BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9595

Length=795
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009766983.1|  PREDICTED: RING-H2 finger protein ATL67-like       248   1e-78   Nicotiana sylvestris
ref|XP_009597583.1|  PREDICTED: RING-H2 finger protein ATL67-like       248   1e-78   Nicotiana tomentosiformis
ref|XP_006339638.1|  PREDICTED: RING-H2 finger protein ATL67-like       246   7e-77   Solanum tuberosum [potatoes]
ref|XP_010326706.1|  PREDICTED: RING-H2 finger protein ATL67-like       245   8e-77   Solanum lycopersicum
ref|XP_011093078.1|  PREDICTED: RING-H2 finger protein ATL68            236   1e-73   Sesamum indicum [beniseed]
gb|EYU32179.1|  hypothetical protein MIMGU_mgv1a014108mg                229   3e-71   Erythranthe guttata [common monkey flower]
gb|EPS71501.1|  hypothetical protein M569_03256                         226   3e-70   Genlisea aurea
gb|EPS68076.1|  hypothetical protein M569_06695                         219   1e-67   Genlisea aurea
emb|CDP08747.1|  unnamed protein product                                218   1e-66   Coffea canephora [robusta coffee]
ref|XP_011093041.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    230   2e-66   
ref|XP_004248065.1|  PREDICTED: RING-H2 finger protein ATL67-like       209   3e-63   Solanum lycopersicum
gb|KJB24638.1|  hypothetical protein B456_004G154800                    201   3e-60   Gossypium raimondii
ref|XP_006491198.1|  PREDICTED: RING-H2 finger protein ATL67-like       199   8e-60   
ref|XP_011037158.1|  PREDICTED: RING-H2 finger protein ATL67            198   5e-59   Populus euphratica
gb|KJB09703.1|  hypothetical protein B456_001G157500                    199   8e-59   Gossypium raimondii
gb|EYU35114.1|  hypothetical protein MIMGU_mgv1a020271mg                196   2e-58   Erythranthe guttata [common monkey flower]
emb|CBI40419.3|  unnamed protein product                                198   3e-58   Vitis vinifera
ref|XP_002320162.1|  zinc finger family protein                         193   4e-57   Populus trichocarpa [western balsam poplar]
gb|KJB41423.1|  hypothetical protein B456_007G103900                    191   1e-56   Gossypium raimondii
ref|XP_012083296.1|  PREDICTED: RING-H2 finger protein ATL67            192   1e-56   Jatropha curcas
ref|XP_006358653.1|  PREDICTED: RING-H2 finger protein ATL67-like       191   3e-56   Solanum tuberosum [potatoes]
ref|XP_010669733.1|  PREDICTED: RING-H2 finger protein ATL67-like       190   5e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010261407.1|  PREDICTED: RING-H2 finger protein ATL67-like       189   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010559104.1|  PREDICTED: RING-H2 finger protein ATL67-like       187   4e-55   Tarenaya hassleriana [spider flower]
emb|CAN73279.1|  hypothetical protein VITISV_040608                     196   3e-54   Vitis vinifera
gb|KFK35351.1|  hypothetical protein AALP_AA5G273400                    185   8e-54   Arabis alpina [alpine rockcress]
ref|XP_010661826.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    195   9e-54   
ref|XP_006291847.1|  hypothetical protein CARUB_v10018022mg             184   2e-53   Capsella rubella
ref|XP_009349321.1|  PREDICTED: RING-H2 finger protein ATL67-like       182   3e-53   Pyrus x bretschneideri [bai li]
emb|CDX71732.1|  BnaC08g31420D                                          180   8e-52   
ref|XP_010251603.1|  PREDICTED: RING-H2 finger protein ATL67            178   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_006402471.1|  hypothetical protein EUTSA_v10006504mg             178   3e-51   
gb|KEH18782.1|  zinc finger, C3HC4 type (RING finger) protein           178   3e-51   Medicago truncatula
ref|NP_191714.1|  RING-H2 finger protein ATL68                          178   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010512505.1|  PREDICTED: RING-H2 finger protein ATL68 isof...    177   9e-51   
ref|XP_010469090.1|  PREDICTED: RING-H2 finger protein ATL68-like...    177   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_007135149.1|  hypothetical protein PHAVU_010G105200g             176   1e-50   Phaseolus vulgaris [French bean]
ref|XP_004492810.1|  PREDICTED: RING-H2 finger protein ATL67-like       174   3e-50   Cicer arietinum [garbanzo]
ref|XP_007051690.1|  S-adenosyl-L-methionine-dependent methyltran...    185   4e-50   
ref|XP_009116820.1|  PREDICTED: RING-H2 finger protein ATL68            175   7e-50   Brassica rapa
ref|XP_002876620.1|  zinc finger family protein                         174   8e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_009341125.1|  PREDICTED: RING-H2 finger protein ATL67            173   1e-49   Pyrus x bretschneideri [bai li]
emb|CDY11361.1|  BnaA09g39270D                                          173   2e-49   Brassica napus [oilseed rape]
ref|XP_009345625.1|  PREDICTED: RING-H2 finger protein ATL67-like       171   4e-49   Pyrus x bretschneideri [bai li]
ref|XP_008343409.1|  PREDICTED: RING-H2 finger protein ATL67-like       171   1e-48   
emb|CDY65206.1|  BnaAnng20290D                                          171   1e-48   Brassica napus [oilseed rape]
ref|XP_009142411.1|  PREDICTED: RING-H2 finger protein ATL67-like       171   1e-48   Brassica rapa
ref|XP_002301380.1|  hypothetical protein POPTR_0002s16670g             170   1e-48   
ref|XP_008232965.1|  PREDICTED: RING-H2 finger protein ATL67            170   2e-48   Prunus mume [ume]
ref|XP_009338797.1|  PREDICTED: uncharacterized protein LOC103931112    180   3e-48   
ref|XP_006583264.1|  PREDICTED: RING-H2 finger protein ATL67-like       168   1e-47   
ref|XP_009345627.1|  PREDICTED: RING-H2 finger protein ATL67-like       166   5e-47   Pyrus x bretschneideri [bai li]
gb|ABD28581.1|  Zinc finger, RING-type                                  165   1e-46   Medicago truncatula
emb|CDY27329.1|  BnaC04g50760D                                          166   1e-46   Brassica napus [oilseed rape]
ref|XP_006294928.1|  hypothetical protein CARUB_v10023982mg             164   9e-46   
gb|KFK37394.1|  hypothetical protein AALP_AA4G251500                    164   1e-45   Arabis alpina [alpine rockcress]
ref|XP_003624102.1|  Ring finger protein                                165   4e-45   
ref|XP_011622828.1|  PREDICTED: RING-H2 finger protein ATL67            160   7e-45   Amborella trichopoda
ref|XP_010506614.1|  PREDICTED: RING-H2 finger protein ATL67            161   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006397800.1|  hypothetical protein EUTSA_v10001804mg             161   1e-44   Eutrema salsugineum [saltwater cress]
ref|NP_182139.1|  RING-H2 finger protein ATL67                          161   1e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008375945.1|  PREDICTED: uncharacterized protein LOC103439174    169   2e-44   
emb|CDY42011.1|  BnaC04g00890D                                          160   2e-44   Brassica napus [oilseed rape]
ref|XP_009142683.1|  PREDICTED: RING-H2 finger protein ATL67            160   2e-44   Brassica rapa
emb|CDX79992.1|  BnaA05g01640D                                          160   2e-44   
gb|KJB49432.1|  hypothetical protein B456_008G119400                    157   2e-43   Gossypium raimondii
ref|XP_011468973.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    166   2e-43   Fragaria vesca subsp. vesca
ref|XP_003534530.1|  PREDICTED: RING-H2 finger protein ATL67-like       156   4e-43   Glycine max [soybeans]
ref|XP_010508059.1|  PREDICTED: RING-H2 finger protein ATL67-like       157   6e-43   Camelina sativa [gold-of-pleasure]
ref|XP_007139765.1|  hypothetical protein PHAVU_008G057200g             154   2e-42   Phaseolus vulgaris [French bean]
ref|XP_002880221.1|  zinc finger family protein                         154   8e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_010916932.1|  PREDICTED: RING-H2 finger protein ATL67-like       153   9e-42   Elaeis guineensis
ref|XP_010518279.1|  PREDICTED: RING-H2 finger protein ATL67-like       153   2e-41   
ref|XP_010092874.1|  RING-H2 finger protein ATL68                       152   2e-41   Morus notabilis
ref|XP_010054857.1|  PREDICTED: uncharacterized protein LOC104443218    160   2e-41   
ref|XP_009381057.1|  PREDICTED: RING-H2 finger protein ATL67-like       144   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004133841.1|  PREDICTED: RING-H2 finger protein ATL67            143   4e-38   Cucumis sativus [cucumbers]
ref|XP_008437981.1|  PREDICTED: RING-H2 finger protein ATL67            142   6e-38   Cucumis melo [Oriental melon]
ref|XP_003552426.1|  PREDICTED: RING-H2 finger protein ATL67-like       142   6e-38   Glycine max [soybeans]
ref|XP_009409038.1|  PREDICTED: RING-H2 finger protein ATL67            142   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW57001.1|  putative RING zinc finger domain superfamily protein    140   1e-36   
ref|XP_008663969.1|  PREDICTED: RING-H2 finger protein ATL67-like       139   3e-36   
gb|AFW57002.1|  putative RING zinc finger domain superfamily protein    139   8e-36   
ref|NP_001147253.1|  RING-H2 finger protein ATL2M                       135   7e-35   Zea mays [maize]
gb|EAY75741.1|  hypothetical protein OsI_03653                          134   2e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_008810939.1|  PREDICTED: RING-H2 finger protein ATL67-like       134   4e-34   Phoenix dactylifera
ref|XP_008650149.1|  PREDICTED: RING-H2 finger protein ATL67-like       134   7e-34   
ref|NP_001044176.2|  Os01g0736600                                       132   9e-34   
ref|XP_008671136.1|  PREDICTED: RING-H2 finger protein ATL67-like       132   9e-34   Zea mays [maize]
gb|EMS59911.1|  RING-H2 finger protein ATL68                            133   2e-33   Triticum urartu
ref|XP_008665968.1|  PREDICTED: RING-H2 finger protein ATL67-like       130   4e-33   
ref|XP_008671143.1|  PREDICTED: RING-H2 finger protein ATL67-like       132   4e-33   Zea mays [maize]
ref|NP_001147642.1|  RING-H2 finger protein ATL2M                       130   4e-33   
ref|XP_008680882.1|  PREDICTED: RING-H2 finger protein ATL67-like       129   1e-32   Zea mays [maize]
ref|XP_009403522.1|  PREDICTED: RING-H2 finger protein ATL67-like       129   2e-32   
ref|XP_006646300.1|  PREDICTED: RING-H2 finger protein ATL67-like       127   1e-31   Oryza brachyantha
ref|XP_002992199.1|  hypothetical protein SELMODRAFT_186618             125   1e-31   
emb|CDM81763.1|  unnamed protein product                                125   2e-31   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006654677.1|  PREDICTED: RING-H2 finger protein ATL67-like       125   3e-31   Oryza brachyantha
ref|XP_010232275.1|  PREDICTED: RING-H2 finger protein ATL67-like       125   4e-31   Brachypodium distachyon [annual false brome]
ref|XP_001754650.1|  predicted protein                                  122   5e-30   
ref|XP_004961430.1|  PREDICTED: RING-H2 finger protein ATL67-like...    122   9e-30   Setaria italica
ref|XP_004961429.1|  PREDICTED: RING-H2 finger protein ATL67-like...    122   1e-29   Setaria italica
ref|XP_002458455.1|  hypothetical protein SORBIDRAFT_03g033910          121   1e-29   Sorghum bicolor [broomcorn]
ref|XP_004969874.1|  PREDICTED: RING-H2 finger protein ATL67-like       120   3e-29   Setaria italica
ref|XP_002982100.1|  hypothetical protein SELMODRAFT_59303              118   4e-29   
ref|XP_001760297.1|  predicted protein                                  119   4e-29   
ref|XP_010545157.1|  PREDICTED: RING-H2 finger protein ATL67            119   8e-29   Tarenaya hassleriana [spider flower]
ref|XP_002440115.1|  hypothetical protein SORBIDRAFT_09g026220          118   2e-28   
ref|XP_010036586.1|  PREDICTED: RING-H2 finger protein ATL70            117   3e-28   Eucalyptus grandis [rose gum]
ref|XP_009348829.1|  PREDICTED: RING-H2 finger protein ATL70-like       115   7e-28   Pyrus x bretschneideri [bai li]
ref|XP_007219093.1|  hypothetical protein PRUPE_ppa015141mg             114   3e-27   
ref|XP_002316476.1|  hypothetical protein POPTR_0010s24960g             113   5e-27   
ref|XP_008246264.1|  PREDICTED: putative RING-H2 finger protein A...    113   7e-27   Prunus mume [ume]
gb|KJB67866.1|  hypothetical protein B456_010G215700                    113   9e-27   Gossypium raimondii
ref|XP_009607421.1|  PREDICTED: RING-H2 finger protein ATL67-like       112   9e-27   
gb|EAY98765.1|  hypothetical protein OsI_20699                          113   1e-26   Oryza sativa Indica Group [Indian rice]
emb|CDX99014.1|  BnaC09g48210D                                          111   2e-26   
ref|NP_001056103.1|  Os05g0526600                                       112   4e-26   
ref|XP_010247223.1|  PREDICTED: putative RING-H2 finger protein A...    111   6e-26   Nelumbo nucifera [Indian lotus]
emb|CDX70002.1|  BnaA10g23510D                                          110   6e-26   
ref|XP_009122386.1|  PREDICTED: putative RING-H2 finger protein A...    110   6e-26   Brassica rapa
ref|XP_006444937.1|  hypothetical protein CICLE_v10024039mg             112   1e-25   
ref|XP_004308667.1|  PREDICTED: putative RING-H2 finger protein A...    110   1e-25   Fragaria vesca subsp. vesca
ref|XP_009370633.1|  PREDICTED: putative RING-H2 finger protein A...    110   1e-25   
ref|XP_002871246.1|  zinc finger family protein                         110   1e-25   
ref|XP_009606480.1|  PREDICTED: RING-H2 finger protein ATL70-like       109   1e-25   Nicotiana tomentosiformis
ref|XP_008246265.1|  PREDICTED: putative RING-H2 finger protein A...    109   2e-25   Prunus mume [ume]
ref|XP_008445399.1|  PREDICTED: putative RING-H2 finger protein A...    109   2e-25   Cucumis melo [Oriental melon]
ref|XP_010534324.1|  PREDICTED: putative RING-H2 finger protein A...    109   2e-25   Tarenaya hassleriana [spider flower]
ref|XP_006826443.2|  PREDICTED: RING-H2 finger protein ATL70            109   3e-25   
emb|CDP10580.1|  unnamed protein product                                108   3e-25   Coffea canephora [robusta coffee]
ref|XP_007214748.1|  hypothetical protein PRUPE_ppa024917mg             108   4e-25   
ref|XP_010907479.1|  PREDICTED: putative RING-H2 finger protein A...    110   4e-25   
ref|XP_008231804.1|  PREDICTED: RING-H2 finger protein ATL70-like       108   6e-25   Prunus mume [ume]
ref|XP_002525544.1|  ring finger protein, putative                      108   7e-25   Ricinus communis
gb|KFK25096.1|  hypothetical protein AALP_AA8G065900                    108   9e-25   Arabis alpina [alpine rockcress]
ref|NP_196321.1|  putative RING-H2 finger protein                       106   1e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002266804.1|  PREDICTED: putative RING-H2 finger protein A...    107   2e-24   Vitis vinifera
ref|XP_010031027.1|  PREDICTED: putative RING-H2 finger protein A...    107   2e-24   Eucalyptus grandis [rose gum]
emb|CBI35066.3|  unnamed protein product                                107   2e-24   Vitis vinifera
ref|XP_004146803.1|  PREDICTED: putative RING-H2 finger protein A...    106   3e-24   Cucumis sativus [cucumbers]
ref|XP_006399182.1|  hypothetical protein EUTSA_v10014903mg             105   3e-24   Eutrema salsugineum [saltwater cress]
ref|XP_002873260.1|  zinc finger family protein                         106   4e-24   Arabidopsis lyrata subsp. lyrata
ref|XP_010491302.1|  PREDICTED: putative RING-H2 finger protein A...    105   7e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010423262.1|  PREDICTED: putative RING-H2 finger protein A...    104   9e-24   Camelina sativa [gold-of-pleasure]
ref|XP_009786544.1|  PREDICTED: RING-H2 finger protein ATL70-like       105   9e-24   Nicotiana sylvestris
ref|XP_008786940.1|  PREDICTED: putative RING-H2 finger protein A...    104   1e-23   Phoenix dactylifera
ref|XP_010452652.1|  PREDICTED: putative RING-H2 finger protein A...    104   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_006481618.1|  PREDICTED: RING-H2 finger protein ATL70-like       104   1e-23   Citrus sinensis [apfelsine]
ref|XP_006494565.1|  PREDICTED: putative RING-H2 finger protein A...    104   1e-23   Citrus sinensis [apfelsine]
ref|NP_196267.1|  putative RING-H2 finger protein ATL71                 105   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006430043.1|  hypothetical protein CICLE_v10013347mg             104   2e-23   
ref|XP_009766603.1|  PREDICTED: RING-H2 finger protein ATL70            104   2e-23   Nicotiana sylvestris
ref|XP_002524078.1|  ring finger protein, putative                      103   2e-23   Ricinus communis
ref|XP_009396462.1|  PREDICTED: RING-H2 finger protein ATL70-like       103   2e-23   
gb|KJB36246.1|  hypothetical protein B456_006G148300                    103   2e-23   Gossypium raimondii
ref|XP_011620724.1|  PREDICTED: putative RING-H2 finger protein A...    103   2e-23   
ref|XP_010553415.1|  PREDICTED: RING-H2 finger protein ATL70            103   3e-23   Tarenaya hassleriana [spider flower]
ref|XP_010263056.1|  PREDICTED: RING-H2 finger protein ATL70-like       103   3e-23   Nelumbo nucifera [Indian lotus]
ref|XP_009397427.1|  PREDICTED: RING-H2 finger protein ATL70-like       103   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011024142.1|  PREDICTED: RING-H2 finger protein ATL70-like       103   4e-23   Populus euphratica
ref|XP_010910949.1|  PREDICTED: RING-H2 finger protein ATL70-like       103   4e-23   
ref|XP_008241078.1|  PREDICTED: RING-H2 finger protein ATL70            102   6e-23   Prunus mume [ume]
ref|XP_006289981.1|  hypothetical protein CARUB_v10003611mg             102   6e-23   Capsella rubella
ref|XP_009623417.1|  PREDICTED: RING-H2 finger protein ATL70-like       102   7e-23   Nicotiana tomentosiformis
ref|XP_012074288.1|  PREDICTED: RING-H2 finger protein ATL70-like       102   8e-23   Jatropha curcas
ref|XP_006432382.1|  hypothetical protein CICLE_v10003203mg             102   9e-23   Citrus clementina [clementine]
ref|XP_010491212.1|  PREDICTED: putative RING-H2 finger protein A...    102   9e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002308329.2|  hypothetical protein POPTR_0006s21610g             102   1e-22   Populus trichocarpa [western balsam poplar]
gb|KEH32994.1|  zinc finger, C3HC4 type (RING finger) protein           102   1e-22   Medicago truncatula
gb|AAX92713.1|  zinc finger family protein                            99.8    1e-22   Picea abies
ref|XP_010106981.1|  RING-H2 finger protein ATL70                       101   1e-22   Morus notabilis
ref|XP_011024141.1|  PREDICTED: putative RING-H2 finger protein A...    100   2e-22   Populus euphratica
ref|XP_011035614.1|  PREDICTED: RING-H2 finger protein ATL70-like       101   2e-22   Populus euphratica
ref|XP_011020460.1|  PREDICTED: putative RING-H2 finger protein A...    101   2e-22   Populus euphratica
ref|XP_010670554.1|  PREDICTED: putative RING-H2 finger protein A...    102   2e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009412312.1|  PREDICTED: RING-H2 finger protein ATL70-like       101   3e-22   
ref|XP_002316478.2|  hypothetical protein POPTR_0010s24940g             100   3e-22   
ref|XP_008391986.1|  PREDICTED: RING-H2 finger protein ATL70-like       100   3e-22   
ref|XP_010423335.1|  PREDICTED: putative RING-H2 finger protein A...    102   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010653248.1|  PREDICTED: RING-H2 finger protein ATL70            100   4e-22   Vitis vinifera
ref|XP_009617009.1|  PREDICTED: RING-H2 finger protein ATL70-like       100   5e-22   Nicotiana tomentosiformis
ref|XP_007028017.1|  RING/U-box superfamily protein                   98.6    6e-22   
ref|XP_012068725.1|  PREDICTED: putative RING-H2 finger protein A...  99.8    8e-22   Jatropha curcas
ref|XP_010557977.1|  PREDICTED: putative RING-H2 finger protein A...    100   9e-22   Tarenaya hassleriana [spider flower]
ref|XP_009133055.1|  PREDICTED: RING-H2 finger protein ATL70-like     99.8    9e-22   Brassica rapa
emb|CDX79639.1|  BnaC03g19750D                                        99.8    1e-21   
emb|CDX84590.1|  BnaA03g16400D                                        99.4    1e-21   
ref|XP_008462625.1|  PREDICTED: RING-H2 finger protein ATL70-like     99.4    1e-21   Cucumis melo [Oriental melon]
ref|XP_007202672.1|  hypothetical protein PRUPE_ppa012474mg           99.0    1e-21   Prunus persica
ref|XP_009766163.1|  PREDICTED: RING-H2 finger protein ATL70-like     99.0    1e-21   Nicotiana sylvestris
ref|XP_011034693.1|  PREDICTED: putative RING-H2 finger protein A...  99.4    2e-21   Populus euphratica
ref|XP_010931540.1|  PREDICTED: LOW QUALITY PROTEIN: putative RIN...  99.0    2e-21   
ref|XP_007028016.1|  RING/U-box superfamily protein                   98.6    2e-21   
ref|XP_007145777.1|  hypothetical protein PHAVU_007G266900g           97.4    2e-21   Phaseolus vulgaris [French bean]
ref|XP_004143342.1|  PREDICTED: RING-H2 finger protein ATL70-like     98.6    2e-21   Cucumis sativus [cucumbers]
ref|XP_004249398.1|  PREDICTED: RING-H2 finger protein ATL70-like     99.0    2e-21   Solanum lycopersicum
ref|XP_003520719.1|  PREDICTED: RING-H2 finger protein ATL70-like     98.2    2e-21   Glycine max [soybeans]
ref|XP_004499794.1|  PREDICTED: putative RING-H2 finger protein A...  98.2    3e-21   Cicer arietinum [garbanzo]
gb|ERM93680.1|  hypothetical protein AMTR_s00004p00172400             97.4    3e-21   Amborella trichopoda
ref|XP_010932992.1|  PREDICTED: RING-H2 finger protein ATL70-like     98.2    3e-21   Elaeis guineensis
ref|XP_009794907.1|  PREDICTED: RING-H2 finger protein ATL70-like     98.2    3e-21   Nicotiana sylvestris
ref|XP_008801681.1|  PREDICTED: RING-H2 finger protein ATL70-like     98.2    3e-21   Phoenix dactylifera
ref|XP_011042565.1|  PREDICTED: RING-H2 finger protein ATL70          97.8    3e-21   Populus euphratica
ref|XP_002323373.2|  zinc finger family protein                       97.8    3e-21   Populus trichocarpa [western balsam poplar]
ref|XP_003522850.1|  PREDICTED: putative RING-H2 finger protein A...  98.6    3e-21   Glycine max [soybeans]
ref|XP_006290100.1|  hypothetical protein CARUB_v10003745mg           98.6    3e-21   Capsella rubella
ref|XP_009600924.1|  PREDICTED: RING-H2 finger protein ATL70-like     97.8    4e-21   Nicotiana tomentosiformis
ref|XP_007219590.1|  hypothetical protein PRUPE_ppa023497mg             100   4e-21   
ref|XP_007145778.1|  hypothetical protein PHAVU_007G266900g           97.8    4e-21   Phaseolus vulgaris [French bean]
ref|XP_011094530.1|  PREDICTED: RING-H2 finger protein ATL70          97.8    4e-21   Sesamum indicum [beniseed]
ref|XP_002316477.1|  hypothetical protein POPTR_0010s24950g           98.6    4e-21   
ref|XP_010312505.1|  PREDICTED: RING-H2 finger protein ATL70-like     96.3    4e-21   
ref|XP_009606479.1|  PREDICTED: RING-H2 finger protein ATL70-like     97.8    5e-21   Nicotiana tomentosiformis
ref|XP_006339176.1|  PREDICTED: RING-H2 finger protein ATL70-like     97.8    5e-21   Solanum tuberosum [potatoes]
ref|XP_007162988.1|  hypothetical protein PHAVU_001G197000g           97.4    5e-21   Phaseolus vulgaris [French bean]
ref|XP_010452581.1|  PREDICTED: putative RING-H2 finger protein A...  97.8    6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_004303426.1|  PREDICTED: RING-H2 finger protein ATL70-like     97.4    9e-21   Fragaria vesca subsp. vesca
gb|KJB46372.1|  hypothetical protein B456_007G363500                  96.7    1e-20   Gossypium raimondii
ref|XP_002311001.2|  hypothetical protein POPTR_0008s01980g           96.3    1e-20   
ref|XP_008442940.1|  PREDICTED: RING-H2 finger protein ATL70-like     96.3    1e-20   
ref|XP_010034163.1|  PREDICTED: RING-H2 finger protein ATL70-like     96.3    1e-20   Eucalyptus grandis [rose gum]
ref|XP_008801680.1|  PREDICTED: RING-H2 finger protein ATL70-like     96.7    1e-20   Phoenix dactylifera
ref|XP_009780433.1|  PREDICTED: RING-H2 finger protein ATL70-like     95.9    2e-20   Nicotiana sylvestris
ref|XP_010247791.1|  PREDICTED: RING-H2 finger protein ATL70-like     96.7    2e-20   Nelumbo nucifera [Indian lotus]
gb|ABD28580.2|  Zinc finger, RING-type                                95.5    2e-20   Medicago truncatula
ref|XP_006348447.1|  PREDICTED: RING-H2 finger protein ATL70-like     95.9    3e-20   Solanum tuberosum [potatoes]
gb|KHN35925.1|  RING-H2 finger protein ATL70                          95.1    3e-20   Glycine soja [wild soybean]
ref|XP_003519107.1|  PREDICTED: RING-H2 finger protein ATL70-like     95.1    3e-20   
ref|XP_003590313.1|  RING finger-like protein                         95.1    3e-20   Medicago truncatula
ref|XP_010907478.1|  PREDICTED: putative RING-H2 finger protein A...  95.5    3e-20   Elaeis guineensis
ref|XP_007010488.1|  RING/U-box superfamily protein                   95.1    4e-20   
gb|KGN59227.1|  hypothetical protein Csa_3G782740                     94.7    4e-20   Cucumis sativus [cucumbers]
gb|EYU18141.1|  hypothetical protein MIMGU_mgv1a020648mg              95.1    4e-20   Erythranthe guttata [common monkey flower]
ref|XP_010031322.1|  PREDICTED: RING-H2 finger protein ATL70-like     94.7    5e-20   Eucalyptus grandis [rose gum]
ref|XP_011032890.1|  PREDICTED: RING-H2 finger protein ATL70-like     94.7    6e-20   Populus euphratica
ref|XP_008779439.1|  PREDICTED: RING-H2 finger protein ATL70-like     94.4    6e-20   Phoenix dactylifera
ref|XP_007211321.1|  hypothetical protein PRUPE_ppa019102m2g          94.0    7e-20   
ref|XP_008644441.1|  PREDICTED: RING-H2 finger protein ATL70-like     94.4    8e-20   Zea mays [maize]
ref|XP_003535824.1|  PREDICTED: RING-H2 finger protein ATL70-like     94.0    1e-19   Glycine max [soybeans]
ref|XP_003526340.1|  PREDICTED: putative RING-H2 finger protein A...  94.4    1e-19   Glycine max [soybeans]
ref|XP_002316475.2|  hypothetical protein POPTR_0010s24970g           94.0    1e-19   
ref|XP_009364983.1|  PREDICTED: RING-H2 finger protein ATL70-like     93.2    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_010505117.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...  95.1    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_002299182.1|  zinc finger family protein                       93.6    1e-19   
gb|EYU42915.1|  hypothetical protein MIMGU_mgv1a022735mg              93.6    1e-19   Erythranthe guttata [common monkey flower]
gb|AES80321.2|  anaphase-promoting complex subunit 11 RING-H2 fin...  94.7    1e-19   Medicago truncatula
ref|XP_010053130.1|  PREDICTED: RING-H2 finger protein ATL20-like     96.7    1e-19   Eucalyptus grandis [rose gum]
ref|XP_009761748.1|  PREDICTED: RING-H2 finger protein ATL70-like     93.2    1e-19   Nicotiana sylvestris
gb|KCW77385.1|  hypothetical protein EUGRSUZ_D01737                   95.9    1e-19   Eucalyptus grandis [rose gum]
ref|XP_008341939.1|  PREDICTED: RING-H2 finger protein ATL22-like     95.5    2e-19   
ref|XP_002523355.1|  RING-H2 finger protein ATL3K, putative           95.9    2e-19   
ref|XP_003624103.1|  RING finger protein                              94.4    2e-19   
ref|XP_010034160.1|  PREDICTED: RING-H2 finger protein ATL70-like     92.4    2e-19   Eucalyptus grandis [rose gum]
gb|EEC67633.1|  hypothetical protein OsI_35029                        93.2    2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_010058951.1|  PREDICTED: RING-H2 finger protein ATL70-like     92.8    2e-19   Eucalyptus grandis [rose gum]
gb|EMS67322.1|  Putative RING-H2 finger protein ATL71                 92.0    3e-19   Triticum urartu
ref|XP_006365671.1|  PREDICTED: RING-H2 finger protein ATL70-like     92.4    3e-19   
ref|XP_002514430.1|  RING-H2 finger protein ATL2I, putative           93.2    3e-19   Ricinus communis
ref|XP_006367022.1|  PREDICTED: putative RING-H2 finger protein A...  92.8    3e-19   
ref|NP_850254.1|  RING-H2 finger protein ATL70                        93.6    3e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAD21466.1|  putative RING zinc finger protein                     92.4    4e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KDO36575.1|  hypothetical protein CISIN_1g044489mg                 93.2    4e-19   Citrus sinensis [apfelsine]
ref|XP_004496105.1|  PREDICTED: RING-H2 finger protein ATL70-like     92.0    5e-19   Cicer arietinum [garbanzo]
ref|XP_002881418.1|  hypothetical protein ARALYDRAFT_482561           92.0    5e-19   
ref|XP_011084385.1|  PREDICTED: RING-H2 finger protein ATL70-like     91.7    5e-19   Sesamum indicum [beniseed]
ref|XP_008376136.1|  PREDICTED: RING-H2 finger protein ATL22-like     92.4    6e-19   
ref|XP_008363732.1|  PREDICTED: putative RING-H2 finger protein A...  92.8    6e-19   
ref|XP_008788609.1|  PREDICTED: putative RING-H2 finger protein A...  92.0    7e-19   Phoenix dactylifera
ref|XP_008341554.1|  PREDICTED: RING-H2 finger protein ATL20-like     94.7    7e-19   Malus domestica [apple tree]
ref|XP_009358601.1|  PREDICTED: RING-H2 finger protein ATL20-like     94.7    7e-19   Pyrus x bretschneideri [bai li]
ref|XP_006410761.1|  hypothetical protein EUTSA_v10017882mg           91.7    8e-19   
ref|XP_006294959.1|  hypothetical protein CARUB_v10024015mg           92.4    8e-19   Capsella rubella
ref|XP_008231284.1|  PREDICTED: RING-H2 finger protein ATL70-like     90.5    9e-19   Prunus mume [ume]
ref|XP_009389703.1|  PREDICTED: RING-H2 finger protein ATL70-like     91.7    9e-19   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN70851.1|  hypothetical protein VITISV_030130                   93.2    9e-19   Vitis vinifera
ref|XP_010034164.1|  PREDICTED: RING-H2 finger protein ATL70-like     90.5    1e-18   Eucalyptus grandis [rose gum]
ref|XP_004298903.1|  PREDICTED: RING-H2 finger protein ATL22-like     94.0    1e-18   Fragaria vesca subsp. vesca
ref|XP_009346442.1|  PREDICTED: RING-H2 finger protein ATL20-like     94.0    1e-18   
ref|XP_007139764.1|  hypothetical protein PHAVU_008G057100g           90.9    1e-18   
gb|AFG60106.1|  hypothetical protein 0_14595_01                       89.7    1e-18   
ref|XP_004497640.1|  PREDICTED: RING-H2 finger protein ATL70-like     90.5    1e-18   
gb|EMS62870.1|  60S ribosomal protein L2, mitochondrial               93.6    2e-18   
ref|XP_008231299.1|  PREDICTED: RING-H2 finger protein ATL70-like     89.7    2e-18   
ref|XP_010068824.1|  PREDICTED: RING-H2 finger protein ATL70-like     90.5    2e-18   
emb|CDX84166.1|  BnaC04g09280D                                        91.3    2e-18   
gb|AFG60102.1|  hypothetical protein 0_14595_01                       89.4    2e-18   
ref|XP_010090484.1|  RING-H2 finger protein ATL70                     90.5    2e-18   
ref|XP_009346447.1|  PREDICTED: RING-H2 finger protein ATL20-like     92.8    2e-18   
ref|XP_009800115.1|  PREDICTED: RING-H2 finger protein ATL20-like     92.8    2e-18   
emb|CBX25263.1|  hypothetical_protein                                 90.5    3e-18   
ref|XP_012083822.1|  PREDICTED: putative RING-H2 finger protein A...  92.4    3e-18   
ref|XP_011003877.1|  PREDICTED: putative RING-H2 finger protein A...  92.4    3e-18   
ref|XP_007219990.1|  hypothetical protein PRUPE_ppb022242mg           92.0    4e-18   
ref|XP_008374064.1|  PREDICTED: putative RING-H2 finger protein A...  91.3    4e-18   
ref|XP_006439350.1|  hypothetical protein CICLE_v10023950mg           90.5    4e-18   
ref|XP_010266501.1|  PREDICTED: putative RING-H2 finger protein A...  92.0    4e-18   
ref|XP_004981503.1|  PREDICTED: putative RING-H2 finger protein A...  89.7    4e-18   
gb|KFK36484.1|  hypothetical protein AALP_AA4G130700                  89.4    4e-18   
ref|XP_009779415.1|  PREDICTED: putative RING-H2 finger protein A...  90.1    5e-18   
ref|XP_009354746.1|  PREDICTED: RING-H2 finger protein ATL70-like     88.6    5e-18   
ref|XP_007220080.1|  hypothetical protein PRUPE_ppa024659mg           88.6    5e-18   
gb|EMT06963.1|  RING-H2 finger protein ATL3K                          86.7    5e-18   
ref|XP_002321438.2|  hypothetical protein POPTR_0015s01980g           91.7    5e-18   
gb|KEH21229.1|  RING-H2 finger ATL21A-like protein                    92.0    6e-18   
ref|XP_008233182.1|  PREDICTED: putative RING-H2 finger protein A...  91.7    6e-18   
ref|XP_004503620.1|  PREDICTED: RING-H2 finger protein ATL22-like     91.7    6e-18   
ref|XP_009614900.1|  PREDICTED: RING-H2 finger protein ATL20-like     91.3    9e-18   
ref|XP_006476386.1|  PREDICTED: putative RING-H2 finger protein A...  90.9    9e-18   
ref|XP_010095770.1|  Putative RING-H2 finger protein ATL21A           90.9    1e-17   
ref|XP_008341919.1|  PREDICTED: putative RING-H2 finger protein A...  87.0    1e-17   
gb|KJB24215.1|  hypothetical protein B456_004G133500                  90.5    1e-17   
ref|XP_010068825.1|  PREDICTED: RING-H2 finger protein ATL74-like     89.0    1e-17   
ref|XP_010266503.1|  PREDICTED: putative RING-H2 finger protein A...  90.9    1e-17   
gb|EAZ38754.1|  hypothetical protein OsJ_23156                        86.7    1e-17   
ref|XP_010266502.1|  PREDICTED: putative RING-H2 finger protein A...  91.3    1e-17   
ref|XP_010261573.1|  PREDICTED: putative RING-H2 finger protein A...  90.9    1e-17   
ref|XP_009133056.1|  PREDICTED: RING-H2 finger protein ATL70-like     87.8    1e-17   
ref|XP_004228913.1|  PREDICTED: RING-H2 finger protein ATL70-like     88.2    1e-17   
ref|XP_010031323.1|  PREDICTED: RING-H2 finger protein ATL70-like     87.8    1e-17   
emb|CDX79641.1|  BnaC03g19770D                                        87.8    2e-17   
gb|KDP28493.1|  hypothetical protein JCGZ_14264                       92.4    2e-17   
ref|XP_009603430.1|  PREDICTED: putative RING-H2 finger protein A...  89.7    2e-17   
gb|KJB18996.1|  hypothetical protein B456_003G079700                  89.7    2e-17   
ref|XP_004306676.1|  PREDICTED: putative RING-H2 finger protein A...  90.1    2e-17   
gb|KJB24216.1|  hypothetical protein B456_004G133600                  90.1    2e-17   
ref|XP_002311000.1|  hypothetical protein POPTR_0008s01970g           87.0    2e-17   
emb|CBX25349.1|  hypothetical_protein                                 92.0    2e-17   
ref|XP_010058318.1|  PREDICTED: putative RING-H2 finger protein A...  90.1    2e-17   
ref|XP_003591676.1|  RING finger protein                              87.0    2e-17   
ref|XP_009766758.1|  PREDICTED: putative RING-H2 finger protein A...  89.4    2e-17   
ref|XP_009387632.1|  PREDICTED: RING-H2 finger protein ATL70-like     87.0    2e-17   
ref|XP_010261657.1|  PREDICTED: putative RING-H2 finger protein A...  89.7    3e-17   
ref|XP_009790335.1|  PREDICTED: putative RING-H2 finger protein A...  89.7    3e-17   
ref|XP_010087268.1|  RING-H2 finger protein ATL22                     90.1    3e-17   
ref|XP_002318389.1|  hypothetical protein POPTR_0012s01830g           86.3    3e-17   
ref|XP_007208903.1|  hypothetical protein PRUPE_ppa026957mg           89.4    3e-17   
emb|CDX75080.1|  BnaA05g08260D                                        87.4    3e-17   
ref|XP_006476387.1|  PREDICTED: putative RING-H2 finger protein A...  89.7    4e-17   
ref|XP_008451949.1|  PREDICTED: putative RING-H2 finger protein A...  89.4    4e-17   
emb|CDP05077.1|  unnamed protein product                              89.4    4e-17   
ref|XP_002320862.2|  hypothetical protein POPTR_0014s09380g           89.0    4e-17   
ref|XP_009143625.1|  PREDICTED: RING-H2 finger protein ATL70-like     86.7    4e-17   
ref|XP_006296335.1|  hypothetical protein CARUB_v10025505mg           89.0    4e-17   
ref|XP_003559350.1|  PREDICTED: putative RING-H2 finger protein A...  87.0    5e-17   
ref|XP_004245516.1|  PREDICTED: putative RING-H2 finger protein A...  89.4    5e-17   
ref|XP_007039003.1|  RING/U-box superfamily protein, putative         89.0    5e-17   
ref|XP_012086721.1|  PREDICTED: putative RING-H2 finger protein A...  89.4    5e-17   
ref|XP_006343860.1|  PREDICTED: putative RING-H2 finger protein A...  89.4    5e-17   
emb|CDP12156.1|  unnamed protein product                              88.6    5e-17   
ref|XP_007040523.1|  RING/U-box superfamily protein, putative         89.0    5e-17   
emb|CDX84589.1|  BnaA03g16410D                                        86.3    5e-17   
ref|XP_007040518.1|  RING/U-box superfamily protein                   89.0    5e-17   
ref|XP_004236803.1|  PREDICTED: putative RING-H2 finger protein A...  86.7    6e-17   
ref|XP_006439351.1|  hypothetical protein CICLE_v10020389mg           89.4    6e-17   
gb|KEH21232.1|  RING-H2 finger protein ATL21A, putative               89.4    6e-17   
ref|XP_008239111.1|  PREDICTED: RING-H2 finger protein ATL22-like     87.8    6e-17   
ref|XP_002509961.1|  ring finger protein, putative                    89.0    6e-17   
ref|XP_004149762.1|  PREDICTED: putative RING-H2 finger protein A...  89.0    7e-17   
emb|CDY11378.1|  BnaA09g39440D                                        88.2    8e-17   
ref|XP_002529293.1|  ring finger protein, putative                    88.2    8e-17   
ref|XP_009116841.1|  PREDICTED: RING-H2 finger protein ATL22          88.2    9e-17   
emb|CDX98928.1|  BnaC09g49070D                                        85.9    1e-16   
ref|XP_011038118.1|  PREDICTED: putative RING-H2 finger protein A...  88.2    1e-16   
ref|XP_011038108.1|  PREDICTED: putative RING-H2 finger protein A...  88.2    1e-16   
ref|XP_006470952.1|  PREDICTED: putative RING-H2 finger protein A...  88.2    1e-16   
gb|EYU40016.1|  hypothetical protein MIMGU_mgv1a020706mg              88.2    1e-16   
ref|XP_010267327.1|  PREDICTED: RING-H2 finger protein ATL52-like     87.0    1e-16   
ref|XP_010412874.1|  PREDICTED: RING-H2 finger protein ATL38-like     87.4    1e-16   
ref|XP_010671482.1|  PREDICTED: RING-H2 finger protein ATL20-like     87.8    1e-16   
emb|CDY55783.1|  BnaC03g76790D                                        85.5    1e-16   
ref|XP_006584762.1|  PREDICTED: putative RING-H2 finger protein A...  88.2    1e-16   
ref|XP_010671483.1|  PREDICTED: putative RING-H2 finger protein A...  87.8    1e-16   
ref|XP_002864223.1|  hypothetical protein ARALYDRAFT_918381           85.1    1e-16   
ref|XP_006339702.1|  PREDICTED: putative RING-H2 finger protein A...  87.0    1e-16   
ref|XP_012090085.1|  PREDICTED: RING-H2 finger protein ATL20 isof...  87.0    2e-16   
ref|XP_008239033.1|  PREDICTED: RING-H2 finger protein ATL22-like     87.4    2e-16   
ref|XP_011470463.1|  PREDICTED: RING-H2 finger protein ATL70-like     84.3    2e-16   
ref|XP_011023186.1|  PREDICTED: putative RING-H2 finger protein A...  87.4    2e-16   
ref|XP_010327016.1|  PREDICTED: putative RING-H2 finger protein A...  86.7    2e-16   
ref|XP_008375176.1|  PREDICTED: RING-H2 finger protein ATL70-like     84.0    2e-16   
ref|XP_002893502.1|  hypothetical protein ARALYDRAFT_313509           86.7    2e-16   
ref|XP_006299271.1|  hypothetical protein CARUB_v10015425mg           87.4    2e-16   
ref|XP_006350635.1|  PREDICTED: RING-H2 finger protein ATL22-like     87.4    2e-16   
ref|XP_006399122.1|  hypothetical protein EUTSA_v10015385mg           85.1    2e-16   
ref|XP_010676294.1|  PREDICTED: RING-H2 finger protein ATL22-like     87.4    2e-16   
ref|XP_002302627.2|  zinc finger family protein                       87.4    2e-16   
ref|XP_010534380.1|  PREDICTED: putative RING-H2 finger protein A...  84.7    2e-16   
ref|XP_006422179.1|  hypothetical protein CICLE_v10006544mg           87.4    2e-16   
ref|XP_009125646.1|  PREDICTED: putative RING-H2 finger protein A...  85.1    2e-16   
emb|CDY40424.1|  BnaA04g20930D                                        84.7    2e-16   
emb|CDY04989.1|  BnaAnng01710D                                        84.7    2e-16   
ref|XP_004503619.1|  PREDICTED: putative RING-H2 finger protein A...  87.4    2e-16   
ref|XP_010508011.1|  PREDICTED: putative RING-H2 finger protein A...  87.0    2e-16   
ref|XP_009770319.1|  PREDICTED: putative RING-H2 finger protein A...  83.6    2e-16   
ref|NP_565593.1|  RING-H2 finger protein ATL22                        87.0    3e-16   
emb|CDY14081.1|  BnaC02g01980D                                        84.7    3e-16   
ref|XP_009141531.1|  PREDICTED: RING-H2 finger protein ATL70          84.3    3e-16   
ref|XP_002304557.1|  hypothetical protein POPTR_0003s13970g           87.0    3e-16   
gb|EYU19636.1|  hypothetical protein MIMGU_mgv1a023039mg              86.7    3e-16   
ref|XP_002513558.1|  ring finger protein, putative                    87.0    3e-16   
ref|XP_010666762.1|  PREDICTED: RING-H2 finger protein ATL70-like     84.3    3e-16   
ref|XP_010662987.1|  PREDICTED: putative RING-H2 finger protein A...  86.7    3e-16   
ref|XP_004510676.1|  PREDICTED: putative RING-H2 finger protein A...  86.7    3e-16   
ref|XP_006583239.1|  PREDICTED: putative RING-H2 finger protein A...  85.1    3e-16   
ref|XP_006604906.1|  PREDICTED: RING-H2 finger protein ATL22-like     86.7    3e-16   
ref|XP_006583240.1|  PREDICTED: putative RING-H2 finger protein A...  85.1    3e-16   
ref|XP_006583238.1|  PREDICTED: putative RING-H2 finger protein A...  85.1    3e-16   
ref|XP_007210965.1|  hypothetical protein PRUPE_ppa023153mg           85.9    3e-16   
ref|XP_010112130.1|  Putative RING-H2 finger protein ATL71            84.0    3e-16   
ref|XP_010482695.1|  PREDICTED: putative RING-H2 finger protein A...  86.7    3e-16   
ref|XP_009603368.1|  PREDICTED: RING-H2 finger protein ATL20-like     83.2    3e-16   
ref|XP_010512543.1|  PREDICTED: RING-H2 finger protein ATL22-like     87.0    3e-16   
emb|CBI23148.3|  unnamed protein product                              86.7    3e-16   
ref|NP_001146387.1|  uncharacterized LOC100279967                     84.3    3e-16   
gb|KHN24595.1|  RING-H2 finger protein ATL67                          80.9    3e-16   
ref|XP_009358722.1|  PREDICTED: RING-H2 finger protein ATL22-like     86.3    3e-16   
ref|XP_010469020.1|  PREDICTED: RING-H2 finger protein ATL22          86.7    3e-16   
ref|XP_009378776.1|  PREDICTED: putative RING-H2 finger protein A...  86.3    3e-16   
ref|XP_006339703.1|  PREDICTED: putative RING-H2 finger protein A...  86.7    3e-16   
ref|XP_006280571.1|  hypothetical protein CARUB_v10026524mg           87.0    3e-16   
ref|XP_007147071.1|  hypothetical protein PHAVU_006G093800g           87.0    4e-16   
ref|XP_010413354.1|  PREDICTED: RING-H2 finger protein ATL22-like     86.7    4e-16   
ref|XP_010067110.1|  PREDICTED: RING-H2 finger protein ATL70-like     84.3    4e-16   
ref|XP_006402450.1|  hypothetical protein EUTSA_v10006034mg           86.7    4e-16   
ref|XP_010094662.1|  E3 ubiquitin-protein ligase ATL6                 85.9    4e-16   
emb|CDY27323.1|  BnaC04g50820D                                        84.0    4e-16   
ref|XP_004231227.1|  PREDICTED: putative RING-H2 finger protein A...  83.6    4e-16   
ref|XP_010090485.1|  Putative RING-H2 finger protein ATL71            84.3    4e-16   
ref|XP_010055868.1|  PREDICTED: putative RING-H2 finger protein A...  81.3    5e-16   
ref|NP_200123.2|  Wall-associated receptor kinase and RING-finger...  86.3    5e-16   
ref|XP_004234950.1|  PREDICTED: RING-H2 finger protein ATL22-like     85.9    5e-16   
ref|XP_011001897.1|  PREDICTED: putative RING-H2 finger protein A...  85.9    5e-16   
emb|CDY70482.1|  BnaCnng68610D                                        83.6    5e-16   
ref|XP_010442867.1|  PREDICTED: putative RING-H2 finger protein A...  86.3    5e-16   
gb|KJB18988.1|  hypothetical protein B456_003G079300                  86.3    5e-16   
ref|XP_010446567.1|  PREDICTED: RING-H2 finger protein ATL32-like     85.1    5e-16   
ref|XP_009409416.1|  PREDICTED: E3 ubiquitin-protein ligase ATL31...  85.9    5e-16   
ref|XP_007209058.1|  hypothetical protein PRUPE_ppa016874mg           85.9    5e-16   
ref|XP_006580524.1|  PREDICTED: putative RING-H2 finger protein A...  86.3    5e-16   
ref|XP_011651602.1|  PREDICTED: RING-H2 finger protein ATL20-like     85.9    5e-16   
ref|XP_009597538.1|  PREDICTED: RING-H2 finger protein ATL16-like     85.9    6e-16   
ref|XP_009590909.1|  PREDICTED: putative RING-H2 finger protein A...  83.2    6e-16   
ref|NP_174125.2|  RING-H2 finger protein ATL20                        85.1    6e-16   
ref|XP_006304404.1|  hypothetical protein CARUB_v10010955mg           85.5    6e-16   
ref|XP_009801446.1|  PREDICTED: RING-H2 finger protein ATL16-like     85.1    7e-16   
gb|KCW89165.1|  hypothetical protein EUGRSUZ_A01477                   82.0    7e-16   
ref|XP_004509804.1|  PREDICTED: RING-H2 finger protein ATL51-like     85.5    7e-16   
ref|XP_006401744.1|  hypothetical protein EUTSA_v10013815mg           85.9    7e-16   
ref|XP_004301500.1|  PREDICTED: RING-H2 finger protein ATL22-like     86.3    7e-16   
ref|XP_002297975.2|  hypothetical protein POPTR_0001s10610g           85.9    7e-16   
ref|XP_009142419.1|  PREDICTED: putative RING-H2 finger protein A...  85.5    7e-16   
emb|CDY66314.1|  BnaA04g29690D                                        85.5    7e-16   
ref|XP_010100772.1|  Putative RING-H2 finger protein ATL21A           85.5    7e-16   
ref|XP_003636983.1|  RING finger protein                              84.0    7e-16   
emb|CDY32074.1|  BnaC04g44920D                                        83.2    7e-16   
emb|CDX71709.1|  BnaC08g31650D                                        85.5    8e-16   
ref|XP_008646927.1|  PREDICTED: RING-H2 finger protein ATL44-like     83.2    8e-16   
ref|XP_009775127.1|  PREDICTED: RING-H2 finger protein ATL80-like     83.2    8e-16   
ref|XP_007160165.1|  hypothetical protein PHAVU_002G298300g           85.9    8e-16   
emb|CDY27321.1|  BnaC04g50840D                                        85.5    8e-16   
gb|KJB18932.1|  hypothetical protein B456_003G079800                  85.9    8e-16   
ref|XP_007018124.1|  RING/U-box superfamily protein, putative         85.9    8e-16   
ref|XP_010068826.1|  PREDICTED: E3 ubiquitin-protein ligase ATL31...  82.8    8e-16   
ref|XP_003529891.1|  PREDICTED: putative RING-H2 finger protein A...  85.5    9e-16   
gb|KCW72414.1|  hypothetical protein EUGRSUZ_E008652                  82.0    9e-16   
ref|XP_004496297.1|  PREDICTED: RING-H2 finger protein ATL70-like     82.0    9e-16   
gb|KCW72411.1|  hypothetical protein EUGRSUZ_E00861                   84.7    1e-15   
gb|KFK26929.1|  hypothetical protein AALP_AA8G311200                  87.0    1e-15   
ref|XP_009119849.1|  PREDICTED: RING-H2 finger protein ATL20-like     85.5    1e-15   
ref|XP_002878405.1|  predicted protein                                85.1    1e-15   
ref|XP_011022503.1|  PREDICTED: RING-H2 finger protein ATL20-like     85.5    1e-15   
gb|KHN43100.1|  Putative RING-H2 finger protein ATL21A                86.7    1e-15   
ref|XP_003548419.1|  PREDICTED: putative RING-H2 finger protein A...  85.1    1e-15   
emb|CDY49456.1|  BnaA10g06460D                                        85.1    1e-15   
ref|XP_010435933.1|  PREDICTED: putative RING-H2 finger protein A...  84.7    1e-15   
ref|XP_007211068.1|  hypothetical protein PRUPE_ppa018265mg           84.7    1e-15   
ref|XP_010455325.1|  PREDICTED: putative RING-H2 finger protein A...  84.7    1e-15   
ref|XP_008441618.1|  PREDICTED: RING-H2 finger protein ATL20-like     85.1    1e-15   
ref|XP_009358718.1|  PREDICTED: RING-H2 finger protein ATL22-like     84.7    1e-15   
gb|KDO45410.1|  hypothetical protein CISIN_1g044813mg                 84.7    1e-15   
gb|AAG51486.1|AC069471_17  RING zinc finger protein, putative         84.3    1e-15   
ref|XP_003610985.1|  RING-H2 zinc finger protein-like protein         84.7    1e-15   
emb|CDY13888.1|  BnaA09g43900D                                        85.1    1e-15   
gb|KJB18976.1|  hypothetical protein B456_003G080000                  84.7    1e-15   
gb|KJB49549.1|  hypothetical protein B456_008G125000                  85.1    1e-15   
emb|CDY66316.1|  BnaA04g29710D                                        82.4    1e-15   
ref|XP_010445549.1|  PREDICTED: RING-H2 finger protein ATL20-like     85.1    1e-15   
ref|XP_009358723.1|  PREDICTED: putative RING-H2 finger protein A...  83.6    1e-15   
ref|XP_009781442.1|  PREDICTED: RING-H2 finger protein ATL67-like     82.8    1e-15   
ref|XP_008239109.1|  PREDICTED: putative RING-H2 finger protein A...  85.1    1e-15   
gb|KJB24214.1|  hypothetical protein B456_004G133400                  85.1    1e-15   
gb|KHG04758.1|  Putative RING-H2 finger ATL21A -like protein          85.1    1e-15   
gb|EPS60936.1|  hypothetical protein M569_13867                       81.3    1e-15   
gb|EEC76299.1|  hypothetical protein OsI_13817                        82.4    1e-15   
ref|XP_009770318.1|  PREDICTED: RING-H2 finger protein ATL20-like     81.6    1e-15   
ref|XP_002277387.1|  PREDICTED: putative RING-H2 finger protein A...  84.7    2e-15   
ref|XP_009379779.1|  PREDICTED: RING-H2 finger protein ATL68-like     82.8    2e-15   
ref|XP_009117511.1|  PREDICTED: putative RING-H2 finger protein A...  84.7    2e-15   



