  191  LKQNGWLGNYALGASYIALPWWAGHALFGELTWQVLILTLIYSWAGLGIAIVNDFKSVEG  250

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID+ Q  +A YL S+ +  YA  L+ L  PQI FQ
Sbjct  251  DRQLGLKSLPVMFGVTTAAWICVLMIDIFQGFMAAYLVSIHENLYAAILVLLIIPQITFQ  310

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  311  DMYFLRDPLKNDVKYQASAQPF  332



>ref|WP_015185029.1| chlorophyll synthase [Microcoleus sp. PCC 7113]
 gb|AFZ20896.1| chlorophyll synthase [Microcoleus sp. PCC 7113]
Length=323

 Score =   191 bits (486),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALGSSYI+LPWWAG ALFG L   ++VLTL YS+AGLGIA+VNDFKS+EG
Sbjct  165  LKKNGWLGNYALGSSYIALPWWAGHALFGQLNWTIVVLTLFYSLAGLGIAVVNDFKSVEG  224

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  225  DRQLGLKSLPVMFGIGTAAWICVLMIDIFQAGIAGYLISIHQNLYAAILLLLIIPQITFQ  284

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  285  DMYFLRDPLKNDVKYQASAQPF  306



>ref|WP_028946405.1| chitin-binding protein [Synechocystis sp. PCC 6714]
 gb|AIE73296.1| Chlorophyll a synthase ChlG [Synechocystis sp. PCC 6714]
Length=324

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFGTL   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  166  LKQNGWLGNYALGASYIALPWWAGHALFGTLNSTIMILTLIYSLAGLGIAVVNDFKSVEG  225

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG   A WICV  ID+ Q  +AGYL  V +  YA  +L L  PQI FQ
Sbjct  226  DRQLGLKSLPVMFGIGAAAWICVIMIDVFQAGIAGYLIYVHQQLYATIVLLLLIPQITFQ  285

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  286  DMYFLRNPLENDVKYQASAQPF  307



>ref|WP_043326699.1| chitin-binding protein [Cyanobium gracile]
Length=315

 Score =   191 bits (485),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  146  LKQNGWLGNYALGASYIALPWWAGQALFGQLTWATALLTLAYSLAGLGIAVVNDFKSVEG  205

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPV FG + A WI  G IDL QL++   L ++G+ + A+ L+ L  PQI FQ
Sbjct  206  DRALGLQSLPVVFGVQRASWISAGMIDLFQLAMVAVLIAIGQHFAAVLLVLLIIPQITFQ  265

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH*SPDAFVTISGEI  285
              + L+DPV +DVKYQASAQPFLVLG+LVTALA  H    AF  ++  +
Sbjct  266  DIWLLRDPVAFDVKYQASAQPFLVLGMLVTALAIGHSDLTAFAALTAPL  314



>ref|WP_036487712.1| chitin-binding protein [Myxosarcina sp. GI1]
Length=333

 Score =   191 bits (486),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+G +ALGSSYI+LPWW G ALFG L   +++LTL+YS AGLGIAIVNDFKS+EG
Sbjct  175  LKQNGWLGTYALGSSYIALPWWTGHALFGDLNWTIVILTLIYSFAGLGIAIVNDFKSVEG  234

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV AIDL Q+ +  YL S+ +  Y   +L L  PQI FQ
Sbjct  235  DRQLGLKSLPVMFGVTTAAWICVVAIDLFQIGIGSYLVSIRENLYGAIVLLLVIPQITFQ  294

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP++ DVKYQASAQPF
Sbjct  295  DMYFLRDPLENDVKYQASAQPF  316



>ref|WP_002802683.1| chitin-binding protein [Microcystis aeruginosa]
 emb|CCI37225.1| Genome sequencing data, contig C311 [Microcystis aeruginosa PCC 
9701]
Length=326

 Score =   191 bits (485),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNGTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  228  DEKLGLKSLPVMFGITTAAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>ref|WP_002781907.1| Genome sequencing data, contig C311 [Microcystis aeruginosa]
 emb|CCI16568.1| Genome sequencing data, contig C311 [Microcystis aeruginosa PCC 
9806]
Length=326

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNGTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  228  DEKLGLKSLPVMFGITTAAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>ref|WP_024970493.1| chitin-binding protein [Microcystis aeruginosa]
Length=326

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNGTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  228  DEKLGLKSLPVMFGITTAAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>ref|WP_004158757.1| chitin-binding protein [Microcystis aeruginosa]
 emb|CCH93998.1| Genome sequencing data, contig C311 [Microcystis aeruginosa PCC 
9432]
Length=329

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNGTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  228  DEKLGLKSLPVMFGITTAAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>ref|WP_045361424.1| chitin-binding protein [Microcystis aeruginosa]
 dbj|GAL95172.1| chlorophyll a synthase ChlG [Microcystis aeruginosa NIES-44]
Length=326

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNGTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  228  DEKLGLKSLPVMFGITTAAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>ref|WP_008196576.1| chitin-binding protein [Microcystis sp. T1-4]
 emb|CCI30484.1| Chlorophyll a synthase [Microcystis sp. T1-4]
Length=326

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNGTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  228  DEKLGLKSLPVMFGITTAAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>ref|WP_017288009.1| chitin-binding protein [Leptolyngbya boryana]
Length=325

 Score =   191 bits (485),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+G +ALG+SYI++PWW G ALFG L P +I+LTL YS +GLGIAIVNDFKS+EG
Sbjct  167  LKQNGWLGCYALGASYIAIPWWTGHALFGDLNPTIIILTLFYSFSGLGIAIVNDFKSVEG  226

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+A+GL+SLPV FG  TA WICV  ID+ Q  VAGYL ++ +   A  L+ L  PQI FQ
Sbjct  227  DKALGLKSLPVMFGVTTAAWICVAMIDVFQAGVAGYLMTIHQNLMATLLILLIIPQITFQ  286

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  287  DMYFLRDPIKNDVKYQASAQPF  308



>ref|WP_027404157.1| chitin-binding protein [Aphanizomenon flos-aquae]
Length=344

 Score =   191 bits (486),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL YS+AGLGIAIVNDFKS+EG
Sbjct  186  LKQNGWLGNYALGASYIALPWWAGHALFGELNWKIVILTLFYSLAGLGIAIVNDFKSVEG  245

