BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9559

Length=659
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004235390.1|  PREDICTED: protein REVEILLE 7                      177   4e-49   Solanum lycopersicum
ref|XP_009618565.1|  PREDICTED: protein REVEILLE 1-like isoform X1      174   5e-48   Nicotiana tomentosiformis
ref|XP_009768903.1|  PREDICTED: uncharacterized protein LOC104219...    174   8e-48   Nicotiana sylvestris
ref|XP_011072049.1|  PREDICTED: protein REVEILLE 7-like isoform X2      167   4e-45   
gb|AAU90342.2|  Myb-like DNA-binding protein, putative                  166   2e-44   Solanum demissum
ref|XP_009618566.1|  PREDICTED: protein REVEILLE 1-like isoform X2      160   7e-43   Nicotiana tomentosiformis
ref|XP_011072048.1|  PREDICTED: protein REVEILLE 7-like isoform X1      161   8e-43   
ref|XP_009768904.1|  PREDICTED: protein REVEILLE 1-like isoform X2      160   1e-42   Nicotiana sylvestris
ref|XP_011086968.1|  PREDICTED: protein REVEILLE 2-like isoform X1      153   5e-40   Sesamum indicum [beniseed]
ref|XP_010101053.1|  Myb-like protein G                                 150   1e-38   Morus notabilis
emb|CDO98602.1|  unnamed protein product                                150   1e-38   Coffea canephora [robusta coffee]
ref|XP_010675239.1|  PREDICTED: protein REVEILLE 2 isoform X1           146   2e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011086969.1|  PREDICTED: protein REVEILLE 2-like isoform X2      145   4e-37   Sesamum indicum [beniseed]
ref|XP_010246196.1|  PREDICTED: protein REVEILLE 1-like                 145   7e-37   Nelumbo nucifera [Indian lotus]
ref|XP_008368744.1|  PREDICTED: protein REVEILLE 1-like                 139   2e-36   
ref|XP_002317724.1|  EARLY-PHYTOCHROME-RESPONSIVE1 family protein       142   9e-36   Populus trichocarpa [western balsam poplar]
ref|XP_007037069.1|  Homeodomain-like superfamily protein, putati...    141   2e-35   Theobroma cacao [chocolate]
ref|XP_010525035.1|  PREDICTED: protein REVEILLE 1                      140   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_009790907.1|  PREDICTED: protein REVEILLE 1-like isoform X1      140   3e-35   Nicotiana sylvestris
ref|XP_008240377.1|  PREDICTED: protein REVEILLE 7-like isoform X2      139   9e-35   Prunus mume [ume]
ref|XP_002305260.2|  hypothetical protein POPTR_0004s07270g             138   1e-34   
ref|XP_010537507.1|  PREDICTED: protein REVEILLE 7 isoform X1           137   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_008240374.1|  PREDICTED: protein REVEILLE 7-like isoform X1      139   1e-34   Prunus mume [ume]
ref|XP_012074729.1|  PREDICTED: protein REVEILLE 1 isoform X2           139   1e-34   
ref|XP_012074728.1|  PREDICTED: protein REVEILLE 1 isoform X1           139   1e-34   Jatropha curcas
ref|XP_011649662.1|  PREDICTED: protein REVEILLE 7-like                 138   1e-34   Cucumis sativus [cucumbers]
ref|XP_011000774.1|  PREDICTED: protein REVEILLE 7-like                 138   1e-34   Populus euphratica
ref|XP_008439595.1|  PREDICTED: protein REVEILLE 2-like                 138   1e-34   Cucumis melo [Oriental melon]
ref|XP_006384118.1|  hypothetical protein POPTR_0004s07270g             138   2e-34   
gb|KDO44076.1|  hypothetical protein CISIN_1g021851mg                   135   2e-34   Citrus sinensis [apfelsine]
ref|XP_008381387.1|  PREDICTED: protein REVEILLE 1-like                 137   4e-34   
emb|CDX69388.1|  BnaA10g17370D                                          136   4e-34   
ref|XP_010062320.1|  PREDICTED: protein REVEILLE 2                      137   4e-34   Eucalyptus grandis [rose gum]
ref|XP_002526589.1|  DNA binding protein, putative                      137   5e-34   Ricinus communis
ref|XP_011085926.1|  PREDICTED: protein REVEILLE 1                      137   5e-34   Sesamum indicum [beniseed]
gb|AIL81922.1|  RVE1-like protein                                       137   5e-34   Euphorbia esula [wolf's milk]
ref|XP_004299482.1|  PREDICTED: protein REVEILLE 7-like isoform X2      135   5e-34   Fragaria vesca subsp. vesca
gb|KHN24174.1|  Myb-like protein G                                      134   5e-34   Glycine soja [wild soybean]
ref|NP_001236032.1|  MYB transcription factor MYB173                    134   5e-34   Glycine max [soybeans]