>ref|XP_009766983.1| PREDICTED: RING-H2 finger protein ATL67-like [Nicotiana sylvestris]
Length=208

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 157/191 (82%), Gaps = 7/191 (4%)
 Frame = -2

Query  686  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHP  507
            NS   N +TIGLGYAIAIA GFLVL STVLLASYICCRS AARRRRR+    +   N+  
Sbjct  24   NSLSQNLSTIGLGYAIAIALGFLVLLSTVLLASYICCRSAAARRRRRQAQHNSQNLNN--  81

Query  506  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  327
             +NG+YLPRIIFVAEDDEEND VS QN  LGLDQ VINSYPKLVYSKR+GN     GN  
Sbjct  82   SENGIYLPRIIFVAEDDEENDEVSSQNATLGLDQVVINSYPKLVYSKRNGN-----GNGN  136

Query  326  LCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVV  147
             C ICLCEYKD EMLRM+PDCKHYFHV C+DAWLKLNASCPVCRNSPLPTPLSTPLSEVV
Sbjct  137  DCPICLCEYKDGEMLRMMPDCKHYFHVMCIDAWLKLNASCPVCRNSPLPTPLSTPLSEVV  196

Query  146  PLSHYSDGRRR  114
            PLS YSDGRRR
Sbjct  197  PLSQYSDGRRR  207



>ref|XP_009597583.1| PREDICTED: RING-H2 finger protein ATL67-like [Nicotiana tomentosiformis]
Length=211

 Score =   248 bits (633),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 148/191 (77%), Positives = 157/191 (82%), Gaps = 7/191 (4%)
 Frame = -2

Query  686  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHP  507
            NS   N +TIGLGYAIAIA GFLVL STVLLASYICCRS AARRRRR+    +   N+  
Sbjct  27   NSLSQNLSTIGLGYAIAIALGFLVLLSTVLLASYICCRSAAARRRRRQAQHNSQNLNN--  84

Query  506  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  327
             +NG+YLPRIIFVAEDDEEND VS QN  LGLDQ VINSYPKLVYSKR+GN     GN  
Sbjct  85   SENGIYLPRIIFVAEDDEENDDVSSQNATLGLDQVVINSYPKLVYSKRNGN-----GNGN  139

Query  326  LCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVV  147
             C ICLCEYKD EMLRM+PDCKHYFHV C+DAWLKLNASCPVCRNSPLPTPLSTPLSEVV
Sbjct  140  DCPICLCEYKDGEMLRMMPDCKHYFHVMCIDAWLKLNASCPVCRNSPLPTPLSTPLSEVV  199

Query  146  PLSHYSDGRRR  114
            PLS YSDGRRR
Sbjct  200  PLSQYSDGRRR  210



>ref|XP_006339638.1| PREDICTED: RING-H2 finger protein ATL67-like [Solanum tuberosum]
Length=260

 Score =   246 bits (627),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 157/186 (84%), Gaps = 3/186 (2%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            N +TIGLGYAIAIA GFLVL STVLLASYICCRS AARRRRR+  A +   N++  +NG+
Sbjct  77   NLSTIGLGYAIAIALGFLVLLSTVLLASYICCRSAAARRRRRQARANSRNPNNN-IENGI  135

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  312
            YLPRIIFVAEDDEEND    QN  LGLDQ VINSYPKL+YSKR+G  G   GND +C IC
Sbjct  136  YLPRIIFVAEDDEENDDGLSQNATLGLDQVVINSYPKLIYSKRNG--GSGNGNDVVCPIC  193

Query  311  LCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHY  132
            LCEYKD EMLRM+PDCKHYFHV C+DAWLKLNASCPVCRNSPLPTPLSTPLSEVVPLS Y
Sbjct  194  LCEYKDGEMLRMMPDCKHYFHVMCLDAWLKLNASCPVCRNSPLPTPLSTPLSEVVPLSQY  253

Query  131  SDGRRR  114
            SDGRRR
Sbjct  254  SDGRRR  259



>ref|XP_010326706.1| PREDICTED: RING-H2 finger protein ATL67-like [Solanum lycopersicum]
Length=259

 Score =   245 bits (626),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 145/186 (78%), Positives = 157/186 (84%), Gaps = 3/186 (2%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            N +TIGLGYAIAIA GFLVL STVLLASYICCRS AARRRRR+  A +   N++  +NG+
Sbjct  76   NLSTIGLGYAIAIALGFLVLLSTVLLASYICCRSAAARRRRRQARANSRNPNNN-IENGI  134

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  312
            YLPRIIFVAEDDEEND    QN  LGLDQ VINSYPKL+YSKR+G  G   GND +C IC
Sbjct  135  YLPRIIFVAEDDEENDDGLSQNATLGLDQVVINSYPKLIYSKRNG--GSGNGNDVVCPIC  192

Query  311  LCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHY  132
            LCEYKD EMLRM+PDCKHYFHV C+DAWLKLNASCPVCRNSPLPTPLSTPLSEVVPLS Y
Sbjct  193  LCEYKDGEMLRMMPDCKHYFHVMCLDAWLKLNASCPVCRNSPLPTPLSTPLSEVVPLSQY  252

Query  131  SDGRRR  114
            SDGRRR
Sbjct  253  SDGRRR  258



>ref|XP_011093078.1| PREDICTED: RING-H2 finger protein ATL68 [Sesamum indicum]
Length=207

 Score =   236 bits (601),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 142/187 (76%), Positives = 154/187 (82%), Gaps = 9/187 (5%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            + T+IGLGYAIAIA GFLVLFST+LLASYICCRS AARRRRR    E    N   ++N +
Sbjct  30   SLTSIGLGYAIAIALGFLVLFSTILLASYICCRSAAARRRRRNQQRENSNPNRS-NENSI  88

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  312
            YLPRIIFVAEDDE       QNV +GLDQAVINSYPKLVYSKR+GN     GNDT+C+IC
Sbjct  89   YLPRIIFVAEDDEN----ESQNVVVGLDQAVINSYPKLVYSKRNGN----WGNDTVCAIC  140

Query  311  LCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHY  132
            LCEY++SEMLRMLPDCKH FHVTCVDAWLKLNASCPVCR SPLPTPLSTPL EVVPLS Y
Sbjct  141  LCEYRESEMLRMLPDCKHCFHVTCVDAWLKLNASCPVCRQSPLPTPLSTPLQEVVPLSQY  200

Query  131  SDGRRRQ  111
            SD RRRQ
Sbjct  201  SDWRRRQ  207



>gb|EYU32179.1| hypothetical protein MIMGU_mgv1a014108mg [Erythranthe guttata]
Length=200

 Score =   229 bits (584),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 154/194 (79%), Gaps = 9/194 (5%)
 Frame = -2

Query  692  KPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNS  513
            K +S   N  +IGLGYAIAIA GFLVLFST+LLASYICCRS A+RRRRR          +
Sbjct  16   KSSSFSQNLNSIGLGYAIAIALGFLVLFSTILLASYICCRSAASRRRRRDNRDRNP---N  72

Query  512  HPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGN  333
            H ++N +YLPRIIFVAEDD+ +     QN  +GLD+A INSYPK V+ KR+G  GG  G 
Sbjct  73   HSNENSIYLPRIIFVAEDDDND----SQNAVVGLDEAAINSYPKFVFGKRNGISGG--GG  126

Query  332  DTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSE  153
            D +CSICLCEY++SEMLRMLPDC+HYFHV CVDAWLKLNASCPVCRNSPLPTPLSTPL E
Sbjct  127  DAVCSICLCEYRESEMLRMLPDCRHYFHVMCVDAWLKLNASCPVCRNSPLPTPLSTPLQE  186

Query  152  VVPLSHYSDGRRRQ  111
            VVPLS Y+DGRRRQ
Sbjct  187  VVPLSQYTDGRRRQ  200



>gb|EPS71501.1| hypothetical protein M569_03256, partial [Genlisea aurea]
Length=182

 Score =   226 bits (576),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 153/187 (82%), Gaps = 10/187 (5%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            N ++IGLGYAIAIA GFLVLFSTVLLASYICCRS A+RRR R        R+S   +N +
Sbjct  6    NLSSIGLGYAIAIALGFLVLFSTVLLASYICCRSAASRRRIRHRSENRDRRDS--GENSI  63

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  312
            YLPR+IFVAEDD+       Q+VA+GLDQAVINSYPKLV+SKR  N     G+DT+CSIC
Sbjct  64   YLPRVIFVAEDDDSE----AQSVAVGLDQAVINSYPKLVFSKRHSN----WGDDTVCSIC  115

Query  311  LCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHY  132
            LCEY+++E+LRMLPDCKH FHV CVDAWLKLNASCPVCRNSPLPTPLSTPL EVVPLS Y
Sbjct  116  LCEYRETEVLRMLPDCKHLFHVMCVDAWLKLNASCPVCRNSPLPTPLSTPLQEVVPLSQY  175

Query  131  SDGRRRQ  111
            +DGRRRQ
Sbjct  176  ADGRRRQ  182



>gb|EPS68076.1| hypothetical protein M569_06695, partial [Genlisea aurea]
Length=200

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 147/196 (75%), Gaps = 16/196 (8%)
 Frame = -2

Query  689  PNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSH  510
            P S   N   IG+GYA+AIA GFLVLFST+LLASYIC      R    R  +     N  
Sbjct  18   PLSFSENLNAIGIGYAVAIALGFLVLFSTLLLASYIC-----IRSAASRRRSRHQSENRR  72

Query  509  PDD---NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTT  339
             DD   N +YLPR+IFVAEDD+       QNV +GLDQAVINSYPKLV+SKR+ N    +
Sbjct  73   RDDAGENSIYLPRVIFVAEDDDSE----VQNVVVGLDQAVINSYPKLVFSKRNLN----S  124

Query  338  GNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstpl  159
            GNDT+CSICLCEY++SE+LR+LPDCKH FHV CVDAWLKLNASCPVCRNSPLPTPLSTPL
Sbjct  125  GNDTVCSICLCEYRESEVLRVLPDCKHLFHVMCVDAWLKLNASCPVCRNSPLPTPLSTPL  184

Query  158  SEVVPLSHYSDGRRRQ  111
             EVVPLS Y+DGRRRQ
Sbjct  185  QEVVPLSLYADGRRRQ  200



>emb|CDP08747.1| unnamed protein product [Coffea canephora]
Length=216

 Score =   218 bits (555),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 150/185 (81%), Gaps = 3/185 (2%)
 Frame = -2

Query  662  TIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSH-PDDNGVYL  486
            ++GLGYAIAIAFGFLVL STVLLASYICCRS AARRRRR       +  S+ P++  +YL
Sbjct  34   SVGLGYAIAIAFGFLVLLSTVLLASYICCRSAAARRRRRFDSQSGPHNPSNNPNETSIYL  93

Query  485  PRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLC  306
            PRIIFV ED+ +++  S +N  +GLDQAVINSYPK  +SK   N     GND +CSICLC
Sbjct  94   PRIIFVTEDENDDEVSSSENAVVGLDQAVINSYPKFHFSKI--NASFCAGNDPVCSICLC  151

Query  305  EYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
            +YK+SEMLR+LPDCKHYFHVTC+DAWLKLNASCPVCRNSPLPTPLSTPLSEVVPLS YS 
Sbjct  152  DYKESEMLRLLPDCKHYFHVTCIDAWLKLNASCPVCRNSPLPTPLSTPLSEVVPLSQYSG  211

Query  125  GRRRQ  111
            GRRR 
Sbjct  212  GRRRS  216



>ref|XP_011093041.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105173085 
[Sesamum indicum]
Length=685

 Score =   230 bits (586),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 139/202 (69%), Positives = 158/202 (78%), Gaps = 19/202 (9%)
 Frame = -2

Query  701  TTV--KPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaea  528
            TTV  +P+S   N ++IGLGYAIA A GFLV FST+LLASYICCRS+A RRRRR      
Sbjct  4    TTVPTRPSSLSQNLSSIGLGYAIAFALGFLVFFSTILLASYICCRSVADRRRRRLAR---  60

Query  527  gyRNSHPD---DNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSG  357
               N +PD   DN +YLPRIIFVAED+E +     QN   GLDQAVINSYPK V++KR+G
Sbjct  61   ---NQNPDNSNDNSIYLPRIIFVAEDEESD----AQNAVAGLDQAVINSYPKFVFTKRNG  113

Query  356  NPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplpt  177
            +  G    D++CSICLCEY++SEMLRMLPDC+H FHV CVDAWLKLNASCPVCRNSPLPT
Sbjct  114  DGAG----DSVCSICLCEYRESEMLRMLPDCRHCFHVMCVDAWLKLNASCPVCRNSPLPT  169

Query  176  plstplSEVVPLSHYSDGRRRQ  111
            PLSTPL EVVPLS YSDGRRRQ
Sbjct  170  PLSTPLQEVVPLSQYSDGRRRQ  191



>ref|XP_004248065.1| PREDICTED: RING-H2 finger protein ATL67-like [Solanum lycopersicum]
Length=205

 Score =   209 bits (531),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 148/189 (78%), Gaps = 10/189 (5%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            +   IGLGYAIAIA  FL L ST++L+SY+CCRS A RRR+ +         S   + G+
Sbjct  25   SLNKIGLGYAIAIALAFLFLLSTLILSSYLCCRSAAYRRRQAQS-------QSRNPNTGI  77

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGT--TGNDTLCS  318
            Y+P +IFVAE+DE ND VS QN   GL+QAVINSYPKL+YS R+GN G    + ND +C+
Sbjct  78   YIPSVIFVAEEDE-NDDVSSQNTFAGLNQAVINSYPKLIYSSRNGNWGNGNGSRNDVVCA  136

Query  317  ICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            ICLC+YK++EMLRMLP+CKHYFHV CVDAWLKLNASCPVCRNSPLPTP+STPLSEVVPLS
Sbjct  137  ICLCDYKEAEMLRMLPECKHYFHVMCVDAWLKLNASCPVCRNSPLPTPMSTPLSEVVPLS  196

Query  137  HYSDGRRRQ  111
             YSDGRRR 
Sbjct  197  QYSDGRRRH  205



>gb|KJB24638.1| hypothetical protein B456_004G154800 [Gossypium raimondii]
Length=187

 Score =   201 bits (510),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 139/190 (73%), Gaps = 8/190 (4%)
 Frame = -2

Query  680  APTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDD  501
            +P   T +GLGY+IAIA GFLVL ST+LLASYICCRS ++     R  +      S  D 
Sbjct  5    SPNYLTNLGLGYSIAIALGFLVLLSTILLASYICCRSSSSSSSSPRAFSPNATVASASD-  63

Query  500  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  321
             G+ LPRIIFVAEDD+       +N A+GLDQAVINSYPK  +SK       ++  +T C
Sbjct  64   -GINLPRIIFVAEDDD------NENAAVGLDQAVINSYPKFQFSKDRSAAVDSSNVNTTC  116

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPL  141
            SICLCEYKDSEMLRM+P+C+HYFHV C+DAWLKLN SCPVCRNSPLPTPLSTPLSEVVPL
Sbjct  117  SICLCEYKDSEMLRMMPECRHYFHVPCLDAWLKLNGSCPVCRNSPLPTPLSTPLSEVVPL  176

Query  140  SHYSDGRRRQ  111
            S Y+  RR +
Sbjct  177  SQYAADRRSR  186



>ref|XP_006491198.1| PREDICTED: RING-H2 finger protein ATL67-like [Citrus sinensis]
 gb|KDO86329.1| hypothetical protein CISIN_1g029203mg [Citrus sinensis]
Length=197

 Score =   199 bits (507),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 119/193 (62%), Positives = 138/193 (72%), Gaps = 6/193 (3%)
 Frame = -2

Query  680  APTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDD  501
            +P   T IGLGY+IAIA GFLVL STVLLASYICCR   +         E    N+   +
Sbjct  8    SPNYLTNIGLGYSIAIALGFLVLLSTVLLASYICCRRNNSSHNSNANPHEN---NNSVSN  64

Query  500  NGVYLPRIIFVAEDD--EENDGVSGQNVALGLDQAVINSYPKLVYSKRS-GNPGGTTGND  330
            +G+ LPRIIFVAEDD  EEN      N+ +GLDQAVINSYPK  ++K S      +   +
Sbjct  65   DGIILPRIIFVAEDDGQEENRNQDDDNLVVGLDQAVINSYPKFQFTKESVSGNNNSNNIN  124

Query  329  TLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEV  150
            T CSICLCEYKD EMLRM+P+C+HYFH+ CVDAWLKLN SCPVCRNSPLPTPLSTPL EV
Sbjct  125  TTCSICLCEYKDLEMLRMMPECRHYFHLCCVDAWLKLNGSCPVCRNSPLPTPLSTPLQEV  184

Query  149  VPLSHYSDGRRRQ  111
            VPLS Y+  RRR+
Sbjct  185  VPLSQYAADRRRR  197



>ref|XP_011037158.1| PREDICTED: RING-H2 finger protein ATL67 [Populus euphratica]
Length=205

 Score =   198 bits (503),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 141/190 (74%), Gaps = 5/190 (3%)
 Frame = -2

Query  677  PTNF-TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDD  501
            PTN+ T +GLGY+IAIA  FLVL ST+LLASYICCR+   R R    +      ++    
Sbjct  20   PTNYLTNLGLGYSIAIALFFLVLLSTILLASYICCRTTRHRSRNSNNNNSNYSNSTA---  76

Query  500  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  321
            +G+ LPRIIFVAEDDEE +    ++ ALGL+QAVINSYPKL +SK  G    T      C
Sbjct  77   DGIILPRIIFVAEDDEEQER-DLESAALGLNQAVINSYPKLQFSKDGGFSERTNNFCNTC  135

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPL  141
            SICLCEYKD EMLRM+PDC+HYFH+ C+DAWLKLN SCPVCRNSPLPTPLSTPLSEVVPL
Sbjct  136  SICLCEYKDLEMLRMMPDCRHYFHLLCLDAWLKLNGSCPVCRNSPLPTPLSTPLSEVVPL  195

Query  140  SHYSDGRRRQ  111
            S Y+  RRR+
Sbjct  196  SQYAADRRRR  205



>gb|KJB09703.1| hypothetical protein B456_001G157500 [Gossypium raimondii]
Length=256

 Score =   199 bits (506),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 112/191 (59%), Positives = 140/191 (73%), Gaps = 18/191 (9%)
 Frame = -2

Query  686  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHP  507
            +S+P  FT +GLGY+IAIA  FLVL S VLLASYICCR  ++              N  P
Sbjct  6    HSSPLYFTNLGLGYSIAIALAFLVLLSIVLLASYICCRPSSSFSP-----------NPTP  54

Query  506  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  327
              +G+ LPR++FVAED+++      +NV +GLDQAVINSYPK  ++K +   G T  N T
Sbjct  55   VSDGIILPRVVFVAEDEDD------ENVVVGLDQAVINSYPKFQFTKEAAAVGSTNVNTT  108

Query  326  LCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVV  147
             CSICLCEY+D EMLRM+P+C+HYFHV+C+DAWLKLN SCP+CRNSPLPTPLSTPLSE+V
Sbjct  109  -CSICLCEYRDLEMLRMMPECRHYFHVSCLDAWLKLNGSCPICRNSPLPTPLSTPLSEIV  167

Query  146  PLSHYSDGRRR  114
            PLS ++  RRR
Sbjct  168  PLSQHAADRRR  178



>gb|EYU35114.1| hypothetical protein MIMGU_mgv1a020271mg [Erythranthe guttata]
Length=198

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/187 (65%), Positives = 142/187 (76%), Gaps = 12/187 (6%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrr-ldaeagyRNSHPDDNG  495
            N  +IG GY+ AIA GFLVLFS+++LA YICCRS AA RRRR  L  +   R +   ++ 
Sbjct  23   NLRSIGFGYSFAIALGFLVLFSSIVLAFYICCRSSAAARRRRHDLQIQNQNRRNRSGEHS  82

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSI  315
            +YLP  IFV E +        QN  +GLDQAVINSYPKLV++KRSGN     GND +CSI
Sbjct  83   IYLPSTIFVDESEP-------QNGVIGLDQAVINSYPKLVFAKRSGN----WGNDAVCSI  131

Query  314  CLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSH  135
            CLCEY++SE+LRMLPDCKH FH  CVDAWLKLNASCPVCRNSPLPTP+STPL EVVPLS 
Sbjct  132  CLCEYRESEVLRMLPDCKHCFHAMCVDAWLKLNASCPVCRNSPLPTPMSTPLQEVVPLSQ  191

Query  134  YSDGRRR  114
            Y+DGRRR
Sbjct  192  YADGRRR  198



>emb|CBI40419.3| unnamed protein product [Vitis vinifera]
Length=279

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 138/188 (73%), Gaps = 16/188 (9%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            T  + +GLGYAIAIAF FLVL STVLLASY+CCR         R  A A   +     +G
Sbjct  83   TYLSNLGLGYAIAIAFAFLVLLSTVLLASYLCCRRRPLSPHHSRNPASAANSS-----DG  137

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSI  315
            + LPRIIFVAED++E+     QNV +GLDQAVI+SYPK  +SK        T  D++CSI
Sbjct  138  IVLPRIIFVAEDEDED-----QNVVVGLDQAVIDSYPKFPFSK------SNTHLDSVCSI  186

Query  314  CLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSH  135
            CLCEYKDSEMLRMLPDC+H FH+ CVDAWLKLNASCPVCRNSPLPTPLSTPLSE+VPLS 
Sbjct  187  CLCEYKDSEMLRMLPDCRHCFHLYCVDAWLKLNASCPVCRNSPLPTPLSTPLSELVPLSQ  246

Query  134  YSDGRRRQ  111
            Y   RRR+
Sbjct  247  YPADRRRR  254



>ref|XP_002320162.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE98477.1| zinc finger family protein [Populus trichocarpa]
Length=205

 Score =   193 bits (490),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 139/190 (73%), Gaps = 5/190 (3%)
 Frame = -2

Query  677  PTNF-TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDD  501
            P N+ T +GLGY+IAIA  FLVL ST+LLASYICCR+   R R    +      ++    
Sbjct  20   PANYLTNLGLGYSIAIALFFLVLLSTILLASYICCRTNRHRSRNSNNNNNNYANSTA---  76

Query  500  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  321
            +G+ LPRIIFVAEDDEE +    ++ A+GL+QAVINSYPK  +SK  G    T      C
Sbjct  77   DGIILPRIIFVAEDDEEQER-DLESAAVGLNQAVINSYPKFQFSKDGGFSERTNNFCNTC  135

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPL  141
            SICLCEYKD EMLRM+PDC+HYFH+ C+DAWLKLN SCPVCRNSPLPTPLSTPLSEVVPL
Sbjct  136  SICLCEYKDLEMLRMMPDCRHYFHLLCLDAWLKLNGSCPVCRNSPLPTPLSTPLSEVVPL  195

Query  140  SHYSDGRRRQ  111
            S Y+  RRR+
Sbjct  196  SQYAADRRRR  205



>gb|KJB41423.1| hypothetical protein B456_007G103900 [Gossypium raimondii]
Length=183

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/196 (61%), Positives = 139/196 (71%), Gaps = 15/196 (8%)
 Frame = -2

Query  704  LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  525
            ++T  P S+PT  T +GLGY+IAIA GFLVL ST+LLASYIC RS  + R      +   
Sbjct  1    MSTPSP-SSPTYLTNLGLGYSIAIAVGFLVLLSTILLASYICFRSSTSPRAFSSNPSAIP  59

Query  524  yRNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG  345
              NS    +G+ LP IIFVAED+  +      NV LGLDQAVINSYPK  + K S     
Sbjct  60   ASNS----DGILLPTIIFVAEDEATD------NVVLGLDQAVINSYPKFQFCKDSA----  105

Query  344  TTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplst  165
             +  +T CSICLCEYKD EMLRM+P+CKHYFHV C+DAWLKLN SCPVCRNSPLPTPLST
Sbjct  106  ASNLNTTCSICLCEYKDLEMLRMMPECKHYFHVFCIDAWLKLNGSCPVCRNSPLPTPLST  165

Query  164  plSEVVPLSHYSDGRR  117
            PLSEVVPLS ++  RR
Sbjct  166  PLSEVVPLSQFAADRR  181



>ref|XP_012083296.1| PREDICTED: RING-H2 finger protein ATL67 [Jatropha curcas]
 gb|KDP28554.1| hypothetical protein JCGZ_14325 [Jatropha curcas]
Length=209

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 140/190 (74%), Gaps = 11/190 (6%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSH----PDD  501
             T +GLGY+IAIA GFLVL STVLLASY+CCR+   R      +   G  N +    PD 
Sbjct  27   ITNLGLGYSIAIALGFLVLLSTVLLASYMCCRASRNRSFNSNDNDNNGNDNDNSNSVPD-  85

Query  500  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  321
             G+ LPRIIFVAED+++ +    +  A+GLDQAVINSYPK  ++K     G + GN T C
Sbjct  86   -GILLPRIIFVAEDEDDQER-DLETSAVGLDQAVINSYPKFQFTKD----GSSNGNSTTC  139

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPL  141
            SICLCEYKD EMLRM+P+C+H+FH+ C+DAWLKLN SCPVCRNSPLPTPLSTPLSEVVPL
Sbjct  140  SICLCEYKDLEMLRMMPECRHFFHLCCIDAWLKLNGSCPVCRNSPLPTPLSTPLSEVVPL  199

Query  140  SHYSDGRRRQ  111
            S Y+  RRR+
Sbjct  200  SQYAADRRRR  209



>ref|XP_006358653.1| PREDICTED: RING-H2 finger protein ATL67-like [Solanum tuberosum]
Length=200

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 145/187 (78%), Gaps = 15/187 (8%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            +   IGLGYAIAIA  FL L ST+LL+SY+CCRS A RRR+ +         +   + G+
Sbjct  29   SLNKIGLGYAIAIALAFLFLLSTLLLSSYLCCRSTAYRRRQAQS-------QTRNPNTGI  81

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  312
            Y+P +IFVAE DE ND VS QN   GLDQAVINSYPKL+YSKR+GN       D +CSIC
Sbjct  82   YIPSVIFVAEADE-NDDVSSQNTFAGLDQAVINSYPKLIYSKRNGN-------DVVCSIC  133

Query  311  LCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHY  132
            LC+YK++EMLRMLP+CKHYFHV C+DAWLKLNASCPVCRNSPLPTP+STPLSEVVPLS Y
Sbjct  134  LCDYKEAEMLRMLPECKHYFHVMCIDAWLKLNASCPVCRNSPLPTPMSTPLSEVVPLSQY  193

Query  131  SDGRRRQ  111
            SDGRRR 
Sbjct  194  SDGRRRH  200



>ref|XP_010669733.1| PREDICTED: RING-H2 finger protein ATL67-like [Beta vulgaris subsp. 
vulgaris]
Length=206

 Score =   190 bits (483),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 146/208 (70%), Gaps = 20/208 (10%)
 Frame = -2