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG + A  ICV  IDL Q  VAGYL S+ +  YA  L+ L  PQI FQ
Sbjct  246  DRQLGLQSLPVMFGIQNAALICVVTIDLFQGLVAGYLVSIHENLYAAILVLLIIPQITFQ  305

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  306  DMYFLRDPIANDVKYQASAQPF  327



>ref|WP_043369672.1| chitin-binding protein [Cyanobium sp. PCC 7001]
Length=306

 Score =   190 bits (483),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  146  LKQNGWLGNYALGASYIALPWWAGQALFGQLTWATALLTLAYSLAGLGIAVVNDFKSVEG  205

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPV FG E A WI  G IDL QL++   L ++G+ + A+ L+ L  PQI FQ
Sbjct  206  DRALGLQSLPVVFGIEKASWISAGMIDLFQLAMVAVLIAIGQHFAAVLLVLLIVPQITFQ  265

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV +DVKYQASAQPF
Sbjct  266  DIWLLRDPVAFDVKYQASAQPF  287



>ref|WP_043705085.1| chitin-binding protein [Synechococcus sp. CB0205]
Length=307

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT     LTL YS+AGLGIA+VNDFKS+EG
Sbjct  146  LKQNGWLGNYALGASYIALPWWAGQALFGHLTWTTAFLTLAYSLAGLGIAVVNDFKSVEG  205

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG E A WI  G ID+ QL++   L ++G+ + A+ L+ L  PQI FQ
Sbjct  206  DRALGLQSLPVAFGIERASWISAGMIDVFQLAMVAVLIAIGQHFAAVLLVLLIVPQITFQ  265

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV +DVKYQASAQPF
Sbjct  266  DIWLLRDPVAFDVKYQASAQPF  287



>gb|EJK49881.1| hypothetical protein THAOC_31201 [Thalassiosira oceanica]
Length=414

 Score =   193 bits (490),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTL-TPDVIVLTLLYSIAGLGIAIVNDFKSIE  615
            LKQNGW GN+ALG SYISLPWW GQA+FG L  P   +L +LYSIAGLGIAIVNDFKS+E
Sbjct  253  LKQNGWAGNYALGCSYISLPWWCGQAVFGELDRPVYFILPILYSIAGLGIAIVNDFKSVE  312

Query  614  GDRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFF  435
            GDR +GLQSLPVAFG +TAKWIC G++ +TQL VA YL S+ +  YA  L+GL  PQI++
Sbjct  313  GDRQLGLQSLPVAFGIDTAKWICAGSVTVTQLGVAAYLQSINETTYAAILMGLLLPQIYY  372

Query  434  QFKYFLKDPVKYDVKYQASAQPF  366
            Q    + DPV  DVKYQAS+QPF
Sbjct  373  QATLLIPDPVANDVKYQASSQPF  395



>gb|AFY28552.1| chlorophyll synthase, ChlG [Cyanobium gracile PCC 6307]
Length=338

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/169 (62%), Positives = 130/169 (77%), Gaps = 0/169 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  169  LKQNGWLGNYALGASYIALPWWAGQALFGQLTWATALLTLAYSLAGLGIAVVNDFKSVEG  228

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPV FG + A WI  G IDL QL++   L ++G+ + A+ L+ L  PQI FQ
Sbjct  229  DRALGLQSLPVVFGVQRASWISAGMIDLFQLAMVAVLIAIGQHFAAVLLVLLIIPQITFQ  288

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH*SPDAFVTISGEI  285
              + L+DPV +DVKYQASAQPFLVLG+LVTALA  H    AF  ++  +
Sbjct  289  DIWLLRDPVAFDVKYQASAQPFLVLGMLVTALAIGHSDLTAFAALTAPL  337



>ref|WP_017304623.1| chitin-binding protein [Spirulina subsalsa]
Length=327

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYI+LPW AG ALFG L   ++ LTL YS+AGLGIA+VNDFKS+EG
Sbjct  169  LKQNGWLGNYALGSSYIALPWCAGHALFGQLNWTIVWLTLFYSLAGLGIAVVNDFKSVEG  228

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  IDL Q  VA YL ++G+  YA  LL L  PQI FQ
Sbjct  229  DRQLGLKSLPVMFGVGTAAWICVLMIDLFQAGVAVYLIAIGQNLYATILLLLVIPQITFQ  288

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  289  DMYFLRDPLKNDVKYQASAQPF  310



>ref|WP_002789018.1| chitin-binding protein [Microcystis aeruginosa]
 emb|CCI18974.1| Chlorophyll a synthase [Microcystis aeruginosa PCC 9807]
Length=326

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNWTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  228  DEKLGLKSLPVMFGITTAAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>ref|WP_002766585.1| chitin-binding protein [Microcystis aeruginosa]
 emb|CCI01335.1| Chlorophyll a synthase [Microcystis aeruginosa PCC 9443]
Length=326

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNWTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  228  DEKLGLKSLPVMFGITTAAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>ref|WP_040896611.1| chitin-binding protein [Xenococcus sp. PCC 7305]
Length=323

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYI+LPWWAG ALFG L   +++LTL+YS AGLGIA+VNDFKS+EG
Sbjct  165  LKQNGWLGNYALGSSYIALPWWAGHALFGELNWTIVILTLIYSFAGLGIAVVNDFKSVEG  224

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID  Q+ +A YL  + +  YA+ L  L  PQ+ FQ
Sbjct  225  DRTLGLKSLPVMFGITTAAWICVIMIDTFQIGIASYLVVIHENIYAIILGVLILPQMIFQ  284

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP++ DVKYQASAQPF
Sbjct  285  NIYFLRDPLENDVKYQASAQPF  306



>ref|WP_002742486.1| chlorophyll synthase, ChlG [Microcystis aeruginosa]
 emb|CAO87329.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS48970.1| chlorophyll synthase, ChlG [Microcystis aeruginosa DIANCHI905]
Length=326

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNGTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQ+ FQ
Sbjct  228  DEKLGLKSLPVMFGITTAAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQMTFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>gb|ELS04995.1| chlorophyll synthase [Xenococcus sp. PCC 7305]
Length=332

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYI+LPWWAG ALFG L   +++LTL+YS AGLGIA+VNDFKS+EG
Sbjct  174  LKQNGWLGNYALGSSYIALPWWAGHALFGELNWTIVILTLIYSFAGLGIAVVNDFKSVEG  233

