BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9581

Length=1175
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006362577.1|  PREDICTED: serine/threonine-protein kinase P...  66.6    2e-21   
ref|XP_009617352.1|  PREDICTED: serine/threonine-protein kinase p...  82.8    2e-21   Nicotiana tomentosiformis
ref|XP_009617353.1|  PREDICTED: serine/threonine-protein kinase p...  83.2    2e-21   Nicotiana tomentosiformis
ref|XP_009770599.1|  PREDICTED: serine/threonine-protein kinase p...  77.0    2e-16   Nicotiana sylvestris
ref|XP_009770600.1|  PREDICTED: serine/threonine-protein kinase p...  76.6    2e-16   Nicotiana sylvestris
ref|XP_004239418.1|  PREDICTED: serine/threonine-protein kinase p...  63.5    8e-16   Solanum lycopersicum



>ref|XP_006362577.1| PREDICTED: serine/threonine-protein kinase PRP4 homolog [Solanum 
tuberosum]
Length=984

 Score = 66.6 bits (161),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 88/142 (62%), Gaps = 5/142 (4%)
 Frame = +2

Query  107  MTSDSSDPARRKHHRSSHSDVETDEPSkrrkhghhhhhhrrrhhrhhgkkhEEIDSKLet  286
            M SDS++P+RRKHHRSS SD +T EP  +R+   HHH H R H  H  K  E+ DSK E 
Sbjct  1    MASDSNEPSRRKHHRSSPSDEDTGEP-LKRRKHRHHHRHHRHHRHHSKKHLEKSDSKSEK  59

Query  287  evkeaeveteggkeVLgsgavgvamsssNLGIDYDMEEGEIIEDDVPPTSAAYDVAEDIE  466
            E+ +++ E E G +      +G  +  S LGIDYDMEEGEIIEDDV  T+A  D  E I 
Sbjct  60   EMVKSKSEIENGGKPGEEMKIGTVVGVSTLGIDYDMEEGEIIEDDVVDTAAVGDADEIIV  119

Query  467  NKKLSS----DMDHHEAHAEGP  520
             KKL +    +M+ HEA  +GP
Sbjct  120  AKKLGNEDDLNMELHEAKGQGP  141


 Score = 65.1 bits (157),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 117/194 (60%), Gaps = 10/194 (5%)
 Frame = +1

Query  610   KYLANGNLVGERHKHEGK-----CSPIEESRTQKHYYGDRNDLKDRK-RSLTPDNAGKRR  771
             K+ ANG+ + E HK E K         EES  QK Y+ D + L+D+  +SLTP+N GKR 
Sbjct  178   KHSANGSYIYEFHKLESKPQKEDSIAGEESTEQKSYHEDESALQDQIIKSLTPENVGKRH  237

Query  772   KTAKVALPRDGYEDEGPYGKDSKSPDRSRGLPQSQSTSEEVSISEVFHKPEGVFykdrky  951
             ++ +V+     + +E    K SKSPDRSRG  +S+S  EE  +     + +  + K+ +Y
Sbjct  238   RSVRVSSSHYEHPEERHVTKSSKSPDRSRGRSRSKSVLEESFLVPKSREIDDTYEKESRY  297

Query  952   kgdkdyERVTGLIRDYCHGSQGFLKEKerersssrsryssQDDRFHSHETAERYREGSRE  1131
             + + D E++ G  RDY HGS+   +++E+E +S  SR S   DR+++ E+ +R+RE S E
Sbjct  298   RSNFDDEKI-GYNRDYRHGSRESSRDREKEHNSCNSRSSR--DRYYNRESVDRFRE-SME  353

Query  1132  IDRDRTKNRDRERE  1173
              DRDR + +DRERE
Sbjct  354   NDRDRVREKDRERE  367



>ref|XP_009617352.1| PREDICTED: serine/threonine-protein kinase prpf4B isoform X1 
[Nicotiana tomentosiformis]
Length=1031

 Score = 82.8 bits (203),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 115/198 (58%), Gaps = 8/198 (4%)
 Frame = +1