Query  704  LTTVKPNSAP---TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrlda  534
            ++ + P S+P    +   +GLGYAIAI+ GFLVLFS +LL+SYICCR+   R  R+ +  
Sbjct  1    MSAISPPSSPHFTLSLQNLGLGYAIAISLGFLVLFSALLLSSYICCRANRRRITRQHVSD  60

Query  533  eagyRNSHPDDNGVYLPRIIFVAEDDE--ENDGVSGQNVALGLDQAVINSYPKLVY----  372
                     + N + +PRIIFVAEDD+  E +     N  +GLD+AVINSYPK  +    
Sbjct  61   ---------NSNAIIVPRIIFVAEDDDNDEENQNRASNGVVGLDRAVINSYPKFQFFKKN  111

Query  371  --SKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVC  198
              SK + N   + G++ +CSICLC+YK+ EMLRM+PDCKH+FH+ C+DAWLKLN SCPVC
Sbjct  112  LESKDNNNNYYSNGDNLMCSICLCDYKEGEMLRMMPDCKHFFHLCCLDAWLKLNGSCPVC  171

Query  197  RNsplptplstplSEVVPLSHYSDGRRR  114
            RNSPLPTP+STPL+EVVPLS Y+D RRR
Sbjct  172  RNSPLPTPVSTPLAEVVPLSQYADNRRR  199



>ref|XP_010261407.1| PREDICTED: RING-H2 finger protein ATL67-like [Nelumbo nucifera]
Length=205

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 138/189 (73%), Gaps = 15/189 (8%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDD---  501
            N T +G GYAIAIA GFLVL STV+L+SYICCR+   R R    D      +S+PD    
Sbjct  29   NLTNLGFGYAIAIALGFLVLLSTVVLSSYICCRASRNRHRSSNPDNS----DSNPDSSNP  84

Query  500  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  321
            NG+ LPRIIFVAEDD+ +     ++V +GLDQ+VINSYPK  + K           D++C
Sbjct  85   NGIILPRIIFVAEDDDGSR--DDESVVVGLDQSVINSYPKFPFCK------SKDRGDSVC  136

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPL  141
            SICLC+YKD EMLRM+PDC+H+FH+ C+DAWL+LNASCPVCRNSPLPTPLSTPLSE+VPL
Sbjct  137  SICLCDYKDGEMLRMMPDCRHFFHLCCIDAWLRLNASCPVCRNSPLPTPLSTPLSELVPL  196

Query  140  SHYSDGRRR  114
            S Y   RRR
Sbjct  197  SQYPGNRRR  205



>ref|XP_010559104.1| PREDICTED: RING-H2 finger protein ATL67-like [Tarenaya hassleriana]
Length=197

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 110/189 (58%), Positives = 135/189 (71%), Gaps = 17/189 (9%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
             T IGLGY+IAIA GFLVL ST+LL+SY+CCR+   R       + A        D G+ 
Sbjct  20   LTGIGLGYSIAIALGFLVLLSTILLSSYVCCRASRRRSSSSATASAAV-------DGGII  72

Query  488  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  309
            LPRIIFVAEDD++ +  +G+N+ +GLDQ+VINSYPK  +SK S       G D  CSICL
Sbjct  73   LPRIIFVAEDDDDLEA-NGENIVVGLDQSVINSYPKFQFSKESDG-----GGDATCSICL  126

Query  308  CEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstplSEVVPL  141
            CEY+++EMLRM+P+CKH FH+ C+DAWLKLN SCPVCRN    +P  TPLSTPLSEVVPL
Sbjct  127  CEYREAEMLRMMPECKHSFHLCCLDAWLKLNGSCPVCRNSPLPTPQSTPLSTPLSEVVPL  186

Query  140  SHYSDGRRR  114
            S Y+  RRR
Sbjct  187  SQYAADRRR  195



>emb|CAN73279.1| hypothetical protein VITISV_040608 [Vitis vinifera]
Length=641

 Score =   196 bits (498),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 138/188 (73%), Gaps = 16/188 (9%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            T  + +GLGYAIAIAF FLVL STVLLASY+CCR         R  A A   +     +G
Sbjct  26   TYLSNLGLGYAIAIAFAFLVLLSTVLLASYLCCRRRPLSPHHSRNPASAANSS-----DG  80

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSI  315
            + LPRIIFVAED++E+     QNV +GLDQAVI+SYPK  +SK        T  D++CSI
Sbjct  81   IVLPRIIFVAEDEDED-----QNVVVGLDQAVIDSYPKFPFSK------SNTHLDSVCSI  129

Query  314  CLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSH  135
            CLCEYKDSEMLRMLPDC+H FH+ CVDAWLKLNASCPVCRNSPLPTPLSTPLSE+VPLS 
Sbjct  130  CLCEYKDSEMLRMLPDCRHCFHLYCVDAWLKLNASCPVCRNSPLPTPLSTPLSELVPLSQ  189

Query  134  YSDGRRRQ  111
            Y   RRR+
Sbjct  190  YPADRRRR  197



>gb|KFK35351.1| hypothetical protein AALP_AA5G273400 [Arabis alpina]
Length=221

 Score =   185 bits (469),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 111/198 (56%), Positives = 134/198 (68%), Gaps = 11/198 (6%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            T  T++GLGY+IAIA GFLVL ST++L+SYICCR+   R      +       S   +  
Sbjct  23   TYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSTSAANTNTNANASF-GNRS  81

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRS-----GNPGGTTGN-  333
            + +PRIIFVAEDD+    VSG  V  GLDQ +INSYPK  Y+K +     G+ G   G+ 
Sbjct  82   IIVPRIIFVAEDDDLESAVSGNVVVGGLDQPIINSYPKFHYTKETAVSVAGDNGFHGGDG  141

Query  332  DTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplst  165
            DT CSICLCEY + EMLRM+P+CKHYFHV C+DAWLKLN SCPVCRN    +P  TP ST
Sbjct  142  DTTCSICLCEYVEEEMLRMMPECKHYFHVYCLDAWLKLNGSCPVCRNSPLPTPQSTPSST  201

Query  164  plSEVVPLSHYSDGRRRQ  111
            PLSEVVPLS Y+  RRR 
Sbjct  202  PLSEVVPLSQYAADRRRS  219



>ref|XP_010661826.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC100263595 
[Vitis vinifera]
Length=682

 Score =   195 bits (496),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 120/188 (64%), Positives = 138/188 (73%), Gaps = 16/188 (9%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            T  + +GLGYAIAIAF FLVL STVLLASY+CCR         R  A A   +     +G
Sbjct  26   TYLSNLGLGYAIAIAFAFLVLLSTVLLASYLCCRRRPLSPHHSRNPASAANSS-----DG  80

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSI  315
            + LPRIIFVAED++E+     QNV +GLDQAVI+SYPK  +SK        T  D++CSI
Sbjct  81   IVLPRIIFVAEDEDED-----QNVVVGLDQAVIDSYPKFPFSK------SNTHLDSVCSI  129

Query  314  CLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSH  135
            CLCEYKDSEMLRMLPDC+H FH+ CVDAWLKLNASCPVCRNSPLPTPLSTPLSE+VPLS 
Sbjct  130  CLCEYKDSEMLRMLPDCRHCFHLYCVDAWLKLNASCPVCRNSPLPTPLSTPLSELVPLSQ  189

Query  134  YSDGRRRQ  111
            Y   RRR+
Sbjct  190  YPADRRRR  197



>ref|XP_006291847.1| hypothetical protein CARUB_v10018022mg [Capsella rubella]
 gb|EOA24745.1| hypothetical protein CARUB_v10018022mg [Capsella rubella]
Length=211

 Score =   184 bits (466),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 131/199 (66%), Gaps = 20/199 (10%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            T  T++GLGY+IAIA GFLVL ST++L+SYICCR+   R             NS   D G
Sbjct  20   TYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSASAATT-----NSSFRDRG  74

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKR-------SGNPGGTTG  336
            V +PRIIFVAEDD   D  SG  V  GLD ++INSYPK  ++K         G   G  G
Sbjct  75   VIVPRIIFVAEDD---DLESGNVVVGGLDHSIINSYPKFPFTKDITSVVDGDGFHDGE-G  130

Query  335  NDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptpls  168
             DT CSICLCEY + EMLRM+P+CKHYFHV C+DAWLKLN SCPVCRN    +P  TP S
Sbjct  131  RDTTCSICLCEYTEEEMLRMMPECKHYFHVYCLDAWLKLNGSCPVCRNSPLPTPQTTPQS  190

Query  167  tplSEVVPLSHYSDGRRRQ  111
            TPLSEVVPLS Y+  RRR 
Sbjct  191  TPLSEVVPLSQYAADRRRS  209



>ref|XP_009349321.1| PREDICTED: RING-H2 finger protein ATL67-like [Pyrus x bretschneideri]
Length=191

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 130/190 (68%), Gaps = 12/190 (6%)
 Frame = -2

Query  686  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHP  507
            +S P   TT+GLGY IAI+ GFLVLFST+LLASY+CCR    R  + R            
Sbjct  9    HSPPNYLTTLGLGYGIAISLGFLVLFSTLLLASYLCCRVSRHRPPQPRNPNPNPNPE---  65

Query  506  DDNGVYLPRIIFVAEDDEENDGVSG-QNVALGLDQAVINSYPKLVYSKRSGNPGGTTGND  330
               GV LPRIIFVAEDD E +     +N  +GL  + INSYPK  +SK +  P  +T   
Sbjct  66   ---GVILPRIIFVAEDDNEQEQQDDDENAVVGLHPSAINSYPKFPFSKEAAIPDSST---  119

Query  329  TLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEV  150
              CSICLC+YKD+EMLRM+P+C+HYFH+ C+DAWL+LN SCPVCRNSPLPTPLSTPL EV
Sbjct  120  --CSICLCDYKDAEMLRMMPECRHYFHLLCLDAWLRLNGSCPVCRNSPLPTPLSTPLQEV  177

Query  149  VPLSHYSDGR  120
            VPLS Y   R
Sbjct  178  VPLSQYPADR  187



>emb|CDX71732.1| BnaC08g31420D [Brassica napus]
Length=216

 Score =   180 bits (456),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 133/196 (68%), Gaps = 15/196 (8%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            T  T++GLGY+IAIA GFLVL ST++L+SYICCR+   R      + ++ + N       
Sbjct  24   TYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSTSAANLDSSFGN-----RS  78

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGN-DTLCS  318
            + +PRI+FVAE D+     SG  V  GLDQ +INSYPK  Y + SG+     G+ DT CS
Sbjct  79   IIVPRIMFVAEGDDLESAPSGNVVVGGLDQPIINSYPKFRY-RASGDDELQGGDGDTTCS  137

Query  317  ICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN--------splptplstp  162
            ICLCEY + EM+RM+P+CKHYFHV+C+DAWLKLN SCPVCRN        +P  TP STP
Sbjct  138  ICLCEYMEEEMVRMMPECKHYFHVSCLDAWLKLNGSCPVCRNSPLPTPQSTPQSTPQSTP  197

Query  161  lSEVVPLSHYSDGRRR  114
            LSEVVPLS Y+  RRR
Sbjct  198  LSEVVPLSQYAADRRR  213



>ref|XP_010251603.1| PREDICTED: RING-H2 finger protein ATL67 [Nelumbo nucifera]
Length=211

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 114/189 (60%), Positives = 136/189 (72%), Gaps = 14/189 (7%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDD---  501
            N + IGLGYAIAIA GFLVL STVLLASY+CCRS   R R    +       S+PD    
Sbjct  34   NLSNIGLGYAIAIALGFLVLLSTVLLASYVCCRSSRNRSRSSDPENP----GSNPDSSHS  89

Query  500  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  321
            NG+ LPRIIFVAEDD+++      ++ +GL+QAVINSYPK  + K           D++C
Sbjct  90   NGIILPRIIFVAEDDDDDSRDD-DSLVVGLNQAVINSYPKFPFCKSKDR------GDSVC  142

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPL  141
            SICLC+YKD EMLRM+PDC H+FH+ C+DAWL+LNASCPVCRNSP PTPLSTPLSE+VPL
Sbjct  143  SICLCDYKDGEMLRMMPDCHHFFHLCCIDAWLRLNASCPVCRNSPFPTPLSTPLSELVPL  202

Query  140  SHYSDGRRR  114
            S Y   RRR
Sbjct  203  SQYPGNRRR  211



>ref|XP_006402471.1| hypothetical protein EUTSA_v10006504mg [Eutrema salsugineum]
 gb|ESQ43924.1| hypothetical protein EUTSA_v10006504mg [Eutrema salsugineum]
Length=215

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/198 (56%), Positives = 132/198 (67%), Gaps = 16/198 (8%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            T  T++GLGY+IAIA GFLVL ST++L+SYICCR+   R      +A     N+   +  
Sbjct  20   TYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSAETENA-----NASFGNRS  74

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGT-------TG  336
            + +PRIIFVAEDD+    VSG  V  GLDQ +INSYPK  ++K      G         G
Sbjct  75   IIVPRIIFVAEDDDLESAVSGGVVVGGLDQPIINSYPKFRFTKDISLAAGDGFQGVDGEG  134

Query  335  NDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptpls  168
             DT CSICLCEY + EMLRM+P+CKHYFHV C+DAWLKLN SCPVCRN    +P  TP S
Sbjct  135  GDTTCSICLCEYMEEEMLRMMPECKHYFHVFCLDAWLKLNGSCPVCRNSPLPTPQSTPQS  194

Query  167  tplSEVVPLSHYSDGRRR  114
            TPLSEVVPLS Y+  RRR
Sbjct  195  TPLSEVVPLSQYAADRRR  212



>gb|KEH18782.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=203

 Score =   178 bits (451),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 131/179 (73%), Gaps = 17/179 (9%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
             T +G GY+IAIA GFL L ST++L+SY+CCR+   R      + +     +H  D GV 
Sbjct  16   LTNLGFGYSIAIALGFLFLLSTLILSSYLCCRTFRNRNNHLNGNNQL----NHNHD-GVV  70

Query  488  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  309
            LPR+IFVAED+E+      ++V LGLDQ VINSYP+L Y K         G+D+ CSICL
Sbjct  71   LPRVIFVAEDEEDR-----EDVVLGLDQNVINSYPRLQYCK-------DLGHDSTCSICL  118

Query  308  CEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHY  132
            CEYKDSEMLRM+P+C+HYFH+ C+D+WLKLN SCPVCRNSP+PTPLSTPL EVVPLSHY
Sbjct  119  CEYKDSEMLRMMPECRHYFHLCCLDSWLKLNGSCPVCRNSPMPTPLSTPLQEVVPLSHY  177



>ref|NP_191714.1| RING-H2 finger protein ATL68 [Arabidopsis thaliana]
 sp|Q9M313.1|ATL68_ARATH RecName: Full=RING-H2 finger protein ATL68 [Arabidopsis thaliana]
 gb|AAL16112.1|AF428280_1 AT3g61550/F2A19_150 [Arabidopsis thaliana]
 emb|CAB71085.1| putative protein [Arabidopsis thaliana]
 gb|AAM51602.1| AT3g61550/F2A19_150 [Arabidopsis thaliana]
 dbj|BAD95337.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE80221.1| RING-H2 finger protein ATL68 [Arabidopsis thaliana]
Length=212

 Score =   178 bits (451),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 114/198 (58%), Positives = 133/198 (67%), Gaps = 18/198 (9%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            T  T++GLGY+IAIA GFLVL ST++L+SYICCR+   R      +A A    S   D G
Sbjct  19   TYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSASAANANANASFS---DRG  75

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKR-------SGNPGGTTG  336
            V +PRIIFVAEDD   D  SG  V  GLD +VINSYPK  ++K         G   G  G
Sbjct  76   VIVPRIIFVAEDD---DLESGNVVVGGLDHSVINSYPKFHFTKDITAVVNGDGFHDGE-G  131

Query  335  NDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptpls  168
             +T CSICLCEY + EMLRM+P+CKHYFHV C+DAWLKLN SCPVCRN    +P  TP S
Sbjct  132  RETTCSICLCEYMEEEMLRMMPECKHYFHVYCLDAWLKLNGSCPVCRNSPLPTPQSTPQS  191

Query  167  tplSEVVPLSHYSDGRRR  114
            TPLSEVVPLS Y+  RRR
Sbjct  192  TPLSEVVPLSQYAADRRR  209



>ref|XP_010512505.1| PREDICTED: RING-H2 finger protein ATL68 isoform X1 [Camelina 
sativa]
 ref|XP_010512506.1| PREDICTED: RING-H2 finger protein ATL68 isoform X2 [Camelina 
sativa]
Length=214

 Score =   177 bits (448),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 112/199 (56%), Positives = 133/199 (67%), Gaps = 19/199 (10%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            T  T++GLGY+IAIA GFLVL ST++L+SYICCR+   R       A + +R     D  
Sbjct  22   TYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSASAATANSSFR-----DRS  76

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNP--GGT-----TG  336
            V +PRIIFVAEDD   D  SG  V  GLD ++INSYPK  ++K   +   GG       G
Sbjct  77   VIVPRIIFVAEDD---DLESGNVVVGGLDHSIINSYPKFHFTKDIASVVVGGDGFHDGEG  133

Query  335  NDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptpls  168
             DT CSICLCEY + EMLRM+P+CKHYFHV C+DAWLKLN SCPVCRN    +P  TP S
Sbjct  134  RDTTCSICLCEYTEEEMLRMMPECKHYFHVYCLDAWLKLNGSCPVCRNSPLPTPQTTPQS  193

Query  167  tplSEVVPLSHYSDGRRRQ  111
            TPLSEVVPLS Y+  RRR 
Sbjct  194  TPLSEVVPLSQYAADRRRS  212



>ref|XP_010469090.1| PREDICTED: RING-H2 finger protein ATL68-like isoform X1 [Camelina 
sativa]
 ref|XP_010469091.1| PREDICTED: RING-H2 finger protein ATL68-like isoform X2 [Camelina 
sativa]
Length=214

 Score =   177 bits (448),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 133/199 (67%), Gaps = 19/199 (10%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            T  T++GLGY+IAIA GFLVL ST++L+SYICCR+   R       A + +R     D  
Sbjct  22   TYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSASAATANSSFR-----DRS  76

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSK--RSGNPGGT-----TG  336
            V +PRIIFVAEDD   D  SG  V  GLD ++INSYPK  ++K   S   GG       G
Sbjct  77   VIVPRIIFVAEDD---DLESGNVVVGGLDHSIINSYPKFHFTKDITSVVVGGDGFHDGEG  133

Query  335  NDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptpls  168
             DT CSICLCEY + EMLRM+P+CKHYFHV C+DAWLKLN SCPVCRN    +P  TP S
Sbjct  134  RDTTCSICLCEYTEEEMLRMMPECKHYFHVYCLDAWLKLNGSCPVCRNSPLPTPQTTPQS  193

Query  167  tplSEVVPLSHYSDGRRRQ  111
            TPLSEVVPLS Y+  RRR 
Sbjct  194  TPLSEVVPLSQYAADRRRS  212



>ref|XP_007135149.1| hypothetical protein PHAVU_010G105200g [Phaseolus vulgaris]
 gb|ESW07143.1| hypothetical protein PHAVU_010G105200g [Phaseolus vulgaris]
Length=190

 Score =   176 bits (446),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 132/187 (71%), Gaps = 13/187 (7%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
            FT +G GY+IAIA G L L ST++L+SY+CCR++  R             ++ PD  G+ 
Sbjct  16   FTNLGFGYSIAIALGVLFLISTLILSSYLCCRTLRHRNNNHHRRRHRHNLHA-PD--GIV  72

Query  488  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  309
            LPR+IFVAEDD+  DG    +   GL+QAVINSYPK  ++K  G        DT CSICL
Sbjct  73   LPRVIFVAEDDD--DGARQNDAVSGLEQAVINSYPKFPFTKDGGY-------DTTCSICL  123

Query  308  CEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHY-  132
            C+YKD+EMLRM+P+C+HYFH+ C+D WLKLN SCPVCRNSP+PTPLSTPL EVVPLS Y 
Sbjct  124  CDYKDTEMLRMMPECRHYFHLCCLDPWLKLNGSCPVCRNSPMPTPLSTPLQEVVPLSQYA  183

Query  131  SDGRRRQ  111
            +D R R+
Sbjct  184  ADARGRR  190



>ref|XP_004492810.1| PREDICTED: RING-H2 finger protein ATL67-like [Cicer arietinum]
Length=178

 Score =   174 bits (442),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 104/189 (55%), Positives = 126/189 (67%), Gaps = 21/189 (11%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDN---  498
            FT  G GY+IAIA  FLVLF+T++L+ Y CCR+                   H   N   
Sbjct  8    FTNFGFGYSIAIALAFLVLFATLILSFYFCCRTNNNPNNNHNSI--------HDTPNYSL  59

Query  497  GVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCS  318
            GV + R IFV EDDEEN         +GLD+ VINSYP+  +++   N     G ++ CS
Sbjct  60   GVVVSRDIFVTEDDEEN-------TVVGLDENVINSYPRFQFNR---NNATVLGQNSTCS  109

Query  317  ICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            ICLCEYKDSEMLRM+P+C+HYFH+ C+D+WLKLN SCPVCRNSPLPTPLSTPL EVVPLS
Sbjct  110  ICLCEYKDSEMLRMMPECRHYFHLCCLDSWLKLNGSCPVCRNSPLPTPLSTPLQEVVPLS  169

Query  137  HYSDGRRRQ  111
            HYS  RRR+
Sbjct  170  HYSADRRRR  178



>ref|XP_007051690.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX95847.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=680

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 139/185 (75%), Gaps = 10/185 (5%)
 Frame = -2

Query  683  SAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPD  504
            S+P   T +GLGY+IAIA GFLVL ST+LLASYICCRS ++ R        A   +   +
Sbjct  7    SSPNYLTNLGLGYSIAIALGFLVLLSTILLASYICCRSSSSPRAFSPNPTTAVAAS---N  63

Query  503  DNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTL  324
             +G+ LPRIIFVAED++       ++V +GLDQAVINSYPK  +SK +     +T  +T 
Sbjct  64   SDGIILPRIIFVAEDED------NESVVVGLDQAVINSYPKFQFSKEAAA-ANSTNANTT  116

Query  323  CSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVP  144
            CSICLCEY+D EMLRM+P+C+HYFHV+C+DAWLKLN SCP+CRNSPLPTPLSTPLSEVVP
Sbjct  117  CSICLCEYRDLEMLRMMPECRHYFHVSCIDAWLKLNGSCPICRNSPLPTPLSTPLSEVVP  176

Query  143  LSHYS  129
            LS Y+
Sbjct  177  LSQYA  181



>ref|XP_009116820.1| PREDICTED: RING-H2 finger protein ATL68 [Brassica rapa]
Length=219

 Score =   175 bits (443),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 133/200 (67%), Gaps = 20/200 (10%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
             T++GLGY+IAIA GFL+L ST++L+SYICCR+   R      + ++ + N       + 
Sbjct  22   ITSLGLGYSIAIALGFLILISTIILSSYICCRASRLRFSTSAANLDSSFGN-----RSII  76

Query  488  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSK------RSGNPGGTTGN-D  330
            +PRI+FVA+ D+     SG  V  GL+Q +INSYPK  Y+K       SG+     G+ D
Sbjct  77   VPRIMFVADGDDLESAPSGNIVVGGLEQPIINSYPKFRYTKGITVDASSGDDELQGGDGD  136

Query  329  TLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN--------splptp  174
            T CSICLCEY + EM+RM+P+CKHYFHV+C+DAWLKLN SCPVCRN        +P  TP
Sbjct  137  TTCSICLCEYMEEEMVRMMPECKHYFHVSCLDAWLKLNGSCPVCRNSPLPTPQSTPQSTP  196

Query  173  lstplSEVVPLSHYSDGRRR  114
             STPLSEVVPLS Y+  RRR
Sbjct  197  QSTPLSEVVPLSQYAADRRR  216



>ref|XP_002876620.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52879.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=211

 Score =   174 bits (442),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 112/198 (57%), Positives = 130/198 (66%), Gaps = 18/198 (9%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            T  T++GLGY+IAIA GFLVL ST++L+SYICCR+   R       A A        D  
Sbjct  18   TYITSLGLGYSIAIALGFLVLISTIILSSYICCRASRLRFSASAATANANASFR---DRS  74

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKR-------SGNPGGTTG  336
            V +PRIIFVAEDD   D  SG  V  GLD ++INSYPK  ++K         G   G  G
Sbjct  75   VIVPRIIFVAEDD---DLESGNVVVGGLDHSIINSYPKFHFTKDITAVVDGDGFHDGERG  131

Query  335  NDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptpls  168
             DT CSICLCEY + EMLRM+P+CKHYFHV C+DAWLKLN SCPVCRN    +P  TP S
Sbjct  132  -DTTCSICLCEYMEEEMLRMMPECKHYFHVYCLDAWLKLNGSCPVCRNSPLPTPQSTPQS  190

Query  167  tplSEVVPLSHYSDGRRR  114
            TPLSEVVPLS Y+  RRR
Sbjct  191  TPLSEVVPLSQYAADRRR  208



>ref|XP_009341125.1| PREDICTED: RING-H2 finger protein ATL67 [Pyrus x bretschneideri]
Length=197

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 132/190 (69%), Gaps = 12/190 (6%)
 Frame = -2

Query  680  APTNF-TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPD  504
            +PTN+ TT+GLGY IAI+ GFLVLFST+LLASYICCR    R        +    N +P 
Sbjct  15   SPTNYLTTLGLGYGIAISLGFLVLFSTLLLASYICCRVSRHRHHHHHQPPQRQ--NQNPS  72

Query  503  DNGVYLPRIIFVAEDDEENDGVSGQNVAL-GLDQAVINSYPKLVYSKRSGNPGGTTGNDT  327
              GV LPRIIFVAEDD E         A+ GL  +VINSYPK  +SK +        + +
Sbjct  73   PEGVILPRIIFVAEDDNEQQQQDDDENAVVGLHPSVINSYPKFPFSKEA--------SSS  124

Query  326  LCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVV  147
             CSICLC+YKD+EMLRM+P+C+HYFH+ C+DAWL+L  SCPVCRNSPLPTPLSTPL EVV
Sbjct  125  TCSICLCDYKDAEMLRMMPECRHYFHLLCLDAWLRLKGSCPVCRNSPLPTPLSTPLQEVV  184

Query  146  PLSHYSDGRR  117
            PLS Y   RR
Sbjct  185  PLSQYPADRR  194



>emb|CDY11361.1| BnaA09g39270D [Brassica napus]
Length=207

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 128/193 (66%), Gaps = 18/193 (9%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
             T++GLGY+IAIA GFL+L ST++L+SYICCR+   R      + ++ + N       + 
Sbjct  22   ITSLGLGYSIAIALGFLILISTIILSSYICCRASRLRFSTSAANLDSSFGN-----RSII  76

Query  488  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  309
            +PRI+FVA+ D+     SG  V  GL+Q +INSYPK    +  G  G     DT CSICL
Sbjct  77   VPRIMFVADGDDLESAPSGNIVVGGLEQPIINSYPKFRDDELQGGDG-----DTTCSICL  131

Query  308  CEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN--------splptplstplSE  153
            CEY + EM+RM+P+CKHYFHV+C+DAWLKLN SCPVCRN        +P  TP STPLSE
Sbjct  132  CEYMEEEMVRMMPECKHYFHVSCLDAWLKLNGSCPVCRNSPLPTPQSTPQSTPQSTPLSE  191

Query  152  VVPLSHYSDGRRR  114
            VVPLS Y+  RRR
Sbjct  192  VVPLSQYAADRRR  204



>ref|XP_009345625.1| PREDICTED: RING-H2 finger protein ATL67-like, partial [Pyrus 
x bretschneideri]
Length=178

 Score =   171 bits (434),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 127/184 (69%), Gaps = 8/184 (4%)
 Frame = -2

Query  659  IGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPR  480
            +GLGY IAI+ GFLVLFST+LLASYICCR    R        +    N +P   GV LPR
Sbjct  1    LGLGYGIAISLGFLVLFSTLLLASYICCRVSRHRHHHHHQPPQRQ--NPNPSPEGVILPR  58

Query  479  IIFVAEDDEENDGVSGQNVAL-GLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCE  303
            IIFVAEDD E         A+ GL  +VINSYPK  +SK +  P  +T     CSICLC+
Sbjct  59   IIFVAEDDNEQQQQDDDENAVVGLHPSVINSYPKFPFSKEASTPDSST-----CSICLCD  113

Query  302  YKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDG  123
            YKD+EMLRM+P+C+HYFH+ C+DAWL+L  SCPVCRNSPLPTPLSTPL EVVPLS Y   
Sbjct  114  YKDAEMLRMMPECRHYFHLLCLDAWLRLKGSCPVCRNSPLPTPLSTPLQEVVPLSQYPAD  173

Query  122  RRRQ  111
            RR +
Sbjct  174  RRWR  177



>ref|XP_008343409.1| PREDICTED: RING-H2 finger protein ATL67-like [Malus domestica]
Length=199

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/192 (58%), Positives = 130/192 (68%), Gaps = 10/192 (5%)
 Frame = -2

Query  680  APTNF-TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPD  504
            +PTN+ TT+GLGY IAI+ GFLVLFST+LLASYICCR    R              S   
Sbjct  15   SPTNYLTTLGLGYGIAISLGFLVLFSTLLLASYICCRVSRHRHHHHHPPQPQNPNPS---  71

Query  503  DNGVYLPRIIFVAEDDEENDGVSGQ-NVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  327
              GV LPRIIFVAEDD E        N  +GL  +VINSYP   +SK +  P  +T    
Sbjct  72   PEGVILPRIIFVAEDDNEQQQQDDDGNAVVGLHPSVINSYPXFPFSKEASTPDSST----  127

Query  326  LCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVV  147
             CSICLC+YKD+EMLRM+P+C+HYFH+ C+DAWL+L  SCPVCRNSPLPTPLSTPL EVV
Sbjct  128  -CSICLCDYKDAEMLRMMPECRHYFHLLCLDAWLRLKGSCPVCRNSPLPTPLSTPLQEVV  186

Query  146  PLSHYSDGRRRQ  111
            PLS Y   RR +
Sbjct  187  PLSQYPADRRWR  198



>emb|CDY65206.1| BnaAnng20290D [Brassica napus]
Length=210

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 125/188 (66%), Gaps = 17/188 (9%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            ++ TT+G GY IAI  GFLVL S VLL+SYICCR    R              +      
Sbjct  24   SHLTTLGFGYTIAIGLGFLVLISIVLLSSYICCRDSRRRTTAVE--------TTEERGRS  75

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG---TTGNDTL  324
            V LPR+IFV+E+D  N+ +   +V +GLDQAVINSYPK  +SK +          G DT 
Sbjct  76   VNLPRVIFVSEED--NEDLEAGDVIVGLDQAVINSYPKFHFSKETSAASSDGFGGGGDTS  133

Query  323  CSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstplS  156
            C+ICLCEYK++EMLRM+P+CKHYFH+ C+DAWLKLN SCPVCRN    +P  TPLSTPLS
Sbjct  134  CTICLCEYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTSTPLSTPLS  193

Query  155  EVVPLSHY  132
            EVVPLS Y
Sbjct  194  EVVPLSLY  201



>ref|XP_009142411.1| PREDICTED: RING-H2 finger protein ATL67-like [Brassica rapa]
Length=210

 Score =   171 bits (434),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 126/192 (66%), Gaps = 17/192 (9%)
 Frame = -2

Query  686  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHP  507
            +S  ++ TT+G GY IAI  GFLVL S VLL+SYICCR    R              +  
Sbjct  20   DSNNSHLTTLGFGYTIAIGLGFLVLISIVLLSSYICCRDSRRRTTAVE--------TTEE  71

Query  506  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG---TTG  336
                V LPR+IFV+E+D  N+ +    V +GLDQAVINSYPK  +SK +          G
Sbjct  72   RGRSVNLPRVIFVSEED--NEDLEAGEVIVGLDQAVINSYPKFHFSKETSAASSDGFGGG  129

Query  335  NDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptpls  168
             DT C+ICLCEYK++EMLRM+P+CKHYFH+ C+DAWLKLN SCPVCRN    +P  TPLS
Sbjct  130  GDTSCTICLCEYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTSTPLS  189

Query  167  tplSEVVPLSHY  132
            TPLSEVVPLS Y
Sbjct  190  TPLSEVVPLSLY  201



>ref|XP_002301380.1| hypothetical protein POPTR_0002s16670g [Populus trichocarpa]
 gb|EEE80653.1| hypothetical protein POPTR_0002s16670g [Populus trichocarpa]
Length=171

 Score =   170 bits (430),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 107/199 (54%), Positives = 130/199 (65%), Gaps = 35/199 (18%)
 Frame = -2

Query  698  TVKPNSAPTN---FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaea  528
            TV  +++P +    T +GLGY+IAIA GFLVL ST+LLASYICCR+              
Sbjct  5    TVTTSTSPPSSNYLTNLGLGYSIAIALGFLVLVSTILLASYICCRATRN-----------  53

Query  527  gyRNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPG  348
                SH                D+E+   + G   A+GLDQAVINSYPK  +S+  G   
Sbjct  54   ---RSH----------------DEEQERDLEG--AAVGLDQAVINSYPKFQFSRDGGFCE  92

Query  347  GTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptpls  168
             T   ++ CSICLCEYKD EMLRM+P+C+HYFH  C+DAWLKLN SCPVCRNSPLPTPLS
Sbjct  93   RTDNLNSTCSICLCEYKDLEMLRMMPECRHYFHSLCLDAWLKLNGSCPVCRNSPLPTPLS  152

Query  167  tplSEVVPLSHYSDGRRRQ  111
            TPLSEVVPLS Y++ RRR+
Sbjct  153  TPLSEVVPLSQYAEDRRRR  171



>ref|XP_008232965.1| PREDICTED: RING-H2 finger protein ATL67 [Prunus mume]
Length=193

 Score =   170 bits (431),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 125/185 (68%), Gaps = 11/185 (6%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
             TT+GLGY IAIA GFLVLFST+LLASYICCR                  +     +G+ 
Sbjct  16   LTTLGLGYGIAIALGFLVLFSTLLLASYICCRVSRHHHHPPPNPNRNPNNS-----DGII  70

Query  488  LPRIIFVAEDDEENDGVSGQNVAL-GLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  312
            LPRIIFVAEDD +         A+ G+ Q+VINSYPK  +SK       +T     CSIC
Sbjct  71   LPRIIFVAEDDNDQQQQDDDENAVVGIHQSVINSYPKFSFSKDVAAADSST-----CSIC  125

Query  311  LCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHY  132
            LC+YKD+EMLRM+P+C+HYFH+ C+DAWLKLN SCPVCRNSPLPTPLSTPL EVVPLS Y
Sbjct  126  LCDYKDAEMLRMMPECRHYFHLMCLDAWLKLNGSCPVCRNSPLPTPLSTPLQEVVPLSQY  185

Query  131  SDGRR  117
               RR
Sbjct  186  PADRR  190



>ref|XP_009338797.1| PREDICTED: uncharacterized protein LOC103931112, partial [Pyrus 
x bretschneideri]
Length=697

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 132/193 (68%), Gaps = 12/193 (6%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
             TT+GLGY IAI+ GFLVLFST+LLASY+CCR    R  + R               GV 
Sbjct  2    LTTLGLGYGIAISLGFLVLFSTLLLASYLCCRVSRHRPPQPRNPNPNPNPE------GVI  55

Query  488  LPRIIFVAEDDEENDGVSG-QNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  312
            LPRIIFVAEDD E +     +N  +GL  + INSYPK  +SK +  P  +T     CSIC
Sbjct  56   LPRIIFVAEDDNEQEQQDDDENAVVGLHPSAINSYPKFPFSKEAAIPDSST-----CSIC  110

Query  311  LCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHY  132
            LC+YKD+EMLRM+P+C+HYFH+ C+DAWL+LN SCPVCRNSPLPTPLSTPL EVVPLS Y
Sbjct  111  LCDYKDAEMLRMMPECRHYFHLLCLDAWLRLNGSCPVCRNSPLPTPLSTPLQEVVPLSQY  170

Query  131  SDGRRRQ*LWIDF  93
               R  + + +DF
Sbjct  171  PADRGWRGIVLDF  183



>ref|XP_006583264.1| PREDICTED: RING-H2 finger protein ATL67-like [Glycine max]
Length=190

 Score =   168 bits (426),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 132/184 (72%), Gaps = 17/184 (9%)
 Frame = -2

Query  659  IGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPR  480
            +G GY+IAIA G L L ST++L+SY+CCR++  R               H  D GV LPR
Sbjct  23   LGFGYSIAIALGVLFLLSTLILSSYLCCRTLRRRNNNNN--------RRHTPD-GVVLPR  73

Query  479  IIFVAEDDEENDGVSGQN-VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCE  303
            +IFV ED++++D  + QN VA GLDQAVINSYPK  + K  GN       D+ CSICLCE
Sbjct  74   VIFVPEDEDDDDDDTRQNDVATGLDQAVINSYPKFPFVKE-GN------YDSTCSICLCE  126

Query  302  YKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDG  123
            YKDSEMLRM+P+C+HYFH+ C+D WLKLN SCPVCRNSP+PTPLSTPL EVVPLS Y+D 
Sbjct  127  YKDSEMLRMMPECRHYFHLCCLDPWLKLNGSCPVCRNSPMPTPLSTPLQEVVPLSQYADA  186

Query  122  RRRQ  111
            R R+
Sbjct  187  RARR  190



>ref|XP_009345627.1| PREDICTED: RING-H2 finger protein ATL67-like, partial [Pyrus 
x bretschneideri]
Length=174

 Score =   166 bits (420),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 123/178 (69%), Gaps = 8/178 (4%)
 Frame = -2

Query  647  YAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRIIFV  468
            YA+AI+ GFLVLFST+LLASYICCR    R        +    N +P   GV LPRIIFV
Sbjct  1    YALAISLGFLVLFSTLLLASYICCRVSRHRHHHHHQPPQRQ--NPNPSPEGVILPRIIFV  58

Query  467  AEDDEENDGVSGQNVAL-GLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDS  291
            AEDD E         A+ GL  +VINSYPK  +SK +  P  +T     CSICLC+YKD+
Sbjct  59   AEDDNEQQQQDDDENAVVGLHPSVINSYPKFPFSKEASTPDSST-----CSICLCDYKDA  113

Query  290  EMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDGRR  117
            EMLRM+P+C+HYFH+ C+DAWL+L  SCPVCRNSPLPTPLSTPL EVVPLS Y   RR
Sbjct  114  EMLRMMPECRHYFHLLCLDAWLRLKGSCPVCRNSPLPTPLSTPLQEVVPLSQYPADRR  171



>gb|ABD28581.1| Zinc finger, RING-type [Medicago truncatula]
 gb|AES80320.2| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=179

 Score =   165 bits (418),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 123/186 (66%), Gaps = 15/186 (8%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
            FT +GLGY+IAI   FLVL +T++L+ Y+CCR           +             GV 
Sbjct  8    FTNLGLGYSIAITLAFLVLLATLILSFYLCCRKNNNPNNNLNNNTNTLNYT-----EGVI  62

Query  488  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  309
            +   IF+AE+DEEN         +GL+  +INSYP+  +S+ S       G +T CSICL
Sbjct  63   VRTDIFIAENDEEN-------AVVGLEDNMINSYPRFQFSRDSAT---VLGQNTTCSICL  112

Query  308  CEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYS  129
            CEYKDSEMLRM+P+C+HYFH+ C+D+WLKLN SCPVCRNSPLPTPLSTPL EVVPLS Y+
Sbjct  113  CEYKDSEMLRMMPECRHYFHLCCLDSWLKLNGSCPVCRNSPLPTPLSTPLQEVVPLSQYA  172

Query  128  DGRRRQ  111
              RRR+
Sbjct  173  ADRRRR  178



>emb|CDY27329.1| BnaC04g50760D [Brassica napus]
Length=212

 Score =   166 bits (420),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 127/194 (65%), Gaps = 19/194 (10%)
 Frame = -2

Query  686  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHP  507
            +S  ++ +T+G GY IAI  GFLVL S VLL+SYICCR    R              +  
Sbjct  20   DSNHSHLSTLGFGYTIAIGLGFLVLISIVLLSSYICCRDSRRRTTAVE--------TTEE  71

Query  506  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKR-----SGNPGGT  342
                V LPR+IFV+E+D  N+ +   +V +GLDQAVINSYPK  +S       S    G 
Sbjct  72   RGRSVNLPRVIFVSEED--NEDLEAGDVIVGLDQAVINSYPKFHFSNETSVASSDGFAGG  129

Query  341  TGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptp  174
             G DT CSICLC+YK++EMLRM+P+CKHYFH+ C+DAWLKLN SCPVCRN    +P  TP
Sbjct  130  GGGDTSCSICLCQYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPFPTPTSTP  189

Query  173  lstplSEVVPLSHY  132
            LSTPLSEVVPLS Y
Sbjct  190  LSTPLSEVVPLSLY  203



>ref|XP_006294928.1| hypothetical protein CARUB_v10023982mg, partial [Capsella rubella]
 gb|EOA27826.1| hypothetical protein CARUB_v10023982mg, partial [Capsella rubella]
Length=233