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  ID  Q+ +A YL  + +  YA+ L  L  PQ+ FQ
Sbjct  234  DRTLGLKSLPVMFGITTAAWICVIMIDTFQIGIASYLVVIHENIYAIILGVLILPQMIFQ  293

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP++ DVKYQASAQPF
Sbjct  294  NIYFLRDPLENDVKYQASAQPF  315



>ref|WP_004266754.1| chitin-binding protein [Microcystis aeruginosa]
 emb|CCH99764.1| Chlorophyll a synthase [Microcystis aeruginosa PCC 9717]
Length=326

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNWTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  228  DEKLGLKSLPVMFGITTAAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>gb|EDY39225.1| chlorophyll synthase, ChlG [Cyanobium sp. PCC 7001]
Length=326

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  166  LKQNGWLGNYALGASYIALPWWAGQALFGQLTWATALLTLAYSLAGLGIAVVNDFKSVEG  225

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPV FG E A WI  G IDL QL++   L ++G+ + A+ L+ L  PQI FQ
Sbjct  226  DRALGLQSLPVVFGIEKASWISAGMIDLFQLAMVAVLIAIGQHFAAVLLVLLIVPQITFQ  285

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV +DVKYQASAQPF
Sbjct  286  DIWLLRDPVAFDVKYQASAQPF  307



>ref|WP_035986122.1| chitin-binding protein [Leptolyngbya sp. KIOST-1]
Length=349

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L+  +++LTL YS+AGLGIA+VNDFKS+EG
Sbjct  191  LKQNGWLGNYALGASYIALPWWAGHALFGDLSWQIVLLTLFYSLAGLGIAVVNDFKSVEG  250

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR MGL+SLPV FG  TA WICV AID+ Q  VA YL ++ +  YA+ L+ L  PQI FQ
Sbjct  251  DRQMGLKSLPVMFGVTTAAWICVLAIDIFQGGVAAYLMAIHQNLYAVLLILLIIPQITFQ  310

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  311  DMYFLRDPLGNDVKYQASAQPF  332



>ref|WP_002776168.1| chitin-binding protein [Microcystis aeruginosa]
 emb|CCI06588.1| Chlorophyll a synthase [Microcystis aeruginosa PCC 7941]
Length=329

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNWTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  228  DEKLGLKSLPVMFGITTAAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>ref|WP_043717019.1| chitin-binding protein [Synechococcus sp. CB0101]
Length=307

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT     LTL YS+AGLGIA+VNDFKS+EG
Sbjct  146  LKQNGWLGNYALGASYIALPWWAGQALFGHLTWTTAFLTLAYSLAGLGIAVVNDFKSVEG  205

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG E A WI  G ID+ QL++   L ++G+ + A+ L+ L  PQI FQ
Sbjct  206  DRALGLQSLPVAFGIEKASWISAGMIDVFQLAMVAVLIAIGQHFAAVLLVLLIIPQITFQ  265

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV +DVKYQASAQPF
Sbjct  266  DIWLLRDPVAFDVKYQASAQPF  287



>ref|WP_015202439.1| chlorophyll synthase [Crinalium epipsammum]
 gb|AFZ12317.1| chlorophyll synthase [Crinalium epipsammum PCC 9333]
Length=330

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYISLPWWAG ALFG L   ++VLTL YS+AGLGIA+VNDFKS+EG
Sbjct  172  LKQNGWLGNYALGASYISLPWWAGHALFGQLNWTIVVLTLFYSLAGLGIAVVNDFKSVEG  231

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG + A  ICV  ID+ QL +AGYL S+ +  YA  L+ L  PQI FQ
Sbjct  232  DRQLGLKSLPVMFGIDKAALICVLMIDIFQLGIAGYLVSIHQNLYAAILVLLVIPQITFQ  291

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  292  DMYFLRNPLENDVKYQASAQPF  313



>ref|WP_011933674.1| chitin-binding protein [Synechococcus sp. WH 7803]
 emb|CAK24202.1| Chlorophyll synthase 33 kD subunit [Synechococcus sp. WH 7803]
Length=317

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  155  LKQNGWLGNYALGASYIALPWWAGQALFGQLTWATAILTLAYSLAGLGIAVVNDFKSVEG  214

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG   A WI  G ID+ QL +   L ++G+ + A+ L+ L  PQI FQ
Sbjct  215  DRALGLQSLPVAFGIRPASWISAGMIDIFQLLMVAVLIAIGQHFAAVLLVLLIVPQITFQ  274

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV YDVKYQASAQPF
Sbjct  275  DIWLLRDPVAYDVKYQASAQPF  296



>ref|WP_040934684.1| chitin-binding protein [Prochloron didemni]
Length=336

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   + + TL+YS+AGLGIA++NDFKS+EG
Sbjct  178  LKQNGWLGNYALGASYIALPWWAGHALFGQLDWTIAISTLIYSLAGLGIAVINDFKSVEG  237

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG   A WICV AID+ Q  +AGYL S+ +  YA+ L+ L  PQI  Q
Sbjct  238  DRQLGLKSLPVMFGVTAAAWICVLAIDIFQAGMAGYLVSIHQNIYAIILVALIIPQIALQ  297

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFLKDP++ DVKYQASAQPF
Sbjct  298  NIYFLKDPLENDVKYQASAQPF  319



>ref|XP_005767761.1| hypothetical protein EMIHUDRAFT_421924 [Emiliania huxleyi CCMP1516]
 ref|XP_005770960.1| hypothetical protein EMIHUDRAFT_430815 [Emiliania huxleyi CCMP1516]
 gb|EOD15332.1| hypothetical protein EMIHUDRAFT_421924 [Emiliania huxleyi CCMP1516]
 gb|EOD18531.1| hypothetical protein EMIHUDRAFT_430815 [Emiliania huxleyi CCMP1516]
Length=354

 Score =   190 bits (483),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 115/144 (80%), Gaps = 3/144 (2%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFG--TLTPDVIVLTLLYSIAGLGIAIVNDFKSI  618
            LK  GW+G +ALGSSYI+LPW  G A+F   T+TP  +VLT+LYSIAGLGIAIVNDFKSI
Sbjct  195  LKAEGWLGTYALGSSYIALPWLCGHAMFSASTITPQEVVLTVLYSIAGLGIAIVNDFKSI  254