gb|AHZ13511.1|  RVE1-like protein                                       137   5e-34   Euphorbia esula [wolf's milk]
gb|AIL81923.1|  RVE1-like protein                                       137   6e-34   Euphorbia esula [wolf's milk]
gb|ABW22144.1|  putative At5g37260-like protein                         136   6e-34   Solanum peruvianum [Peruvian tomato]
gb|ABW22142.1|  putative At5g37260-like protein                         136   6e-34   Solanum peruvianum [Peruvian tomato]
gb|AEO52898.1|  hypothetical protein                                    136   6e-34   Solanum peruvianum [Peruvian tomato]
gb|ABW22136.1|  putative At5g37260-like protein                         136   6e-34   Solanum peruvianum [Peruvian tomato]
ref|XP_011013212.1|  PREDICTED: protein REVEILLE 1-like                 136   6e-34   Populus euphratica
ref|XP_009790908.1|  PREDICTED: protein REVEILLE 1-like isoform X2      136   6e-34   Nicotiana sylvestris
ref|XP_008227906.1|  PREDICTED: LOW QUALITY PROTEIN: protein REVE...    136   9e-34   Prunus mume [ume]
ref|XP_009121398.1|  PREDICTED: protein REVEILLE 1-like                 135   1e-33   Brassica rapa
gb|KGN63974.1|  hypothetical protein Csa_1G032440                       138   1e-33   Cucumis sativus [cucumbers]
ref|XP_006441350.1|  hypothetical protein CICLE_v10020130mg             135   1e-33   Citrus clementina [clementine]
ref|XP_007152597.1|  hypothetical protein PHAVU_004G143400g             135   1e-33   Phaseolus vulgaris [French bean]
ref|NP_568344.2|  myb family transcription factor RVE1                  134   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011464451.1|  PREDICTED: protein REVEILLE 7-like isoform X1      135   1e-33   Fragaria vesca subsp. vesca
ref|XP_010453914.1|  PREDICTED: protein REVEILLE 1 isoform X1           134   2e-33   Camelina sativa [gold-of-pleasure]
dbj|BAO57283.1|  Myb family transcription factor                        135   2e-33   Ipomoea nil [qian niu]
gb|KHN08771.1|  Myb-like protein G                                      134   2e-33   Glycine soja [wild soybean]
gb|ADL36788.1|  MYBR domain class transcription factor                  135   2e-33   Malus domestica [apple tree]
ref|XP_009355963.1|  PREDICTED: protein REVEILLE 7-like                 135   2e-33   
ref|NP_001289226.1|  protein REVEILLE 7-like                            135   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_003553057.1|  PREDICTED: protein LHY                             134   2e-33   Glycine max [soybeans]
ref|NP_198542.1|  MYB family transcription factor Circadian 1           132   2e-33   Arabidopsis thaliana [mouse-ear cress]
gb|ADV29615.1|  At5g37260-like protein                                  135   2e-33   Solanum arcanum
gb|AAS09985.1|  MYB transcription factor                                132   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006405937.1|  hypothetical protein EUTSA_v10028153mg             132   2e-33   
gb|ABW22150.1|  putative At5g37260-like protein                         134   2e-33   Solanum peruvianum [Peruvian tomato]
gb|ABW22137.1|  putative At5g37260-like protein                         134   2e-33   Solanum peruvianum [Peruvian tomato]
dbj|BAB10517.1|  unnamed protein product                                134   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287913.1|  hypothetical protein CARUB_v10001147mg             134   2e-33   Capsella rubella
ref|XP_010453916.1|  PREDICTED: protein REVEILLE 1 isoform X3           134   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010420440.1|  PREDICTED: protein REVEILLE 1-like                 134   2e-33   
gb|ABW22133.1|  putative At5g37260-like protein                         134   2e-33   Solanum peruvianum [Peruvian tomato]
gb|AAX44338.1|  putative At5g37260                                      134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|AAX44336.1|  putative At5g37260                                      134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ABW22157.1|  putative At5g37260-like protein                         134   3e-33   Solanum chilense
gb|ABW22132.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|AAX44342.1|  putative At5g37260                                      134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|AAX44337.1|  putative At5g37260                                      134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ABW22171.1|  putative At5g37260-like protein                         134   3e-33   Solanum chilense