 Score =   164 bits (416),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 131/187 (70%), Gaps = 20/187 (11%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG-V  492
             TT+G GY+IAIA GFLVL STVLL+SYICCR    R              S  D  G V
Sbjct  50   LTTLGFGYSIAIALGFLVLLSTVLLSSYICCRDSRRRTTAV---------ESTGDRGGSV  100

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNP---GGTTGNDTLC  321
             LPRIIFVAE+D  ND  +G +V +GLDQAVINSYPK  +SK S      G  +G DT C
Sbjct  101  ILPRIIFVAEED--NDLEAG-DVVVGLDQAVINSYPKFHFSKESSAASLDGFGSGGDTTC  157

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstplSE  153
            SICLCEYK++EMLRM+P+CKHYFH+ C+DAWLKLN SCPVCRN    +P  TPLSTPLSE
Sbjct  158  SICLCEYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTSTPLSTPLSE  217

Query  152  VVPLSHY  132
            VVPLS Y
Sbjct  218  VVPLSQY  224



>gb|KFK37394.1| hypothetical protein AALP_AA4G251500 [Arabis alpina]
Length=215

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 111/194 (57%), Positives = 131/194 (68%), Gaps = 20/194 (10%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG--  495
             TT+G GY+IAI  GFLVL STVLL+SYICCR    R              S  D  G  
Sbjct  30   LTTLGFGYSIAITLGFLVLLSTVLLSSYICCRDSRRRTTAV---------ESTGDRGGGS  80

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG---TTGNDTL  324
            V LPRIIFVAE+D  N+ +   ++ +GLDQ VINSYPK  +SK +          G DT+
Sbjct  81   VVLPRIIFVAEED--NEDLEAGDLIIGLDQNVINSYPKFHFSKETSAASSDGFGGGGDTM  138

Query  323  CSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstplS  156
            CSICLCEYK++EMLRM+P+CKHYFH+ C+DAWLKLN SCPVCRN    +P  TPLSTPLS
Sbjct  139  CSICLCEYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTSTPLSTPLS  198

Query  155  EVVPLSHYSDGRRR  114
            EVVPLS Y+  RRR
Sbjct  199  EVVPLSQYAADRRR  212



>ref|XP_003624102.1| Ring finger protein [Medicago truncatula]
Length=298

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 129/198 (65%), Gaps = 15/198 (8%)
 Frame = -2

Query  686  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHP  507
            +S  + FT +GLGY+IAI   FLVL +T++L+ Y+CCR           +          
Sbjct  2    SSPHSFFTNLGLGYSIAITLAFLVLLATLILSFYLCCRKNNNPNNNLNNNTNTLNYT---  58

Query  506  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  327
               GV +   IF+AE+DEEN  V       GL+  +INSYP+  +S+ S       G +T
Sbjct  59   --EGVIVRTDIFIAENDEENAVV-------GLEDNMINSYPRFQFSRDSAT---VLGQNT  106

Query  326  LCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVV  147
             CSICLCEYKDSEMLRM+P+C+HYFH+ C+D+WLKLN SCPVCRNSPLPTPLSTPL EVV
Sbjct  107  TCSICLCEYKDSEMLRMMPECRHYFHLCCLDSWLKLNGSCPVCRNSPLPTPLSTPLQEVV  166

Query  146  PLSHYSDGRRRQ*LWIDF  93
            PLS Y+  RRR+ + + F
Sbjct  167  PLSQYAADRRRRRILVVF  184



>ref|XP_011622828.1| PREDICTED: RING-H2 finger protein ATL67 [Amborella trichopoda]
 gb|ERN04598.1| hypothetical protein AMTR_s00075p00134690 [Amborella trichopoda]
Length=178

 Score =   160 bits (406),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 130/185 (70%), Gaps = 26/185 (14%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDN--  498
            NF+++GLGY+IAIA G LVL ST+LLASYICCR                   S P  N  
Sbjct  13   NFSSLGLGYSIAIALGLLVLLSTILLASYICCRGR----------------RSPPPSNVE  56

Query  497  GVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCS  318
             + LPRIIFVAE +E+       +V +GLDQ +INSYPK  +SK       + GN+ +CS
Sbjct  57   TIVLPRIIFVAEGEEDE--GDEHSVVVGLDQNMINSYPKFAFSK------ASKGNEAMCS  108

Query  317  ICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            ICLCEYK+ EMLRM+PDC+H+FH+ CVDAWL+LNASCPVCR SPLPTPLSTPLSE+VPLS
Sbjct  109  ICLCEYKEGEMLRMMPDCRHFFHLCCVDAWLRLNASCPVCRTSPLPTPLSTPLSELVPLS  168

Query  137  HYSDG  123
            H+ D 
Sbjct  169  HFPDA  173



>ref|XP_010506614.1| PREDICTED: RING-H2 finger protein ATL67 [Camelina sativa]
Length=214

 Score =   161 bits (408),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 134/193 (69%), Gaps = 20/193 (10%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG-V  492
             TT+G GY+IAIA GFLVL STVLL+SYICCR    R              S  D  G V
Sbjct  31   LTTLGFGYSIAIALGFLVLLSTVLLSSYICCRDSRRRTTAV---------ESVGDRGGSV  81

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNP---GGTTGNDTLC  321
             LPRIIFVAE+D  ND  +G +V +GLDQAVINSYPK  YSK S      G  +G DT C
Sbjct  82   ILPRIIFVAEED--NDLEAG-DVVVGLDQAVINSYPKFHYSKDSSAASSDGFGSGGDTTC  138

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstplSE  153
            SICLCEYK++EMLRM+P+CKHYFH+ C+DAWLKLN SCPVCRN    +P  TPLSTPLSE
Sbjct  139  SICLCEYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTSTPLSTPLSE  198

Query  152  VVPLSHYSDGRRR  114
            +VPLS Y+  R R
Sbjct  199  IVPLSQYAADRMR  211



>ref|XP_006397800.1| hypothetical protein EUTSA_v10001804mg [Eutrema salsugineum]
 gb|ESQ39253.1| hypothetical protein EUTSA_v10001804mg [Eutrema salsugineum]
Length=214

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 128/188 (68%), Gaps = 17/188 (9%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            T  TT+G GY+IAIA GFLVL STVLL+SYICCR    R             ++      
Sbjct  28   TYLTTLGFGYSIAIALGFLVLLSTVLLSSYICCRDSRRRTTAVE--------STGERGGS  79

Query  494  VYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG---TTGNDTL  324
            V LPRIIFVAE+D  N+ +   +V +GLDQAVINSYPK  +SK +          G DT 
Sbjct  80   VILPRIIFVAEED--NEDLEAGDVIVGLDQAVINSYPKFHFSKETSAASSDGFGGGGDTT  137

Query  323  CSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstplS  156
            CSICLCEY+++EMLRM+P+CKHYFH+ C+DAWLKLN SCPVCRN    +P  TPLSTPLS
Sbjct  138  CSICLCEYREAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTSTPLSTPLS  197

Query  155  EVVPLSHY  132
            EVVPLS Y
Sbjct  198  EVVPLSQY  205



>ref|NP_182139.1| RING-H2 finger protein ATL67 [Arabidopsis thaliana]
 sp|O82353.1|ATL67_ARATH RecName: Full=RING-H2 finger protein ATL67 [Arabidopsis thaliana]
 gb|AAC62890.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAL69457.1| At2g46160/T3F17.19 [Arabidopsis thaliana]
 gb|AEC10650.1| RING-H2 finger protein ATL67 [Arabidopsis thaliana]
Length=214

 Score =   161 bits (407),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 128/187 (68%), Gaps = 19/187 (10%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG-V  492
             TT+G GY+IAIA GFLVL STVLL+SYICCR    R              S  D  G V
Sbjct  30   LTTLGFGYSIAIALGFLVLLSTVLLSSYICCRDSRRRTTAV---------ESTGDRGGSV  80

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG---TTGNDTLC  321
             LPRIIFVAE+D  N+ +   +V +GLDQAVINSYPK  +SK +          G DT C
Sbjct  81   ILPRIIFVAEED--NEDLEAGDVVVGLDQAVINSYPKFHFSKDTSAASSDGFGGGGDTTC  138

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstplSE  153
            SICLCEYK++EMLRM+P+CKHYFH+ C+DAWLKLN SCPVCRN    +P  TPLSTPLSE
Sbjct  139  SICLCEYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTSTPLSTPLSE  198

Query  152  VVPLSHY  132
            VVPLS Y
Sbjct  199  VVPLSQY  205



>ref|XP_008375945.1| PREDICTED: uncharacterized protein LOC103439174 [Malus domestica]
Length=672

 Score =   169 bits (428),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 131/188 (70%), Gaps = 13/188 (7%)
 Frame = -2

Query  677  PTNF-TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDD  501
            PTN+ TT+GLGY IAI+ GFLVLFST+LLASY+CCR    R  + R              
Sbjct  11   PTNYLTTLGLGYGIAISLGFLVLFSTLLLASYLCCRVSRHRPPQPRNPNPNPNPE-----  65

Query  500  NGVYLPRIIFVAEDDEENDGVSGQNVAL-GLDQAVINSYPKLVYSKRSGNPGGTTGNDTL  324
             GV LPRIIFV+EDD + +       A+ GL  +VINSYPK  +SK +  P  +T     
Sbjct  66   -GVILPRIIFVSEDDNDQEQQDDDENAVVGLHPSVINSYPKFPFSKEAATPDSST-----  119

Query  323  CSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVP  144
            CSICLC+YKD+EMLRM+P+C+HYFH+ C+DAWL+LN SCPVCRNSPLPTPLSTPL EVVP
Sbjct  120  CSICLCDYKDAEMLRMMPECRHYFHLLCLDAWLRLNGSCPVCRNSPLPTPLSTPLQEVVP  179

Query  143  LSHYSDGR  120
            LS Y   R
Sbjct  180  LSQYPADR  187



>emb|CDY42011.1| BnaC04g00890D [Brassica napus]
Length=208

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 126/186 (68%), Gaps = 23/186 (12%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
             TT+G GY+IAIA GFLVL STVLL+SYICCR    R       +             V 
Sbjct  30   LTTLGFGYSIAIALGFLVLLSTVLLSSYICCRDSRRRTTAVESTSA-----------SVI  78

Query  488  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSG---NPGGTTGNDTLCS  318
            LPR+IFVAE+D E       +V +GLDQAVINSYPK  +SK +    + G  +G DT CS
Sbjct  79   LPRVIFVAEEDLE-----AGDVNVGLDQAVINSYPKFHFSKETSAASSDGFGSGGDTTCS  133

Query  317  ICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstplSEV  150
            ICLCEY+++EMLRM+P+CKHYFH+ C+DAWLKLN SCPVCRN    +P  TP STPLSEV
Sbjct  134  ICLCEYREAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTSTPQSTPLSEV  193

Query  149  VPLSHY  132
            VPLS Y
Sbjct  194  VPLSQY  199



>ref|XP_009142683.1| PREDICTED: RING-H2 finger protein ATL67 [Brassica rapa]
Length=208

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 126/186 (68%), Gaps = 23/186 (12%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
             TT+G GY+IAIA GFLVL STVLL+SYICCR    R       +             V 
Sbjct  30   LTTLGFGYSIAIALGFLVLLSTVLLSSYICCRGSRRRTTAVESTSA-----------SVI  78

Query  488  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSG---NPGGTTGNDTLCS  318
            LPR+IFVAE+D E       +V +GLDQAVINSYPK  +SK +    + G  +G DT CS
Sbjct  79   LPRVIFVAEEDLE-----AGDVNVGLDQAVINSYPKFHFSKETSAASSDGFGSGGDTTCS  133

Query  317  ICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstplSEV  150
            ICLCEY+++EMLRM+P+CKHYFH+ C+DAWLKLN SCPVCRN    +P  TP STPLSEV
Sbjct  134  ICLCEYREAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTSTPQSTPLSEV  193

Query  149  VPLSHY  132
            VPLS Y
Sbjct  194  VPLSQY  199



>emb|CDX79992.1| BnaA05g01640D [Brassica napus]
Length=208

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/186 (57%), Positives = 126/186 (68%), Gaps = 23/186 (12%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
             TT+G GY+IAIA GFLVL STVLL+SYICCR    R       +             V 
Sbjct  30   LTTLGFGYSIAIALGFLVLLSTVLLSSYICCRDSRRRTTAVESTSA-----------SVI  78

Query  488  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSG---NPGGTTGNDTLCS  318
            LPR+IFVAE+D E       +V +GLDQAVINSYPK  +SK +    + G  +G DT CS
Sbjct  79   LPRVIFVAEEDLE-----AGDVNVGLDQAVINSYPKFHFSKETSAASSDGLGSGGDTTCS  133

Query  317  ICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstplSEV  150
            ICLCEY+++EMLRM+P+CKHYFH+ C+DAWLKLN SCPVCRN    +P  TP STPLSEV
Sbjct  134  ICLCEYREAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTSTPQSTPLSEV  193

Query  149  VPLSHY  132
            VPLS Y
Sbjct  194  VPLSQY  199



>gb|KJB49432.1| hypothetical protein B456_008G119400 [Gossypium raimondii]
Length=199

 Score =   157 bits (398),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 140/197 (71%), Gaps = 8/197 (4%)
 Frame = -2

Query  689  PNSAPTNFTT-IGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNS  513
            P S+PT  TT +G+GYAI +A GFL+L ST+LLASYIC RS +    R           +
Sbjct  5    PLSSPTYLTTNLGVGYAIVVALGFLLLLSTLLLASYICFRSSSPLPPRAISPNPISTPTA  64

Query  512  HPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPG----G  345
              + NG+ LPRI+F+ E+D E+D      V  GLD+AVINSYPK  +SK   +      G
Sbjct  65   A-NSNGIVLPRIVFIGEEDHEHD--EENVVVFGLDRAVINSYPKFRFSKEEVSTAVEVTG  121

Query  344  TTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplst  165
            ++  +T+CSICLCEY++SEMLRM+P+C+H FHVTC+DAWLKLN SCPVCRNSPLPTP+ST
Sbjct  122  SSARNTICSICLCEYRESEMLRMMPECRHCFHVTCIDAWLKLNGSCPVCRNSPLPTPIST  181

Query  164  plSEVVPLSHYSDGRRR  114
            PLSEVVPLS Y   RRR
Sbjct  182  PLSEVVPLSQYDADRRR  198



>ref|XP_011468973.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101302880 
[Fragaria vesca subsp. vesca]
Length=689

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 110/188 (59%), Positives = 132/188 (70%), Gaps = 15/188 (8%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
             TT+GLGYAIAIA GFLVL ST+LLASYICCR     + + R   +    N +    GV 
Sbjct  13   LTTLGLGYAIAIALGFLVLLSTLLLASYICCRVSRRSQTQTRTRTQ----NPNSSSEGVI  68

Query  488  LPRIIFVAEDDE----ENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  321
            LPRIIFVAEDD+    +ND     N A GL   VINSYPK  +SK  G      G+ + C
Sbjct  69   LPRIIFVAEDDDLENPQND--DDNNSAAGLHHNVINSYPKFPFSKELGG-----GDASTC  121

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPL  141
            SICLC+Y++ EMLRM+P+C+H+FH+ C+DAWLKLN SCPVCRNSPLPTPLSTPL EVVPL
Sbjct  122  SICLCDYREFEMLRMMPECRHHFHLLCLDAWLKLNGSCPVCRNSPLPTPLSTPLQEVVPL  181

Query  140  SHYSDGRR  117
            S ++  RR
Sbjct  182  SQHAADRR  189



>ref|XP_003534530.1| PREDICTED: RING-H2 finger protein ATL67-like [Glycine max]
 gb|KHN29298.1| RING-H2 finger protein ATL68 [Glycine soja]
Length=184

 Score =   156 bits (395),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 134/186 (72%), Gaps = 15/186 (8%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            +F  +GLGY+IAIA  FL L ST+LL+SY+CCR    R R     A +        D G+
Sbjct  12   HFPHLGLGYSIAIALAFLFLLSTLLLSSYLCCRHNRRRLRHTTAAATS--------DGGI  63

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  312
             LPR+IFVAED++E DG    +VA+G DQ+VINSYP+  +++   N       +T CSIC
Sbjct  64   VLPRVIFVAEDEDE-DG----SVAVGFDQSVINSYPRFQFNR--DNARNNNIINTTCSIC  116

Query  311  LCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHY  132
            LCEYKDSEMLRM+P+C+HYFH+ C+D+WLKLN SCPVCRNSPLPTPLSTPL EVVPLS Y
Sbjct  117  LCEYKDSEMLRMMPECRHYFHLCCLDSWLKLNGSCPVCRNSPLPTPLSTPLQEVVPLSQY  176

Query  131  SDGRRR  114
            +  RRR
Sbjct  177  AADRRR  182



>ref|XP_010508059.1| PREDICTED: RING-H2 finger protein ATL67-like [Camelina sativa]
Length=214

 Score =   157 bits (396),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 131/193 (68%), Gaps = 20/193 (10%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG-V  492
             TT+G GY+IAIA GFLVL STVLL+SYICCR    R              S  D  G V
Sbjct  31   LTTLGFGYSIAIALGFLVLLSTVLLSSYICCRDSRRRTTAV---------ESVGDRGGSV  81

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGN---DTLC  321
             LPRIIFVAE+D  ND  +G +V +GLDQAVINSYPK  YSK S            DT C
Sbjct  82   ILPRIIFVAEED--NDLEAG-DVVVGLDQAVINSYPKFHYSKDSSAASSDGFGGGGDTTC  138

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstplSE  153
            SICLCEYK++EMLRM+P+CKHYFH+ C+DAWLKLN SCPVCRN    +P  TPLSTPLSE
Sbjct  139  SICLCEYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTSTPLSTPLSE  198

Query  152  VVPLSHYSDGRRR  114
            VVPLS Y+  R R
Sbjct  199  VVPLSQYAADRMR  211



>ref|XP_007139765.1| hypothetical protein PHAVU_008G057200g [Phaseolus vulgaris]
 gb|ESW11759.1| hypothetical protein PHAVU_008G057200g [Phaseolus vulgaris]
Length=186

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 112/194 (58%), Positives = 144/194 (74%), Gaps = 10/194 (5%)
 Frame = -2

Query  695  VKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRN  516
            + P+    +FT +GLGY+IAIA  FL L ST+LL+SY+CCR+   R +   +   A    
Sbjct  1    MSPSIPSPHFTHLGLGYSIAIALAFLFLLSTLLLSSYLCCRATRHRNQTTAVATAA----  56

Query  515  SHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTG  336
            ++P D GV LPR+IFVAEDDEE++  S   VALGLDQ+VINSYP+  + +  G+   + G
Sbjct  57   ANPSD-GVVLPRVIFVAEDDEEDEEAS---VALGLDQSVINSYPRFQFDR--GSARNSNG  110

Query  335  NDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplS  156
            N+  CSICLCEYKDSEMLRM+P+C+H+FH+ C+D+WL+L  SCPVCRNSPLPTPLSTPL 
Sbjct  111  NNNTCSICLCEYKDSEMLRMMPECRHFFHLCCLDSWLRLRGSCPVCRNSPLPTPLSTPLQ  170

Query  155  EVVPLSHYSDGRRR  114
            EVVPLS Y+  RRR
Sbjct  171  EVVPLSQYAADRRR  184



>ref|XP_002880221.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56480.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=214

 Score =   154 bits (388),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 127/187 (68%), Gaps = 19/187 (10%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG-V  492
             TT+G GY+IAIA GFLVL STVLL+SYICCR    R              S  D  G V
Sbjct  30   LTTLGFGYSIAIALGFLVLLSTVLLSSYICCRDSRRRTTAV---------ESAGDHGGSV  80

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGN---DTLC  321
             LPRIIFVAE+D  N+ +   +V +GLDQAVINSYPK  +SK S            DT C
Sbjct  81   ILPRIIFVAEED--NEDLEAGDVVVGLDQAVINSYPKFHFSKDSSAASSDGFGGGGDTTC  138

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstplSE  153
            SICLCEYK++EMLRM+P+CKHYFH+ C+DAWLKLN SCPVCRN    +P  TPLSTPLSE
Sbjct  139  SICLCEYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTSTPLSTPLSE  198

Query  152  VVPLSHY  132
            VVPLS Y
Sbjct  199  VVPLSQY  205



>ref|XP_010916932.1| PREDICTED: RING-H2 finger protein ATL67-like [Elaeis guineensis]
Length=210

 Score =   153 bits (387),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 106/195 (54%), Positives = 132/195 (68%), Gaps = 20/195 (10%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            N + +GLGYAIAIA G LVL STVLLASY+CCR+ +            G  ++      V
Sbjct  28   NLSNLGLGYAIAIALGVLVLLSTVLLASYVCCRARSRNTNPNPNGGGTGGNSNG-----V  82

Query  491  YLPRIIFVAEDD--EENDGVSGQ--NVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTL  324
             LPRIIFVAEDD  E+N+G  G   +   GLD A I+SYP+  +S          G DT+
Sbjct  83   VLPRIIFVAEDDNDEDNNGEEGGRGSAPTGLDPAAISSYPRFPFS-------AAKGGDTV  135

Query  323  CSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNspl----ptplstplS  156
            CSICL EY++ EMLRM+PDC+HYFH+ C+D WL+LNASCPVCRNSP+     TPLSTPLS
Sbjct  136  CSICLGEYREGEMLRMMPDCRHYFHLPCIDEWLRLNASCPVCRNSPMPTPVSTPLSTPLS  195

Query  155  EVVPLSHYSDGRRRQ  111
            E+VPLSH++  RRR+
Sbjct  196  ELVPLSHFAADRRRR  210



>ref|XP_010518279.1| PREDICTED: RING-H2 finger protein ATL67-like [Camelina sativa]
 ref|XP_010518280.1| PREDICTED: RING-H2 finger protein ATL67-like [Camelina sativa]
 ref|XP_010518281.1| PREDICTED: RING-H2 finger protein ATL67-like [Camelina sativa]
Length=214

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 114/193 (59%), Positives = 129/193 (67%), Gaps = 20/193 (10%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG-V  492
             T +G GY+IAIA GFLVL STVLL+SYICCR    R              S  D  G V
Sbjct  31   LTNLGFGYSIAIALGFLVLLSTVLLSSYICCRDSRRRTTAV---------ESVGDRGGSV  81

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGN---DTLC  321
             LPRIIFVAE+D  ND  +G +V +G DQAVINSYPK  YSK S            DT C
Sbjct  82   ILPRIIFVAEED--NDLEAG-DVVVGFDQAVINSYPKFHYSKDSSAASSDGFGGGGDTTC  138

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstplSE  153
            SICLCEYK++EMLRM+P+CKHYFH+ C+DAWLKLN SCPVCRN    +P  TPLSTPLSE
Sbjct  139  SICLCEYKEAEMLRMMPECKHYFHLCCLDAWLKLNGSCPVCRNSPLPTPTSTPLSTPLSE  198

Query  152  VVPLSHYSDGRRR  114
            VVPLS Y+  R R
Sbjct  199  VVPLSQYAADRMR  211



>ref|XP_010092874.1| RING-H2 finger protein ATL68 [Morus notabilis]
 gb|EXB52692.1| RING-H2 finger protein ATL68 [Morus notabilis]
Length=207

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 106/189 (56%), Positives = 130/189 (69%), Gaps = 10/189 (5%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
            FT +GLGY IAIA GFLVL S +LLASYICCR+  A          +   N +P+ +G+ 
Sbjct  23   FTNLGLGYPIAIALGFLVLLSILLLASYICCRASRASYHSSSSSVPSNL-NPNPNHDGII  81

Query  488  LPRIIFVAEDDEENDGVS----GQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  321
            LPRIIFVAED++++             +GL Q+VINSYPK  Y +      G    ++ C
Sbjct  82   LPRIIFVAEDEDDDADGRRGDLDDGAVVGLHQSVINSYPKFPYER-----DGAGIKESTC  136

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPL  141
            SICLCEYK SEMLRM+P+C+H FH+ C+DAWLKLN SCPVCRNSPLPTPLSTPL EVVPL
Sbjct  137  SICLCEYKASEMLRMMPECRHCFHLCCLDAWLKLNGSCPVCRNSPLPTPLSTPLQEVVPL  196

Query  140  SHYSDGRRR  114
            S ++  RRR
Sbjct  197  SQFAADRRR  205



>ref|XP_010054857.1| PREDICTED: uncharacterized protein LOC104443218 [Eucalyptus grandis]
Length=699

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 104/130 (80%), Gaps = 5/130 (4%)
 Frame = -2

Query  500  NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  321
            +G+ LPRIIFVAEDD E      Q  A+GLD +VINSYPK  +S+ +G  GG+T     C
Sbjct  75   DGIILPRIIFVAEDDNEGSEAE-QGAAVGLDPSVINSYPKFAFSREAGGVGGST----TC  129

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPL  141
            SICLCEYKD+EMLRM+P+C+H+FH+ C+DAWLKLN SCPVCRNSPLPTPLSTPLSEVVPL
Sbjct  130  SICLCEYKDAEMLRMMPECRHFFHLLCLDAWLKLNGSCPVCRNSPLPTPLSTPLSEVVPL  189

Query  140  SHYSDGRRRQ  111
            S Y + RRR+
Sbjct  190  SQYGEDRRRR  199



>ref|XP_009381057.1| PREDICTED: RING-H2 finger protein ATL67-like [Musa acuminata 
subsp. malaccensis]
Length=188

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 130/196 (66%), Gaps = 21/196 (11%)
 Frame = -2

Query  686  NSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHP  507
             S+ ++FTT+ L  AIA++ G LVL S +L+ASY+CCR  +           +       
Sbjct  9    GSSSSHFTTLSLPLAIAVSLGLLVLLSALLVASYVCCRRQSRDPDPDPGPGPSPAIA---  65

Query  506  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  327
              +G+ LPRIIFVAEDDE + G      A GLDQA I+SYPK  +S  SG        DT
Sbjct  66   --DGIVLPRIIFVAEDDEGDGGR-----ASGLDQAAISSYPKFPFSVASGG-------DT  111

Query  326  LCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstpl  159
            +CSICLCEY++ EMLRM+PDC+HYFH+ C+D WL+LNASCPVCR     +P+ TP+STPL
Sbjct  112  VCSICLCEYREGEMLRMIPDCRHYFHLLCIDVWLRLNASCPVCRTSPLPTPVSTPISTPL  171

Query  158  SEVVPLSHYSDGRRRQ  111
            SE+VPLS ++  RRR+
Sbjct  172  SELVPLSLFAADRRRR  187



>ref|XP_004133841.1| PREDICTED: RING-H2 finger protein ATL67 [Cucumis sativus]
 gb|KGN56477.1| hypothetical protein Csa_3G121045 [Cucumis sativus]
Length=184

 Score =   143 bits (360),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 128/183 (70%), Gaps = 11/183 (6%)
 Frame = -2

Query  659  IGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPR  480
            IGLGY+IAIA  FLVL S +LLA Y+CCR+  +R  RR     +        D G+ LP+
Sbjct  13   IGLGYSIAIALAFLVLLSALLLAFYVCCRASRSRHLRRPPPPSSRS------DAGIILPQ  66

Query  479  IIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEY  300
            IIFVAEDD   D      V +GLDQ VINSYPK  +S+         G + +CSICLCEY
Sbjct  67   IIFVAEDDAAPDRDDDNGV-VGLDQTVINSYPKFPFSRDKS----MAGANCVCSICLCEY  121

Query  299  KDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDGR  120
            KD+EMLRM+P+C+HYFH+ C+DAWLKLN SCPVCRNSPLPTPLSTPL EVVPLS Y   R
Sbjct  122  KDAEMLRMMPECRHYFHLCCIDAWLKLNGSCPVCRNSPLPTPLSTPLQEVVPLSQYMADR  181

Query  119  RRQ  111
            RR+
Sbjct  182  RRR  184



>ref|XP_008437981.1| PREDICTED: RING-H2 finger protein ATL67 [Cucumis melo]
Length=184

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 129/183 (70%), Gaps = 11/183 (6%)
 Frame = -2

Query  659  IGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPR  480
            IGLGY+IAIA  FLVL S +LLA Y+CCR+  +R  RR     +        + G+ LP+
Sbjct  13   IGLGYSIAIALAFLVLLSALLLAFYVCCRASRSRHLRRPPPPPSR------SETGIILPQ  66

Query  479  IIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEY  300
            IIFVAEDD   D      V +GLDQ+VINSYPK  +S+         G + +CSICLCEY
Sbjct  67   IIFVAEDDAAPDRDDDNGV-VGLDQSVINSYPKFPFSRDKS----MAGANCVCSICLCEY  121

Query  299  KDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDGR  120
            KD+EMLRM+P+C+HYFH+ C+DAWLKLN SCPVCRNSPLPTPLSTPL EVVPLS Y   R
Sbjct  122  KDAEMLRMMPECRHYFHLCCIDAWLKLNGSCPVCRNSPLPTPLSTPLQEVVPLSQYMADR  181

Query  119  RRQ  111
            RR+
Sbjct  182  RRR  184



>ref|XP_003552426.1| PREDICTED: RING-H2 finger protein ATL67-like [Glycine max]
Length=179

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 132/186 (71%), Gaps = 13/186 (7%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            +F  +GLGY+IAIA  FL L ST+LL+SY+CCR    R  +          ++   D G+
Sbjct  5    HFPHLGLGYSIAIALAFLFLLSTLLLSSYLCCRHNRRRHTQTTA-------SAAASDGGI  57

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  312
             LPR+IFVAEDD+E+       + +GLDQ+VINSYP+  ++K S         +T CSIC
Sbjct  58   VLPRVIFVAEDDDEDADAC---MVVGLDQSVINSYPRFQFNKDSD---ARNIINTTCSIC  111

Query  311  LCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHY  132
            LCEYKDSEMLRM+P+C+HYFH+ C+D+WLKLN SCPVCRNSPLPTPLSTPL EVVPLS Y
Sbjct  112  LCEYKDSEMLRMMPECRHYFHLCCLDSWLKLNGSCPVCRNSPLPTPLSTPLQEVVPLSQY  171

Query  131  SDGRRR  114
            +  RRR
Sbjct  172  AADRRR  177



>ref|XP_009409038.1| PREDICTED: RING-H2 finger protein ATL67 [Musa acuminata subsp. 
malaccensis]
Length=188

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 111/182 (61%), Gaps = 24/182 (13%)
 Frame = -2

Query  644  AIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRIIFVA  465
            AIA++ G L   S +L+ SYICCR              A          GV    IIFVA
Sbjct  26   AIAVSLGLL---SALLVVSYICCRRRPQNPGSAPGPIPA---------EGVLQRHIIFVA  73

Query  464  EDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEM  285
            EDD+  D   G   A GLDQA I+SYPK  +S          G DT+CSICLCEY++ EM
Sbjct  74   EDDDGEDS-EGGGRASGLDQAAISSYPKFPFS-------AAKGGDTVCSICLCEYREGEM  125

Query  284  LRMLPDCKHYFHVTCVDAWLKLNASCPVCRNs----plptplstplSEVVPLSHYSDGRR  117
            LRM+PDC HYFH+ C+D WL+LNASCPVCR S    P+ TP+STPLSE+VPLS ++  RR
Sbjct  126  LRMMPDCHHYFHLLCIDVWLRLNASCPVCRTSPLPTPVSTPISTPLSELVPLSQFAADRR  185

Query  116  RQ  111
            R+
Sbjct  186  RR  187



>gb|AFW57001.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=208

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 124/207 (60%), Gaps = 22/207 (11%)
 Frame = -2

Query  698  TVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyR  519
            +V   +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA   
Sbjct  12   SVSSMTARRQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTT  66

Query  518  NSHPDDNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRS  360
             S      + +PR++FVAE  E  E+D       +     +GLD A I SYPK+ +S R+
Sbjct  67   ASSSGHLSITVPRVLFVAEGSESPEDDAYPSSSAAAACSPVGLDAAAIASYPKVAFSSRA  126

Query  359  GNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNspl-  183
                     + +CSICL EY+D E LR++P+C+H FHV C+DAWL  +ASCPVCR+SP+ 
Sbjct  127  AE------ANAMCSICLSEYRDGETLRVMPECRHGFHVACLDAWLSRSASCPVCRSSPVP  180

Query  182  ---ptplstplSEVVPLSHYSDGRRRQ  111
                TPL+TPLSE+VPLS Y+  RRR+
Sbjct  181  TPNATPLATPLSELVPLSQYAADRRRR  207



>ref|XP_008663969.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
Length=193

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 122/202 (60%), Gaps = 22/202 (11%)
 Frame = -2

Query  683  SAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPD  504
            +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA    S   
Sbjct  2    TARRQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTTASSSG  56

Query  503  DNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRSGNPGG  345
               + +PR++FVAE  E  E+D       +     +GLD A I SYPK+ +S R+     
Sbjct  57   HLSITVPRVLFVAEGSESPEDDAYPSSSAAAACSPVGLDAAAIASYPKVAFSSRAAE---  113

Query  344  TTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNspl----pt  177
                + +CSICL EY+D E LR++P+C+H FHV C+DAWL  +ASCPVCR+SP+     T
Sbjct  114  ---ANAMCSICLSEYRDGETLRVMPECRHGFHVACLDAWLSRSASCPVCRSSPVPTPNAT  170

Query  176  plstplSEVVPLSHYSDGRRRQ  111
            PL+TPLSE+VPLS Y+  RRR+
Sbjct  171  PLATPLSELVPLSQYAADRRRR  192



>gb|AFW57002.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=273

 Score =   139 bits (351),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 88/207 (43%), Positives = 122/207 (59%), Gaps = 22/207 (11%)
 Frame = -2

Query  698  TVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyR  519
            +V   +A    + +GLGY+IAIA GFL+LF++ LLA Y C            +       
Sbjct  12   SVSSMTARRQLSNLGLGYSIAIALGFLILFASFLLAFYFCFGRGGDYWAGEAVTTA----  67

Query  518  NSHPDDNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRS  360
             S      + +PR++FVAE  E  E+D       +     +GLD A I SYPK+ +S R+
Sbjct  68   -SSSGHLSITVPRVLFVAEGSESPEDDAYPSSSAAAACSPVGLDAAAIASYPKVAFSSRA  126

Query  359  GNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNspl-  183
                     + +CSICL EY+D E LR++P+C+H FHV C+DAWL  +ASCPVCR+SP+ 
Sbjct  127  AE------ANAMCSICLSEYRDGETLRVMPECRHGFHVACLDAWLSRSASCPVCRSSPVP  180

Query  182  ---ptplstplSEVVPLSHYSDGRRRQ  111
                TPL+TPLSE+VPLS Y+  RRR+
Sbjct  181  TPNATPLATPLSELVPLSQYAADRRRR  207



>ref|NP_001147253.1| RING-H2 finger protein ATL2M [Zea mays]
 gb|ACG26390.1| RING-H2 finger protein ATL2M [Zea mays]
 gb|ACN27082.1| unknown [Zea mays]
 gb|AFW78795.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=206

 Score =   135 bits (340),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 125/201 (62%), Gaps = 19/201 (9%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDN---  498
              ++GLGYAIAIAFGFLVL ++VLLASY C R  AA +              H   +   
Sbjct  7    LASLGLGYAIAIAFGFLVLLASVLLASYFCLRRGAASQGFGTGAGVGVGSTRHAASSASS  66

Query  497  ----GVYLPRIIFVAED----DEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGT  342
                 + +PR++FVAED       + G +     +GLD +VI SYP + +SK     G  
Sbjct  67   SGHISITVPRVVFVAEDYDSPGSSSRGPAAAASPVGLDASVIASYPMVPFSKA----GAG  122

Query  341  TGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNs----plptp  174
               +  CSICLCEYK+ EMLR++P+C+H FH+TC+DAWL+ +ASCPVCR+S    P+ TP
Sbjct  123  ADTEVACSICLCEYKEGEMLRVMPECRHRFHLTCLDAWLRRSASCPVCRSSPIPTPVATP  182

Query  173  lstplSEVVPLSHYSDGRRRQ  111
            LSTPLSE+VPLS Y+  RRR 
Sbjct  183  LSTPLSELVPLSQYAADRRRS  203



>gb|EAY75741.1| hypothetical protein OsI_03653 [Oryza sativa Indica Group]
Length=197

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 122/193 (63%), Gaps = 17/193 (9%)
 Frame = -2

Query  665  TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYL  486
             T+GLGY+IAIA GFLVL +++LLASY C R          +   +   +       + +
Sbjct  13   ATLGLGYSIAIALGFLVLLASLLLASYFCFRRGGGGGHFSGVLTPSSSSS----HLSITV  68

Query  485  PRIIFVAEDDEEND----GVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCS  318
            PR++FVAE  E  D    GV+  +  +GLD A I SYPK+ +       G  +  D +CS
Sbjct  69   PRVLFVAEGSESPDAYSSGVAAASSPVGLDPAAIASYPKVPFYS-----GAGSDADAMCS  123

Query  317  ICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNs----plptplstplSEV  150
            ICL EY D EMLR++PDC+H FHV+C+DAWL+ NASCPVCR+S    P+ TPL+TPLSE+
Sbjct  124  ICLSEYADGEMLRVMPDCRHRFHVSCLDAWLRRNASCPVCRSSPIPTPVATPLATPLSEL  183

Query  149  VPLSHYSDGRRRQ  111
            VPLS Y+  RRR 
Sbjct  184  VPLSQYAADRRRS  196



>ref|XP_008810939.1| PREDICTED: RING-H2 finger protein ATL67-like [Phoenix dactylifera]
Length=222

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 131/200 (66%), Gaps = 25/200 (13%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            N + +GLGYAIAIA G LVL STVLLASY+CCR+ A           AG  ++      V
Sbjct  35   NLSNLGLGYAIAIALGVLVLLSTVLLASYVCCRARARSTNPNPNGGGAGGNSNG-----V  89

Query  491  YLPRIIFVAEDDEENDGVSGQ---------NVALGLDQAVINSYPKLVYSKRSGNPGGTT  339
             LPRIIFVAE++EE+D  +           +   GLD A I+SYP+  +S          
Sbjct  90   VLPRIIFVAEEEEEDDEDNNGEEGGRGGRGSAPTGLDPAAISSYPRFPFS-------AAK  142

Query  338  GNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNspl----ptpl  171
            G + +CSICL EY++ EMLRM+PDC+HYFH+ C+D WL+LNASCPVCRNSP+     TPL
Sbjct  143  GGEAVCSICLGEYREGEMLRMMPDCRHYFHLPCIDEWLRLNASCPVCRNSPMPTPVSTPL  202

Query  170  stplSEVVPLSHYSDGRRRQ  111
            STPLSE+VPLSH++  RRR+
Sbjct  203  STPLSELVPLSHFAADRRRR  222



>ref|XP_008650149.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
Length=246

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 102/176 (58%), Gaps = 18/176 (10%)
 Frame = -2

Query  698  TVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyR  519
            +V   +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA   
Sbjct  67   SVSSTTARPQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTT  121

Query  518  NSHPDDNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRS  360
             S      + +PR++FVAE  E  E+D       +     +GLD A I SYPK+V+S ++
Sbjct  122  ASSSGHLSITVPRVLFVAEGSESPEDDAYPSSSAAAACSPVGLDAAAIASYPKVVFSSKA  181

Query  359  GNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
                     D +CSICL EY+D E LR++P+C+H FHV C+DAWL  +ASCPVCR+
Sbjct  182  AE------ADAMCSICLSEYRDGETLRVMPECRHGFHVACLDAWLSRSASCPVCRS  231



>ref|NP_001044176.2| Os01g0736600 [Oryza sativa Japonica Group]
 dbj|BAD87014.1| RING zinc finger protein-like [Oryza sativa Japonica Group]
 gb|EAZ13459.1| hypothetical protein OsJ_03375 [Oryza sativa Japonica Group]
 dbj|BAG94186.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97131.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF06090.2| Os01g0736600 [Oryza sativa Japonica Group]
Length=197

 Score =   132 bits (332),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 120/193 (62%), Gaps = 17/193 (9%)
 Frame = -2

Query  665  TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYL  486
             T+GLGY+IAIA GFLVL +++LLASY C      R       +     +S      + +
Sbjct  13   ATLGLGYSIAIALGFLVLLASLLLASYFC----FRRGGGGGHFSGVLTPSSSSSHLSITV  68

Query  485  PRIIFVAEDDEEND----GVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCS  318
            PR++FVAE  E  D    GV+  +  +GLD A I SYPK+ +       G     D +CS
Sbjct  69   PRVLFVAEGSESPDAYSSGVAAASSPVGLDPAAIASYPKVPFYS-----GAGADADAMCS  123

Query  317  ICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNs----plptplstplSEV  150
            ICL EY D EMLR++PDC+H FHV C+DAWL+ NASCPVCR+S    P+ TPL+TPLSE+
Sbjct  124  ICLSEYADGEMLRVMPDCRHRFHVCCLDAWLRRNASCPVCRSSPIPTPVATPLATPLSEL  183