Query  617  EGDRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIF  438
            EGDRA+G+ SLPVAFG +TAK+ICV +IDLTQL VA YL+++G+  YA  L GL  PQ+F
Sbjct  255  EGDRALGMNSLPVAFGIDTAKYICVASIDLTQLGVAAYLYAIGETTYAAVLFGLVLPQMF  314

Query  437  FQFKYFLKDPVKYDVKYQASAQPF  366
             Q   F++DPV  DVKYQA+AQPF
Sbjct  315  AQLT-FIQDPVANDVKYQAAAQPF  337



>ref|WP_008318168.1| chlorophyll synthase [Leptolyngbya sp. PCC 6406]
Length=336

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL YS+AGLGIA+VNDFKS+EG
Sbjct  177  LKQNGWLGNYALGASYIALPWWAGHALFGELNLTIVLLTLFYSMAGLGIAVVNDFKSVEG  236

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR MGL SLPV FG  TA WICV  ID+ Q  +A YL +V +  YA+ L+ L  PQI FQ
Sbjct  237  DRQMGLASLPVMFGVGTAAWICVLMIDIFQGGIAAYLVAVHQNLYAVLLVLLIIPQITFQ  296

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  297  DMYFLRNPLENDVKYQASAQPF  318



>ref|WP_040943923.1| chitin-binding protein [Prochloron didemni]
Length=336

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   + + TL+YS+AGLGIA++NDFKS+EG
Sbjct  178  LKQNGWLGNYALGASYIALPWWAGHALFGQLDWTIAISTLIYSLAGLGIAVINDFKSVEG  237

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG   A WICV AID+ Q  +AGYL S+ +  YA+ L+ L  PQI  Q
Sbjct  238  DRQLGLKSLPVMFGVTAAAWICVLAIDIFQAGMAGYLVSIHQNIYAIILVALIIPQIALQ  297

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFLKDP++ DVKYQASAQPF
Sbjct  298  NIYFLKDPLENDVKYQASAQPF  319



>ref|WP_040939572.1| chitin-binding protein [Prochloron didemni]
Length=336

 Score =   189 bits (481),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   + + TL+YS+AGLGIA++NDFKS+EG
Sbjct  178  LKQNGWLGNYALGASYIALPWWAGHALFGQLDWTIAISTLIYSLAGLGIAVINDFKSVEG  237

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG   A WICV AID+ Q  +AGYL S+ +  YA+ L+ L  PQI  Q
Sbjct  238  DRQLGLKSLPVMFGVTAAAWICVLAIDIFQAGMAGYLVSIHQNIYAIILVALIIPQIALQ  297

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFLKDP++ DVKYQASAQPF
Sbjct  298  NIYFLKDPLENDVKYQASAQPF  319



>ref|WP_042503728.1| chitin-binding protein [Synechococcus sp. WH 8102]
Length=317

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  155  LKQNGWLGNYALGASYIALPWWAGQALFGQLTWSTALLTLAYSLAGLGIAVVNDFKSVEG  214

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG +TA WI  G ID+ QL++   L ++G+ + A+ L+ L  PQI FQ
Sbjct  215  DRELGLQSLPVVFGIKTASWISAGMIDIFQLAMVAVLIAIGQHFAAVLLVLLIVPQITFQ  274

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV++DVKYQASAQPF
Sbjct  275  DIWLLRDPVEFDVKYQASAQPF  296



>gb|ABA55504.1| chloroplast chlorophyll synthase, partial [Isochrysis galbana]
Length=401

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 115/144 (80%), Gaps = 3/144 (2%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFG--TLTPDVIVLTLLYSIAGLGIAIVNDFKSI  618
            LK  GW+G +ALGSSYI+LPW  G A+F   T+TP  +VLT+LYSIAGLGIAIVNDFKSI
Sbjct  242  LKAEGWLGTYALGSSYIALPWLCGHAMFSASTITPQEVVLTVLYSIAGLGIAIVNDFKSI  301

Query  617  EGDRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIF  438
            EGD A+G+ SLPVAFG +TAKWICV +ID+TQL VA YL+S+G+  YA  L GL  PQ+F
Sbjct  302  EGDAALGMNSLPVAFGIDTAKWICVASIDVTQLGVAAYLYSIGESTYAAILFGLVLPQMF  361

Query  437  FQFKYFLKDPVKYDVKYQASAQPF  366
             Q+  F++DPV  DVKYQA+AQPF
Sbjct  362  AQYT-FVQDPVANDVKYQAAAQPF  384



>ref|WP_015216855.1| chlorophyll synthase [Anabaena cylindrica]
 gb|AFZ60239.1| chlorophyll synthase [Anabaena cylindrica PCC 7122]
Length=344

 Score =   190 bits (482),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   ++VLTL YS+AGLGIAIVNDFKS+EG
Sbjct  186  LKQNGWLGNYALGASYIALPWWAGHALFGELNWRIVVLTLFYSLAGLGIAIVNDFKSVEG  245

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG + A  ICV  IDL Q  VA YL S+ +  YA  L+ L  PQI FQ
Sbjct  246  DRQLGLQSLPVMFGIQNAALICVVMIDLFQGLVAAYLVSIHENLYAAILVLLIIPQITFQ  305

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  306  DMYFLRDPIANDVKYQASAQPF  327



>ref|WP_002796856.1| chitin-binding protein [Microcystis aeruginosa]
 dbj|BAG02024.1| chlorophyll a synthase [Microcystis aeruginosa NIES-843]
 emb|CCI24338.1| Chlorophyll a synthase [Microcystis aeruginosa PCC 9809]
Length=326

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNWTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  T+ WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  228  DEKLGLKSLPVMFGITTSAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>ref|WP_002733514.1| chlorophyll synthase, ChlG [Microcystis aeruginosa]
 gb|ELP56538.1| chlorophyll synthase, ChlG [Microcystis aeruginosa TAIHU98]
Length=326

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNWTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQ+ FQ
Sbjct  228  DEKLGLKSLPVMFGITTAAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQMTFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>ref|WP_006041997.1| chitin-binding protein [Synechococcus sp. WH 7805]
 gb|EAR18306.1| bacteriochlorophyll a synthase [Synechococcus sp. WH 7805]
Length=317

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  155  LKQNGWLGNYALGASYIALPWWAGQALFGQLTWATALLTLAYSLAGLGIAVVNDFKSVEG  214