Query  595   RNFSEKYLANGNLVGERHKHEGK-----CSPIEESRTQKHYYGDRNDLKDRKRSLTPDNA  759
             R  S+K+ ANG+ + E HK + K         EE R QK Y  D + L+D+++SLTP+++
Sbjct  155   RKSSDKHFANGSCIDEFHKLDSKPQKKDSYAGEEVRKQKSYDDDESHLQDQRKSLTPESS  214

Query  760   GKRRKTAKVALPRDGYEDEGPYGKDSKSPDRSRGLPQSQSTSEEVSISEVFHKPEGVFyk  939
             GKR ++  V+   D + +E    K SKSPDR RG  +S+S  EE  +     + +  + K
Sbjct  215   GKRHRSVGVSSSHDEHLEERHVTKLSKSPDRFRGRSRSKSVLEESFLVPKSREKDDAYEK  274

Query  940   drkykgdkdyERVTGLIRDYCHGSQGFLKEKerersssrsryssQDDRFHSHETAERYRE  1119
             + +Y+ + D E++ G  +DY HGS+     ++ E+  + S      DR++S E+ +RYRE
Sbjct  275   ESRYRSNLDDEKI-GHNKDYRHGSRE--SSRDIEKEHNSSYSRHSRDRYYSTESVDRYRE  331

Query  1120  GSREIDRDRTKNRDRERE  1173
              S E +RDR + +DRERE
Sbjct  332   SSIENERDRVREKDRERE  349


 Score = 48.5 bits (114),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 30/50 (60%), Gaps = 8/50 (16%)
 Frame = +2

Query  371  NLGIDYDMEEGEIIEDDVPPTSAAYDVAEDIENKKLSSDMDHHEAHAEGP  520
             LG+DYDMEEGEIIEDDV  T+   D  E         DM+ HEA  +GP
Sbjct  84   TLGLDYDMEEGEIIEDDVAATATVGDGHE--------LDMELHEAQRQGP  125



>ref|XP_009617353.1| PREDICTED: serine/threonine-protein kinase prpf4B isoform X2 
[Nicotiana tomentosiformis]
Length=996

 Score = 83.2 bits (204),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 72/198 (36%), Positives = 115/198 (58%), Gaps = 8/198 (4%)
 Frame = +1

Query  595   RNFSEKYLANGNLVGERHKHEGK-----CSPIEESRTQKHYYGDRNDLKDRKRSLTPDNA  759
             R  S+K+ ANG+ + E HK + K         EE R QK Y  D + L+D+++SLTP+++
Sbjct  155   RKSSDKHFANGSCIDEFHKLDSKPQKKDSYAGEEVRKQKSYDDDESHLQDQRKSLTPESS  214

Query  760   GKRRKTAKVALPRDGYEDEGPYGKDSKSPDRSRGLPQSQSTSEEVSISEVFHKPEGVFyk  939
             GKR ++  V+   D + +E    K SKSPDR RG  +S+S  EE  +     + +  + K
Sbjct  215   GKRHRSVGVSSSHDEHLEERHVTKLSKSPDRFRGRSRSKSVLEESFLVPKSREKDDAYEK  274

Query  940   drkykgdkdyERVTGLIRDYCHGSQGFLKEKerersssrsryssQDDRFHSHETAERYRE  1119
             + +Y+ + D E++ G  +DY HGS+     ++ E+  + S      DR++S E+ +RYRE
Sbjct  275   ESRYRSNLDDEKI-GHNKDYRHGSRE--SSRDIEKEHNSSYSRHSRDRYYSTESVDRYRE  331

Query  1120  GSREIDRDRTKNRDRERE  1173
              S E +RDR + +DRERE
Sbjct  332   SSIENERDRVREKDRERE  349


 Score = 48.5 bits (114),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 30/50 (60%), Gaps = 8/50 (16%)
 Frame = +2