Query  149  VPLSHYSDGRRRQ  111
            VPLS Y+  RRR 
Sbjct  184  VPLSQYAADRRRS  196



>ref|XP_008671136.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
 ref|XP_008660621.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
Length=191

 Score =   132 bits (332),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 101/176 (57%), Gaps = 18/176 (10%)
 Frame = -2

Query  698  TVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyR  519
            +V   +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA   
Sbjct  12   SVSSTTARPQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTT  66

Query  518  NSHPDDNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRS  360
             S      + +PR++FVAE  E  E+D       +     +GLD A I SYPK+ +S ++
Sbjct  67   ASSSGHLSITVPRVLFVAEGSESPEDDAYPSSSAAAACSPVGLDAAAIASYPKVAFSSKA  126

Query  359  GNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
                     D +CSICL EY+D E LR++P+C+H FHV C+DAWL  +ASCPVCR+
Sbjct  127  AE------ADAMCSICLSEYRDGETLRVMPECRHGFHVACLDAWLSRSASCPVCRS  176



>gb|EMS59911.1| RING-H2 finger protein ATL68 [Triticum urartu]
Length=282

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 92/196 (47%), Positives = 122/196 (62%), Gaps = 18/196 (9%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            ++  T+GLGY+IAIA GFLVL ++VLLASY C R                  +SH     
Sbjct  8    SSLATLGLGYSIAIALGFLVLLASVLLASYFCFRHGEGAGGHFAGAITPTSSSSH---LS  64

Query  494  VYLPRIIFVAEDDEENDGVSGQNVA----LGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  327
            + +PR++FVAE  E  +  S    A    +GLD A I SYPK ++S+         G D 
Sbjct  65   ITVPRVLFVAEGSESPEAYSSAAAAASSPVGLDLAAIASYPKALFSR-------AAGGDA  117

Query  326  LCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstpl  159
            +CSICL EY D EMLR++P+C+H FHV C+DAWL+ +ASCPVCR+    +P+ TPL+TPL
Sbjct  118  MCSICLSEYMDGEMLRLMPECRHRFHVMCLDAWLRRSASCPVCRSSPIPTPVTTPLATPL  177

Query  158  SEVVPLSHYSDGRRRQ  111
            SE+VPLS Y+  RRR 
Sbjct  178  SELVPLSQYAADRRRS  193



>ref|XP_008665968.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
Length=191

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 101/176 (57%), Gaps = 18/176 (10%)
 Frame = -2

Query  698  TVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyR  519
            +V   +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA   
Sbjct  12   SVSSTTARPQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTT  66

Query  518  NSHPDDNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRS  360
             S      + +PR++FVAE  E  ++D       +     +GLD A I SYPK+ +S ++
Sbjct  67   ASSSGHLSITVPRVLFVAEGSESPKDDAYPSSSAAAACSPVGLDAAAIASYPKVAFSSKA  126

Query  359  GNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
                     D +CSICL EY+D E LR++P+C+H FHV C+DAWL  +ASCPVCR+
Sbjct  127  AE------ADAMCSICLSEYRDGETLRVMPECRHGFHVACLDAWLSRSASCPVCRS  176



>ref|XP_008671143.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
 ref|XP_008671172.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
 ref|XP_008657436.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
Length=276

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 101/176 (57%), Gaps = 18/176 (10%)
 Frame = -2

Query  698  TVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyR  519
            +V   +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA   
Sbjct  97   SVSSTTARPQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTT  151

Query  518  NSHPDDNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRS  360
             S      + +PR++FVAE  E  E+D       +     +GLD A I SYPK+ +S ++
Sbjct  152  ASSSGHLSITVPRVLFVAEGSESPEDDAYPSSSAAAACSPVGLDAAAIASYPKVAFSSKA  211

Query  359  GNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
                     D +CSICL EY+D E LR++P+C+H FHV C+DAWL  +ASCPVCR+
Sbjct  212  AE------ADAMCSICLSEYRDGETLRVMPECRHGFHVACLDAWLSRSASCPVCRS  261



>ref|NP_001147642.1| RING-H2 finger protein ATL2M [Zea mays]
 gb|ACG28231.1| RING-H2 finger protein ATL2M [Zea mays]
Length=193

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 114/190 (60%), Gaps = 22/190 (12%)
 Frame = -2

Query  647  YAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRIIFV  468
            Y+IAIA GFL+LF++ LLA Y C       R       EA    S      + +PR++FV
Sbjct  14   YSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTTASSSGHLSITVPRVLFV  68

Query  467  AEDDE--ENDGVSGQNVA-----LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  309
            AE  E  E+D       A     +GLD A I SYPK+ +S R+         D +CSICL
Sbjct  69   AEGSESPEDDAYPSSAAAAACSPVGLDAAAIASYPKVAFSSRAAE------ADAMCSICL  122

Query  308  CEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNspl----ptplstplSEVVPL  141
             EY+D E LR++P+C+H FH  C+DAWL  +ASCPVCR+SP+     TPL+TPLSE+VPL
Sbjct  123  SEYRDGETLRVMPECRHGFHAACLDAWLSRSASCPVCRSSPVPTPNATPLATPLSELVPL  182

Query  140  SHYSDGRRRQ  111
            S Y+  RRR+
Sbjct  183  SQYAADRRRR  192



>ref|XP_008680882.1| PREDICTED: RING-H2 finger protein ATL67-like [Zea mays]
Length=191

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 100/176 (57%), Gaps = 18/176 (10%)
 Frame = -2

Query  698  TVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyR  519
            +V   +A    + +GLGY+IAIA GFL+LF++ LLA Y C       R       EA   
Sbjct  12   SVSSTTARPQLSNLGLGYSIAIALGFLILFASFLLAFYFC-----FGRGGDYWAGEAVTT  66

Query  518  NSHPDDNGVYLPRIIFVAEDDE--ENDG-----VSGQNVALGLDQAVINSYPKLVYSKRS  360
             S      + +PR++FVAE  E  E+D       +     +GLD A I SYPK+ +S R+
Sbjct  67   ASSSGHLSITVPRVLFVAEGSESPEDDAYPSSSAAAACSPVGLDAAAIASYPKVAFSSRA  126

Query  359  GNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
                     D +CSICL EY+D E LR++P+C+H FHV C+DAWL  +AS PVCR+
Sbjct  127  AE------ADAMCSICLSEYRDGETLRVMPECRHGFHVACLDAWLSRSASYPVCRS  176



>ref|XP_009403522.1| PREDICTED: RING-H2 finger protein ATL67-like [Musa acuminata 
subsp. malaccensis]
Length=197

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 126/200 (63%), Gaps = 22/200 (11%)
 Frame = -2

Query  689  PNSAPTN--FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRN  516
            P++ P++  FT++ L +A+A+A G LVL S  LLASY+CCR                  +
Sbjct  12   PSTTPSSSIFTSLALPFAVAVALGLLVLLSAFLLASYVCCRGQPQSTALDP--------S  63

Query  515  SHPDDNGVYLPRIIFVAEDDEENDGVSGQNV-ALGLDQAVINSYPKLVYSKRSGNPGGTT  339
            + P D  V  PRIIFV EDD+ +    G    A GLDQ  I+SYPK  +S          
Sbjct  64   AVPADGIVAPPRIIFVPEDDDGDGSEGGGGGQASGLDQTAISSYPKFPFS-------AAK  116

Query  338  GNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptpl  171
            G DT+CSICLCEY+  EMLRM+PDC+H+FH+ C+D WL+LNASCPVCR     +P+ TP 
Sbjct  117  GGDTVCSICLCEYRKGEMLRMMPDCRHHFHLLCIDVWLRLNASCPVCRTSPLPTPVSTPT  176

Query  170  stplSEVVPLSHYSDGRRRQ  111
            STPLSE+VPLS ++  RRR+
Sbjct  177  STPLSELVPLSQFAADRRRR  196



>ref|XP_006646300.1| PREDICTED: RING-H2 finger protein ATL67-like [Oryza brachyantha]
Length=226

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 92/193 (48%), Positives = 117/193 (61%), Gaps = 19/193 (10%)
 Frame = -2

Query  665  TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYL  486
             T+GLGY+IAIA GFLVL +++LLASY C                    +SH     + +
Sbjct  44   ATLGLGYSIAIALGFLVLLASLLLASYFC--FRRGGGGHFSGVLTPTSSSSH---LSITV  98

Query  485  PRIIFVAEDDEENDGVSGQNVA----LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCS  318
            PR++FVAE  E  D  S    A    +GLD A I SYPK+ +     +       D +CS
Sbjct  99   PRVLFVAEGSESPDAYSSGAAAAASPVGLDAAAIASYPKVPFYSTGAD------ADAMCS  152

Query  317  ICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNs----plptplstplSEV  150
            ICL EY D EMLR++PDC+H FHV C+DAWL+ NASCPVCR+S    P+ TPL+TPLSE+
Sbjct  153  ICLSEYTDGEMLRVMPDCRHRFHVVCLDAWLRRNASCPVCRSSPIPTPVATPLATPLSEL  212

Query  149  VPLSHYSDGRRRQ  111
            VPLS Y+  RRR 
Sbjct  213  VPLSQYAADRRRS  225



>ref|XP_002992199.1| hypothetical protein SELMODRAFT_186618 [Selaginella moellendorffii]
 gb|EFJ06696.1| hypothetical protein SELMODRAFT_186618 [Selaginella moellendorffii]
Length=160

 Score =   125 bits (315),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 86/160 (54%), Gaps = 39/160 (24%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            + + +GLGY IAIA G LVL ST++LASY+C                             
Sbjct  14   SMSRVGLGYGIAIAVGILVLVSTIMLASYVC-----------------------------  44

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  312
                   V +     D   G+    GLDQ  + SYP++V+S +   P      DT C+IC
Sbjct  45   -------VRQQSSSRDRSDGEWTISGLDQVTLESYPRIVFSAQQPLPHP---QDTACAIC  94

Query  311  LCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            L +Y+++EMLR+LPDC+H FHV C+D+W++L A+CP+CR 
Sbjct  95   LADYREAEMLRVLPDCRHVFHVQCIDSWMRLQATCPMCRT  134



>emb|CDM81763.1| unnamed protein product [Triticum aestivum]
Length=177

 Score =   125 bits (315),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 100/165 (61%), Gaps = 14/165 (8%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            ++  T+GLGY+IAIA GFLVL ++VLLASY C R   +              +SH     
Sbjct  8    SSLATLGLGYSIAIALGFLVLLASVLLASYFCFRHGESAGGHFAGAITPTSSSSH---LS  64

Query  494  VYLPRIIFVAEDDEENDGVSGQNVA----LGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  327
            + +PR++FVAE  E  +  S    A    +GLD A I SYPK  +S+         G D 
Sbjct  65   ITVPRVLFVAEGSESPEAYSSAAAAASSPVGLDPAAIASYPKAPFSR-------AAGGDA  117

Query  326  LCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            +CSICL EY D EMLR++P+C+H FHV C+DAWL+ +ASCPVCR+
Sbjct  118  MCSICLSEYMDGEMLRLMPECRHRFHVMCLDAWLRRSASCPVCRS  162



>ref|XP_006654677.1| PREDICTED: RING-H2 finger protein ATL67-like [Oryza brachyantha]
Length=200

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 121/197 (61%), Gaps = 14/197 (7%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            + +++G+GYA+A+A GFLVL +++LL SY C R              A    S      +
Sbjct  7    SLSSVGVGYAVAVALGFLVLLASLLLTSYFCFRRGVPGGGGVHSARHAVSSASSSGHISI  66

Query  491  YLPRIIFVAEDDEENDGVSG------QNVALGLDQAVINSYPKLVYSKRSGNPGGTTGND  330
             +PR+IFVA+D +     S        +  +GLD AVI SYPK+ +S+ +         +
Sbjct  67   TVPRVIFVADDTDSPGSSSRGAGGGVASSPVGLDPAVIASYPKVPFSRAAA----GADAE  122

Query  329  TLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstp  162
              CSICLCEYK+ EM RM+P+C+H FH+ C+DAWL+ +ASCPVCR+    +P+ TPL+TP
Sbjct  123  AACSICLCEYKEGEMQRMMPECRHRFHLMCLDAWLRRSASCPVCRSSPIPTPVATPLATP  182

Query  161  lSEVVPLSHYSDGRRRQ  111
            LSE+VPLS Y+  RRR 
Sbjct  183  LSELVPLSQYAADRRRH  199



>ref|XP_010232275.1| PREDICTED: RING-H2 finger protein ATL67-like [Brachypodium distachyon]
Length=200

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 118/192 (61%), Gaps = 12/192 (6%)
 Frame = -2

Query  662  TIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLP  483
            T+GLGY+IAIA GFLVL +++LLASY C                A    S      + +P
Sbjct  12   TLGLGYSIAIALGFLVLLASLLLASYFC-FRHGGAAGGGGHFTGAFTPTSGSSHLSITVP  70

Query  482  RIIFVAEDDEENDGVSGQNVA----LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSI  315
            R++FVAE  E  D  S    A    +GLD A I SYPK  +S+           D +CSI
Sbjct  71   RVLFVAEGSESPDAYSSAAAAASSPVGLDPAAIASYPKAPFSRSRAA---AADADAMCSI  127

Query  314  CLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptplstplSEVV  147
            CLCEY+D EMLR++P+C+H FHV C+DAWL+ + SCPVCR+    +P+ TPL+TPLSE+V
Sbjct  128  CLCEYRDGEMLRLMPECRHRFHVMCLDAWLRRSGSCPVCRSSPIPTPVATPLATPLSELV  187

Query  146  PLSHYSDGRRRQ  111
            PLSHY+  RRR 
Sbjct  188  PLSHYAADRRRS  199



>ref|XP_001754650.1| predicted protein [Physcomitrella patens]
 gb|EDQ80620.1| predicted protein [Physcomitrella patens]
Length=175

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 89/160 (56%), Gaps = 18/160 (11%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            N + +GLGY IAIA G LVL ST++LASY+C                    +S       
Sbjct  4    NLSKVGLGYGIAIAVGILVLVSTIMLASYVC--------------VRVHQTSSGSQSGNS  49

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  312
              P       DD   + ++  + + GLDQ  + SYPK+VY+  S  P      D  CSIC
Sbjct  50   AGPAAYHSGGDDAHGNPLTEWSTS-GLDQVTVESYPKVVYTA-SQPP--LNLQDNSCSIC  105

Query  311  LCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            L +YKD ++LRMLP+C+H FH  C+DAWL+L+ASCP+CR 
Sbjct  106  LGDYKDGDILRMLPECRHMFHAPCIDAWLRLHASCPMCRT  145



>ref|XP_004961430.1| PREDICTED: RING-H2 finger protein ATL67-like isoform X2 [Setaria 
italica]
Length=204

 Score =   122 bits (305),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 125/201 (62%), Gaps = 19/201 (9%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
              ++GLGYAIAIA GFLVL ++VLLASY C R  A            G    H   +   
Sbjct  7    LASLGLGYAIAIALGFLVLLASVLLASYFCLRRGAGDGFGAGGVGGVGGSARHAASSASS  66

Query  488  -------LPRIIFVAEDDEE----NDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGT  342
                   +PR++FVAED +     + G +     +GLD AVI +YP++ +S+ +  P   
Sbjct  67   SGHISITVPRVVFVAEDYDSPGSSSRGAAAAASPVGLDPAVIATYPRVPFSRAALGPDA-  125

Query  341  TGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptp  174
               +  CSICLCEY++ EMLR++P+CKH FH+TC+DAWL+ +ASCPVCR+    +P+ TP
Sbjct  126  ---EVACSICLCEYREGEMLRVMPECKHRFHLTCLDAWLRRSASCPVCRSSPIPTPVSTP  182

Query  173  lstplSEVVPLSHYSDGRRRQ  111
            LSTPLSE+VPLS Y+  RRR 
Sbjct  183  LSTPLSELVPLSQYAADRRRS  203



>ref|XP_004961429.1| PREDICTED: RING-H2 finger protein ATL67-like isoform X1 [Setaria 
italica]
Length=206

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 92/201 (46%), Positives = 125/201 (62%), Gaps = 19/201 (9%)
 Frame = -2

Query  668  FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
              ++GLGYAIAIA GFLVL ++VLLASY C R  A            G    H   +   
Sbjct  7    LASLGLGYAIAIALGFLVLLASVLLASYFCLRRGAGDGFGAGGVGGVGGSARHAASSASS  66

Query  488  -------LPRIIFVAEDDEE----NDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGT  342
                   +PR++FVAED +     + G +     +GLD AVI +YP++ +S+ +  P   
Sbjct  67   SGHISITVPRVVFVAEDYDSPGSSSRGAAAAASPVGLDPAVIATYPRVPFSRAALGPDA-  125

Query  341  TGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splptp  174
               +  CSICLCEY++ EMLR++P+CKH FH+TC+DAWL+ +ASCPVCR+    +P+ TP
Sbjct  126  ---EVACSICLCEYREGEMLRVMPECKHRFHLTCLDAWLRRSASCPVCRSSPIPTPVSTP  182

Query  173  lstplSEVVPLSHYSDGRRRQ  111
            LSTPLSE+VPLS Y+  RRR 
Sbjct  183  LSTPLSELVPLSQYAADRRRS  203



>ref|XP_002458455.1| hypothetical protein SORBIDRAFT_03g033910 [Sorghum bicolor]
 gb|EES03575.1| hypothetical protein SORBIDRAFT_03g033910 [Sorghum bicolor]
Length=197

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 115/190 (61%), Gaps = 18/190 (9%)
 Frame = -2

Query  647  YAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRIIFV  468
            Y+IAIA GFLVL +++LLA Y C                    +S      + +PR++FV
Sbjct  14   YSIAIALGFLVLLASLLLAFYFCFGRGGGGGGDYWAGEAVTTASSS-GHLSITVPRVLFV  72

Query  467  AEDDEENDGVSGQNVA-------LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  309
            AE  E  D  +  + +       +GLD A I SYPK+ +S R+         D +CSICL
Sbjct  73   AEGSESPDDAAYSSASAAAACSPVGLDAAAIASYPKVAFSSRAAE------ADAMCSICL  126

Query  308  CEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNspl----ptplstplSEVVPL  141
             EY+D EMLR++P+C+H FHV C+DAWL+ +ASCPVCR+SP+     TPL+TPLSE+VPL
Sbjct  127  SEYRDGEMLRVMPECRHGFHVACLDAWLRRSASCPVCRSSPIPTPNATPLATPLSELVPL  186

Query  140  SHYSDGRRRQ  111
            S Y+  RRR+
Sbjct  187  SQYAADRRRR  196



>ref|XP_004969874.1| PREDICTED: RING-H2 finger protein ATL67-like [Setaria italica]
Length=193

 Score =   120 bits (301),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 69/138 (50%), Positives = 93/138 (67%), Gaps = 16/138 (12%)
 Frame = -2

Query  494  VYLPRIIFVAEDDEENDGVSGQNVA------LGLDQAVINSYPKLVYSKRSGNPGGTTGN  333
            + +PR++FVAE  E  D  +  + A      +GLD A I SYPK+ +S R+         
Sbjct  62   ITVPRVLFVAEGSESPDDAAYSSAAAASCCPVGLDPAAIASYPKVPFSSRAAE------A  115

Query  332  DTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNs----plptplst  165
            D +CSICL EY+D EMLR++P+C+H FHV C+DAWL+ + SCPVCR+S    P  TPL+T
Sbjct  116  DAMCSICLSEYRDGEMLRLMPECRHRFHVACLDAWLRRSGSCPVCRSSPIPTPTATPLAT  175

Query  164  plSEVVPLSHYSDGRRRQ  111
            PLSE+VPLSHY+  RRR+
Sbjct  176  PLSELVPLSHYAADRRRR  193



>ref|XP_002982100.1| hypothetical protein SELMODRAFT_59303, partial [Selaginella moellendorffii]
 gb|EFJ16768.1| hypothetical protein SELMODRAFT_59303, partial [Selaginella moellendorffii]
Length=147

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/160 (37%), Positives = 86/160 (54%), Gaps = 37/160 (23%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            + + +GLGY IAIA G LVL ST++LASY+C                             
Sbjct  3    SMSRVGLGYGIAIAVGILVLVSTIMLASYVC-----------------------------  33

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  312
                 +  +      D   G+    GLDQ  + SYP++V+S +   P      DT C+IC
Sbjct  34   -----VRQSSSSSARDRSDGEWTISGLDQVTLESYPRIVFSAQQPLPHP---QDTACAIC  85

Query  311  LCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            L +Y+++EMLR+LPDC+H FHV C+D+W++L A+CP+CR 
Sbjct  86   LADYREAEMLRVLPDCRHVFHVQCIDSWMRLQATCPMCRT  125



>ref|XP_001760297.1| predicted protein [Physcomitrella patens]
 gb|EDQ75053.1| predicted protein [Physcomitrella patens]
Length=183

 Score =   119 bits (299),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 84/160 (53%), Gaps = 18/160 (11%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV  492
            + + +GLGY IAIA G LVL STV+LASY+C        +            + PD  G 
Sbjct  12   SLSKVGLGYGIAIAVGILVLVSTVMLASYVC----VRVHQTSSGSLSGSSTGAAPDHAGG  67

Query  491  YLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSIC  312
                     E               GLDQ  + SYPK+VYS     P      DT CSIC
Sbjct  68   DDGGGGAFTEWSTS-----------GLDQITVESYPKVVYSASQALPHL---QDTSCSIC  113

Query  311  LCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            L +YKD + LRMLP+C+H FH  C+DAWL+L+ASCP+CR 
Sbjct  114  LGDYKDGDTLRMLPECRHMFHALCIDAWLRLHASCPMCRT  153



>ref|XP_010545157.1| PREDICTED: RING-H2 finger protein ATL67 [Tarenaya hassleriana]
Length=204

 Score =   119 bits (298),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 90/122 (74%), Gaps = 6/122 (5%)
 Frame = -2

Query  506  DDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  327
            +++ +  PR+IFVAEDD+++  +  ++V    DQ+VINSYPK  +SK     G TT    
Sbjct  74   EESDIISPRVIFVAEDDDDDHDLE-ESVVPRFDQSVINSYPKFQFSKEPEGGGCTT----  128

Query  326  LCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVV  147
             CSICLCEYK++EMLRM+P+CKH FH+ C+D WLKL  SCPVCRNSPLPTP STP SEVV
Sbjct  129  -CSICLCEYKEAEMLRMMPECKHSFHLCCLDVWLKLKRSCPVCRNSPLPTPQSTPSSEVV  187

Query  146  PL  141
            P 
Sbjct  188  PF  189



>ref|XP_002440115.1| hypothetical protein SORBIDRAFT_09g026220 [Sorghum bicolor]
 gb|EES18545.1| hypothetical protein SORBIDRAFT_09g026220 [Sorghum bicolor]
Length=206

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 90/202 (45%), Positives = 123/202 (61%), Gaps = 17/202 (8%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrs-------iaarrrrrrldaeagyRNS  513
            +  ++GLGYAIAIA GFLVL ++VLLASY C R                     A    S
Sbjct  6    SLASLGLGYAIAIALGFLVLLASVLLASYFCLRRGGAGDLFGPGVGVGVGSARHAASSAS  65

Query  512  HPDDNGVYLPRIIFVAEDDEE----NDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG  345
                  + +PR++FVAED +     + G +     +GLD +VI SYP++ +SK       
Sbjct  66   SSGHISITVPRVVFVAEDYDSPGSSSRGAAAAASPVGLDPSVIASYPRVPFSKAGAG--A  123

Query  344  TTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splpt  177
                +  CSICLCEY++ EMLR++P+C+H FH+TC+DAWL+ +ASCPVCR+    +P+ T
Sbjct  124  GADAEVACSICLCEYREGEMLRVMPECRHRFHLTCLDAWLRRSASCPVCRSSPIPTPVAT  183

Query  176  plstplSEVVPLSHYSDGRRRQ  111
            PLSTPLSE+VPLS Y+  RRR 
Sbjct  184  PLSTPLSELVPLSQYAADRRRS  205



>ref|XP_010036586.1| PREDICTED: RING-H2 finger protein ATL70 [Eucalyptus grandis]
 gb|KCW48196.1| hypothetical protein EUGRSUZ_K01918 [Eucalyptus grandis]
Length=183

 Score =   117 bits (293),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 80/178 (45%), Positives = 104/178 (58%), Gaps = 14/178 (8%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            GLGY I ++ G L+L +T+ LASY C R++          +    R   P          
Sbjct  19   GLGYGIGVSVGVLLLITTITLASYFCARNLQGASASSAFSSRRVRRLHRPPP--------  70

Query  476  IFVAEDDEENDGVSGQNVA-LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEY  300
               A D E    V  Q +A  GLD+A I  YPKL+YS+      G+T   + CS+CL +Y
Sbjct  71   ---ATDQERVVVVVEQGLAEQGLDEATITGYPKLLYSEAKLEKKGSTA--SCCSVCLADY  125

Query  299  KDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
            KD++MLR LPDC H FH  C+D WL+L+ +CPVCR SPLPTPLSTPL+EVVPL+   D
Sbjct  126  KDTDMLRALPDCSHLFHQKCIDPWLRLHPTCPVCRTSPLPTPLSTPLAEVVPLAIRRD  183



>ref|XP_009348829.1| PREDICTED: RING-H2 finger protein ATL70-like [Pyrus x bretschneideri]
Length=169

 Score =   115 bits (289),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 100/176 (57%), Gaps = 25/176 (14%)
 Frame = -2

Query  653  LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRII  474
             GY I ++ G L+L +T+ LASY C R+                            P   
Sbjct  19   FGYGIGVSVGVLLLITTITLASYFCARTQQPPA-----------------------PPTR  55

Query  473  FVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKD  294
              A D  +  GV    V +GLD   I SYPKL+YS+       +T   + CSICL +YK+
Sbjct  56   RNAGDAMDPPGVENFVVDIGLDDNTIQSYPKLLYSEAKLQMKDSTA--SCCSICLADYKN  113

Query  293  SEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
            S+MLR+LPDC+H FH+ C+D WL+LN +CPVCR SP+PTPLSTPL+EVVPL+   D
Sbjct  114  SDMLRLLPDCRHLFHLKCIDPWLRLNPTCPVCRTSPIPTPLSTPLAEVVPLASRRD  169



>ref|XP_007219093.1| hypothetical protein PRUPE_ppa015141mg [Prunus persica]
 gb|EMJ20292.1| hypothetical protein PRUPE_ppa015141mg [Prunus persica]
Length=193

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 104/187 (56%), Gaps = 22/187 (12%)
 Frame = -2

Query  677  PTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDD-  501
            P + T +G+GY IAIA   L L S ++LASY C           ++   +     H D  
Sbjct  24   PASATGVGVGYGIAIAVSILFLISAIMLASYAC----------VKVKGASATTRPHEDRS  73

Query  500  ---NGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGND  330
               N VY  R    +E    ND V    V +GLD   I+SYPKLV  +    P     N 
Sbjct  74   VAYNNVYGHR--SRSEAVNSNDPVV---VVMGLDGPTIDSYPKLVLGESRRLP---QRNY  125

Query  329  TLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEV  150
            T+CSICL EYK  + +R +PDC H FH  CVD WL+++A+CP+CRNSP P+   +PLS++
Sbjct  126  TVCSICLSEYKPRDQVRCIPDCHHCFHAECVDEWLRMSATCPICRNSPAPSVGPSPLSDL  185

Query  149  VPLSHYS  129
            VPL+ +S
Sbjct  186  VPLAFHS  192



>ref|XP_002316476.1| hypothetical protein POPTR_0010s24960g [Populus trichocarpa]
 gb|EEF02647.1| hypothetical protein POPTR_0010s24960g [Populus trichocarpa]
Length=165

 Score =   113 bits (283),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 99/173 (57%), Gaps = 26/173 (15%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G  YAI ++ G LVL  ++ LA+Y C                           GV  P  
Sbjct  15   GYAYAIGMSSGVLVLIISITLAAYFCTY-------------------------GVDSPTH  49

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
                + D   D  S   + LGLD+A + SYPKL+YSK    P G     + CSICL +YK
Sbjct  50   TGTNQGDSITDHDS-IVMELGLDEATLASYPKLLYSKARLEPRGNDLLPSCCSICLGDYK  108

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            DS+MLR+LPDC H FH+ CVD WL+L+ +CP+CRNSP+PTPLSTPL+EV PL+
Sbjct  109  DSDMLRLLPDCGHVFHLKCVDCWLRLHPTCPICRNSPMPTPLSTPLAEVAPLA  161



>ref|XP_008246264.1| PREDICTED: putative RING-H2 finger protein ATL69 isoform X1 [Prunus 
mume]
Length=176

 Score =   113 bits (283),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 71/186 (38%), Positives = 103/186 (55%), Gaps = 20/186 (11%)
 Frame = -2

Query  677  PTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDN  498
            P + T +G+GY IAIA   L L S ++LASY C           ++   +     H D N
Sbjct  7    PVSATGVGIGYGIAIAVSILFLISAIMLASYAC----------VKVKGASATTRPHEDRN  56

Query  497  GVYLPRIIFVAEDDEENDGVSGQN---VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDT  327
              Y      V E    ++ V+  +   V +GLD   INSYPK+V  +    P     N T
Sbjct  57   VAYN----NVYEHRNRSEAVNSNDPVVVVMGLDGPTINSYPKMVLGESRRLP---QRNYT  109

Query  326  LCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVV  147
            +C ICL EYK  + +R +P+C H FH  CVD WL+++A+CP+CRNSP P+   +PLS++V
Sbjct  110  VCCICLSEYKPRDQVRCIPECHHCFHAECVDEWLRMSATCPICRNSPAPSVGPSPLSDLV  169

Query  146  PLSHYS  129
            PL+ ++
Sbjct  170  PLAFHA  175



>gb|KJB67866.1| hypothetical protein B456_010G215700 [Gossypium raimondii]
Length=178

 Score =   113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 94/173 (54%), Gaps = 23/173 (13%)
 Frame = -2

Query  704  LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  525
            ++T  P   P + T +GLGY IAIA   LVL ST++LASY  C  + A     R    + 
Sbjct  1    MSTADP---PISTTGVGLGYGIAIAVSILVLISTIMLASY-ACVRVKASGSGNRSRRNSN  56

Query  524  yRNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNP  351
              NS+    G+             E+D +    V +GLD  VI SYPK++   S+R   P
Sbjct  57   GGNSNGTSRGI------------TEDDSMDVATVVVGLDGPVIESYPKIIVGESRRLPKP  104

Query  350  GGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
                 N+  C ICL EY+  + +R +PDC+H FHV C+D WL++N +CP+CRN
Sbjct  105  -----NNGPCCICLTEYQPKDQIRCIPDCEHCFHVDCIDEWLRMNGTCPLCRN  152



>ref|XP_009607421.1| PREDICTED: RING-H2 finger protein ATL67-like, partial [Nicotiana 
tomentosiformis]
Length=154

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 56/86 (65%), Positives = 68/86 (79%), Gaps = 6/86 (7%)
 Frame = -2

Query  518  NSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTT  339
            N++ ++N +YLPR+IFVA D+EEND VS QN  LG+DQAVINSYPKLVYSKR+G     +
Sbjct  74   NANTENNRIYLPRLIFVA-DEEENDDVSSQNTILGIDQAVINSYPKLVYSKRNG-----S  127

Query  338  GNDTLCSICLCEYKDSEMLRMLPDCK  261
            G D +C I LCEYKDSEM RMLPD +
Sbjct  128  GKDVVCFIFLCEYKDSEMSRMLPDTR  153



>gb|EAY98765.1| hypothetical protein OsI_20699 [Oryza sativa Indica Group]
Length=206

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 125/203 (62%), Gaps = 20/203 (10%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNS-----HP  507
            +F+++G+GYA+AIA GFLVL +++LLA Y C R   A   RR        R++       
Sbjct  7    SFSSLGVGYAVAIALGFLVLLASLLLAFYFCSRRGGAGVVRRGGQGVHSARHAVSSASSS  66

Query  506  DDNGVYLPRIIFVAEDDEENDGVSGQNVA-------LGLDQAVINSYPKLVYSKRSGNPG  348
                + +PR+IFVA+D +     S            +GLD AVI SYPK+ +S+ +    
Sbjct  67   GHISITVPRVIFVADDSDSPGSSSRGGAGGGAASSPVGLDPAVIASYPKVPFSRAAA---  123

Query  347  GTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----splp  180
                 +  CSICLCEYK+ EM RM+P+C+H FH+ C+DAWL+ +ASCPVCR+    +P+ 
Sbjct  124  -GADAEAACSICLCEYKEGEMQRMMPECRHRFHLMCLDAWLRRSASCPVCRSSPIPTPVS  182

Query  179  tplstplSEVVPLSHYSDGRRRQ  111
            TPL+TPLSE+VPLS Y+  RRR 
Sbjct  183  TPLATPLSELVPLSQYAADRRRH  205



>emb|CDX99014.1| BnaC09g48210D [Brassica napus]
Length=157

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 103/187 (55%), Gaps = 43/187 (23%)
 Frame = -2

Query  677  PTN--FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPD  504
            PTN   T +GLGY IAIA   L+L ST++LASYIC                         
Sbjct  3    PTNPPATGVGLGYGIAIAVSILILISTIMLASYICI------------------------  38

Query  503  DNGVYLPRIIFVAEDDEENDGV---SGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTT  339
                   R+     D   ++GV       V LGLD+ VI SYP++V   S+R   P    
Sbjct  39   -------RLKSAPRDGATSEGVLDSPAAEVKLGLDRPVIESYPRIVLGESRRLPRP----  87

Query  338  GNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstpl  159
             N+  CSICLC+Y+  + +R +P+C H FH  CVD WL+ +A+CP+CRNSP P+ L+TPL
Sbjct  88   -NNGPCSICLCDYEARDPVRCIPECNHCFHADCVDEWLRTSATCPLCRNSPAPSRLATPL  146

Query  158  SEVVPLS  138
            S++VP++
Sbjct  147  SDLVPVA  153



>ref|NP_001056103.1| Os05g0526600 [Oryza sativa Japonica Group]
 gb|AAU44063.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF18017.1| Os05g0526600 [Oryza sativa Japonica Group]
Length=207

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 89/204 (44%), Positives = 123/204 (60%), Gaps = 21/204 (10%)
 Frame = -2

Query  671  NFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRN------SH  510
            +F+++G+GYA+AIA GFLVL +++LLA Y C R   A   RR                S 
Sbjct  7    SFSSLGVGYAVAIALGFLVLLASLLLAFYFCSRRGGAGVVRRGGGQGVHSARHAVSSASS  66

Query  509  PDDNGVYLPRIIFVAEDDEENDGVSGQNVA-------LGLDQAVINSYPKLVYSKRSGNP  351
                 + +PR+IFVA+D +     S            +GLD AVI SYPK+ +S+ +   
Sbjct  67   SGHISITVPRVIFVADDSDSPGSSSRGGAGGGAASSPVGLDPAVIASYPKVPFSRAAT--  124

Query  350  GGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----spl  183
                  +  CSICLCEYK+ EM RM+P+C+H FH+ C+DAWL+ +ASCPVCR+    +P+
Sbjct  125  --GADAEAACSICLCEYKEGEMQRMMPECRHRFHLMCLDAWLRRSASCPVCRSSPIPTPV  182

Query  182  ptplstplSEVVPLSHYSDGRRRQ  111
             TPL+TPLSE+VPLS Y+  RRR 
Sbjct  183  STPLATPLSELVPLSQYAADRRRH  206



>ref|XP_010247223.1| PREDICTED: putative RING-H2 finger protein ATL69 [Nelumbo nucifera]
Length=184

 Score =   111 bits (277),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 77/200 (39%), Positives = 111/200 (56%), Gaps = 25/200 (13%)
 Frame = -2

Query  704  LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  525
            +++V P   P + + +G+GY IAIA G LVL ST++LASY+C          R       
Sbjct  1    MSSVGP---PESVSGVGVGYGIAIAVGILVLISTIMLASYVC---------VRVKAGNLS  48

Query  524  yRNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVAL--GLDQAVINSYPKLVY--SKRSG  357
                  + N          A +   +   +G +  L  GLD+ +I+SYPKL+   S+R  
Sbjct  49   GDGGSGNRNSDSSGAGGGGATNHHHHHMATGHSPVLVVGLDKPIIDSYPKLILGESRRLP  108

Query  356  NPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN----s  189
             P     ND  C+ICL EY+  E +R +PDC+H FH  CVD WL+++A+CP+CR+    S
Sbjct  109  KP-----NDGSCAICLSEYRPKETIRCIPDCQHCFHAGCVDEWLQMSATCPLCRSSPVPS  163

Query  188  plptplstplSEVVPLSHYS  129
               TP +TPLSE+VPL+ YS
Sbjct  164  AGSTPAATPLSELVPLAFYS  183



>emb|CDX70002.1| BnaA10g23510D [Brassica napus]
Length=157

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 103/187 (55%), Gaps = 43/187 (23%)
 Frame = -2

Query  677  PTN--FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPD  504
            PTN   T +GLGY IAIA   L+L ST++LASYIC                     S P 
Sbjct  3    PTNPPATGVGLGYGIAIAVSILILISTIMLASYIC-----------------IRSKSAPR  45

Query  503  DNGVYLPRIIFVAEDDEENDGV---SGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTT  339
            D                 ++GV       V LGLD+ VI SYP++V   S+R   P    
Sbjct  46   DGAT--------------SEGVLDSPAAEVKLGLDRPVIESYPRIVLGESRRLPRP----  87

Query  338  GNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstpl  159
             N+  CSICLC+Y+  + +R +P+C H FH  CVD WL+ +A+CP+CRNSP P+ L+TPL
Sbjct  88   -NNGPCSICLCDYEARDPVRCIPECNHCFHADCVDEWLRTSATCPLCRNSPAPSRLATPL  146

Query  158  SEVVPLS  138
            S++VP++
Sbjct  147  SDLVPVA  153



>ref|XP_009122386.1| PREDICTED: putative RING-H2 finger protein ATL69 [Brassica rapa]
Length=157

 Score =   110 bits (275),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 77/187 (41%), Positives = 102/187 (55%), Gaps = 43/187 (23%)
 Frame = -2

Query  677  PTN--FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPD  504
            PTN   T +GLGY IAIA   L+L ST++LASYIC                     S P 
Sbjct  3    PTNPPATGVGLGYGIAIAVSILILISTIMLASYIC-----------------IRSKSAPR  45

Query  503  DNGVYLPRIIFVAEDDEENDGV---SGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTT  339
            D                 +DGV       V LGLD+ VI SYP++V   S+R   P    
Sbjct  46   DGAT--------------SDGVLDSPAAEVKLGLDRPVIESYPRIVLGESRRLPRP----  87

Query  338  GNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstpl  159
             N+  CSICLC+Y   + +R +P+C H FH  CVD WL+ +A+CP+CRNSP P+ L+TPL
Sbjct  88   -NNGPCSICLCDYVARDPVRCIPECNHCFHADCVDEWLRTSATCPLCRNSPAPSRLATPL  146

Query  158  SEVVPLS  138
            S++VP++
Sbjct  147  SDLVPVA  153



>ref|XP_006444937.1| hypothetical protein CICLE_v10024039mg, partial [Citrus clementina]
 gb|ESR58177.1| hypothetical protein CICLE_v10024039mg, partial [Citrus clementina]
Length=267

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 79/121 (65%), Gaps = 21/121 (17%)
 Frame = -2

Query  473  FVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKD  294
            F  +  EEN      N+ +GLDQAVINSYPK  ++K S                     D
Sbjct  168  FNCKRKEENRNQDDDNLVVGLDQAVINSYPKFQFTKES---------------------D  206

Query  293  SEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDGRRR  114
             EMLRM+P+C+HYFH+ CVDAWLKLN SCPVCRNSPLPTPLSTPL EVVPLS Y+  RRR
Sbjct  207  LEMLRMMPECRHYFHLCCVDAWLKLNGSCPVCRNSPLPTPLSTPLQEVVPLSQYAADRRR  266

Query  113  Q  111
            +
Sbjct  267  R  267



>ref|XP_004308667.1| PREDICTED: putative RING-H2 finger protein ATL69 [Fragaria vesca 
subsp. vesca]
Length=174

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 101/185 (55%), Gaps = 20/185 (11%)
 Frame = -2

Query  677  PTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDN  498
            P + T +G+GY IAIA   LVL S ++LASY C                  +   + DD 
Sbjct  7    PISATGVGVGYGIAIAVSILVLISAIMLASYAC-------------VRVKSHGGYYSDDY  53

Query  497  GVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTL  324
                      +     N       V LGLD   I+SYPK+V   SKR   P     ND +
Sbjct  54   DEQYSNSHRRSPTTTSNYSAEPATVVLGLDGPTIDSYPKIVLGESKRLPKP-----NDGV  108

Query  323  CSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVP  144
            CSICL EY+  + +R +P+C H FHV CVD WL+++A+CPVCRNSP P+P+ +PLS +VP
Sbjct  109  CSICLSEYQAKDPVRCIPECHHCFHVDCVDEWLRMSATCPVCRNSPAPSPVPSPLSNLVP  168