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG   A WI  G ID+ QL +   L ++G+ + A+ L+ L  PQI FQ
Sbjct  215  DRALGLQSLPVAFGIRPASWISAGMIDIFQLLMVAVLIAIGQHFAAVLLVLLIVPQITFQ  274

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV YDVKYQASAQPF
Sbjct  275  DIWLLRDPVAYDVKYQASAQPF  296



>ref|WP_011610670.1| chitin-binding protein [Trichodesmium erythraeum]
 gb|ABG50279.1| chlorophyll synthase [Trichodesmium erythraeum IMS101]
Length=326

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYI+LPWW G ALFG L   +++LTL YS AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGSSYIALPWWTGHALFGELNLTIVILTLFYSFAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  TA WICV  ID+ Q  VA YL S+ +  YA+ LL +  PQI FQ
Sbjct  228  DEKLGLKSLPVMFGIGTAAWICVLMIDIFQAGVAVYLISIKENLYAVILLLMVIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  288  DMYFLRNPLENDVKYQASAQPF  309



>ref|WP_002791418.1| chitin-binding protein [Microcystis aeruginosa]
 emb|CCI29448.1| Genome sequencing data, contig C311 [Microcystis aeruginosa PCC 
9808]
Length=326

 Score =   189 bits (480),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNGTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  T+ WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQ+ FQ
Sbjct  228  DEKLGLKSLPVMFGITTSAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQMTFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  288  DMYFLRDPLKNDVKYQASAQPF  309



>ref|WP_008274923.1| chitin-binding protein [Cyanothece sp. CCY0110]
 gb|EAZ91853.1| chlorophyll a synthase [Cyanothece sp. CCY0110]
Length=326

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGELNWTIVILTLFYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA W+CV  ID+ Q  +  YL  + +  YA  LL L  PQI FQ
Sbjct  228  DRQLGLKSLPVMFGINTAAWVCVIMIDVFQAGIGAYLIYIHQNLYAAILLLLVIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP++ DVKYQASAQPF
Sbjct  288  DMYFLRDPLENDVKYQASAQPF  309



>ref|WP_007100447.1| chitin-binding protein [Synechococcus sp. RS9917]
 gb|EAQ68120.1| chlorophyll synthase, ChlG [Synechococcus sp. RS9917]
Length=317

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  155  LKQNGWLGNYALGASYIALPWWAGQALFGQLTWSTAILTLAYSLAGLGIAVVNDFKSVEG  214

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+A+GLQSLPV FG+E A WI  G ID+ QL +   L  +G+ + A+ L+ L  PQI FQ
Sbjct  215  DKALGLQSLPVVFGTERASWISAGMIDVFQLLMVAVLIGIGQHFAAVLLVLLIVPQITFQ  274

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV +DVKYQASAQPF
Sbjct  275  DIWLLRDPVAFDVKYQASAQPF  296



>ref|WP_006276267.1| chitin-binding protein [Cylindrospermopsis raciborskii]
 gb|EFA70756.1| chlorophyll synthetase [Cylindrospermopsis raciborskii CS-505]
Length=343

 Score =   189 bits (480),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   ++VLTL YS+AGLGIAIVNDFKS+EG
Sbjct  183  LKQNGWLGNYALGASYIALPWWAGHALFGELNWKIVVLTLFYSLAGLGIAIVNDFKSVEG  242

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL SLPV FG +TA  ICV  ID+ Q  VAGYL S+ +  YA  L  L  PQI FQ
Sbjct  243  DRQLGLNSLPVMFGIQTAALICVVMIDVFQGLVAGYLVSIHENLYAAILALLIIPQITFQ  302

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  303  DMYFLRDPIGNDVKYQASAQPF  324



>ref|XP_002984907.1| hypothetical protein SELMODRAFT_423983 [Selaginella moellendorffii]
 gb|EFJ14157.1| hypothetical protein SELMODRAFT_423983 [Selaginella moellendorffii]
Length=374

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 130/156 (83%), Gaps = 16/156 (10%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQ+GWIGN+ALGSSYI+LPWWA QALFGTL+ DV+VLTLLYS AGLGIAIVNDFKSIEG
Sbjct  235  LKQSGWIGNYALGSSYIALPWWASQALFGTLSWDVVVLTLLYSTAGLGIAIVNDFKSIEG  294

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRAMGLQSLPVAFG +TAKWIC+G+IDLTQLSVAGYLF+ GK YYALALLGL  PQI F 
Sbjct  295  DRAMGLQSLPVAFGIDTAKWICIGSIDLTQLSVAGYLFATGKLYYALALLGLITPQIIF-  353

Query  431  FKYFLKDPVKYDVKYQASAQPFlvlgllvtalaTSH  324
                           QASAQPF VLGLLVTALATSH
Sbjct  354  ---------------QASAQPFFVLGLLVTALATSH  374



>emb|CAE08192.1| chlorophyll synthase 33 kD subunit [Synechococcus sp. WH 8102]
Length=336

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  174  LKQNGWLGNYALGASYIALPWWAGQALFGQLTWSTALLTLAYSLAGLGIAVVNDFKSVEG  233

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG +TA WI  G ID+ QL++   L ++G+ + A+ L+ L  PQI FQ
Sbjct  234  DRELGLQSLPVVFGIKTASWISAGMIDIFQLAMVAVLIAIGQHFAAVLLVLLIVPQITFQ  293

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV++DVKYQASAQPF
Sbjct  294  DIWLLRDPVEFDVKYQASAQPF  315



>ref|WP_009543798.1| MULTISPECIES: chitin-binding protein [Cyanothece]
 gb|ACB53470.1| chlorophyll a synthase [Cyanothece sp. ATCC 51142]
Length=326

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   ++VLTL YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGDLNWTIVVLTLFYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA W+CV  ID+ Q  +  YL  + +  YA  LL L  PQI FQ
Sbjct  228  DRQLGLKSLPVMFGVNTAAWLCVIMIDVFQAGIGAYLIYIQENLYAAILLLLVIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP++ DVKYQASAQPF
Sbjct  288  DMYFLRDPLENDVKYQASAQPF  309



>ref|WP_009789357.1| chitin-binding protein [Synechococcus sp. BL107]
 gb|EAU70563.1| bacteriochlorophyll a synthase [Synechococcus sp. BL107]
Length=317