gb|ABW22153.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ADV29610.1|  At5g37260-like protein                                  134   3e-33   Solanum arcanum
gb|ABW22165.1|  putative At5g37260-like protein                         134   3e-33   Solanum chilense
gb|ABW22151.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ABW22138.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
ref|XP_004231624.1|  PREDICTED: protein REVEILLE 1                      134   3e-33   Solanum lycopersicum
gb|ABW22145.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ADV29645.1|  At5g37260-like protein                                  134   3e-33   Solanum arcanum
gb|ABW22170.1|  putative At5g37260-like protein                         134   3e-33   Solanum chilense
gb|AEO52901.1|  hypothetical protein                                    134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|AAX44333.1|  putative At5g37260                                      134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|AAX44341.1|  putative At5g37260                                      134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|AEO52891.1|  hypothetical protein                                    134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ABW22147.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ABW22127.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|AAX44353.1|  putative At5g37260                                      134   3e-33   Solanum habrochaites
gb|ADV29607.1|  At5g37260-like protein                                  134   3e-33   Solanum arcanum
gb|ADV29622.1|  At5g37260-like protein                                  134   3e-33   Solanum arcanum
gb|ABW22128.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|AEO52893.1|  hypothetical protein                                    134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ABW22152.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ABW22146.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ABW22140.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ADV29646.1|  At5g37260-like protein                                  134   3e-33   Solanum arcanum
gb|ABW22169.1|  putative At5g37260-like protein                         134   3e-33   Solanum chilense
gb|ABW22160.1|  putative At5g37260-like protein                         134   3e-33   Solanum chilense
gb|ADV29614.1|  At5g37260-like protein                                  134   3e-33   Solanum arcanum
gb|ABW22148.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
ref|XP_007215304.1|  hypothetical protein PRUPE_ppa005083mg             134   3e-33   
gb|AEO52895.1|  hypothetical protein                                    134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ADV29557.1|  At5g37260-like protein                                  134   3e-33   Solanum habrochaites
gb|ABW22158.1|  putative At5g37260-like protein                         134   3e-33   Solanum chilense
gb|ABW22167.1|  putative At5g37260-like protein                         134   3e-33   Solanum chilense
gb|AEO52801.1|  hypothetical protein                                    134   3e-33   Solanum chilense
gb|ABW22124.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ADV29577.1|  At5g37260-like protein                                  134   3e-33   Solanum habrochaites
gb|ABW22154.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ABW22174.1|  putative At5g37260-like protein                         134   3e-33   Solanum chilense
gb|AAX44355.1|  putative At5g37260                                      134   3e-33   Solanum habrochaites
gb|ADV29591.1|  At5g37260-like protein                                  134   3e-33   Solanum habrochaites
gb|ADV29570.1|  At5g37260-like protein                                  134   3e-33   Solanum habrochaites
gb|ADV29564.1|  At5g37260-like protein                                  134   3e-33   Solanum habrochaites
gb|ABW22129.1|  putative At5g37260-like protein                         134   3e-33   Solanum peruvianum [Peruvian tomato]
gb|ABL63123.1|  MYB transcription factor                                134   3e-33   Catharanthus roseus [chatas]