Query  143  LSHYS  129
            ++ +S
Sbjct  169  MAFHS  173



>ref|XP_009370633.1| PREDICTED: putative RING-H2 finger protein ATL69 [Pyrus x bretschneideri]
Length=195

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 100/189 (53%), Gaps = 20/189 (11%)
 Frame = -2

Query  704  LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  525
             T   P SAP     +G+GY IAIA   LVL S ++LASY C   +  +    R      
Sbjct  2    FTAESPASAPG----VGVGYGIAIAVSILVLISAIMLASYAC---VKVKGSTGRGHTGDA  54

Query  524  yRNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG  345
              N + D N  +             ++      V  GLD   I+SYPKLV  +    P  
Sbjct  55   TSNYYEDGNRRF----------STTSNSTEPVVVLTGLDDPTIDSYPKLVLGESRRLP--  102

Query  344  TTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplst  165
               ND +CSICL EYK  + +R +PDC H FH  CVD WL+++A+CPVCRNSP P+   +
Sbjct  103  -QRNDAVCSICLSEYKPKDQVRCIPDCHHCFHAECVDEWLRMSATCPVCRNSPAPSAGPS  161

Query  164  plSEVVPLS  138
            PLS++VPL+
Sbjct  162  PLSDLVPLA  170



>ref|XP_002871246.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47505.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=159

 Score =   110 bits (274),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 103/193 (53%), Gaps = 45/193 (23%)
 Frame = -2

Query  695  VKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRN  516
            + P S P   + +GLGY IAIA   LVL S ++LASYIC                     
Sbjct  1    MSPISPPA--SGVGLGYGIAIAVSILVLISFIMLASYICI--------------------  38

Query  515  SHPDDNGVYLPRIIFVAEDDEENDGV-----SGQNVALGLDQAVINSYPKLVY--SKRSG  357
                       R      D+  +DGV         V LGLD+ VI SYP++V   S+R  
Sbjct  39   -----------RSKSTGRDEATSDGVLDSPSPAAEVKLGLDRPVIESYPRIVLGDSRRLP  87

Query  356  NPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplpt  177
             P     N+  CSICLC+Y+  E +R +P+C H FH  CVD WL+ +A+CP+CRNSP P+
Sbjct  88   RP-----NNGPCSICLCDYEAREPVRCIPECNHCFHTDCVDEWLRTSATCPLCRNSPAPS  142

Query  176  plstplSEVVPLS  138
             L+TPLS+++PL+
Sbjct  143  RLATPLSDLIPLA  155



>ref|XP_009606480.1| PREDICTED: RING-H2 finger protein ATL70-like [Nicotiana tomentosiformis]
Length=168

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 96/173 (55%), Gaps = 33/173 (19%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY I ++ G ++L +T+   SY C                          N     R 
Sbjct  24   GFGYTIGVSAGIVLLIATITFTSYFC------------------------TRNQTTTRRP  59

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
            +  A  DE         + +G+D+  + SYPKL+YS+   N   +T N   CSICL +YK
Sbjct  60   LRTANRDE-------HMMEMGIDEKTLLSYPKLLYSEAKVNYKDSTAN--CCSICLADYK  110

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
              +MLR+LPDC H FH+ CVD WL LN++CPVCRNSPLPTPLSTPL+EVVPL+
Sbjct  111  SKDMLRLLPDCGHLFHLKCVDPWLLLNSTCPVCRNSPLPTPLSTPLAEVVPLA  163



>ref|XP_008246265.1| PREDICTED: putative RING-H2 finger protein ATL69 isoform X2 [Prunus 
mume]
Length=163

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 101/183 (55%), Gaps = 27/183 (15%)
 Frame = -2

Query  677  PTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDN  498
            P + T +G+GY IAIA   L L S ++LASY C           ++   +     H D N
Sbjct  7    PVSATGVGIGYGIAIAVSILFLISAIMLASYAC----------VKVKGASATTRPHEDRN  56

Query  497  GVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCS  318
                     VA +   ND V    V +GLD   INSYPK+V  +    P     N T+C 
Sbjct  57   ---------VAVN--SNDPVV---VVMGLDGPTINSYPKMVLGESRRLP---QRNYTVCC  99

Query  317  ICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            ICL EYK  + +R +P+C H FH  CVD WL+++A+CP+CRNSP P+   +PLS++VPL+
Sbjct  100  ICLSEYKPRDQVRCIPECHHCFHAECVDEWLRMSATCPICRNSPAPSVGPSPLSDLVPLA  159

Query  137  HYS  129
             ++
Sbjct  160  FHA  162



>ref|XP_008445399.1| PREDICTED: putative RING-H2 finger protein ATL69 [Cucumis melo]
Length=168

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 75/192 (39%), Positives = 105/192 (55%), Gaps = 25/192 (13%)
 Frame = -2

Query  704  LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  525
            +++  P S+P   T +GLGY IAIA   LV  STV+L SY C      R +         
Sbjct  1    MSSAHPPSSPA--TGVGLGYGIAIAVSILVFISTVMLISYAC-----IRVKSSTRPRPRP  53

Query  524  yRNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG  345
              NS P      +  ++ +                +GLD ++I SYPKLV  +    P  
Sbjct  54   SANSLPSPPAATVDNVVVLM---------------VGLDGSIIESYPKLVLGESRRLPPP  98

Query  344  TTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplst  165
              G    CSICL +YK  + +R +PDC+H FH  CVD WL+++A+CP+CRNSP PTP++T
Sbjct  99   NNGP---CSICLSDYKPHDSVRCIPDCRHCFHSDCVDEWLRMSATCPLCRNSPAPTPVAT  155

Query  164  plSEVVPLSHYS  129
            PLSE VPL+ ++
Sbjct  156  PLSEFVPLASHA  167



>ref|XP_010534324.1| PREDICTED: putative RING-H2 finger protein ATL69 [Tarenaya hassleriana]
Length=178

 Score =   109 bits (272),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 73/184 (40%), Positives = 105/184 (57%), Gaps = 16/184 (9%)
 Frame = -2

Query  677  PTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDN  498
            P     +GLGY IAIA   LVL ST++LASY+C     +    R  + E    +++  D 
Sbjct  7    PVTAAGVGLGYGIAIAVSILVLISTIMLASYLC-IRAKSAGNHREGEEEDDEDSAYSSDG  65

Query  497  GVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTL  324
            G          E          + + LGLD   I SYP++V   S+R   P     N+  
Sbjct  66   GAR--------ELHAPPGSTVEEEMKLGLDGPAIESYPRIVLGESRRLPRP-----NNGP  112

Query  323  CSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVP  144
            CSICLC+Y+  + +R +P+C H FHV CVD WL+++A+CP+CRNSP P+ +STPLS++VP
Sbjct  113  CSICLCDYEARDSVRCIPECNHCFHVDCVDEWLRVSATCPLCRNSPAPSRVSTPLSDMVP  172

Query  143  LSHY  132
            L+ +
Sbjct  173  LAFH  176



>ref|XP_006826443.2| PREDICTED: RING-H2 finger protein ATL70 [Amborella trichopoda]
Length=204

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 101/176 (57%), Gaps = 21/176 (12%)
 Frame = -2

Query  665  TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYL  486
            + +G  Y I ++ G L+L +T++LASY C R                  N+    N    
Sbjct  46   SAVGFSYGIGVSVGILLLITTIMLASYFCTRGRTTFPMPHLAPTHPNNNNNQQHGN----  101

Query  485  PRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLC  306
                 V ED +            GLD+A + SYP L YS+   +   T  + + CSICL 
Sbjct  102  -----VVEDHQLQ----------GLDEATLLSYPTLPYSQAKLH--KTAASSSCCSICLG  144

Query  305  EYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            +YKDS+MLRMLPDC H FHV CVD+WL+L+ +CP CR+SPLP+PLSTPLSEVVPL+
Sbjct  145  DYKDSDMLRMLPDCGHLFHVKCVDSWLRLHPTCPNCRSSPLPSPLSTPLSEVVPLA  200



>emb|CDP10580.1| unnamed protein product [Coffea canephora]
Length=169

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 103/175 (59%), Gaps = 31/175 (18%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            GLGY I ++ G LVL +T+ LASY C R  A                            +
Sbjct  19   GLGYGIGVSVGILVLITTITLASYYCTRRSAT---------------------------V  51

Query  476  IFVAEDDEENDGVSGQN--VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCE  303
            +   + + + D    ++  V +GLD+A + SYP+++YS+       +TG  + CSICL +
Sbjct  52   VAPLQRNPQQDPADPRHLVVEVGLDEATLLSYPEMLYSEAKVKNNDSTG--SCCSICLAD  109

Query  302  YKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            YK+++MLR+LPDC H FH+ CVD WL+ + +CPVCR SPLPTPLSTPL+EV PL+
Sbjct  110  YKNTDMLRLLPDCGHLFHLKCVDPWLRQHPTCPVCRTSPLPTPLSTPLAEVAPLA  164



>ref|XP_007214748.1| hypothetical protein PRUPE_ppa024917mg [Prunus persica]
 gb|EMJ15947.1| hypothetical protein PRUPE_ppa024917mg [Prunus persica]
Length=170

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 100/178 (56%), Gaps = 20/178 (11%)
 Frame = -2

Query  659  IGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPR  480
            IG  Y I ++ G LVL   V L SY C R                     P +   +   
Sbjct  13   IGFAYGIGVSVGVLVLIIIVTLLSYFCTRM------------------RFPPNYPSFRRS  54

Query  479  IIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEY  300
               V +   +N   +G  V LGLD + + ++P+L+YS+   +   +T   T CSICL +Y
Sbjct  55   SSAVRQLQLQNAAAAG-GVELGLDDSALRNFPQLLYSQAKLHKNEST-TTTSCSICLGDY  112

Query  299  KDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
            KD+++LR+LPDC H FH+TCVD WL+L  +CP+CRNSP PTP++TPL+EV PL+   D
Sbjct  113  KDTDVLRLLPDCGHLFHLTCVDPWLRLRPTCPICRNSPAPTPIATPLAEVAPLAGRRD  170



>ref|XP_010907479.1| PREDICTED: putative RING-H2 finger protein ATL71 [Elaeis guineensis]
Length=222

 Score =   110 bits (274),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 99/175 (57%), Gaps = 28/175 (16%)
 Frame = -2

Query  653  LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRII  474
            LGY +  + G LVL +T+LLASY+C                    N           R  
Sbjct  76   LGYGLGFSIGILVLVTTILLASYLC--------------------NRSNTTTRSLRRRSG  115

Query  473  FVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKD  294
              A +    D      V  GLD+ ++ SYPKL+YS+   +  G+TG  + CSICL +YKD
Sbjct  116  RPAGETRLTD------VEAGLDEDILMSYPKLLYSQARLHEKGSTG--SCCSICLADYKD  167

Query  293  SEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYS  129
            ++MLR LPDC H FHV C++ WL+L+ +CP+CR SPLPTPL TPL+EV PL+  S
Sbjct  168  TDMLRGLPDCGHMFHVNCINPWLRLHPTCPMCRASPLPTPLPTPLAEVAPLAGQS  222



>ref|XP_008231804.1| PREDICTED: RING-H2 finger protein ATL70-like [Prunus mume]
Length=178

 Score =   108 bits (270),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 106/192 (55%), Gaps = 18/192 (9%)
 Frame = -2

Query  701  TTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagy  522
            TT+  +   T+    G  Y I ++ G LVL   V L SY C R                 
Sbjct  5    TTMSYSGDETDGNAGGFAYGIGVSVGVLVLIIIVTLLSYFCTRM----------------  48

Query  521  RNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGT  342
                P +   +      + +   +NDG +   V LGLD + + ++P+L+YS+   +   +
Sbjct  49   --RFPPNYPSFRRSSSAIRQLQLQNDGAAAGGVQLGLDDSALRNFPQLLYSQAKLHKSES  106

Query  341  TGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstp  162
            T   T CSICL +YKD+++LR+LPDC H FH+TCVD WL+L  +CP+CRNSP PTP++TP
Sbjct  107  TSTTTSCSICLGDYKDTDVLRLLPDCGHLFHLTCVDPWLRLRPTCPICRNSPAPTPIATP  166

Query  161  lSEVVPLSHYSD  126
            L+EV PL+   D
Sbjct  167  LAEVAPLAGRRD  178



>ref|XP_002525544.1| ring finger protein, putative [Ricinus communis]
 gb|EEF36803.1| ring finger protein, putative [Ricinus communis]
Length=188

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 94/173 (54%), Gaps = 13/173 (8%)
 Frame = -2

Query  704  LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  525
            ++T  P   P +   +GLGY IAIA   LVL ST++LASY C R         R    + 
Sbjct  1    MSTADP---PISAAGVGLGYGIAIAVSILVLISTIMLASYACIRVKGGGGNHTRRSNASS  57

Query  524  yRNSHPDDNGVYLPRII--FVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNP  351
              +S  D     + R+   F A  D      +G  + +GLD+ VI SYPK+V  +    P
Sbjct  58   SSSSSSDGGSSNIYRLSHSFAATGDS-----TGPMIMVGLDEPVIKSYPKIVLGESQRLP  112

Query  350  GGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
                 N+  CSICLC+Y+  +++R +PDC H FH  CVD WL ++A+CP+CRN
Sbjct  113  ---KPNNGPCSICLCDYQARDIIRCIPDCHHCFHAECVDEWLMMSATCPLCRN  162



>gb|KFK25096.1| hypothetical protein AALP_AA8G065900 [Arabis alpina]
Length=196

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 78/191 (41%), Positives = 103/191 (54%), Gaps = 34/191 (18%)
 Frame = -2

Query  695  VKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRN  516
            + P S P N   +GLGY IAIA   LVL ST++LASYIC           R  +   Y +
Sbjct  37   MSPTSPPAN--GVGLGYGIAIAVSILVLISTIMLASYIC----------IRSKSGRRYHH  84

Query  515  SHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGT  342
                  GV                G     V LGLD+ VI SYP++V   S+R   P   
Sbjct  85   QEATSEGVL---------------GSPATEVKLGLDRPVIESYPRIVLGDSRRLPRP---  126

Query  341  TGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstp  162
              N+  CSICLC+Y+  + +R +P+C H FH  CVD WL+ +A+CP+CR SP P+ L+TP
Sbjct  127  --NNGPCSICLCDYEARDPVRCIPECNHCFHADCVDEWLRTSATCPLCRYSPAPSRLATP  184

Query  161  lSEVVPLSHYS  129
            LS+ VPL+  S
Sbjct  185  LSDFVPLTFQS  195



>ref|NP_196321.1| putative RING-H2 finger protein [Arabidopsis thaliana]
 sp|Q9FL42.1|ATL69_ARATH RecName: Full=Putative RING-H2 finger protein ATL69 [Arabidopsis 
thaliana]
 dbj|BAB11162.1| C3HC4-type RING zinc finger protein-like [Arabidopsis thaliana]
 gb|AED91101.1| putative RING-H2 finger protein [Arabidopsis thaliana]
Length=159

 Score =   106 bits (265),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 102/193 (53%), Gaps = 45/193 (23%)
 Frame = -2

Query  695  VKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRN  516
            + P S P   + +GLGY IAIA   LVL S ++LASYIC                     
Sbjct  1    MSPISPPA--SGVGLGYGIAIAVSILVLISFIMLASYICI--------------------  38

Query  515  SHPDDNGVYLPRIIFVAEDDEENDGV-----SGQNVALGLDQAVINSYPKLVY--SKRSG  357
                       R      D+  +D V         V LGLD+ VI SYP++V   S+R  
Sbjct  39   -----------RSKSTGRDEATSDVVLDLPSPAAEVKLGLDRPVIESYPRIVLGDSRRLP  87

Query  356  NPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplpt  177
             P     N+  CSICLC+Y+  E +R +P+C H FH  CVD WL+ +A+CP+CRNSP P+
Sbjct  88   RP-----NNGPCSICLCDYEAREPVRCIPECNHCFHTDCVDEWLRTSATCPLCRNSPAPS  142

Query  176  plstplSEVVPLS  138
             L+TPLS++VPL+
Sbjct  143  RLATPLSDLVPLA  155



>ref|XP_002266804.1| PREDICTED: putative RING-H2 finger protein ATL69 [Vitis vinifera]
Length=174

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 106/198 (54%), Gaps = 31/198 (16%)
 Frame = -2

Query  704  LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  525
            ++T  P   P +   +GLGY IAIA   LVL ST++LASY C R  A+   R        
Sbjct  1    MSTATP---PESAAGVGLGYGIAIAVSILVLISTIMLASYACVRVKASGGTRA-------  50

Query  524  yRNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLV--YSKRSGNP  351
                   D+G         A D  E   V    V  GLD   I SYPK+V   S+R   P
Sbjct  51   -------DHGRPGTNRESTAVDLSELAAVV---VVAGLDGPAIESYPKMVLGQSRRLPRP  100

Query  350  GGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptpl  171
                 ND  CSICL EY+ +E +R +P+C H FH  C+D WL+++A+CP+CR+SP  +  
Sbjct  101  -----NDGPCSICLSEYRPNETVRSIPECNHCFHADCIDEWLRMSATCPICRSSPAVSAA  155

Query  170  ----stplSEVVPLSHYS  129
                +TPLSEVVPL+ ++
Sbjct  156  PTPLATPLSEVVPLAFHA  173



>ref|XP_010031027.1| PREDICTED: putative RING-H2 finger protein ATL69 [Eucalyptus 
grandis]
Length=168

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 76/181 (42%), Positives = 100/181 (55%), Gaps = 24/181 (13%)
 Frame = -2

Query  677  PTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDN  498
            P   T +GLGY IAIA   LVL ST++LASY C         R +        +    D 
Sbjct  7    PPAATGVGLGYGIAIAVSLLVLISTIMLASYAC--------VRVKSHNLRATSDGGDPDA  58

Query  497  GVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSY-PKLVYSKRSGNPGGTTGNDTLC  321
                PR   +              VA+G+D A I +Y PKLV  +    P    G    C
Sbjct  59   ADPTPRAAEI-------------MVAVGMDGAAIETYYPKLVLGESKRLPKHNEGGH--C  103

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPL  141
            SICL EY+  +++R +P+C H FH  CVDAWL+++A+CP+CR+SP PTPL+TPLSEVVPL
Sbjct  104  SICLAEYEAKDVIRCVPECSHCFHAACVDAWLRVSATCPLCRSSPAPTPLATPLSEVVPL  163

Query  140  S  138
            +
Sbjct  164  A  164



>emb|CBI35066.3| unnamed protein product [Vitis vinifera]
Length=191

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 79/198 (40%), Positives = 106/198 (54%), Gaps = 31/198 (16%)
 Frame = -2

Query  704  LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  525
            ++T  P   P +   +GLGY IAIA   LVL ST++LASY C R  A+   R        
Sbjct  1    MSTATP---PESAAGVGLGYGIAIAVSILVLISTIMLASYACVRVKASGGTRA-------  50

Query  524  yRNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLV--YSKRSGNP  351
                   D+G         A D  E   V    V  GLD   I SYPK+V   S+R   P
Sbjct  51   -------DHGRPGTNRESTAVDLSELAAVV---VVAGLDGPAIESYPKMVLGQSRRLPRP  100

Query  350  GGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptpl  171
                 ND  CSICL EY+ +E +R +P+C H FH  C+D WL+++A+CP+CR+SP  +  
Sbjct  101  -----NDGPCSICLSEYRPNETVRSIPECNHCFHADCIDEWLRMSATCPICRSSPAVSAA  155

Query  170  ----stplSEVVPLSHYS  129
                +TPLSEVVPL+ ++
Sbjct  156  PTPLATPLSEVVPLAFHA  173



>ref|XP_004146803.1| PREDICTED: putative RING-H2 finger protein ATL69 [Cucumis sativus]
 gb|KGN47764.1| hypothetical protein Csa_6G401350 [Cucumis sativus]
Length=163

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 105/192 (55%), Gaps = 30/192 (16%)
 Frame = -2

Query  704  LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  525
            +++  P S+P   T +GLGY IAIA   LV  STV+L SY C R  +A  R         
Sbjct  1    MSSAHPPSSPA--TGLGLGYGIAIAVSILVFISTVMLISYACIRVKSATTRPSASLPSPP  58

Query  524  yRNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG  345
                 P DN V L                      +GL  ++I SYPKLV  +    P  
Sbjct  59   T----PVDNVVVL---------------------MVGLHGSIIESYPKLVLGESRRLPPP  93

Query  344  TTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplst  165
              G    CSICL +YK  + +R +PDC+H FH  CVD WL+++A+CP+CRNSP PTPL+T
Sbjct  94   NNGP---CSICLSDYKPHDSVRCIPDCRHCFHSDCVDQWLRMSATCPLCRNSPAPTPLAT  150

Query  164  plSEVVPLSHYS  129
            PLSE+VPL+ ++
Sbjct  151  PLSELVPLASHA  162



>ref|XP_006399182.1| hypothetical protein EUTSA_v10014903mg [Eutrema salsugineum]
 gb|ESQ40635.1| hypothetical protein EUTSA_v10014903mg [Eutrema salsugineum]
Length=157

 Score =   105 bits (263),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 75/187 (40%), Positives = 101/187 (54%), Gaps = 43/187 (23%)
 Frame = -2

Query  677  PTN--FTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPD  504
            PTN   T +GLGY IAIA   LVL ST++LASYIC                         
Sbjct  3    PTNPPATGVGLGYGIAIAVSILVLISTIMLASYICI------------------------  38

Query  503  DNGVYLPRIIFVAEDDEENDGVSGQ---NVALGLDQAVINSYPKLVY--SKRSGNPGGTT  339
                   R  +    +  ++GV G     V +GLD+ VI SYP++V   S R   P    
Sbjct  39   -------RSKYAGRYEATSEGVVGSPAAEVKIGLDRPVIESYPRIVLGDSLRLPRP----  87

Query  338  GNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstpl  159
             N+  CSICL +Y+  + +R +P+C H FH  CVD WL+ +A+CP+CRNSP P+ L+TPL
Sbjct  88   -NNGPCSICLSDYEAKDPVRCIPECNHCFHADCVDEWLRTSATCPLCRNSPAPSTLATPL  146

Query  158  SEVVPLS  138
            S+ VPL+
Sbjct  147  SDFVPLA  153



>ref|XP_002873260.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49519.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=197

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 101/176 (57%), Gaps = 8/176 (5%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            GL Y I ++ G L+L +T+ L SY C RS  +             R +    NG   P  
Sbjct  22   GLAYGIGVSIGILMLITTITLTSYYCTRSHISASPTTTPRTRRRRRET----NGTLQPGQ  77

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTLCSICLCE  303
                 + +END V  +   +GL++ VI S+PKL Y  ++ S +    +   + CSICL +
Sbjct  78   DQFDFEGDENDTVVVE--VMGLNEEVIKSFPKLPYEEARVSYSLQKESSTTSCCSICLAD  135

Query  302  YKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSH  135
            YK  +M+R+LPDC H FH TCVD WL+L+ +CPVCR SPLP+P  TP+++VVP S 
Sbjct  136  YKKMDMIRVLPDCNHLFHDTCVDPWLRLHPTCPVCRTSPLPSPAMTPVADVVPFSR  191



>ref|XP_010491302.1| PREDICTED: putative RING-H2 finger protein ATL69 [Camelina sativa]
Length=160

 Score =   105 bits (261),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 106/193 (55%), Gaps = 44/193 (23%)
 Frame = -2

Query  695  VKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRN  516
            + P S P   + +GLGY IAIA   LVL S ++LASYIC RS +  R             
Sbjct  1    MSPISPPA--SGVGLGYGIAIAVSILVLISFIMLASYICIRSKSTGR-------------  45

Query  515  SHPDDNGVYLPRIIFVAEDDEENDGV-----SGQNVALGLDQAVINSYPKLVY--SKRSG  357
                             ++   +DGV         V LGLD+ VI SYP++V   S+R  
Sbjct  46   -----------------DEATTSDGVLEWPSPAAVVKLGLDRPVIESYPRIVLGDSRRLP  88

Query  356  NPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplpt  177
             P     N+  CSICLC+Y+  E +R +P+C H FH  CVD WL+ +A+CP+CRNSP P+
Sbjct  89   RP-----NNGPCSICLCDYEAREPVRCIPECNHCFHTDCVDEWLRTSATCPLCRNSPAPS  143

Query  176  plstplSEVVPLS  138
             L+TPLS++VPL+
Sbjct  144  RLATPLSDLVPLA  156



>ref|XP_010423262.1| PREDICTED: putative RING-H2 finger protein ATL69 [Camelina sativa]
Length=160

 Score =   104 bits (260),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 103/193 (53%), Gaps = 44/193 (23%)
 Frame = -2

Query  695  VKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRN  516
            + P S P   + +GLGY IAIA   LVL S ++LASYIC                     
Sbjct  1    MSPISPPA--SGVGLGYGIAIAVSILVLISFIMLASYIC-----------------IRSK  41

Query  515  SHPDDNGVYLPRIIFVAEDDEENDGV-----SGQNVALGLDQAVINSYPKLVY--SKRSG  357
            S   D  +              +DGV         V LGLD+ VI SYP++V   S+R  
Sbjct  42   STGRDEAM-------------TSDGVLEWPSPAAVVKLGLDRPVIESYPRIVLGDSRRLP  88

Query  356  NPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplpt  177
             P     N+  CSICLC+Y+  E +R +P+C H FH  CVD WL+ +A+CP+CRNSP P+
Sbjct  89   RP-----NNGPCSICLCDYEAREPVRCIPECNHCFHTDCVDEWLRTSATCPLCRNSPAPS  143

Query  176  plstplSEVVPLS  138
             L+TPLS++VPL+
Sbjct  144  RLATPLSDLVPLA  156



>ref|XP_009786544.1| PREDICTED: RING-H2 finger protein ATL70-like [Nicotiana sylvestris]
Length=173

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 61/109 (56%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = -2

Query  464  EDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEM  285
             ++  N+ V    V LGLD+  + SYPKL+YS+   N   +T   T CSICL +YK+S+M
Sbjct  62   RNENSNEDVQEVVVELGLDEETLLSYPKLLYSEAKVNHKDSTA--TCCSICLADYKNSDM  119

Query  284  LRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            L++LPDC H FH+ CVD WL+LN +CPVCR SPLPTP STPL+EVVPL+
Sbjct  120  LKLLPDCDHLFHLKCVDPWLRLNPTCPVCRTSPLPTPQSTPLAEVVPLA  168



>ref|XP_008786940.1| PREDICTED: putative RING-H2 finger protein ATL69 [Phoenix dactylifera]
Length=176

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/157 (38%), Positives = 77/157 (49%), Gaps = 25/157 (16%)
 Frame = -2

Query  659  IGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPR  480
            +GLGY IAIA G LVL ST++LASY+C                A   NS P       P 
Sbjct  18   VGLGYGIAIAVGLLVLVSTIMLASYVC--------------VRAKGNNSSPRSTAAAAPS  63

Query  479  IIFVAEDDEENDGVSGQNVALGLDQAVINSY-PKLVYSKRSGNPGGTTGNDTLCSICLCE  303
                     +    +   V +GLD+  I +Y PK VY        G       C ICL E
Sbjct  64   STVAGGTPPD----AAAFVVVGLDRPAIEAYYPKFVYK------AGMAAAPGPCPICLAE  113

Query  302  YKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            Y+  E LR +P+C H FH  CVD WL+++A+CP+CR+
Sbjct  114  YEGEEALRRVPECGHCFHADCVDEWLRVSATCPLCRS  150



>ref|XP_010452652.1| PREDICTED: putative RING-H2 finger protein ATL69 [Camelina sativa]
Length=160

 Score =   104 bits (259),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/193 (40%), Positives = 103/193 (53%), Gaps = 44/193 (23%)
 Frame = -2

Query  695  VKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRN  516
            + P S P   + +GLGY IAIA   LVL S ++LASYIC                     
Sbjct  1    MSPISPPA--SGVGLGYGIAIAVSILVLISFIMLASYIC-----------------IRSK  41

Query  515  SHPDDNGVYLPRIIFVAEDDEENDGV-----SGQNVALGLDQAVINSYPKLVY--SKRSG  357
            S   D  +              +DGV         V LGLD+ VI SYP++V   S+R  
Sbjct  42   STGRDEAM-------------TSDGVLEWPSPAAVVKLGLDRPVIESYPRIVLGDSQRLP  88

Query  356  NPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplpt  177
             P     N+  CSICLC+Y+  E +R +P+C H FH  CVD WL+ +A+CP+CRNSP P+
Sbjct  89   RP-----NNGPCSICLCDYEAREPVRCIPECNHCFHTDCVDEWLRTSATCPLCRNSPAPS  143

Query  176  plstplSEVVPLS  138
             L+TPLS++VPL+
Sbjct  144  RLATPLSDLVPLA  156



>ref|XP_006481618.1| PREDICTED: RING-H2 finger protein ATL70-like [Citrus sinensis]
Length=178

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 115/198 (58%), Gaps = 30/198 (15%)
 Frame = -2

Query  701  TTVKPNSAPTNFTTIG-LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  525
            TTVK +      + IG  GY I ++ G L+L +T+ LASY C         R +   +  
Sbjct  5    TTVKASDGFLGSSNIGGFGYGIGVSVGILILITTITLASYFC--------TRGQQQQQTT  56

Query  524  yRNSHPDDNGVYLPRIIFVAEDDEENDGVSGQN-----VALGLDQAVINSYPKLVYSKRS  360
             + S+ ++ G              +NDG +  N     + +GLD++ I SYPKL YS+  
Sbjct  57   NQRSNNNNRG--------------QNDGGADHNQSSIVIDVGLDESTIKSYPKLPYSEAR  102

Query  359  GNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplp  180
                 +T   T CSICL +Y+ S+MLR+LPDC H FHV CVD WL+L+ +CPVCR SPLP
Sbjct  103  LQKKDSTA--TCCSICLADYRSSDMLRLLPDCSHLFHVKCVDPWLRLHPTCPVCRTSPLP  160

Query  179  tplstplSEVVPLSHYSD  126
            TPLSTPL+EVVPL+  +D
Sbjct  161  TPLSTPLAEVVPLAARTD  178



>ref|XP_006494565.1| PREDICTED: putative RING-H2 finger protein ATL69-like [Citrus 
sinensis]
Length=184

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 99/179 (55%), Gaps = 26/179 (15%)
 Frame = -2

Query  653  LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRII  474
            LGY IAIA   LVL ST++LASY C          R     +   N  PD + V      
Sbjct  22   LGYGIAIAVSILVLISTIMLASYAC--IRVKANANRGGGGSSSNSNPTPDFDAV------  73

Query  473  FVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGND-TLCSICLCEYK  297
                    + G++G  V LGLD  VIN+YPK++  +    P     ND   CSICLC+YK
Sbjct  74   --------DSGLAGVLV-LGLDGTVINTYPKIILGESMRMP---RPNDYGPCSICLCDYK  121

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDGR  120
              + +R +PDC H FH  CVD WL+++A+CP+CR+       +TPL+EVVPL+ ++ G+
Sbjct  122  PKDSVRCIPDCHHCFHADCVDEWLRMSATCPLCRS-----SPATPLAEVVPLASHARGK  175



>ref|NP_196267.1| putative RING-H2 finger protein ATL71 [Arabidopsis thaliana]
 sp|Q9FG21.1|ATL71_ARATH RecName: Full=Putative RING-H2 finger protein ATL71 [Arabidopsis 
thaliana]
 dbj|BAB11398.1| C3HC4-type RING zinc finger protein-like [Arabidopsis thaliana]
 gb|AED91023.1| putative RING-H2 finger protein ATL71 [Arabidopsis thaliana]
Length=197

 Score =   105 bits (261),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 99/176 (56%), Gaps = 8/176 (5%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            GL Y I ++ G L+L +T+ L SY C RS  +             R S    NG   P  
Sbjct  22   GLAYGIGVSIGILMLITTITLTSYYCTRSHISASPTTTPRTRRRQRES----NGTLPPGQ  77

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTLCSICLCE  303
                 +D+E+D V  +   LGL + VI  +PKL Y  ++ S +    +   + CSICL +
Sbjct  78   ERFDFEDDESDTVVVE--VLGLTEEVIKGFPKLPYEEARVSYSLQKESSTTSCCSICLAD  135

Query  302  YKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSH  135
            YK  +M+R+LPDC H FH  CVD WL+L+ +CPVCR SPLP+P  TP+++VVP S 
Sbjct  136  YKKMDMIRVLPDCNHLFHDNCVDPWLRLHPTCPVCRTSPLPSPAMTPVADVVPFSR  191



>ref|XP_006430043.1| hypothetical protein CICLE_v10013347mg [Citrus clementina]
 gb|ESR43283.1| hypothetical protein CICLE_v10013347mg [Citrus clementina]
 gb|KDO70651.1| hypothetical protein CISIN_1g037839mg [Citrus sinensis]
Length=177

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 84/198 (42%), Positives = 115/198 (58%), Gaps = 30/198 (15%)
 Frame = -2

Query  701  TTVKPNSAPTNFTTIG-LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  525
            TTVK +      + IG  GY I ++ G L+L +T+ LASY C         R +   +  
Sbjct  4    TTVKASDGFLGSSNIGGFGYGIGVSVGILILITTITLASYFC--------TRGQQQQQTT  55

Query  524  yRNSHPDDNGVYLPRIIFVAEDDEENDGVSGQN-----VALGLDQAVINSYPKLVYSKRS  360
             + S+ ++ G              +NDG +  N     + +GLD++ I SYPKL YS+  
Sbjct  56   NQRSNNNNRG--------------QNDGGADHNQSSIVIDVGLDESTIKSYPKLPYSEAR  101

Query  359  GNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplp  180
                 +T   T CSICL +Y+ S+MLR+LPDC H FHV CVD WL+L+ +CPVCR SPLP
Sbjct  102  LQKKDSTA--TCCSICLADYRSSDMLRLLPDCSHLFHVKCVDPWLRLHPTCPVCRTSPLP  159

Query  179  tplstplSEVVPLSHYSD  126
            TPLSTPL+EVVPL+  +D
Sbjct  160  TPLSTPLAEVVPLAARTD  177



>ref|XP_009766603.1| PREDICTED: RING-H2 finger protein ATL70 [Nicotiana sylvestris]
Length=167

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 72/178 (40%), Positives = 96/178 (54%), Gaps = 34/178 (19%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY + ++ G ++L +T+   SY C R+                             R 
Sbjct  24   GFGYTVGVSAGIVLLIATITFTSYFCTRNQ----------------------------RT  55

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
                 +  E+  V    V +G+D+  + SYPKL+YS+   N   +T N   CSICL +Y 
Sbjct  56   PLRTANRNEHSCV----VEMGIDEKTLLSYPKLLYSEAKVNYKDSTAN--CCSICLADYN  109

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDG  123
              +MLR+LPDC H FH+ CVD WL LN+SCPVCRNSPLPTPLSTPL+EVVP +    G
Sbjct  110  SKDMLRLLPDCGHLFHLKCVDPWLLLNSSCPVCRNSPLPTPLSTPLAEVVPFASRPSG  167



>ref|XP_002524078.1| ring finger protein, putative [Ricinus communis]
 gb|EEF38288.1| ring finger protein, putative [Ricinus communis]
Length=172

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/177 (43%), Positives = 104/177 (59%), Gaps = 22/177 (12%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY I ++ G L+L +T+ LASY C                     +H         R 
Sbjct  18   GFGYGIGVSIGILLLITTITLASYFC-------------------TRNHQQQQQSMQTRR  58

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
               +E+   +D +    V +G+D+A + +YPKL+YS+   +   TT   T CSICL +YK
Sbjct  59   RNRSEE-PPDDRLQDIVVEVGIDEATLKNYPKLLYSQAKLHNTDTTA--TCCSICLADYK  115

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
             ++MLR+LPDC H FH+ CVD WL+L+ +CPVCRNSPLPTPLSTPL+EVVPL+   D
Sbjct  116  STDMLRLLPDCGHLFHLKCVDPWLRLHPTCPVCRNSPLPTPLSTPLAEVVPLASRRD  172



>ref|XP_009396462.1| PREDICTED: RING-H2 finger protein ATL70-like [Musa acuminata 
subsp. malaccensis]
Length=171

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 97/189 (51%), Gaps = 38/189 (20%)
 Frame = -2

Query  674  TNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNG  495
            +N    GL Y +  + G L++ +  LLASY+C                            
Sbjct  18   SNGRPAGLAYGLPASVGILMVITAALLASYLCT---------------------------  50

Query  494  VYLPRIIFVAEDDEEND-GVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCS  318
                R    A +    D   +  ++  G+D+A + SYPK+ YS+      GTT     CS
Sbjct  51   ----RARTTAANRRSGDVAATPTDLEAGIDEATLTSYPKVTYSQAKLEEKGTT-TAACCS  105

Query  317  ICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            ICL +Y+D+++LR+LPDC H FH+ CVD WL+ + SCP CR+SP P+ + TPLSEVVPL+
Sbjct  106  ICLSDYEDADVLRLLPDCGHLFHLDCVDPWLRAHRSCPNCRSSPAPSSMPTPLSEVVPLA  165

Query  137  HYSDGRRRQ  111
                 R RQ
Sbjct  166  -----RARQ  169



>gb|KJB36246.1| hypothetical protein B456_006G148300 [Gossypium raimondii]
Length=169

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/178 (43%), Positives = 99/178 (56%), Gaps = 27/178 (15%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY I ++ G L+L +T+ LASY C                     + P       P  
Sbjct  19   GFGYGIGVSVGILLLITTITLASYFC-------------------TRTQPPQGA---PAR  56

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
                E + + D +    V +GLD+  I SYPKL+YS+       +T   + CSICL +YK
Sbjct  57   RTRQEPNIDPDSLV---VDVGLDEETIKSYPKLLYSEAKLQKKDSTA--SCCSICLADYK  111

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDG  123
             S+MLR+LPDC H FH+ CVD WL+LN +CPVCR SP+ TPLSTPL+EVVPLS    G
Sbjct  112  SSDMLRLLPDCNHLFHLKCVDPWLRLNPTCPVCRTSPIQTPLSTPLAEVVPLSTRQGG  169



>ref|XP_011620724.1| PREDICTED: putative RING-H2 finger protein ATL69 [Amborella trichopoda]
 gb|ERM99091.1| hypothetical protein AMTR_s00101p00120240 [Amborella trichopoda]
Length=172

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/158 (39%), Positives = 83/158 (53%), Gaps = 24/158 (15%)
 Frame = -2

Query  665  TTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYL  486
            T +GLGY IAIA G LVL ST++LASY C                   RN+        +
Sbjct  14   TKVGLGYGIAIAVGLLVLVSTIMLASYAC-----------VKVKGRSSRNTADSSFQATV  62

Query  485  PRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLC  306
            P  +       EN       +  GLD+  I+ +P++V+ +    P     ND  C ICL 
Sbjct  63   PDFL-----TPEN-----HFIMTGLDEQSISGFPRVVFRRAQDIPRPV--NDG-CPICLG  109

Query  305  EYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            E++  E++R +PDC H FHV+C+D WL+LN SCPVCRN
Sbjct  110  EFRKGEVIRWVPDCLHCFHVSCIDGWLRLNGSCPVCRN  147



>ref|XP_010553415.1| PREDICTED: RING-H2 finger protein ATL70 [Tarenaya hassleriana]
Length=186

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/171 (43%), Positives = 99/171 (58%), Gaps = 24/171 (14%)
 Frame = -2

Query  647  YAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRIIFV  468
            Y I ++ G L+L +T+ LASY C RS  +  +  R +       +H DD  V++  I   
Sbjct  27   YGIGVSIGVLLLITTITLASYYCTRSQLSHPQPSRTNHNV----THVDDGLVHVIHIP--  80

Query  467  AEDDEENDGVSGQNVALGLDQAVINSYPKLVYSK-RSGNPGGTTGNDTLCSICLCEYKDS  291
                             GLD+  I  YPK++YS+ +    G      + CSICL +YK S
Sbjct  81   -----------------GLDEDTIRGYPKILYSEAKVMKRGSDDSTTSCCSICLGDYKTS  123

Query  290  EMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            ++LR LPDC H FHV CVD WL+LN +CPVCR SPLPTP++TPL+EVVPL+
Sbjct  124  DLLRQLPDCNHMFHVKCVDTWLRLNPTCPVCRTSPLPTPVATPLAEVVPLA  174



>ref|XP_010263056.1| PREDICTED: RING-H2 finger protein ATL70-like [Nelumbo nucifera]
Length=169

 Score =   103 bits (257),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/193 (38%), Positives = 101/193 (52%), Gaps = 28/193 (15%)
 Frame = -2

Query  701  TTVKPNSAPTNFTTIG-LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  525
            T   PN+       IG  GY I I+ G L+  +T+ LASY C                  
Sbjct  4    TDPSPNNGLLGAKNIGAFGYGIGISVGILLAITTITLASYFC------------------  45

Query  524  yRNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGG  345
               +H D     +P          +  G     +  G+D A + SYPKL+YS+       
Sbjct  46   ---THNDQ----MPSSDQPQRRSAQRSGQHTVTIEEGVDAATLLSYPKLLYSQAKLRSND  98