 Score =   188 bits (478),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT     LTL YS+AGLGIA+VNDFKS+EG
Sbjct  155  LKQNGWLGNYALGASYIALPWWAGQALFGQLTWTTAFLTLAYSLAGLGIAVVNDFKSVEG  214

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPV FG + A WI  G ID+ QL++ G L ++G+ + A+ L+ L  PQI FQ
Sbjct  215  DRALGLQSLPVVFGIKRASWISAGMIDIFQLAMVGVLIAIGQHFAAVLLVLLIIPQITFQ  274

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L DPV++DVKYQASAQPF
Sbjct  275  DIWLLTDPVEFDVKYQASAQPF  296



>ref|WP_015138788.1| chlorophyll synthase [Nostoc sp. PCC 7524]
 gb|AFY48349.1| chlorophyll synthase [Nostoc sp. PCC 7524]
Length=336

 Score =   189 bits (479),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +IVLTL+YS+AGLGIAIVNDFKS+EG
Sbjct  178  LKQNGWLGNYALGASYIALPWWAGHALFGELNWKIIVLTLIYSLAGLGIAIVNDFKSVEG  237

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG + A  ICV  ID+ Q  +A YL S+ +  YA  L+ L  PQI FQ
Sbjct  238  DRQLGLKSLPVMFGIDKAALICVVMIDVFQGLIAAYLVSIHENLYAAILVLLIIPQITFQ  297

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  298  DMYFLRDPLKNDVKYQASAQPF  319



>ref|WP_006854672.1| chitin-binding protein [Synechococcus sp. WH 8016]
 gb|EHA60157.1| chlorophyll synthase, ChlG [Synechococcus sp. WH 8016]
Length=317

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  155  LKQNGWLGNYALGASYIALPWWAGQALFGQLTWATALLTLAYSLAGLGIAVVNDFKSVEG  214

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG   A WI  G IDL QL +   L ++G+ + A+ L+ L  PQI FQ
Sbjct  215  DRALGLQSLPVAFGIGPASWISAGMIDLFQLLMVAVLIAIGQHFAAILLVLLIVPQITFQ  274

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV++DVKYQASAQPF
Sbjct  275  DIWLLRDPVEFDVKYQASAQPF  296



>gb|ABI45755.1| chlorophyll synthase, ChlG [Synechococcus sp. CC9311]
Length=308

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  146  LKQNGWLGNYALGASYIALPWWAGQALFGQLTWATALLTLAYSLAGLGIAVVNDFKSVEG  205

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG   A WI  G IDL QL +   L ++G+ + A+ L+ L  PQI FQ
Sbjct  206  DRALGLQSLPVAFGIGPASWISAGMIDLFQLLMVAVLIAIGQHFAAVLLVLLIVPQITFQ  265

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV++DVKYQASAQPF
Sbjct  266  DIWLLRDPVEFDVKYQASAQPF  287



>ref|WP_041426374.1| chitin-binding protein [Synechococcus sp. CC9311]
Length=317

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  155  LKQNGWLGNYALGASYIALPWWAGQALFGQLTWATALLTLAYSLAGLGIAVVNDFKSVEG  214

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DRA+GLQSLPVAFG   A WI  G IDL QL +   L ++G+ + A+ L+ L  PQI FQ
Sbjct  215  DRALGLQSLPVAFGIGPASWISAGMIDLFQLLMVAVLIAIGQHFAAVLLVLLIVPQITFQ  274

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV++DVKYQASAQPF
Sbjct  275  DIWLLRDPVEFDVKYQASAQPF  296



>ref|WP_018399831.1| chitin-binding protein [filamentous cyanobacterium ESFC-1]
Length=321

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWWAG ALFG L   ++VLTL YS+AGLGIA+VNDFKS+EG
Sbjct  163  LKKNGWLGNYALGASYIALPWWAGHALFGELNGTIVVLTLFYSLAGLGIAVVNDFKSVEG  222

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL SLPV FG  TA WICV  IDL Q  +AGYL S+ +  YA  LL L  PQI FQ
Sbjct  223  DRQLGLNSLPVMFGVGTAAWICVLMIDLFQAGIAGYLISIDQNLYATILLLLIIPQITFQ  282

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+ P++ DVKYQASAQPF
Sbjct  283  DMYFLRAPLENDVKYQASAQPF  304



>ref|WP_015226341.1| chlorophyll synthase [Halothece sp. PCC 7418]
 gb|AFZ44466.1| chlorophyll synthase [Halothece sp. PCC 7418]
Length=330

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG +LFG L   +IVLTL+YS+AGLGIA+VNDFKS+EG
Sbjct  172  LKQNGWLGNYALGASYIALPWWAGHSLFGDLNLTIIVLTLIYSMAGLGIAVVNDFKSVEG  231

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG   A WI V  ID  QL +AGYL S+ +  YA  L+ L  PQI FQ
Sbjct  232  DRELGLKSLPVMFGVGGAAWISVLMIDTFQLGIAGYLMSIHENLYATLLVLLVIPQITFQ  291

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+ P++ DVKYQASAQPF
Sbjct  292  DMYFLRSPLENDVKYQASAQPF  313



>ref|WP_017720164.1| chitin-binding protein [Oscillatoria sp. PCC 10802]
Length=339

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWWAG ALFG L   ++ LTL YS+AGLGIA+VNDFKS+EG
Sbjct  181  LKKNGWLGNYALGASYIALPWWAGHALFGQLNATIVALTLFYSLAGLGIAVVNDFKSVEG  240

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+ +GL+SLPV FG  TA WICV  IDL Q  +A YL ++ +  YA+ LL L  PQI FQ
Sbjct  241  DQKLGLKSLPVMFGIGTAAWICVLMIDLFQAGIAAYLIAIHQNLYAVILLLLVIPQITFQ  300

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  301  DMYFLRNPLENDVKYQASAQPF  322



>ref|WP_041237226.1| chitin-binding protein [Cyanothece sp. PCC 7425]
Length=323

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL YS+AGLGIAIVNDFKS+EG
Sbjct  165  LKQNGWLGNYALGASYIALPWWAGHALFGQLNWKIVILTLAYSLAGLGIAIVNDFKSVEG  224