ref|XP_011035339.1|  PREDICTED: protein REVEILLE 1-like isoform X2      134   3e-33   Populus euphratica
gb|ADV29630.1|  At5g37260-like protein                                  134   3e-33   Solanum arcanum
gb|ADV29612.1|  At5g37260-like protein                                  134   3e-33   Solanum arcanum
gb|AAX44374.1|  putative At5g37260                                      134   3e-33   Solanum pimpinellifolium [currant tomato]
gb|AEO52806.1|  hypothetical protein                                    134   3e-33   Solanum chilense
gb|AEO52800.1|  hypothetical protein                                    134   3e-33   Solanum chilense
gb|ADV29634.1|  At5g37260-like protein                                  134   3e-33   Solanum arcanum
gb|ADV29640.1|  At5g37260-like protein                                  134   3e-33   Solanum arcanum
gb|AAX44369.1|  putative At5g37260                                      134   4e-33   Solanum pimpinellifolium [currant tomato]
gb|ADV29611.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|AEO52894.1|  hypothetical protein                                    134   4e-33   Solanum peruvianum [Peruvian tomato]
gb|AEO52804.1|  hypothetical protein                                    134   4e-33   Solanum chilense
gb|ABW22180.1|  putative At5g37260-like protein                         134   4e-33   Solanum chilense
gb|ABW22176.1|  putative At5g37260-like protein                         134   4e-33   Solanum chilense
gb|AEO52797.1|  hypothetical protein                                    134   4e-33   Solanum chilense
gb|ABW22162.1|  putative At5g37260-like protein                         134   4e-33   Solanum chilense
ref|XP_011035338.1|  PREDICTED: protein REVEILLE 1-like isoform X1      134   4e-33   Populus euphratica
gb|AEO52798.1|  hypothetical protein                                    134   4e-33   Solanum chilense
gb|ABW22161.1|  putative At5g37260-like protein                         134   4e-33   Solanum chilense
gb|AEO52900.1|  hypothetical protein                                    134   4e-33   Solanum peruvianum [Peruvian tomato]
gb|AAX44340.1|  putative At5g37260                                      134   4e-33   Solanum peruvianum [Peruvian tomato]
gb|AAX44343.1|  putative At5g37260                                      134   4e-33   Solanum chilense
gb|ADV29637.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|ADV29618.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|ABW22166.1|  putative At5g37260-like protein                         134   4e-33   Solanum chilense
ref|XP_008393486.1|  PREDICTED: protein REVEILLE 7-like                 134   4e-33   
gb|ADV29620.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|AAX44344.1|  putative At5g37260                                      134   4e-33   Solanum chilense
gb|ADV29642.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|ADV29633.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|ABW22149.1|  putative At5g37260-like protein                         134   4e-33   Solanum peruvianum [Peruvian tomato]
gb|ADV29575.1|  At5g37260-like protein                                  134   4e-33   Solanum habrochaites
gb|AEO52802.1|  hypothetical protein                                    134   4e-33   Solanum chilense
gb|ADV29629.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|ADV29628.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|ADV29626.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|ADV29623.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|ABW22181.1|  putative At5g37260-like protein                         134   4e-33   Solanum chilense
gb|KDO57321.1|  hypothetical protein CISIN_1g0126251mg                  132   4e-33   Citrus sinensis [apfelsine]
gb|ADV29631.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|ADV29602.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|ABW22173.1|  putative At5g37260-like protein                         134   4e-33   Solanum chilense
gb|ADV29639.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|ABW22155.1|  putative At5g37260-like protein                         134   4e-33   Solanum chilense
gb|ABW22130.1|  putative At5g37260-like protein                         134   4e-33   Solanum peruvianum [Peruvian tomato]