Query  344  TTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplst  165
            +T   + CSICL +YK++++LR+LP C H FH+ CVD WL+L  +CPVCR SP+PTPLST
Sbjct  99   STA--SCCSICLADYKNTDVLRLLPGCGHLFHLNCVDPWLRLRPTCPVCRTSPIPTPLST  156

Query  164  plSEVVPLSHYSD  126
            PL+EVVPL+   +
Sbjct  157  PLAEVVPLASRRE  169



>ref|XP_009397427.1| PREDICTED: RING-H2 finger protein ATL70-like [Musa acuminata 
subsp. malaccensis]
Length=190

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 92/173 (53%), Gaps = 16/173 (9%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY + ++ G L+L +T+ LASY C                     S          R 
Sbjct  28   GFGYGLGVSIGMLLLITTITLASYFC---------------TRATTASPTAGPPPPPHRA  72

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
                  ++E    +G +V  G+D+  + SYPK+ YS          G  + CSICL +YK
Sbjct  73   AARRPAEQETTAAAGGDVEAGIDEDTLKSYPKVRYSHAKLR-RDVAGAASCCSICLSDYK  131

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            D+++LR LP+C H FHV CVD WL+L  +CP+CR SPLP+PL TPL++ VPLS
Sbjct  132  DADVLRALPECGHLFHVKCVDPWLRLRPTCPLCRTSPLPSPLPTPLADAVPLS  184



>ref|XP_011024142.1| PREDICTED: RING-H2 finger protein ATL70-like [Populus euphratica]
Length=165

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 95/175 (54%), Gaps = 30/175 (17%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G  YAI ++ G L L  ++ LA+Y C                           GV  P  
Sbjct  15   GYAYAIGMSSGVLFLILSITLAAYFC-------------------------TRGVDSPPH  49

Query  476  IFVAEDD--EENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCE  303
                + D   ++D +  +   LGL++A + SYPKL YSK    P G     + CSICL +
Sbjct  50   TATNQGDFITDHDSIVTE---LGLNEASLASYPKLPYSKARLEPRGNDLLPSCCSICLGD  106

Query  302  YKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            YKDS+M+R+LPDC H FH+ CVD WL+L+ +CP+CR SP+PT LS PL+E  PL+
Sbjct  107  YKDSDMIRLLPDCGHVFHLKCVDCWLRLHPTCPICRKSPMPTTLSAPLAEEAPLA  161



>ref|XP_010910949.1| PREDICTED: RING-H2 finger protein ATL70-like [Elaeis guineensis]
Length=176

 Score =   103 bits (256),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 96/173 (55%), Gaps = 32/173 (18%)
 Frame = -2

Query  647  YAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRIIFV  468
            Y   ++ G L+L + + ++SY C                          N V  PR    
Sbjct  36   YGAGVSVGILLLITIITVSSYYC--------------------------NRVNTPR----  65

Query  467  AEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSE  288
                ++    +  +V  G+D+A + +YPK++YS+      G T   + CSICL +YKDS+
Sbjct  66   PAPPDDGATTAAADVEAGIDEATLMNYPKVLYSETKLRDKGATS--SCCSICLADYKDSD  123

Query  287  MLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYS  129
            +LR LPDC+H FHV CVD WL+LN +CP+CR SPLPTPL TPL+EVVPL+  S
Sbjct  124  VLRDLPDCRHVFHVKCVDPWLRLNPTCPLCRTSPLPTPLPTPLAEVVPLARQS  176



>ref|XP_008241078.1| PREDICTED: RING-H2 finger protein ATL70 [Prunus mume]
Length=168

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 76/179 (42%), Positives = 105/179 (59%), Gaps = 30/179 (17%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY I ++ G L+L +T+ LASY C R+                  +H ++N +  P +
Sbjct  18   GFGYGIGVSVGILLLITTITLASYFCTRTQQPPAPA-----------THRNNNTLDPPDL  66

Query  476  IFVAEDDEENDGVSGQN--VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCE  303
                           QN  V +GLD + I SYPK++YS+      G+T   + CSICL +
Sbjct  67   ---------------QNFVVDIGLDDSTIESYPKMLYSEAKLQKTGSTA--SCCSICLAD  109

Query  302  YKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
            YK ++ LR+LPDCKH FH+ CVD WL+L+ +CPVCR SP+PTPLSTPL+EVVPL+   D
Sbjct  110  YKGTDTLRLLPDCKHLFHLKCVDPWLRLHPTCPVCRTSPIPTPLSTPLAEVVPLASRRD  168



>ref|XP_006289981.1| hypothetical protein CARUB_v10003611mg [Capsella rubella]
 gb|EOA22879.1| hypothetical protein CARUB_v10003611mg [Capsella rubella]
Length=161

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/180 (38%), Positives = 88/180 (49%), Gaps = 43/180 (24%)
 Frame = -2

Query  653  LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRII  474
            LGY IAIA   LVL S ++LASYIC                     S     G       
Sbjct  13   LGYGIAIAVSILVLISFIMLASYIC-------------------IRSKSTGRG-------  46

Query  473  FVAEDDEENDGV-----SGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  309
               ++   +DG          V LGLD+ VI SYPK+V       P   +G    CSICL
Sbjct  47   ---DEARTSDGALDSPSPAAEVKLGLDRPVIESYPKIVLGDSRRLPRPNSGP---CSICL  100

Query  308  CEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYS  129
            C+Y+  E +R +P+C H FH  CVD WL+ +A+CP+CRNSP P+ L        PLSH+S
Sbjct  101  CDYEAREPVRCIPECNHCFHTDCVDEWLRTSATCPLCRNSPAPSRL------ATPLSHFS  154



>ref|XP_009623417.1| PREDICTED: RING-H2 finger protein ATL70-like [Nicotiana tomentosiformis]
Length=181

 Score =   102 bits (255),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 99/169 (59%), Gaps = 17/169 (10%)
 Frame = -2

Query  650  GYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRIIF  471
            GY I  + G LVL + +  ASY+C R+ +           +    S      V   +++F
Sbjct  27   GYGIGFSLGILVLLAIIAYASYLCIRTRSRNNSNVPNFNPSSSHGSSMTTITVDNDQLVF  86

Query  470  VAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDS  291
            + +               GL++ ++ +YPKL+YS+   + G    + + CSICL +YKDS
Sbjct  87   IQQ---------------GLNEDILRNYPKLLYSEAKVHKG--EFDVSGCSICLADYKDS  129

Query  290  EMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVP  144
            ++LR+LPDC H FHV C+D WL+L+ +CP+CRNSPLPTPL+TPL EV+P
Sbjct  130  DLLRILPDCGHIFHVKCIDPWLRLHTTCPICRNSPLPTPLTTPLVEVIP  178



>ref|XP_012074288.1| PREDICTED: RING-H2 finger protein ATL70-like [Jatropha curcas]
 gb|KDP36092.1| hypothetical protein JCGZ_08736 [Jatropha curcas]
Length=175

 Score =   102 bits (254),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 100/177 (56%), Gaps = 23/177 (13%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY I ++ G L+L +T+ LASY C R    +             +  P+     L  I
Sbjct  22   GFGYGIGVSIGILLLITTITLASYFCTRQQQQQPSSTASRRGNNTEDQPPE-----LQNI  76

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
            +                V +GLD+A + SYPKL+YS+       +T   + CSICL +YK
Sbjct  77   V----------------VEVGLDEATLKSYPKLLYSEAKIQKKDSTA--SCCSICLADYK  118

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
             ++MLR+LPDC H FH+ CVD WL+ + +CPVCR SPLPTPLSTPL+EVVPL+   D
Sbjct  119  STDMLRLLPDCGHLFHLKCVDQWLRRHPTCPVCRTSPLPTPLSTPLAEVVPLASRRD  175



>ref|XP_006432382.1| hypothetical protein CICLE_v10003203mg [Citrus clementina]
 gb|ESR45622.1| hypothetical protein CICLE_v10003203mg [Citrus clementina]
Length=176

 Score =   102 bits (254),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 94/176 (53%), Gaps = 23/176 (13%)
 Frame = -2

Query  653  LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRII  474
            LGY IAIA   LVL ST++LASY C                    N      G       
Sbjct  22   LGYGIAIAVSILVLISTIMLASYAC-------------IRVKANANRGGGSGGGSSSNSN  68

Query  473  FVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGND-TLCSICLCEYK  297
                 D  + G++G  V LGLD  VIN++PK++  +    PG    ND   CSICLC+YK
Sbjct  69   PTPNFDAVDSGLAGVLV-LGLDGTVINTFPKIILGESMRMPGP---NDYGPCSICLCDYK  124

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYS  129
              + +R +PDC H FH  CVD WL+++A+CP+CR+       +TPL+EVVPL+ ++
Sbjct  125  PKDSVRCIPDCHHCFHADCVDEWLRMSATCPLCRS-----SPATPLAEVVPLASHA  175



>ref|XP_010491212.1| PREDICTED: putative RING-H2 finger protein ATL71 [Camelina sativa]
Length=199

 Score =   102 bits (255),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 101/177 (57%), Gaps = 8/177 (5%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            GL Y I ++ G L+L +T+ LASY C RS                R +   +  +   + 
Sbjct  22   GLAYGIGVSIGILMLITTITLASYYCTRSHINASPTTTPRTRRRQRET---NETLQAGQE  78

Query  476  IFVAE-DDEENDGVSGQNVALGLDQAVINSYPKLVYSKR--SGNPGGTTGNDTLCSICLC  306
             F  E DD++ND V  +   LGL+  VI S+PKL Y +   S +    + + T CSICL 
Sbjct  79   GFNFEGDDDQNDTVVVE--VLGLNDEVIKSFPKLAYEEACVSYSLQRESSSTTCCSICLA  136

Query  305  EYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSH  135
            EYK  +M+R+LPDC H FH  CVD WLKL+ +CPVCR SPLP+P  TP+++VV  S 
Sbjct  137  EYKKKDMIRVLPDCNHLFHDKCVDPWLKLHPTCPVCRTSPLPSPAITPVADVVSFSR  193



>ref|XP_002308329.2| hypothetical protein POPTR_0006s21610g [Populus trichocarpa]
 gb|EEE91852.2| hypothetical protein POPTR_0006s21610g [Populus trichocarpa]
Length=167

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 77/100 (77%), Gaps = 2/100 (2%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            V +GLD+A +NSYP L+YS+   +  G+T   T CSICL +YK+++ LR+LPDC H FH+
Sbjct  70   VDIGLDEATLNSYPTLLYSEAKLHKTGSTA--TCCSICLADYKNTDKLRLLPDCGHLFHL  127

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
             CVD WL+L+ +CPVCR SPLP+PL+TPL+EVVPL+   D
Sbjct  128  RCVDPWLRLHPTCPVCRTSPLPSPLATPLAEVVPLASRRD  167



>gb|KEH32994.1| zinc finger, C3HC4 type (RING finger) protein [Medicago truncatula]
Length=177

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 87/173 (50%), Gaps = 27/173 (16%)
 Frame = -2

Query  701  TTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagy  522
            T   P+S     T +GLGY I IA   LVL ST++L SY+C                   
Sbjct  3    TAEPPSSTTITTTGVGLGYGITIAVSILVLISTIMLVSYLC-----------------VR  45

Query  521  RNSHPDDNGVYLPRIIFVAEDDEENDGVSGQN-VALGLDQAVINSYPKLVY--SKRSGNP  351
              SH   +  +L   I        N G++      +GL++ +I SYPK++   S+R   P
Sbjct  46   IKSHGRRDSFHL--DIHHQPHTTINSGLAQPGPFIMGLEKPMIESYPKMILGESRRLPKP  103

Query  350  GGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
             G       C+ICL +Y   E +R +PDC+H FH  CVD WLK++A+CP+CRN
Sbjct  104  NGGQ-----CAICLTDYLPKETIRCVPDCQHCFHADCVDEWLKMSATCPLCRN  151



>gb|AAX92713.1| zinc finger family protein [Picea abies]
Length=97

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 2/94 (2%)
 Frame = -2

Query  416  GLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCV  237
            GLDQ  I+SYPK+++S+    P   T  DT CSICL EY+  E+LR++PDC+H FH +C+
Sbjct  6    GLDQKTIDSYPKILFSRHQKLP--LTCQDTWCSICLGEYEYKEVLRLMPDCRHCFHASCI  63

Query  236  DAWLKLNASCPVCRNsplptplstplSEVVPLSH  135
            DAWLKLNASCP+CR SPLP+PL TPLS ++PL+ 
Sbjct  64   DAWLKLNASCPLCRTSPLPSPLPTPLSGLIPLAR  97



>ref|XP_010106981.1| RING-H2 finger protein ATL70 [Morus notabilis]
 gb|EXC12979.1| RING-H2 finger protein ATL70 [Morus notabilis]
Length=173

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 103/177 (58%), Gaps = 21/177 (12%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY I ++ G L+L +++ LASY C                   R+  P  +     R 
Sbjct  18   GFGYGIGVSVGILLLITSITLASYFC------------------TRSQLPPSSAAAARRN  59

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
            +  A + E N  +    + +GLD+A I SYPKL YS+   +    + + + CSICL +YK
Sbjct  60   VGPANNPEPN--LPNFVIDVGLDEATIKSYPKLPYSEAKLH-KANSTSSSCCSICLADYK  116

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
             ++MLR LPDC H FHV CVD WL+L+ +CPVCR SP+PTPLSTPL+EVVPL+   D
Sbjct  117  TTDMLRQLPDCGHLFHVKCVDPWLRLHPTCPVCRTSPIPTPLSTPLAEVVPLATRRD  173



>ref|XP_011024141.1| PREDICTED: putative RING-H2 finger protein ATL71 [Populus euphratica]
Length=146

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYS--KRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYF  252
            + +GLD+A +N+YPKL+YS  K     G  +   + CSICL +YKDSE+LR+LPDC H F
Sbjct  67   IEIGLDEATLNTYPKLLYSEAKEKLEKGDESVAASCCSICLADYKDSELLRLLPDCDHLF  126

Query  251  HVTCVDAWLKLNASCPVCRN  192
            H  C+D WLKL+ +CP+CRN
Sbjct  127  HAQCIDPWLKLHTTCPMCRN  146



>ref|XP_011035614.1| PREDICTED: RING-H2 finger protein ATL70-like [Populus euphratica]
 ref|XP_011046440.1| PREDICTED: RING-H2 finger protein ATL70 [Populus euphratica]
Length=167

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 82/110 (75%), Gaps = 4/110 (4%)
 Frame = -2

Query  449  NDGVSGQN--VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRM  276
            +  ++ QN  V +GLD+A +NSYP L+YS+   +  G+T   T CSICL +YK+++ LR+
Sbjct  60   DQQLNQQNFVVDIGLDEATLNSYPTLLYSEAKLHKTGSTA--TCCSICLADYKNTDKLRL  117

Query  275  LPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
            LPDC H FH+ CVD WL+L+ +CPVCR SPLP+PL+TPL+EVVPL+   +
Sbjct  118  LPDCGHLFHLRCVDPWLRLHPTCPVCRTSPLPSPLATPLAEVVPLASRRE  167



>ref|XP_011020460.1| PREDICTED: putative RING-H2 finger protein ATL69 [Populus euphratica]
Length=180

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 85/160 (53%), Gaps = 25/160 (16%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGV---YL  486
            GLGY IAIA   LVL ST++LASY C           ++      RNS   D GV   Y 
Sbjct  15   GLGYGIAIAVSILVLISTIMLASYAC----------IKVKGNGFGRNSR-SDRGVSDGYG  63

Query  485  PRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTLCSIC  312
            P   F   D  +   V    V +GLD+ +I SYPK+V   S+R   P     N+  C IC
Sbjct  64   PHRHFTTRDSIDLMPV----VVVGLDEPIIESYPKMVLGDSRRLPKP-----NEGPCPIC  114

Query  311  LCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            L +Y   + +R +P C H FH  C+D WLK+NA+CP+CRN
Sbjct  115  LSDYLPRDTIRCIPYCNHCFHADCIDGWLKMNATCPLCRN  154



>ref|XP_010670554.1| PREDICTED: putative RING-H2 finger protein ATL69 [Beta vulgaris 
subsp. vulgaris]
Length=197

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 78/205 (38%), Positives = 100/205 (49%), Gaps = 37/205 (18%)
 Frame = -2

Query  689  PNSAPTNFTT--IGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrr---------  543
            P+  P   TT  +GLGY IAIA   LVL ST++LASY C R  ++  R R          
Sbjct  9    PHQPPPTITTSSVGLGYGIAIAVSILVLISTIMLASYACVRIKSSGARHRGGVTIDNDDV  68

Query  542  ----ldaeagyRNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLV  375
                       R   P   G+  P +I V  D +   GV    V LG             
Sbjct  69   DGIDAADGRDPRRPGPVVTGLPGPVMIKVGRDMQPKKGVLYPEVVLG-------------  115

Query  374  YSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCR  195
             SKR   P     N+  CSICL EYK  +++R +P+C H FHV C+D WLK+N +CP+CR
Sbjct  116  ESKRLPKP-----NNGPCSICLSEYKPKQIVRCMPNCNHCFHVDCIDQWLKMNPTCPLCR  170

Query  194  Nsplptplstpl----SEVVPLSHY  132
            NSP  +   TP     SE+VPL+ Y
Sbjct  171  NSPATSVGPTPTGTPLSELVPLAFY  195



>ref|XP_009412312.1| PREDICTED: RING-H2 finger protein ATL70-like [Musa acuminata 
subsp. malaccensis]
Length=174

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 94/173 (54%), Gaps = 26/173 (15%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            GL Y + I+ G L+L +T+   SY C R+                    PD         
Sbjct  23   GLAYGLGISAGILLLITTITFMSYFCTRTTTTAAATAARPRRPPDDVVGPD---------  73

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
                            +V  GLD+A + SYPK++YS+       TT   T CSICL +YK
Sbjct  74   ---------------MDVEAGLDEATLMSYPKILYSQAKLEERSTTA--TCCSICLADYK  116

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            D+++LR+LP+C H FH+ CVD WL+   +CPVCR+SP+P+PLSTPL+EVVPL+
Sbjct  117  DTDVLRLLPECGHLFHLDCVDPWLRSRPTCPVCRSSPIPSPLSTPLAEVVPLA  169



>ref|XP_002316478.2| hypothetical protein POPTR_0010s24940g [Populus trichocarpa]
 gb|EEF02649.2| hypothetical protein POPTR_0010s24940g [Populus trichocarpa]
Length=156

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 61/82 (74%), Gaps = 6/82 (7%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTL----CSICLCEYKDSEMLRMLPDCKH  258
            + +GLD+A +N+YPKLVYS+     G   G+D++    CSICL +YKDS++LR+LPDC H
Sbjct  43   IEIGLDEATLNTYPKLVYSEAKEKLG--KGDDSVAASCCSICLADYKDSDLLRLLPDCDH  100

Query  257  YFHVTCVDAWLKLNASCPVCRN  192
             FH  C+D WLKL+ +CP+CRN
Sbjct  101  LFHAQCIDPWLKLHTTCPMCRN  122



>ref|XP_008391986.1| PREDICTED: RING-H2 finger protein ATL70-like [Malus domestica]
 ref|XP_008360606.1| PREDICTED: RING-H2 finger protein ATL70-like [Malus domestica]
Length=169

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 78/113 (69%), Gaps = 2/113 (2%)
 Frame = -2

Query  464  EDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEM  285
             D  +  G+    V +GLD   I SYPK++YS+       +T   + CSICL +YK+S+ 
Sbjct  59   RDAMDPPGLENFVVDIGLDDNTIQSYPKMLYSEAKLQKKBSTA--SCCSICLADYKNSDX  116

Query  284  LRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
            LR+LPDC+H FH+ C+D WL+LN +CPVCR SP+PTPLSTPL+EVVPL+   D
Sbjct  117  LRLLPDCRHLFHLKCIDPWLRLNPTCPVCRTSPIPTPLSTPLAEVVPLASRRD  169



>ref|XP_010423335.1| PREDICTED: putative RING-H2 finger protein ATL71 [Camelina sativa]
Length=232

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 88/158 (56%), Gaps = 10/158 (6%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLP-R  480
            GL Y I ++ G L+L +T+ L SY C RS  +             R +    NG +   +
Sbjct  55   GLAYGIGVSIGILMLITTITLTSYYCTRSHISASPTTTPRTRRRQRET----NGAFQAGQ  110

Query  479  IIFVAE-DDEENDGVSGQNVALGLDQAVINSYPKLVYSKR--SGNPGGTTGNDTLCSICL  309
              F  E DD++ND V  +   LGL+  VI S+PKL Y +   S +    +   T CSICL
Sbjct  111  EGFNFEGDDDQNDTVVVE--VLGLNDEVIKSFPKLAYEEACVSYSLQRESSTTTCCSICL  168

Query  308  CEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCR  195
             +YK ++M+R+LPDC H FH  CVD WLKL+ +CPVCR
Sbjct  169  ADYKKTDMIRVLPDCNHLFHDKCVDPWLKLHPTCPVCR  206



>ref|XP_010653248.1| PREDICTED: RING-H2 finger protein ATL70 [Vitis vinifera]
Length=169

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 101/179 (56%), Gaps = 29/179 (16%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            GLGY I ++ G L+L +T+ LASY C                     + P      +P  
Sbjct  18   GLGYGIGVSVGILLLITTITLASYFC---------------------TRPQQ----VPAA  52

Query  476  IFVAED--DEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCE  303
             +       E+   V    V +GLD+A I SYPK+VYS+       +T     CSICL +
Sbjct  53   AYGGGGGLREQQPVVEEFVVDVGLDEATILSYPKMVYSEAKLQHKDSTA--ACCSICLAD  110

Query  302  YKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
            YK S+MLR+LPDC H FH+ CVD WL+L+ +CPVCR SP+PTPLSTPL+EVVPL+   D
Sbjct  111  YKGSDMLRLLPDCGHLFHLKCVDPWLRLHPTCPVCRTSPMPTPLSTPLAEVVPLATRRD  169



>ref|XP_009617009.1| PREDICTED: RING-H2 finger protein ATL70-like [Nicotiana tomentosiformis]
Length=174

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 72/93 (77%), Gaps = 2/93 (2%)
 Frame = -2

Query  416  GLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCV  237
            GLD+  + SYPKL+YS+   N   +T   T CSICL +YK+S+MLR+LPDC H FH+ CV
Sbjct  79   GLDEETLLSYPKLLYSEAKVNHKDSTA--TCCSICLADYKNSDMLRLLPDCGHLFHLKCV  136

Query  236  DAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            D WL+LN +CPVCR SPLPTP STPL+EVVPL+
Sbjct  137  DPWLRLNPTCPVCRTSPLPTPQSTPLAEVVPLA  169



>ref|XP_007028017.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOY08519.1| RING/U-box superfamily protein [Theobroma cacao]
Length=118

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 73/101 (72%), Gaps = 2/101 (2%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            V LGLD+  I SYPKL+YS+   +   +T   + CSICL +YK S+ LR+LPDC H FH+
Sbjct  20   VDLGLDEETIKSYPKLLYSEAKLHNKDSTS--SCCSICLADYKGSDTLRLLPDCNHLFHL  77

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDG  123
             CVD WL+L+ +CPVCR S +PTPLSTPL+EVVPLS    G
Sbjct  78   KCVDPWLRLHPTCPVCRTSLIPTPLSTPLAEVVPLSSRPGG  118



>ref|XP_012068725.1| PREDICTED: putative RING-H2 finger protein ATL69 [Jatropha curcas]
 gb|KDP40569.1| hypothetical protein JCGZ_24568 [Jatropha curcas]
Length=175

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 84/164 (51%), Gaps = 23/164 (14%)
 Frame = -2

Query  677  PTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDN  498
            P + T +GLGY IAIA   LVL ST++LASY C R   + R R          + +  + 
Sbjct  7    PVSATGVGLGYGIAIAVSILVLISTIMLASYACVRVKGSLRDRSNNGDNDDDTDPYRHN-  65

Query  497  GVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTL  324
                 R     E            + +GLD   I SYPK+V   S+R   P     N+  
Sbjct  66   -----RQFMTGE----------PMLVIGLDGPQIESYPKMVLGESRRLPKP-----NNGP  105

Query  323  CSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            CSICL +YK  + LR +P C H FH  CVD WLK++A+CP+CRN
Sbjct  106  CSICLSDYKPKDTLRCIPACHHCFHADCVDEWLKMSATCPLCRN  149



>ref|XP_010557977.1| PREDICTED: putative RING-H2 finger protein ATL71 [Tarenaya hassleriana]
Length=190

 Score =   100 bits (248),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 55/156 (35%), Positives = 80/156 (51%), Gaps = 6/156 (4%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G  Y I ++ G L+L +T+ LASY C R+  +        +    + +     GV    I
Sbjct  20   GFAYGIGVSIGILLLITTISLASYYCTRNHLSASPMTTPRSRRRRQTNQMSPRGV----I  75

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTL--CSICLCE  303
            I V +  ++        V  GLD+  I S P++ Y +   + G      T   CSICL +
Sbjct  76   IAVEQPSDDQQPPDVLTVVSGLDEETIKSLPRIPYEEARESYGRKREASTTSCCSICLAD  135

Query  302  YKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCR  195
            Y D +M+R+LPDC H FH  CVD WL L+++CPVCR
Sbjct  136  YNDRDMIRVLPDCNHIFHDKCVDPWLFLSSTCPVCR  171



>ref|XP_009133055.1| PREDICTED: RING-H2 finger protein ATL70-like [Brassica rapa]
Length=175

 Score = 99.8 bits (247),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 69/181 (38%), Positives = 95/181 (52%), Gaps = 42/181 (23%)
 Frame = -2

Query  662  TIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLP  483
            T G  Y I ++ G L+L +T+ LASY C                                
Sbjct  22   TGGFRYGIGVSIGVLLLITTITLASYFCA-------------------------------  50

Query  482  RIIFVAEDDEENDGVSGQNVAL------GLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  321
            R    +E D+++  V   +  +      GLD+  I SYPK++YS+        +   + C
Sbjct  51   RKQHSSETDQDSTHVHHHHHHVIIDVVPGLDEDTIQSYPKILYSE-----AKRSSTSSCC  105

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPL  141
             ICL +YK + +LR LPDCKH FH+ C+D WL+LN +CPVCR SPLPTPL TPL+EVVPL
Sbjct  106  PICLGDYKGNHLLRQLPDCKHLFHLKCIDTWLRLNPTCPVCRTSPLPTPLPTPLAEVVPL  165

Query  140  S  138
            +
Sbjct  166  A  166



>emb|CDX79639.1| BnaC03g19750D [Brassica napus]
Length=174

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 97/180 (54%), Gaps = 41/180 (23%)
 Frame = -2

Query  662  TIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLP  483
            T G  Y I ++ G L+L +T+ LASY C                   RN H         
Sbjct  22   TGGFRYGIGVSIGVLLLITTITLASYFC------------------ARNQH---------  54

Query  482  RIIFVAEDDEENDGVSGQNVAL-----GLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCS  318
                 +E D+++  V   +  +     GLD+  I SYPK++YS+        +   + C 
Sbjct  55   ----SSETDQDSTHVHHHHHVIIDVVPGLDEDTIQSYPKILYSE-----AKRSSTSSCCP  105

Query  317  ICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            ICL +YK + +LR LPDCKH FH+ C+D WL+LN +CPVCR SPLPTPL TPL+E+VPL+
Sbjct  106  ICLGDYKGNHLLRQLPDCKHLFHLKCIDTWLRLNPTCPVCRTSPLPTPLPTPLAEIVPLA  165



>emb|CDX84590.1| BnaA03g16400D [Brassica napus]
Length=175

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 71/181 (39%), Positives = 97/181 (54%), Gaps = 42/181 (23%)
 Frame = -2

Query  662  TIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLP  483
            T G  Y I ++ G L+L +T+ LASY C                   RN H         
Sbjct  22   TGGFRYGIGVSIGVLLLITTITLASYFC------------------ARNQHS--------  55

Query  482  RIIFVAEDDEENDGVSGQNVAL------GLDQAVINSYPKLVYSKRSGNPGGTTGNDTLC  321
                 +E D+++  V   +  +      GLD+  I SYPK++YS+        +   + C
Sbjct  56   -----SETDQDSTHVHHHHHHVIIDVVPGLDEDTIQSYPKILYSE-----AKRSSTSSCC  105

Query  320  SICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPL  141
             ICL +YK + +LR LPDCKH FH+ C+D WL+LN +CPVCR SPLPTPL TPL+EVVPL
Sbjct  106  PICLGDYKGNHLLRQLPDCKHLFHLKCIDTWLRLNPTCPVCRTSPLPTPLPTPLAEVVPL  165

Query  140  S  138
            +
Sbjct  166  A  166



>ref|XP_008462625.1| PREDICTED: RING-H2 finger protein ATL70-like [Cucumis melo]
Length=172

 Score = 99.4 bits (246),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            V +GLDQ  I SYPKL+YS+       +T   + CSICL +YK+S++LR+LPDC H FH+
Sbjct  75   VEIGLDQETITSYPKLLYSEAKLQKNDSTA--SCCSICLADYKNSDVLRLLPDCGHLFHL  132

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
             CVD WL+L+ +CPVCR SP+PTPLSTPL+E VPL+   D
Sbjct  133  KCVDPWLRLHPTCPVCRTSPIPTPLSTPLAEQVPLASRRD  172



>ref|XP_007202672.1| hypothetical protein PRUPE_ppa012474mg [Prunus persica]
 gb|EMJ03871.1| hypothetical protein PRUPE_ppa012474mg [Prunus persica]
Length=168

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 104/179 (58%), Gaps = 30/179 (17%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY I ++ G L+L +T+ LASY C R+                  +H ++N +  P +
Sbjct  18   GFGYGIGVSVGILLLITTITLASYFCTRTQQPPAPA-----------THRNNNILDPPDL  66

Query  476  IFVAEDDEENDGVSGQN--VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCE  303
                           QN  V +GLD + I SYPK++YS+       +T   + CSICL +
Sbjct  67   ---------------QNFVVDIGLDDSTIESYPKMLYSEAKLQKTDSTA--SCCSICLAD  109

Query  302  YKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
            YK ++ LR+LPDCKH FH+ CVD WL+L+ +CPVCR SP+PTPLSTPL+EVVPL+   D
Sbjct  110  YKGTDTLRLLPDCKHLFHLKCVDPWLRLHPTCPVCRTSPIPTPLSTPLAEVVPLASRRD  168



>ref|XP_009766163.1| PREDICTED: RING-H2 finger protein ATL70-like [Nicotiana sylvestris]
Length=173

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/169 (38%), Positives = 97/169 (57%), Gaps = 25/169 (15%)
 Frame = -2

Query  650  GYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRIIF  471
            GY +  + G LVL + +  A+Y+C R+ +                     N   +P    
Sbjct  27   GYGLGFSLGILVLLAIIAYATYLCIRTRSR--------------------NNSNVPN---  63

Query  470  VAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDS  291
              +       ++   V  GL++ ++ +YPKL+YS+   + G    + + CSICL +YKDS
Sbjct  64   YNQSSSHGSSMTTITVDNGLNEEILRNYPKLLYSEAKVHKG--EFDVSGCSICLADYKDS  121

Query  290  EMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVP  144
            ++LR+LPDC H FHV C+D WL+L+ +CP+CRNSPLPTPL+TPL EVVP
Sbjct  122  DLLRILPDCGHIFHVKCIDPWLRLHTTCPICRNSPLPTPLTTPLVEVVP  170



>ref|XP_011034693.1| PREDICTED: putative RING-H2 finger protein ATL69 [Populus euphratica]
Length=186

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 71/184 (39%), Positives = 103/184 (56%), Gaps = 23/184 (13%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            GLGY IAIA G LVL ST++L SY C R           + +    NS+  ++G      
Sbjct  17   GLGYGIAIAIGILVLISTIMLTSYACSRIKGNGNSNGSNNNDNSNDNSNNYEHG------  70

Query  476  IFVAEDDEENDG--VSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTLCSICL  309
                 D     G  +    V +GL + +I+SY K+V   S+R   P     N+  CSICL
Sbjct  71   ----HDRHFTAGNPIEPMTVMVGLAEPIIDSYTKMVLGESRRLPKP-----NEGPCSICL  121

Query  308  CEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptp----lstplSEVVPL  141
             +Y+  + +R +PDC H FH  C+D WLK++A+CP+CRNSP P+     ++TPL+EVVPL
Sbjct  122  SDYQTKDTIRCIPDCHHCFHADCIDGWLKMSATCPLCRNSPAPSKGPTPVTTPLAEVVPL  181

Query  140  SHYS  129
            + ++
Sbjct  182  AFHA  185



>ref|XP_010931540.1| PREDICTED: LOW QUALITY PROTEIN: putative RING-H2 finger protein 
ATL69 [Elaeis guineensis]
Length=180

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/157 (38%), Positives = 76/157 (48%), Gaps = 21/157 (13%)
 Frame = -2

Query  659  IGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPR  480
            +GLGY IAIA G LVL ST++LASY+C R                   S     G     
Sbjct  18   VGLGYGIAIAVGLLVLVSTIMLASYVCVRVRETAAAPAPPPPLPPPPQSAASVAG-----  72

Query  479  IIFVAEDDEENDGVSGQNVALGLDQAVINSY-PKLVYSKRSGNPGGTTGNDTLCSICLCE  303
                      +D  +   V LGLD   I +Y PK VY      P G       C ICL E
Sbjct  73   -------GSPSD--AAAFVVLGLDGPTIEAYYPKFVYKAGMAAPPGP------CPICLAE  117

Query  302  YKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            Y+  E LR +P+C H FH  CVD WL+++A+CP+CR+
Sbjct  118  YEGGEALRRVPECGHCFHAACVDEWLRVSATCPLCRS  154



>ref|XP_007028016.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOY08518.1| RING/U-box superfamily protein [Theobroma cacao]
Length=166

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 74/101 (73%), Gaps = 2/101 (2%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            V LGLD+  I SYPKL+YS+   +   +T   + CSICL +YK S+ LR+LPDC H FH+
Sbjct  68   VDLGLDEETIKSYPKLLYSEAKLHNKDST--SSCCSICLADYKSSDTLRLLPDCNHLFHL  125

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDG  123
             CVD WL+L+ +CPVCR SP+PTPLSTPL+EVVPLS    G
Sbjct  126  KCVDPWLRLHPTCPVCRTSPIPTPLSTPLAEVVPLSSRPGG  166



>ref|XP_007145777.1| hypothetical protein PHAVU_007G266900g [Phaseolus vulgaris]
 gb|ESW17771.1| hypothetical protein PHAVU_007G266900g [Phaseolus vulgaris]
Length=132

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            V +GLD+A I +YPK++YS+       +T   T CSICL +YK S++LR+LPDC+H FH+
Sbjct  35   VDVGLDEATIMNYPKMLYSEAKQRKSDSTA--TSCSICLGDYKSSDVLRVLPDCEHVFHL  92

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
             C+D WL+L+ +CP+CR SP+PTPLSTPL+EVVPL+   D
Sbjct  93   KCIDPWLRLHPTCPLCRTSPIPTPLSTPLAEVVPLATRRD  132



>ref|XP_004143342.1| PREDICTED: RING-H2 finger protein ATL70-like [Cucumis sativus]
 gb|KGN48327.1| hypothetical protein Csa_6G476670 [Cucumis sativus]
Length=172

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            V +GLDQ  I SYPKL+YS+       +T   + CSICL +YK+S++LR+LPDC H FH+
Sbjct  75   VDIGLDQETITSYPKLLYSEAKLQKNDSTA--SCCSICLADYKNSDVLRLLPDCGHLFHL  132

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
             CVD WL+L+ +CPVCR SP+PTPLSTPL+E VPL+   D
Sbjct  133  KCVDPWLRLHPTCPVCRTSPIPTPLSTPLAEQVPLASRRD  172



>ref|XP_004249398.1| PREDICTED: RING-H2 finger protein ATL70-like [Solanum lycopersicum]
Length=190

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 72/94 (77%), Gaps = 2/94 (2%)
 Frame = -2

Query  419  LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTC  240
            +G+D+  + SYPKL+YS+   N   TT   + CSICL +YK+ +MLR+LPDC+H FH+ C
Sbjct  94   IGIDETTLLSYPKLLYSEAKVNHKDTTA--SCCSICLADYKNKDMLRLLPDCEHLFHLKC  151

Query  239  VDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            VD WL LN SCPVCR SPLPTP STPL+EVVPL+
Sbjct  152  VDPWLMLNPSCPVCRTSPLPTPQSTPLAEVVPLA  185



>ref|XP_003520719.1| PREDICTED: RING-H2 finger protein ATL70-like [Glycine max]
 gb|KHN22597.1| RING-H2 finger protein ATL70 [Glycine soja]
Length=171

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 73/101 (72%), Gaps = 2/101 (2%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            V + LD+A I SYP L+YS+       +T   T CSICL +YK ++MLRMLPDC H FH+
Sbjct  73   VDVSLDEATILSYPTLLYSEAKLKKSDSTA--TCCSICLADYKGTDMLRMLPDCGHQFHL  130

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDG  123
             C+D WL+L+ +CPVCR SP+PTPLSTPL+EVVPL+   D 
Sbjct  131  KCIDPWLRLHPTCPVCRTSPIPTPLSTPLAEVVPLASRQDS  171



>ref|XP_004499794.1| PREDICTED: putative RING-H2 finger protein ATL69-like [Cicer 
arietinum]
Length=175

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/179 (40%), Positives = 99/179 (55%), Gaps = 27/179 (15%)
 Frame = -2

Query  653  LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRII  474
            LGY IAIA   LVL ST++LASY C                     +H    G +     
Sbjct  19   LGYGIAIAVSILVLISTIMLASYFC-----------------VRIKAH-GRRGTFHFHTD  60

Query  473  FVAEDDEENDGVSGQN--VALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTLCSICLC  306
                  E N   S Q     LGL++ +I +YPK++   S+R   P     N+  C+ICL 
Sbjct  61   IENIRRENNINNSTQPGPFILGLEKPMIEAYPKIIIGESRRLPKP-----NEGPCAICLS  115

Query  305  EYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYS  129
            +Y   E +R +PDC+H FHV CVD WL+++A+CP+CRNSP P+P+ TPLSE+VPL+ ++
Sbjct  116  DYLPKETIRCVPDCQHCFHVECVDEWLRMSATCPLCRNSPAPSPIPTPLSELVPLAFHA  174



>gb|ERM93680.1| hypothetical protein AMTR_s00004p00172400 [Amborella trichopoda]
Length=137

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 2/93 (2%)
 Frame = -2

Query  416  GLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCV  237
            GLD+A + SYP L YS+   +   T  + + CSICL +YKDS+MLRMLPDC H FHV CV
Sbjct  43   GLDEATLLSYPTLPYSQAKLH--KTAASSSCCSICLGDYKDSDMLRMLPDCGHLFHVKCV  100

Query  236  DAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            D+WL+L+ +CP CR+SPLP+PLSTPLSEVVPL+
Sbjct  101  DSWLRLHPTCPNCRSSPLPSPLSTPLSEVVPLA  133



>ref|XP_010932992.1| PREDICTED: RING-H2 finger protein ATL70-like [Elaeis guineensis]
Length=173

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 75/101 (74%), Gaps = 2/101 (2%)
 Frame = -2

Query  434  GQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTL--CSICLCEYKDSEMLRMLPDCK  261
            G +V  GLD+A++ SYP ++YS+      GTT   T   CSICL +YKD+++LR+LPDC 
Sbjct  70   GPDVEAGLDEAILRSYPTVLYSEAKLREKGTTTITTASCCSICLADYKDTDVLRLLPDCG  129

Query  260  HYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            H FH+ CVD WL+   +CPVCR+SPLP+PL +PL+EV+PL+
Sbjct  130  HLFHLQCVDLWLRSRPTCPVCRSSPLPSPLPSPLAEVIPLA  170



>ref|XP_009794907.1| PREDICTED: RING-H2 finger protein ATL70-like [Nicotiana sylvestris]
Length=174

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            V +GLD+  + SYPKL+YS+   N   +T   + CSICL +YK  +MLR+LPDC H FH+
Sbjct  76   VEIGLDEKTLLSYPKLLYSEAKVNHKDSTA--SCCSICLADYKKKDMLRLLPDCGHLFHL  133

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
             CVD WL LN SCPVCR SPLPTP STPL+EVVPL+
Sbjct  134  KCVDPWLMLNPSCPVCRTSPLPTPQSTPLAEVVPLA  169



>ref|XP_008801681.1| PREDICTED: RING-H2 finger protein ATL70-like [Phoenix dactylifera]
Length=181

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = -2

Query  428  NVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFH  249
            +V  G+D+A + ++PK++YS+      GTT   + CSICL +YKDS++LR LPDC+H FH
Sbjct  84   DVEAGIDEATLMNFPKVLYSETKLRDEGTTS--SCCSICLADYKDSDVLRDLPDCRHLFH  141