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG   A W+CV  ID+ Q+++A YL  + +  YA+ L+ L  PQI FQ
Sbjct  225  DRKLGLKSLPVMFGVRPAAWLCVLMIDIFQVAMAAYLMYIHQNLYAVILILLIIPQITFQ  284

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  285  DMYFLRDPLKNDVKYQASAQPF  306



>ref|WP_013189701.1| chitin-binding protein [Trichormus azollae]
 gb|ADI62681.1| bacteriochlorophyll/chlorophyll synthetase ['Nostoc azollae' 
0708]
Length=343

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   ++VLTL YS+AGLGIAIVNDFKS++G
Sbjct  185  LKQNGWLGNYALGASYIALPWWAGHALFGELNWWIVVLTLFYSLAGLGIAIVNDFKSVDG  244

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG +TA  ICV  IDL Q  VA YL S+ +  YA  L+ L  PQI FQ
Sbjct  245  DRQLGLQSLPVMFGVQTAALICVVMIDLFQGLVAAYLVSIHENLYAAILVLLIIPQITFQ  304

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+  DVKYQASAQPF
Sbjct  305  DMYFLRDPIANDVKYQASAQPF  326



>gb|ACL46162.1| chlorophyll synthase, ChlG [Cyanothece sp. PCC 7425]
Length=340

 Score =   188 bits (477),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL YS+AGLGIAIVNDFKS+EG
Sbjct  182  LKQNGWLGNYALGASYIALPWWAGHALFGQLNWKIVILTLAYSLAGLGIAIVNDFKSVEG  241

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG   A W+CV  ID+ Q+++A YL  + +  YA+ L+ L  PQI FQ
Sbjct  242  DRKLGLKSLPVMFGVRPAAWLCVLMIDIFQVAMAAYLMYIHQNLYAVILILLIIPQITFQ  301

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  302  DMYFLRDPLKNDVKYQASAQPF  323



>ref|WP_008188082.1| chitin-binding protein [Moorea producens]
 gb|EGJ30204.1| chlorophyll synthase [Moorea producens 3L]
Length=323

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWWAG  LFG L   +++LTL YS+AGLGIA+VNDFKS+EG
Sbjct  165  LKKNGWLGNYALGASYIALPWWAGHGLFGHLNLTIMILTLFYSLAGLGIAVVNDFKSVEG  224

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  IDL Q  +AGYL S+ +  YA  L+ L  PQI FQ
Sbjct  225  DRELGLKSLPVMFGVTTAAWICVVMIDLFQAGIAGYLISIHQNLYAAILILLIIPQITFQ  284

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  285  DMYFLRDPLKNDVKYQASAQPF  306



>ref|WP_021831402.1| Chlorophyll a synthase ChlG [Crocosphaera watsonii]
 emb|CCQ52468.1| Chlorophyll a synthase ChlG [Crocosphaera watsonii WH 8502]
Length=326

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNWTIVILTLFYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA W+CV  ID+ Q  +  YL  + +  YA  +L L  PQI FQ
Sbjct  228  DRQLGLKSLPVMFGVNTAAWLCVTMIDVFQAGIGAYLIYIHQNLYAAMVLLLVIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  288  DMYFLRNPLENDVKYQASAQPF  309



>ref|WP_017325563.1| hypothetical protein [Synechococcus sp. PCC 7336]
Length=353

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALGSSYI+LPWWAG ALFG L   VI +TL+YS+AGLGIA+VNDFKS+EG
Sbjct  195  LKQNGWLGNYALGSSYIALPWWAGHALFGQLNATVIAITLIYSLAGLGIAVVNDFKSVEG  254

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG + A WI V  ID+ Q+S+A +L  VG+   A  ++ L  PQI  Q
Sbjct  255  DRELGLQSLPVVFGVQKAAWISVTTIDVFQISMAIFLVVVGQNLLATLIVFLVIPQIVLQ  314

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DPV  DVKYQASAQPF
Sbjct  315  DMYFLRDPVANDVKYQASAQPF  336



>ref|WP_015190495.1| chlorophyll synthase [Gloeocapsa sp. PCC 7428]
 gb|AFZ32628.1| chlorophyll synthase [Gloeocapsa sp. PCC 7428]
Length=352

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK+NGW+GN+ALG+SYI+LPWW G ALFG L   + +LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  194  LKRNGWLGNYALGASYIALPWWTGHALFGDLNWTIAILTLIYSMAGLGIAVVNDFKSVEG  253

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA WICV  IDL Q  +A YL  +G+  Y   LL L  PQI FQ
Sbjct  254  DRQLGLKSLPVMFGVNTAAWICVAMIDLFQAGIAAYLIGIGENLYGAILLLLLIPQITFQ  313

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP++ DVKYQASAQPF
Sbjct  314  DMYFLRDPIQNDVKYQASAQPF  335



>ref|WP_036003752.1| chitin-binding protein [Leptolyngbya sp. JSC-1]
Length=346

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWW G ALFG L   +++LTL YS+AGLGIA+VNDFKS+EG
Sbjct  188  LKQNGWLGNYALGASYIALPWWTGHALFGDLNWTIVLLTLFYSLAGLGIAVVNDFKSVEG  247

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D+ +GL+SLPV FG  TA WICV  ID+ Q  +A YL  +G+  YA+ L+ L  PQI FQ
Sbjct  248  DQQLGLKSLPVMFGITTAAWICVLMIDVFQSGIAAYLMGIGQNLYAVLLILLIIPQITFQ  307

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  308  DMYFLRDPLKNDVKYQASAQPF  329



>ref|XP_011396726.1| Chlorophyll synthase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM23848.1| Chlorophyll synthase, chloroplastic [Auxenochlorella protothecoides]
Length=403

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 116/167 (69%), Gaps = 25/167 (15%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LK++GWIGN+ALGSSYI+LPWWAGQ LFG L  DV +LT+LYSIAGLGIAIVNDFKSI+G
Sbjct  215  LKRSGWIGNYALGSSYIALPWWAGQILFGQLRLDVAILTMLYSIAGLGIAIVNDFKSIKG  274

Query  611  ------------------------DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGY  504
                                    DR +GL SLPVAFG E AKWIC  +ID+TQL VA Y
Sbjct  275  RVAGEDYVMLPPCNRQRAGAVWICDRELGLNSLPVAFGIEKAKWICAASIDVTQLGVAAY  334