gb|ADV29625.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|AAX44359.1|  putative At5g37260                                      134   4e-33   Solanum chmielewskii
gb|ADV29651.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|ADV29619.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
emb|CDP01692.1|  unnamed protein product                                134   4e-33   Coffea canephora [robusta coffee]
gb|ADV29608.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|ADV29632.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
ref|XP_009613640.1|  PREDICTED: protein REVEILLE 1-like isoform X1      134   4e-33   Nicotiana tomentosiformis
gb|ADV29616.1|  At5g37260-like protein                                  134   4e-33   Solanum arcanum
gb|AEO52888.1|  hypothetical protein                                    134   4e-33   Solanum peruvianum [Peruvian tomato]
gb|ABW22123.1|  putative At5g37260-like protein                         134   4e-33   Solanum peruvianum [Peruvian tomato]
ref|XP_006350462.1|  PREDICTED: uncharacterized protein LOC102602066    134   4e-33   Solanum tuberosum [potatoes]
gb|AEO52897.1|  hypothetical protein                                    134   5e-33   Solanum peruvianum [Peruvian tomato]
gb|KCW69450.1|  hypothetical protein EUGRSUZ_F02906                     135   5e-33   Eucalyptus grandis [rose gum]
gb|KDO57322.1|  hypothetical protein CISIN_1g0126251mg                  132   5e-33   Citrus sinensis [apfelsine]
ref|XP_010492675.1|  PREDICTED: protein REVEILLE 1-like                 133   5e-33   Camelina sativa [gold-of-pleasure]
ref|XP_002873821.1|  myb family transcription factor                    133   5e-33   
ref|XP_011047787.1|  PREDICTED: protein REVEILLE 7-like                 134   5e-33   Populus euphratica
ref|XP_006372412.1|  hypothetical protein POPTR_0017s01380g             134   6e-33   
ref|XP_002868495.1|  hypothetical protein ARALYDRAFT_493689             131   6e-33   
ref|XP_009144670.1|  PREDICTED: protein REVEILLE 2                      131   6e-33   Brassica rapa
ref|XP_006374255.1|  hypothetical protein POPTR_0015s05430g             134   7e-33   Populus trichocarpa [western balsam poplar]
ref|XP_006855608.1|  PREDICTED: uncharacterized protein LOC18445408     134   7e-33   Amborella trichopoda
ref|XP_010037005.1|  PREDICTED: protein REVEILLE 7                      134   7e-33   
ref|XP_009782662.1|  PREDICTED: protein REVEILLE 1-like isoform X1      133   7e-33   Nicotiana sylvestris
emb|CDY26997.1|  BnaC06g12130D                                          131   7e-33   Brassica napus [oilseed rape]
ref|XP_009413064.1|  PREDICTED: protein REVEILLE 5-like                 133   9e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB08184.1|  hypothetical protein B456_001G069700                    133   9e-33   Gossypium raimondii
ref|XP_009609237.1|  PREDICTED: protein REVEILLE 1-like isoform X1      133   9e-33   Nicotiana tomentosiformis
ref|XP_010935334.1|  PREDICTED: protein CCA1                            133   1e-32   Elaeis guineensis
ref|XP_009370571.1|  PREDICTED: protein REVEILLE 1                      133   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_009385654.1|  PREDICTED: protein REVEILLE 1-like isoform X1      133   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG17751.1|  Protein LHY -like protein                               133   1e-32   Gossypium arboreum [tree cotton]
emb|CDY16939.1|  BnaC09g40660D                                          130   1e-32   Brassica napus [oilseed rape]
ref|XP_006430409.1|  hypothetical protein CICLE_v10011554mg             133   1e-32   Citrus clementina [clementine]
ref|XP_004515250.1|  PREDICTED: uncharacterized protein LOC101509066    133   1e-32   Cicer arietinum [garbanzo]
gb|ABH02924.1|  MYB transcription factor MYB131                         131   1e-32   Glycine max [soybeans]
ref|XP_007146984.1|  hypothetical protein PHAVU_006G086700g             131   1e-32   Phaseolus vulgaris [French bean]
gb|EYU38934.1|  hypothetical protein MIMGU_mgv1a008764mg                131   1e-32   Erythranthe guttata [common monkey flower]
ref|XP_006481961.1|  PREDICTED: uncharacterized protein LOC102630458    133   1e-32   Citrus sinensis [apfelsine]
gb|ABW22179.1|  putative At5g37260-like protein                         132   1e-32   Solanum chilense