Query  248  VTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYS  129
              CVD WL+L+ +CPVCR SPLPTPL TPL+EVVPL+ +S
Sbjct  142  AKCVDPWLRLHPTCPVCRTSPLPTPLPTPLAEVVPLATHS  181



>ref|XP_011042565.1| PREDICTED: RING-H2 finger protein ATL70 [Populus euphratica]
Length=167

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 100/177 (56%), Gaps = 27/177 (15%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY I ++ G L+L +T+ LASY C R                       +    +P  
Sbjct  18   GFGYGIGVSIGILLLITTITLASYFCAR-----------------------NQQTSVPSQ  54

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
               + D + N  +    V +GLD+A + SYP L+YS+   +   T    T CSICL +YK
Sbjct  55   GRNSADQQLN--LQSFVVEIGLDEATLKSYPTLLYSEAKLH--KTDSTSTCCSICLADYK  110

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
             ++ LR+LPDC H FH+ CVD WL+L+ +CPVCR SPLPTPL+TPL+EVVPL+   D
Sbjct  111  STDKLRLLPDCGHLFHLKCVDPWLRLHPTCPVCRTSPLPTPLATPLAEVVPLASRRD  167



>ref|XP_002323373.2| zinc finger family protein [Populus trichocarpa]
 gb|EEF05134.2| zinc finger family protein [Populus trichocarpa]
Length=167

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 100/177 (56%), Gaps = 27/177 (15%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY I ++ G L+L +T+ LASY C R                       +    +P  
Sbjct  18   GFGYGIGVSIGILLLITTITLASYFCAR-----------------------NQQTSVPSQ  54

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
               + D + N  +    V +GLD+A + SYP L+YS+   +   T    T CSICL +YK
Sbjct  55   GRNSADQQLN--LQSFVVEIGLDEATLKSYPTLLYSEAKLH--KTDSTSTCCSICLADYK  110

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
             ++ LR+LPDC H FH+ CVD WL+L+ +CPVCR SPLPTPL+TPL+EVVPL+   D
Sbjct  111  STDKLRLLPDCGHLFHLKCVDPWLRLHPTCPVCRTSPLPTPLATPLAEVVPLASRRD  167



>ref|XP_003522850.1| PREDICTED: putative RING-H2 finger protein ATL69-like [Glycine 
max]
Length=188

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 85/174 (49%), Gaps = 18/174 (10%)
 Frame = -2

Query  701  TTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagy  522
            T   P SAPT     GLGY IAIA   LVL ST++LASY C                   
Sbjct  3    TAALPPSAPTATAGGGLGYGIAIAVSILVLISTIMLASYAC--VRIKANGSIITRRHNHN  60

Query  521  RNSHPDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINS--YPKLVY--SKRSGN  354
             N+H  +N            D  +  GV    V LGL++  I +   PK+V   SKR   
Sbjct  61   INTHQRNNNNNNSSF----RDASDGPGV----VVLGLEKPAIEACYGPKIVIGESKRLPR  112

Query  353  PGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            P     +   C+ICL EY   E +R +P+C+H FH  CVD WLK +A+CP+CRN
Sbjct  113  PN----DQGPCAICLSEYLPKETIRCVPECRHCFHAECVDEWLKTSATCPLCRN  162



>ref|XP_006290100.1| hypothetical protein CARUB_v10003745mg [Capsella rubella]
 gb|EOA22998.1| hypothetical protein CARUB_v10003745mg [Capsella rubella]
Length=191

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/195 (38%), Positives = 101/195 (52%), Gaps = 20/195 (10%)
 Frame = -2

Query  698  TVKPNSAPTNFTTI----GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldae  531
            TV P+ +    TT     GL Y I ++ G L+L +T+ L SY C RS  +          
Sbjct  4    TVVPHDSGHWLTTTDRMGGLAYGIGVSIGILMLITTITLTSYYCTRSHISASPTTTPRTR  63

Query  530  agyRNSH-PDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGN  354
               R ++ P     YL           END V  +    GL+  VI S+P L+Y +    
Sbjct  64   RLQREANAPGQERFYL-----------ENDTVVVE--VSGLNDEVIKSFPMLLYEEARVI  110

Query  353  PGGTTGNDTL--CSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplp  180
             G      T   CSICL +YK ++M+R+LPDC H FH  CVD WL+L+ +CPVCR SPLP
Sbjct  111  YGLQREPSTTSCCSICLADYKKTDMIRVLPDCNHLFHDKCVDPWLRLHPTCPVCRTSPLP  170

Query  179  tplstplSEVVPLSH  135
            +P  TP ++VVP S 
Sbjct  171  SPAITPGADVVPFSR  185



>ref|XP_009600924.1| PREDICTED: RING-H2 finger protein ATL70-like [Nicotiana tomentosiformis]
Length=163

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            +  GLD+  I +YPKL+Y++   +  G T + + CSICL +YKD +MLR+LP+C H FH+
Sbjct  73   IQQGLDENTIRTYPKLLYAQVKAHKVGDTASSSGCSICLADYKDKDMLRLLPNCGHLFHL  132

Query  245  TCVDAWLKLNASCPVCRN  192
             C+D WL+L+ +CP+CRN
Sbjct  133  ICIDPWLRLHPTCPICRN  150



>ref|XP_007219590.1| hypothetical protein PRUPE_ppa023497mg [Prunus persica]
 gb|EMJ20789.1| hypothetical protein PRUPE_ppa023497mg [Prunus persica]
Length=313

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 71/105 (68%), Gaps = 22/105 (21%)
 Frame = -2

Query  431  QNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYF  252
            +N  +G+ Q+VINSYPK  +SK                      +D+EMLRM+P+C+HYF
Sbjct  228  ENAVVGIHQSVINSYPKFPFSK----------------------EDAEMLRMMPECRHYF  265

Query  251  HVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDGRR  117
            H+ C+DAWLKLN SCPVCRNSPLPTPLSTPL EVVPLS Y   RR
Sbjct  266  HLMCLDAWLKLNGSCPVCRNSPLPTPLSTPLQEVVPLSQYPADRR  310



>ref|XP_007145778.1| hypothetical protein PHAVU_007G266900g [Phaseolus vulgaris]
 gb|ESW17772.1| hypothetical protein PHAVU_007G266900g [Phaseolus vulgaris]
Length=168

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            V +GLD+A I +YPK++YS+       +T   T CSICL +YK S++LR+LPDC+H FH+
Sbjct  71   VDVGLDEATIMNYPKMLYSEAKQRKSDSTA--TSCSICLGDYKSSDVLRVLPDCEHVFHL  128

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
             C+D WL+L+ +CP+CR SP+PTPLSTPL+EVVPL+   D
Sbjct  129  KCIDPWLRLHPTCPLCRTSPIPTPLSTPLAEVVPLATRRD  168



>ref|XP_011094530.1| PREDICTED: RING-H2 finger protein ATL70 [Sesamum indicum]
Length=173

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 74/94 (79%), Gaps = 2/94 (2%)
 Frame = -2

Query  419  LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTC  240
            +GLD+A + SYPKL+YS+   +   +T   + CSICL +YK+S+MLR+LPDC H FH  C
Sbjct  77   VGLDEATLTSYPKLLYSEAKASHKDSTA--SCCSICLADYKNSDMLRVLPDCGHLFHQKC  134

Query  239  VDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            VD WL+L+ +CPVCR SP+PTPLSTPL+EV+PL+
Sbjct  135  VDPWLRLHPTCPVCRTSPMPTPLSTPLAEVIPLA  168



>ref|XP_002316477.1| hypothetical protein POPTR_0010s24950g [Populus trichocarpa]
 gb|EEF02648.1| hypothetical protein POPTR_0010s24950g [Populus trichocarpa]
Length=211

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 80/155 (52%), Gaps = 25/155 (16%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G+G A+ I+FG L+L   ++ ASYIC                          +G+  P  
Sbjct  15   GIGCAMVISFGILLLIIIIIFASYIC-------------------------THGIQDPSR  49

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
            +  + +           +  GLD+A + SYPKL+YS+           D+ CSICL +Y 
Sbjct  50   LTPSNEGSSITDQGSVAINPGLDEATLASYPKLLYSQEKSQQKVNHSLDSCCSICLGDYI  109

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            DS++LR+LP C H FH+ CVD WL+LN +CP+CRN
Sbjct  110  DSDVLRLLPHCGHTFHLNCVDCWLRLNHTCPICRN  144



>ref|XP_010312505.1| PREDICTED: RING-H2 finger protein ATL70-like [Solanum lycopersicum]
Length=117

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 39/78 (50%), Positives = 57/78 (73%), Gaps = 0/78 (0%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            +  GLD+A + SYPKL+YS+   + G    + + CSICL +YKD++MLR+LP C H FH+
Sbjct  27   IQQGLDEATLRSYPKLLYSQVKSHKGDFASSCSGCSICLGDYKDNDMLRLLPHCGHLFHL  86

Query  245  TCVDAWLKLNASCPVCRN  192
             C+D WL+L+ +CP+CRN
Sbjct  87   MCIDTWLRLHPTCPICRN  104



>ref|XP_009606479.1| PREDICTED: RING-H2 finger protein ATL70-like [Nicotiana tomentosiformis]
Length=174

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 2/96 (2%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            V +GLD+  + SYPKL+YS+   N   +T   + CSICL +YK  +MLR+LPDC H FH+
Sbjct  76   VDIGLDEKTLLSYPKLLYSEAKVNHKDSTA--SCCSICLADYKKKDMLRLLPDCGHLFHL  133

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
             CVD WL LN SCPVCR SPLPTP STPL+EVVPL+
Sbjct  134  KCVDPWLMLNPSCPVCRTSPLPTPQSTPLAEVVPLA  169



>ref|XP_006339176.1| PREDICTED: RING-H2 finger protein ATL70-like [Solanum tuberosum]
Length=185

 Score = 97.8 bits (242),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 101/173 (58%), Gaps = 18/173 (10%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY I ++ G L+L +T+ L SY C R+       RR          H  D+G      
Sbjct  26   GFGYGIGVSVGILLLITTITLTSYFCTRNQTTELPPRRRHRIIRSTLQH--DHG------  77

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
                +DD  N  V      +G+D+  + SYPKL+YS+   N   TT   + CSICL +YK
Sbjct  78   ----QDDNNNCIVD----IIGIDEKTLLSYPKLLYSEAKVNHKDTTA--SCCSICLADYK  127

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            + ++LR+LPDC+H FH+ CVD WL LN SCPVCR SPLPTP STPL+EVVP +
Sbjct  128  NKDVLRLLPDCEHLFHLKCVDPWLMLNPSCPVCRTSPLPTPQSTPLAEVVPFA  180



>ref|XP_007162988.1| hypothetical protein PHAVU_001G197000g [Phaseolus vulgaris]
 gb|ESW34982.1| hypothetical protein PHAVU_001G197000g [Phaseolus vulgaris]
Length=171

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 74/101 (73%), Gaps = 2/101 (2%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            V + LD+A I SYP L+YS+       +T   T CSICL +YK ++MLR+LPDC+H FH+
Sbjct  73   VDVSLDEATILSYPTLLYSEAKVQKSDSTA--TCCSICLADYKGTDMLRVLPDCEHQFHL  130

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDG  123
             C+D WL+L+ +CPVCR SP+PTPLSTPL+EVVPL+   D 
Sbjct  131  KCIDPWLRLHPTCPVCRTSPIPTPLSTPLAEVVPLASRQDS  171



>ref|XP_010452581.1| PREDICTED: putative RING-H2 finger protein ATL71 [Camelina sativa]
Length=199

 Score = 97.8 bits (242),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 71/177 (40%), Positives = 99/177 (56%), Gaps = 8/177 (5%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            GL Y I ++ G L+L +T+ LASY C RS                R +   +  +   + 
Sbjct  22   GLAYGIGVSIGILMLITTITLASYYCTRSHIYASPTTTPRTRRRQRET---NGALQAGQE  78

Query  476  IFVAE-DDEENDGVSGQNVALGLDQAVINSYPKLVYSKR--SGNPGGTTGNDTLCSICLC  306
             F  E DD +ND V  +   LGL+  VI S+PKL Y +   S +    +   T CSICL 
Sbjct  79   GFNFEGDDNQNDTVVIE--VLGLNDEVIKSFPKLAYEEACVSYSLQRESSTTTCCSICLA  136

Query  305  EYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSH  135
            +YK ++M+R+LPDC H FH  CVD WL+ + +CPVCR SPLP+P  TP+++VV  S 
Sbjct  137  DYKKTDMIRVLPDCNHLFHDKCVDPWLRRHPTCPVCRTSPLPSPAVTPVADVVSFSR  193



>ref|XP_004303426.1| PREDICTED: RING-H2 finger protein ATL70-like [Fragaria vesca 
subsp. vesca]
Length=188

 Score = 97.4 bits (241),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 74/177 (42%), Positives = 100/177 (56%), Gaps = 27/177 (15%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY I ++ G L+L +T+ LASY C                     +HP   G+     
Sbjct  39   GFGYGIGVSVGILLLITTITLASYFC---------------TRTPPPAHPATRGIN----  79

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
               A D  +   +    V +GLD   I SYPK++YS+       +T   + CSICL +YK
Sbjct  80   ---ALDPPD---LQSFVVDIGLDDNTIKSYPKMLYSEAKLQKTDSTA--SCCSICLADYK  131

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
             ++ LR+LPDC+H FH+ CVD WL+L+ +CPVCR SPLPTPLSTPL+EVVPL+   D
Sbjct  132  ATDTLRLLPDCEHLFHLKCVDPWLRLHPTCPVCRTSPLPTPLSTPLAEVVPLASRRD  188



>gb|KJB46372.1| hypothetical protein B456_007G363500 [Gossypium raimondii]
Length=170

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/154 (38%), Positives = 78/154 (51%), Gaps = 28/154 (18%)
 Frame = -2

Query  653  LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRII  474
             GYAI ++   L++     LASY+C                     + P ++ +  P   
Sbjct  20   FGYAIGVSAIILLIIVVTALASYVC-------------SKAFQSPQAPPSNSDMIDPESF  66

Query  473  FVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKD  294
            FV      +DG        GLD+  I SYPKL YS+      G+T  DT CSICL +YK 
Sbjct  67   FV------DDGG-------GLDEETIKSYPKLTYSEAKLLKKGST--DTCCSICLNDYKG  111

Query  293  SEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            S+ L MLP+C H FH+ CVD WL+L ++CPVCR 
Sbjct  112  SDSLSMLPNCGHLFHLECVDHWLRLQSTCPVCRT  145



>ref|XP_002311001.2| hypothetical protein POPTR_0008s01980g [Populus trichocarpa]
 gb|EEE88368.2| hypothetical protein POPTR_0008s01980g [Populus trichocarpa]
Length=164

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 62/89 (70%), Gaps = 5/89 (6%)
 Frame = -2

Query  443  GVSGQN---VALGLDQAVINSYPKLVYS--KRSGNPGGTTGNDTLCSICLCEYKDSEMLR  279
             ++GQ+   + +GL++A +N+YPKL+YS  K     G      + CSICL +YKDS++LR
Sbjct  58   SINGQDSVIIEIGLNEATLNTYPKLLYSEAKEKLEKGDDLAATSCCSICLQDYKDSDLLR  117

Query  278  MLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            +LP+C H FH  C+D WLKL+ +CP+CRN
Sbjct  118  LLPECGHLFHAQCIDLWLKLHPTCPICRN  146



>ref|XP_008442940.1| PREDICTED: RING-H2 finger protein ATL70-like [Cucumis melo]
 ref|XP_008442941.1| PREDICTED: RING-H2 finger protein ATL70-like [Cucumis melo]
Length=162

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  GLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCV  237
            GL+  VIN YPK++YS+        +     CSICL +YKD ++LR+LPDC H FH +C+
Sbjct  66   GLEDEVINGYPKILYSEAKLERKLESAAANGCSICLVDYKDDDVLRLLPDCGHLFHGSCI  125

Query  236  DAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            D WL+LN SCPVCR SPLPTP+STPL+EVVPL+
Sbjct  126  DPWLRLNPSCPVCRTSPLPTPISTPLAEVVPLA  158



>ref|XP_010034163.1| PREDICTED: RING-H2 finger protein ATL70-like [Eucalyptus grandis]
 gb|KCW50586.1| hypothetical protein EUGRSUZ_J00298 [Eucalyptus grandis]
Length=169

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 57/154 (37%), Positives = 77/154 (50%), Gaps = 16/154 (10%)
 Frame = -2

Query  653  LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRII  474
             G+ IAI+ G L L     LASY+C      R             +  P    V+  R +
Sbjct  10   FGFCIAISLGVLALIVLFTLASYVC-----TRFCIPPPQTPVTGADHLPGPGPVHGSRPL  64

Query  473  FVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKD  294
              A D     G     +  GL++A + S+PKL+YS+  G         + CSICL EYK+
Sbjct  65   TSAVD-----GGYSITITPGLNEATLGSFPKLLYSQVKG------AGLSCCSICLLEYKE  113

Query  293  SEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
             +++R+LPDC HYFH  CVD WL+ N SCP CR 
Sbjct  114  RDVMRLLPDCGHYFHSKCVDPWLRTNPSCPNCRT  147



>ref|XP_008801680.1| PREDICTED: RING-H2 finger protein ATL70-like [Phoenix dactylifera]
Length=180

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 79/115 (69%), Gaps = 6/115 (5%)
 Frame = -2

Query  455  EENDGVSGQ----NVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTL--CSICLCEYKD  294
              + G +G+    +V  GLD+A + SYPK++YSK      G+T   T   CSICL +YK 
Sbjct  63   RRSSGSAGEARVADVEAGLDEATLMSYPKVLYSKVKLRDKGSTMTTTASCCSICLADYKG  122

Query  293  SEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYS  129
            +++LR LPDC H FH+ CVD WL+ + +CP+CR SP+P+PLSTPL+EVVPLS  S
Sbjct  123  TDVLRTLPDCGHLFHLNCVDPWLRSHPTCPLCRTSPMPSPLSTPLAEVVPLSSRS  177



>ref|XP_009780433.1| PREDICTED: RING-H2 finger protein ATL70-like [Nicotiana sylvestris]
Length=157

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 2/90 (2%)
 Frame = -2

Query  416  GLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCV  237
            GLD+  + SYPKL+YS+   N   +T   T CSICL +YK+S+MLR+LPDC H FH+ CV
Sbjct  25   GLDEETLLSYPKLLYSEAKVNHKDSTL--TCCSICLADYKNSDMLRLLPDCGHLFHLKCV  82

Query  236  DAWLKLNASCPVCRNsplptplstplSEVV  147
            D WL+LN +CPVCR SPL TP STPL+EVV
Sbjct  83   DPWLRLNPTCPVCRTSPLATPQSTPLAEVV  112



>ref|XP_010247791.1| PREDICTED: RING-H2 finger protein ATL70-like [Nelumbo nucifera]
Length=200

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 75/185 (41%), Positives = 104/185 (56%), Gaps = 40/185 (22%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY I ++ G L+L +T+ LASY C                   RN  P D        
Sbjct  52   GFGYGIGVSVGILLLITTITLASYFC------------------TRNQMPSD--------  85

Query  476  IFVAEDDEENDGVSGQNVAL----GLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  309
                +  + +   S Q+  +    G+D+A + SYPKL+YS+       TT   + CSICL
Sbjct  86   ----QPQQSSAQPSNQHTIITIEEGVDEATLLSYPKLLYSQAKLRNKDTTA--SCCSICL  139

Query  308  CEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYS  129
             +YK++++LR+LP C H FH+ CVD WL+L+ +CPVCR SP+PTPLSTPL+EVVPL+   
Sbjct  140  ADYKNTDVLRLLPGCSHLFHLKCVDPWLRLHPTCPVCRTSPIPTPLSTPLAEVVPLA---  196

Query  128  DGRRR  114
             G RR
Sbjct  197  -GSRR  200



>gb|ABD28580.2| Zinc finger, RING-type [Medicago truncatula]
Length=162

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 5/85 (6%)
 Frame = -2

Query  440  VSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGND--TLCSICLCEYKDSEMLRMLPD  267
            V  +N   GL +++INSY    ++K   N   T  +D  T+CSIC+ +YK+SE+LRM+P 
Sbjct  66   VDDKNTVEGLPRSIINSYHTFTFNK---NNIATINHDYDTVCSICISDYKESEILRMMPQ  122

Query  266  CKHYFHVTCVDAWLKLNASCPVCRN  192
            C HYFH  CVD WLK+N SCPVCRN
Sbjct  123  CHHYFHRDCVDTWLKVNGSCPVCRN  147



>ref|XP_006348447.1| PREDICTED: RING-H2 finger protein ATL70-like [Solanum tuberosum]
Length=180

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  GLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCV  237
            GLD+  ++S+PKL+YS    N    +   + CSICL +YK+S+MLR LPDC H FH+ CV
Sbjct  83   GLDEETLSSFPKLLYSDTYKNIHKDSTTSSCCSICLGDYKNSDMLRQLPDCGHLFHLKCV  142

Query  236  DAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            D WL+L+ +CP+CR SPLP+PLSTPL+EVVPL+
Sbjct  143  DPWLRLHPTCPICRTSPLPSPLSTPLAEVVPLA  175



>gb|KHN35925.1| RING-H2 finger protein ATL70 [Glycine soja]
Length=149

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            V +GLD+A I +YPK++YS+       +T   T CSICL +YK S++LR+LPDC H FH+
Sbjct  52   VDVGLDEATIMNYPKMLYSEAKLRKSDSTS--TSCSICLGDYKGSDLLRVLPDCDHVFHL  109

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
             C+D WL+L+ +CP+CR SP+PTPLSTPL+EV+PL+   D
Sbjct  110  KCIDPWLRLHPTCPLCRTSPIPTPLSTPLAEVIPLATRRD  149



>ref|XP_003519107.1| PREDICTED: RING-H2 finger protein ATL70-like [Glycine max]
Length=168

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/100 (54%), Positives = 75/100 (75%), Gaps = 2/100 (2%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            V +GLD+A I +YPK++YS+       +T   T CSICL +YK S++LR+LPDC H FH+
Sbjct  71   VDVGLDEATIMNYPKMLYSEAKLRKSDSTS--TSCSICLGDYKGSDLLRVLPDCDHVFHL  128

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
             C+D WL+L+ +CP+CR SP+PTPLSTPL+EV+PL+   D
Sbjct  129  KCIDPWLRLHPTCPLCRTSPIPTPLSTPLAEVIPLATRRD  168



>ref|XP_003590313.1| RING finger-like protein [Medicago truncatula]
 gb|AES60564.1| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
Length=169

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/99 (56%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = -2

Query  419  LGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTC  240
             GLD+  I SYPK++YS+   N   +T   T CSICL +YK S+ML++LPDCKH FH+ C
Sbjct  73   FGLDEETIMSYPKMLYSEVKLNKYDSTS--TCCSICLGDYKGSDMLKVLPDCKHMFHLKC  130

Query  239  VDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDG  123
            ++ WL+++ SCP+CR SP+PTPLSTPL+EVVPL+   D 
Sbjct  131  IEPWLRIHPSCPLCRTSPIPTPLSTPLAEVVPLATRRDS  169



>ref|XP_010907478.1| PREDICTED: putative RING-H2 finger protein ATL71 [Elaeis guineensis]
Length=178

 Score = 95.5 bits (236),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/113 (48%), Positives = 79/113 (70%), Gaps = 4/113 (4%)
 Frame = -2

Query  455  EENDGVSGQ----NVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSE  288
              + G +G+    +   G+D+A + SYP+++YSK        T   + CSICL +YKD++
Sbjct  63   RRSSGPAGEARVADAEAGVDEATLMSYPEVLYSKVKVKGSTMTTMASCCSICLADYKDTD  122

Query  287  MLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYS  129
            +LR+LPDC H FH++CVD WL+ + +CP+CR SPLP+P+STPL+EVVPLS  S
Sbjct  123  VLRVLPDCGHLFHLSCVDPWLRSHPTCPLCRTSPLPSPISTPLAEVVPLSRRS  175



>ref|XP_007010488.1| RING/U-box superfamily protein [Theobroma cacao]
 gb|EOY19298.1| RING/U-box superfamily protein [Theobroma cacao]
Length=162

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/177 (38%), Positives = 99/177 (56%), Gaps = 28/177 (16%)
 Frame = -2

Query  665  TTIG-LGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVY  489
            T IG   YAI  + G + L   + LA+Y C                   ++++P      
Sbjct  11   TQIGKFAYAIGSSTGIIALLFMITLAAYFC---------------NRANQSTNPSSQH--  53

Query  488  LPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICL  309
                        + D V+ +    GLD+  ++SYP L+YS+   +   +  + + CSICL
Sbjct  54   -------GTTSTDQDSVAREQ---GLDEETLSSYPNLLYSQAKLHKPDSVSSASSCSICL  103

Query  308  CEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
             EYKD++MLR+LPDC H FH+ CVD WL+L+ +CP+CRNSP+PTPL+TPL+EV PL+
Sbjct  104  GEYKDTDMLRLLPDCGHIFHLKCVDPWLRLHPTCPICRNSPVPTPLATPLAEVTPLA  160



>gb|KGN59227.1| hypothetical protein Csa_3G782740 [Cucumis sativus]
Length=162

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 52/93 (56%), Positives = 68/93 (73%), Gaps = 0/93 (0%)
 Frame = -2

Query  416  GLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCV  237
            GL+  VIN YPK++YS+        +     CSICL +YKD ++LR+LPDC H FH  C+
Sbjct  66   GLEDEVINGYPKILYSEAKLERKLESAATNGCSICLVDYKDDDVLRLLPDCGHLFHCGCI  125

Query  236  DAWLKLNASCPVCRNsplptplstplSEVVPLS  138
            D WL+LN SCPVCR SP+PTP+STPL+EV+PL+
Sbjct  126  DPWLRLNPSCPVCRTSPVPTPISTPLAEVIPLA  158



>gb|EYU18141.1| hypothetical protein MIMGU_mgv1a020648mg [Erythranthe guttata]
Length=171

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 74/178 (42%), Positives = 105/178 (59%), Gaps = 24/178 (13%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY I ++ G L+L +T+ LASY C R+ AA                 P  N    PR 
Sbjct  18   GFGYGIGVSVGILLLITTITLASYYCTRNTAAASAFVL-----------PQRN----PRT  62

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
               A+  E++D      V  GLD++ +++YPK++YS  +          + CSICL +YK
Sbjct  63   --AAQPPEDHD------VEAGLDESTLSTYPKMLYSD-APKVDHRDSTASCCSICLADYK  113

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSDG  123
             S++LR+LPDC H FH+ CVD WL+ + +CPVCR SP+P+PLSTPL+EVVPL+   +G
Sbjct  114  SSDLLRVLPDCGHLFHLKCVDPWLRRHPTCPVCRTSPMPSPLSTPLAEVVPLATRPNG  171



>ref|XP_010031322.1| PREDICTED: RING-H2 finger protein ATL70-like [Eucalyptus grandis]
 gb|KCW50583.1| hypothetical protein EUGRSUZ_J00294 [Eucalyptus grandis]
Length=169

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 55/85 (65%), Gaps = 6/85 (7%)
 Frame = -2

Query  446  DGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPD  267
            DG     + LGLD+A + S+PKL+YS+  G         + CSICL EYK+ ++LR+LPD
Sbjct  69   DGGYSIAITLGLDEATLGSFPKLLYSQVKG------AGSSCCSICLLEYKERDVLRLLPD  122

Query  266  CKHYFHVTCVDAWLKLNASCPVCRN  192
            C HYFH  CVD WL+ N SCP CR 
Sbjct  123  CGHYFHSKCVDPWLRTNPSCPNCRT  147



>ref|XP_011032890.1| PREDICTED: RING-H2 finger protein ATL70-like [Populus euphratica]
Length=177

 Score = 94.7 bits (234),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 42/89 (47%), Positives = 62/89 (70%), Gaps = 5/89 (6%)
 Frame = -2

Query  443  GVSGQN---VALGLDQAVINSYPKLVYS--KRSGNPGGTTGNDTLCSICLCEYKDSEMLR  279
             ++GQ+   + +GL++A +N+YPKL+YS  K     G      + CSICL +YKDS++LR
Sbjct  58   SINGQDSVIIDIGLNEATLNTYPKLLYSEAKEKLEKGDDLVATSCCSICLQDYKDSDLLR  117

Query  278  MLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            +LP+C H FH  C+D WLKL+ +CP+CRN
Sbjct  118  LLPECGHLFHAQCIDLWLKLHPTCPICRN  146



>ref|XP_008779439.1| PREDICTED: RING-H2 finger protein ATL70-like [Phoenix dactylifera]
Length=172

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 70/189 (37%), Positives = 101/189 (53%), Gaps = 30/189 (16%)
 Frame = -2

Query  689  PNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSH  510
            PN  P++    G GY + I  G L+L +T+ L SY C                    N+ 
Sbjct  12   PNGFPSSERISGFGYGLGITVGILLLITTITLMSYFC-----------------SQVNTS  54

Query  509  PDDNGVYLPRIIFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGND  330
            P       PR          +    G ++  GLD+A + SYP ++YS+      GTT   
Sbjct  55   PSQTS--RPR---------GSSAAGGPDLEAGLDEATMRSYPTVLYSEAKLREKGTTTTT  103

Query  329  --TLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplS  156
              + CSICL +YKD+++LR+LPDC H FH+ C+D WL+   +CP CR+SPLP+PL +PL+
Sbjct  104  TASYCSICLADYKDTDVLRLLPDCGHLFHLQCIDLWLRSRPTCPFCRSSPLPSPLPSPLA  163

Query  155  EVVPLSHYS  129
            EV+PL+  S
Sbjct  164  EVIPLASQS  172



>ref|XP_007211321.1| hypothetical protein PRUPE_ppa019102m2g, partial [Prunus persica]
 gb|EMJ12520.1| hypothetical protein PRUPE_ppa019102m2g, partial [Prunus persica]
Length=154

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 53/80 (66%), Gaps = 7/80 (9%)
 Frame = -2

Query  425  VALGLDQAVINSYPK--LVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYF  252
            V +GLD   I SYPK  L  S+R   P     NDT CSICL EY+  E LR +P+C HYF
Sbjct  56   VVVGLDSPTIESYPKTLLGESRRLPKP-----NDTTCSICLGEYQPKEELRTIPECNHYF  110

Query  251  HVTCVDAWLKLNASCPVCRN  192
            H +CVD WLK+NA+CPVCR 
Sbjct  111  HASCVDEWLKMNATCPVCRK  130



>ref|XP_008644441.1| PREDICTED: RING-H2 finger protein ATL70-like [Zea mays]
 gb|AFW67418.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=184

 Score = 94.4 bits (233),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 90/176 (51%), Gaps = 28/176 (16%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G GY + ++ G L+L +T+ LASY C      R         A     H  +        
Sbjct  26   GFGYGVGVSVGILLLVTTITLASYFC-----TRAPADAAGEAAPSSGRHGGEG-------  73

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGT---TGNDTLCSICLC  306
               A DD          V LG+D+A +  YP++VY +       T   T   T CSICL 
Sbjct  74   ---AHDD----------VELGIDEATLKGYPEVVYGEARKLAKATKKGTSTCTCCSICLD  120

Query  305  EYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
             Y   ++LRMLPDC H FH  CVD WL+ + +CPVCR SP+P+P+ TPL+EV PL+
Sbjct  121  NYGKGDVLRMLPDCGHLFHRECVDPWLRHHPTCPVCRTSPVPSPMPTPLAEVTPLA  176



>ref|XP_003535824.1| PREDICTED: RING-H2 finger protein ATL70-like [Glycine max]
 gb|KHN04401.1| RING-H2 finger protein ATL70 [Glycine soja]
Length=168

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 55/100 (55%), Positives = 74/100 (74%), Gaps = 2/100 (2%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            V +GLD+A I +YPK++YS+       +T   T CSICL +YK S+ LR+LPDC H FH+
Sbjct  71   VDVGLDEATIMNYPKMLYSEAKLRKFDSTS--TSCSICLGDYKGSDFLRVLPDCDHVFHL  128

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPLSHYSD  126
             C+D WL+L+ +CP+CR SP+PTPLSTPL+EVVPL+   D
Sbjct  129  KCIDPWLRLHPTCPLCRTSPIPTPLSTPLAEVVPLATRRD  168



>ref|XP_003526340.1| PREDICTED: putative RING-H2 finger protein ATL69-like [Glycine 
max]
Length=185

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/178 (37%), Positives = 88/178 (49%), Gaps = 27/178 (15%)
 Frame = -2

Query  704  LTTVKPNSAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeag  525
             T   P SA T   T GLGY IAIA   LVL ST++LASY C           R+ A   
Sbjct  2    FTPAPPPSAVT--ATEGLGYGIAIAVSILVLISTIMLASYAC----------VRIKANVI  49

Query  524  yRNSHPDDNGVYLPRIIFVA---EDDEENDGVSGQNVALGLDQAVINSY--PKLVY--SK  366
                H  ++ +             D  +  GV    V LG+++  I +   PK+V   SK
Sbjct  50   IITRHRHNHSINNNNNNNNNSSFRDASDGPGV----VVLGMEKPAIETCYGPKIVIGESK  105

Query  365  RSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            R   P     +   C+ICL EY   E +R +P+C+H FH  C+D WLK++A+CP+CRN
Sbjct  106  RLSRPS----DQGPCAICLSEYLPKETIRCVPECRHCFHAECIDEWLKMSATCPLCRN  159



>ref|XP_002316475.2| hypothetical protein POPTR_0010s24970g [Populus trichocarpa]
 gb|EEF02646.2| hypothetical protein POPTR_0010s24970g [Populus trichocarpa]
Length=173

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 62/99 (63%), Gaps = 6/99 (6%)
 Frame = -2

Query  470  VAEDDEENDGVSGQ----NVALGLDQAVINSYPKLVYS--KRSGNPGGTTGNDTLCSICL  309
            +  D   +DG S       + +GLD+A +++YPKL+YS  K     G  +   + CSICL
Sbjct  47   IPNDPSVDDGSSSDGDPVTIKIGLDEATLDTYPKLLYSEAKERLEKGDDSVAASNCSICL  106

Query  308  CEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
             +Y DS++LR+LP+C H FH  C+D W KL+ +CPVCRN
Sbjct  107  ADYTDSDLLRLLPECNHLFHSQCIDPWFKLHTTCPVCRN  145



>ref|XP_009364983.1| PREDICTED: RING-H2 finger protein ATL70-like [Pyrus x bretschneideri]
Length=142

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 56/82 (68%), Gaps = 0/82 (0%)
 Frame = -2

Query  437  SGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKH  258
            S   +  GLD+A I SYPKL+YS+      G+    + CSICL +Y+D+++LR +P C H
Sbjct  46   SSPTIEQGLDEATICSYPKLLYSEAKVQMEGSVSAPSCCSICLADYEDNDLLRGVPICGH  105

Query  257  YFHVTCVDAWLKLNASCPVCRN  192
            YFH  CVD WL+L+ +CP+CRN
Sbjct  106  YFHQICVDKWLQLHPTCPICRN  127



>ref|XP_010505117.1| PREDICTED: LOW QUALITY PROTEIN: RING-H2 finger protein ATL70-like 
[Camelina sativa]
Length=237

 Score = 95.1 bits (235),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 94/173 (54%), Gaps = 27/173 (16%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            G  Y I ++ G ++L +T+ L SY C                    +S P        R 
Sbjct  83   GFRYGIGVSIGVVLLITTITLTSYYC---------------TRNQLSSSPS-------RT  120

Query  476  IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYK  297
               +     +      +V  GLD+  I SYPK++YS+  G+   TT   + C+ICL +YK
Sbjct  121  NQDSTRIHHHHHHVIIDVVPGLDEDTIQSYPKILYSEAKGS---TTA--SCCAICLGDYK  175

Query  296  DSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptplstplSEVVPLS  138
               +LR LPDC H FH+ C+D WL+LN +CPVCR SPLPTPLSTPL+EVVPL+
Sbjct  176  GKHLLRQLPDCNHLFHLKCIDTWLRLNPTCPVCRTSPLPTPLSTPLAEVVPLA  228



>ref|XP_002299182.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE83987.1| zinc finger family protein [Populus trichocarpa]
Length=164

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 58/158 (37%), Positives = 79/158 (50%), Gaps = 39/158 (25%)
 Frame = -2

Query  656  GLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPDDNGVYLPRI  477
            GLGY IAIA G LVL ST++L SY C                                RI
Sbjct  17   GLGYGIAIAIGILVLISTIMLTSYACT-------------------------------RI  45

Query  476  -IFVAEDDEENDGVSGQNVALGLDQAVINSYPKLVY--SKRSGNPGGTTGNDTLCSICLC  306
                  +   N+G     V +GL + +I+SY K+V   S+R   P     N+  CSICL 
Sbjct  46   KGNGNGNGSNNNGGEPMTVVVGLAEPIIDSYTKMVLGESRRLPKP-----NEGPCSICLS  100

Query  305  EYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRN  192
            +Y+  + +R +PDC H FH  C+D WLK++A+CP+CRN
Sbjct  101  DYQPKDTIRCIPDCHHCFHADCIDGWLKMSATCPLCRN  138



>gb|EYU42915.1| hypothetical protein MIMGU_mgv1a022735mg [Erythranthe guttata]
Length=160

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 95/192 (49%), Gaps = 47/192 (24%)
 Frame = -2

Query  683  SAPTNFTTIGLGYAIAIAFGFLVLFSTVLLASYICCrsiaarrrrrrldaeagyRNSHPD  504
            SAP +   + LGY IA+A    +L   ++LASYIC R                       
Sbjct  5    SAPNSINCVSLGYGIAVAVSVFLLIFIIVLASYICVRFKTCSD-----------------  47

Query  503  DNGVYLPRIIFVAEDDEENDGVSGQ------NVALGLDQAVINSYP--KLVYSKRSGNPG  348
                         E++E  DG+ GQ       + LGL++ VI +YP  +L  S+R   P 
Sbjct  48   ------------GEEEEGRDGL-GQFQEPVIKIVLGLEKPVIETYPVIELGRSRRLPRP-  93

Query  347  GTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHVTCVDAWLKLNASCPVCRNsplptpls  168
                N+  CSICL +Y   E +R LP+C H FH  C+D WL +N SCP+CRN    +P  
Sbjct  94   ----NNGPCSICLSDYCVKEKIRCLPECNHCFHARCIDEWLLVNGSCPLCRN----SPAV  145

Query  167  tplSEVVPLSHY  132
            TPLS+ VPL++Y
Sbjct  146  TPLSKFVPLANY  157



>gb|AES80321.2| anaphase-promoting complex subunit 11 RING-H2 finger protein 
[Medicago truncatula]
Length=213

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 5/85 (6%)
 Frame = -2

Query  440  VSGQNVALGLDQAVINSYPKLVYSKRSGNPGGTTGND--TLCSICLCEYKDSEMLRMLPD  267
            V  +N   GL +++INSY    ++K   N   T  +D  T+CSIC+ +YK+SE+LRM+P 
Sbjct  117  VDDKNTVEGLPRSIINSYHTFTFNK---NNIATINHDYDTVCSICISDYKESEILRMMPQ  173

Query  266  CKHYFHVTCVDAWLKLNASCPVCRN  192
            C HYFH  CVD WLK+N SCPVCRN
Sbjct  174  CHHYFHRDCVDTWLKVNGSCPVCRN  198



>ref|XP_010053130.1| PREDICTED: RING-H2 finger protein ATL20-like [Eucalyptus grandis]
Length=386

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 55/79 (70%), Gaps = 7/79 (9%)
 Frame = -2

Query  425  VALGLDQAVINSYPK--LVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYF  252
            V++GLD+  I SYP+  L  S+R   P     NDT C ICLCEY+  E LR +P+C HYF
Sbjct  306  VSMGLDRPTIESYPRTQLGESRRLPKP-----NDTTCPICLCEYQPKETLRTIPECNHYF  360

Query  251  HVTCVDAWLKLNASCPVCR  195
            HV C+D WL+LNA+CP+CR
Sbjct  361  HVDCIDGWLRLNATCPLCR  379



>ref|XP_009761748.1| PREDICTED: RING-H2 finger protein ATL70-like [Nicotiana sylvestris]
Length=155

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 67/95 (71%), Gaps = 8/95 (8%)
 Frame = -2

Query  425  VALGLDQAVINSYPKLVYSKRSGNPGGTTGNDTLCSICLCEYKDSEMLRMLPDCKHYFHV  246
            +  G+D+  I +YPKL+Y+ + G+   ++G    CSICL +YKD +MLR+LP+C H FH+
Sbjct  69   IQQGIDEDTIRTYPKLLYAHKVGDTASSSG----CSICLADYKDKDMLRLLPNCGHLFHI  124

Query  245  TCVDAWLKLNASCPVCRNsplptplstplSEVVPL  141
             C+D W +L+ +CP+CRN    +PL +PL EVVPL
Sbjct  125  MCIDPWPRLHPTCPICRN----SPLPSPLVEVVPL  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1628027073272