Query  503  L-FSVGKPYYALALLGLTAPQIFFQFKYFLKDPVKYDVKYQASAQPF  366
            L + + +PYYA  +    APQ++ Q +YFL DPV  DVKYQA+AQPF
Sbjct  335  LAWGLNEPYYAAGIAACLAPQVYAQVRYFLPDPVANDVKYQATAQPF  381



>ref|WP_007303080.1| chitin-binding protein [Crocosphaera watsonii]
 gb|EAM52757.1| Bacteriochlorophyll/chlorophyll synthetase [Crocosphaera watsonii 
WH 8501]
Length=326

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNWTIVILTLFYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA W+CV  ID+ Q  +  YL  + +  YA  +L L  PQI FQ
Sbjct  228  DRQLGLKSLPVMFGVNTAAWLCVIMIDVFQAGIGAYLIYIHQNLYATMVLLLVIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  288  DMYFLRNPLENDVKYQASAQPF  309



>ref|WP_007311921.1| chitin-binding protein [Crocosphaera watsonii]
 gb|EHJ11299.1| Chlorophyll a synthase ChlG [Crocosphaera watsonii WH 0003]
 emb|CCQ62612.1| Chlorophyll a synthase ChlG [Crocosphaera watsonii WH 0401]
 emb|CCQ55732.1| Chlorophyll a synthase ChlG [Crocosphaera watsonii WH 0005]
 emb|CCQ68867.1| Chlorophyll a synthase ChlG [Crocosphaera watsonii WH 0402]
Length=326

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNWTIVILTLFYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG  TA W+CV  ID+ Q  +  YL  + +  YA  +L L  PQI FQ
Sbjct  228  DRQLGLKSLPVMFGVNTAAWLCVIMIDVFQAGIGAYLIYIHQNLYAAMVLLLVIPQITFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL++P++ DVKYQASAQPF
Sbjct  288  DMYFLRNPLENDVKYQASAQPF  309



>ref|WP_016515091.1| bacteriochlorophyll/chlorophyll a synthase [Microcystis aeruginosa]
 gb|EPF22865.1| bacteriochlorophyll/chlorophyll a synthase [Microcystis aeruginosa 
SPC777]
Length=329

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAG ALFG L   +++LTL+YS+AGLGIA+VNDFKS+EG
Sbjct  168  LKQNGWLGNYALGASYIALPWWAGHALFGQLNWTIMILTLIYSLAGLGIAVVNDFKSVEG  227

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            D  +GL+SLPV FG  T+ WICV  ID+ Q  +AGYL S+ +  YA  LL L  PQ+ FQ
Sbjct  228  DEKLGLKSLPVMFGITTSAWICVIMIDVFQAGIAGYLISIHQNLYAAILLLLIIPQMTFQ  287

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQA AQPF
Sbjct  288  DMYFLRDPLKNDVKYQARAQPF  309



>ref|WP_017661464.1| chitin-binding protein [Geitlerinema sp. PCC 7105]
Length=338

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPW AG ALFG L   ++VLT+ YS+AGLGIAIVNDFKS+EG
Sbjct  180  LKQNGWLGNYALGASYITLPWCAGHALFGELNITIVVLTMFYSLAGLGIAIVNDFKSVEG  239

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG   A WICV +ID+ Q  +A YL S+ +  YA+ L+ L  PQI FQ
Sbjct  240  DRQLGLKSLPVMFGIMPAAWICVLSIDIFQTGIAAYLVSIHQNAYAVLLMLLVIPQITFQ  299

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YF+++P++ DVKYQASAQPF
Sbjct  300  DMYFMRNPLENDVKYQASAQPF  321



>gb|AII50024.1| chitin-binding protein [Synechococcus sp. KORDI-52]
Length=308

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  146  LKQNGWLGNYALGASYIALPWWAGQALFGHLTWGTALLTLAYSLAGLGIAVVNDFKSVEG  205

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG + A WI  G ID+ QL++   L  +G+ + A+ L+ L  PQI FQ
Sbjct  206  DRELGLQSLPVVFGIQRASWISAGMIDVFQLAMVAVLIGIGQHFAAVLLVLLIVPQITFQ  265

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV +DVKYQASAQPF
Sbjct  266  DIWLLRDPVAFDVKYQASAQPF  287



>ref|WP_015141839.1| chlorophyll synthase [Pleurocapsa minor]
 gb|AFY75531.1| chlorophyll synthase [Pleurocapsa sp. PCC 7327]
Length=335

 Score =   186 bits (473),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+G +ALGSSYI+LPWW G ALFG L   +++LTL+YS AGLGIA+VNDFKSIEG
Sbjct  177  LKQNGWLGTYALGSSYIALPWWTGHALFGDLNWTIVILTLIYSFAGLGIAVVNDFKSIEG  236

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GL+SLPV FG   A WICV  IDL Q ++A YL  + +  YA  LL L  PQI FQ
Sbjct  237  DRQLGLKSLPVMFGVTAAAWICVLTIDLFQAAIAAYLIYIHENLYATILLLLIIPQITFQ  296

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              YFL+DP+K DVKYQASAQPF
Sbjct  297  DMYFLRDPLKNDVKYQASAQPF  318



>ref|WP_038556134.1| chitin-binding protein [Synechococcus sp. KORDI-52]
Length=317

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  791  LKQNGWIGNFALGSSYISLPWWAGQALFGTLTPDVIVLTLLYSIAGLGIAIVNDFKSIEG  612
            LKQNGW+GN+ALG+SYI+LPWWAGQALFG LT    +LTL YS+AGLGIA+VNDFKS+EG
Sbjct  155  LKQNGWLGNYALGASYIALPWWAGQALFGHLTWGTALLTLAYSLAGLGIAVVNDFKSVEG  214

Query  611  DRAMGLQSLPVAFGSETAKWICVGAIDLTQLSVAGYLFSVGKPYYALALLGLTAPQIFFQ  432
            DR +GLQSLPV FG + A WI  G ID+ QL++   L  +G+ + A+ L+ L  PQI FQ
Sbjct  215  DRELGLQSLPVVFGIQRASWISAGMIDVFQLAMVAVLIGIGQHFAAVLLVLLIVPQITFQ  274

Query  431  FKYFLKDPVKYDVKYQASAQPF  366
              + L+DPV +DVKYQASAQPF
Sbjct  275  DIWLLRDPVAFDVKYQASAQPF  296



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1614230233668