Query  371  NLGIDYDMEEGEIIEDDVPPTSAAYDVAEDIENKKLSSDMDHHEAHAEGP  520
             LG+DYDMEEGEIIEDDV  T+   D  E         DM+ HEA  +GP
Sbjct  84   TLGLDYDMEEGEIIEDDVAATATVGDGHE--------LDMELHEAQRQGP  125



>ref|XP_009770599.1| PREDICTED: serine/threonine-protein kinase prpf4B isoform X1 
[Nicotiana sylvestris]
Length=1044

 Score = 77.0 bits (188),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 112/198 (57%), Gaps = 8/198 (4%)
 Frame = +1

Query  595   RNFSEKYLANGNLVGERHKHEGK-----CSPIEESRTQKHYYGDRNDLKDRKRSLTPDNA  759
             R  S+K+  NG+ + E HK + K         EE R QK Y  D + L+D ++SLTP+++
Sbjct  154   RKSSDKHFVNGSCIDEFHKLDSKPQKEDIYAGEEGRKQKSYDDDESHLQDERKSLTPESS  213

Query  760   GKRRKTAKVALPRDGYEDEGPYGKDSKSPDRSRGLPQSQSTSEEVSISEVFHKPEGVFyk  939
             GKR ++  V+   D + ++    K SKSPDR RG  +S+S  EE  +     + +  + K
Sbjct  214   GKRHRSVGVSSSHDEHLEDRHVTKLSKSPDRFRGRSRSKSVLEESFLVPKSREKDDAYEK  273

Query  940   drkykgdkdyERVTGLIRDYCHGSQGFLKEKerersssrsryssQDDRFHSHETAERYRE  1119
             + +Y+ + D E+  G  +DY HGS+     ++ E+  + S      DR++S ++ +RYRE
Sbjct  274   ESRYRSNFDDEK-NGRNKDYRHGSRE--SSRDVEKEHNSSCNRHSRDRYYSRDSVDRYRE  330

Query  1120  GSREIDRDRTKNRDRERE  1173
              S E +RDR + +DRERE
Sbjct  331   SSIENERDRLREKDRERE  348


 Score = 37.7 bits (86),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 37/71 (52%), Gaps = 16/71 (23%)
 Frame = +2

Query  371  NLGIDYDMEEGEIIEDDVPPTSAAYDVAEDIENKKLSSDMDHHEAHAEGPNFGMPIEKKV  550
             LG+DYDMEEGEIIEDDV   +A  D  E         DM+ HEA  +GP         V
Sbjct  83   TLGLDYDMEEGEIIEDDVAAAAAVGDGDE--------LDMELHEAQRQGP--------AV  126

Query  551  EEADRSKNHEG  583
            E+ DR+    G
Sbjct  127  EKVDRNSTASG  137



>ref|XP_009770600.1| PREDICTED: serine/threonine-protein kinase prpf4B isoform X2 
[Nicotiana sylvestris]
Length=1009

 Score = 76.6 bits (187),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 69/198 (35%), Positives = 112/198 (57%), Gaps = 8/198 (4%)
 Frame = +1

Query  595   RNFSEKYLANGNLVGERHKHEGK-----CSPIEESRTQKHYYGDRNDLKDRKRSLTPDNA  759
             R  S+K+  NG+ + E HK + K         EE R QK Y  D + L+D ++SLTP+++
Sbjct  154   RKSSDKHFVNGSCIDEFHKLDSKPQKEDIYAGEEGRKQKSYDDDESHLQDERKSLTPESS  213

Query  760   GKRRKTAKVALPRDGYEDEGPYGKDSKSPDRSRGLPQSQSTSEEVSISEVFHKPEGVFyk  939
             GKR ++  V+   D + ++    K SKSPDR RG  +S+S  EE  +     + +  + K
Sbjct  214   GKRHRSVGVSSSHDEHLEDRHVTKLSKSPDRFRGRSRSKSVLEESFLVPKSREKDDAYEK  273

Query  940   drkykgdkdyERVTGLIRDYCHGSQGFLKEKerersssrsryssQDDRFHSHETAERYRE  1119
             + +Y+ + D E+  G  +DY HGS+     ++ E+  + S      DR++S ++ +RYRE
Sbjct  274   ESRYRSNFDDEK-NGRNKDYRHGSRE--SSRDVEKEHNSSCNRHSRDRYYSRDSVDRYRE  330

Query  1120  GSREIDRDRTKNRDRERE  1173
              S E +RDR + +DRERE
Sbjct  331   SSIENERDRLREKDRERE  348


 Score = 37.7 bits (86),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 31/71 (44%), Positives = 37/71 (52%), Gaps = 16/71 (23%)
 Frame = +2

Query  371  NLGIDYDMEEGEIIEDDVPPTSAAYDVAEDIENKKLSSDMDHHEAHAEGPNFGMPIEKKV  550
             LG+DYDMEEGEIIEDDV   +A  D  E         DM+ HEA  +GP         V
Sbjct  83   TLGLDYDMEEGEIIEDDVAAAAAVGDGDE--------LDMELHEAQRQGP--------AV  126

Query  551  EEADRSKNHEG  583
            E+ DR+    G
Sbjct  127  EKVDRNSTASG  137



>ref|XP_004239418.1| PREDICTED: serine/threonine-protein kinase prpf4B [Solanum lycopersicum]
Length=1005

 Score = 63.5 bits (153),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 87/142 (61%), Gaps = 5/142 (4%)
 Frame = +2

Query  107  MTSDSSDPARRKHHRSSHSDVETDEPSkrrkhghhhhhhrrrhhrhhgkkhEEIDSKLet  286
            M SDS++P+RRKHHRSS SD +T EP  +R+   HHH H R H  H  K  E+ DSK E 
Sbjct  1    MASDSNEPSRRKHHRSSPSDEDTGEP-LKRRKHRHHHRHHRHHRHHSKKHLEKSDSKSEK  59

Query  287  evkeaeveteggkeVLgsgavgvamsssNLGIDYDMEEGEIIEDDVPPTSAAYDVAEDIE  466
            E+ +++ E E G +      +G  +  S LGIDYDMEEGEIIEDDV  T+A  D  E   
Sbjct  60   EMVKSKSEIENGGKPGEEMKIGTVVGVSTLGIDYDMEEGEIIEDDVVDTAAVGDADETTV  119

Query  467  NKKLSS----DMDHHEAHAEGP  520
             +KL +    +M+ HEA  +GP
Sbjct  120  TEKLGNEDDLNMELHEAQEQGP  141


 Score = 48.9 bits (115),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 67/185 (36%), Positives = 107/185 (58%), Gaps = 9/185 (5%)
 Frame = +1

Query  595   RNFSEKYLANGNLVGERHKHEGK-----CSPIEESRTQKHYYGDRNDLKDRK-RSLTPDN  756
             R  S+K+ ANG+ + + HK + +         EE   QK Y  D N+++DR  RS TP+N
Sbjct  173   RKSSDKHCANGSYIDKFHKLDSEPQKEDSITAEEITKQKSYDEDENEVQDRIIRSSTPEN  232

Query  757   AGKRRKTAKVALPRDGYEDEGPYGKDSKSPDRSRGLPQSQSTSEEVSISEVFHKPEGVFy  936
              GKR ++ +V+     + +E    K SKSPDRSRG  +S+S  EE  +     + +  + 
Sbjct  233   VGKRHRSVRVSSSHYEHPEERHVTKSSKSPDRSRGRSRSKSVLEESFLVPKSREIDDTYE  292

Query  937   kdrkykgdkdyERVTGLIRDYCHGSQGFLKEKerersssrsryssQDDRFHSHETAERYR  1116
             K+ +YKG+ D E++    RDY HGS+   +++E+E +S  SR S   DR+++ E+ +R+R
Sbjct  293   KESRYKGNFDDEKIV-YNRDYRHGSRDSSRDREKEHNSGNSRSSR--DRYYNRESVDRFR  349

Query  1117  EGSRE  1131
             E S E
Sbjct  350   ESSLE  354



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3219410483011