gb|ABH02927.1|  MYB transcription factor MYB140                         126   1e-32   Glycine max [soybeans]
gb|ABW22178.1|  putative At5g37260-like protein                         132   2e-32   Solanum chilense
gb|ABW22143.1|  putative At5g37260-like protein                         132   2e-32   Solanum peruvianum [Peruvian tomato]
gb|ABW22177.1|  putative At5g37260-like protein                         132   2e-32   Solanum chilense
ref|XP_008804812.1|  PREDICTED: protein REVEILLE 7-like                 132   2e-32   Phoenix dactylifera
gb|EYU22283.1|  hypothetical protein MIMGU_mgv1a024824mg                130   2e-32   Erythranthe guttata [common monkey flower]
gb|ABW22156.1|  putative At5g37260-like protein                         132   2e-32   Solanum chilense
gb|AEO52889.1|  hypothetical protein                                    132   2e-32   Solanum peruvianum [Peruvian tomato]
ref|XP_006478113.1|  PREDICTED: uncharacterized protein LOC102614...    132   2e-32   Citrus sinensis [apfelsine]
gb|AEO52890.1|  hypothetical protein                                    132   2e-32   Solanum peruvianum [Peruvian tomato]
ref|XP_006400263.1|  hypothetical protein EUTSA_v10013821mg             131   2e-32   Eutrema salsugineum [saltwater cress]
gb|AHB59600.1|  putative MYB-related protein 13                         132   2e-32   Arachis hypogaea [goober]
gb|ADV29635.1|  At5g37260-like protein                                  132   2e-32   Solanum arcanum
gb|KEH26846.1|  myb transcription factor                                132   2e-32   Medicago truncatula
gb|ABW22168.1|  putative At5g37260-like protein                         132   2e-32   Solanum chilense
gb|ABW22159.1|  putative At5g37260-like protein                         132   2e-32   Solanum chilense
gb|ABW22182.1|  putative At5g37260-like protein                         132   2e-32   Solanum chilense
emb|CDY02714.1|  BnaC02g07210D                                          131   2e-32   
ref|XP_009367121.1|  PREDICTED: protein REVEILLE 1-like isoform X1      132   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_003548314.1|  PREDICTED: protein CCA1                            132   3e-32   Glycine max [soybeans]
dbj|BAP76057.1|  putative LHY                                           133   3e-32   Cryptomeria japonica
gb|AGM20683.1|  EPR                                                     133   4e-32   Populus tomentosa [Chinese white poplar]
ref|XP_010528596.1|  PREDICTED: protein REVEILLE 2                      129   4e-32   Tarenaya hassleriana [spider flower]
gb|KHG08399.1|  Protein LHY -like protein                               131   4e-32   Gossypium arboreum [tree cotton]
gb|ABW22184.1|  putative At5g37260-like protein                         131   5e-32   Solanum chilense
gb|EPS61622.1|  hypothetical protein M569_13174                         128   5e-32   Genlisea aurea
gb|KFK33315.1|  hypothetical protein AALP_AA6G359200                    129   6e-32   Arabis alpina [alpine rockcress]
gb|KFK25943.1|  hypothetical protein AALP_AA8G183100                    130   6e-32   Arabis alpina [alpine rockcress]
ref|XP_009382073.1|  PREDICTED: protein REVEILLE 1-like                 130   6e-32   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABH02928.1|  MYB transcription factor MYB144                         123   7e-32   Glycine max [soybeans]
ref|XP_001767701.1|  cca1b circadian clock protein CCA1b                124   8e-32   
ref|XP_004490782.1|  PREDICTED: uncharacterized protein LOC101488...    130   9e-32   Cicer arietinum [garbanzo]
emb|CCU64195.1|  ScMYB43 protein                                        131   9e-32   Saccharum hybrid cultivar Co 86032
ref|XP_009126176.1|  PREDICTED: protein REVEILLE 1-like                 129   1e-31   Brassica rapa
ref|XP_009613641.1|  PREDICTED: protein REVEILLE 1-like isoform X2      130   1e-31   Nicotiana tomentosiformis
ref|XP_007141962.1|  hypothetical protein PHAVU_008G240700g             130   1e-31   Phaseolus vulgaris [French bean]
ref|XP_010940231.1|  PREDICTED: protein CCA1-like                       130   1e-31   Elaeis guineensis
emb|CDX85462.1|  BnaA02g03510D                                          129   1e-31   
ref|XP_002452742.1|  hypothetical protein SORBIDRAFT_04g031590          130   1e-31   
ref|XP_008794529.1|  PREDICTED: uncharacterized protein LOC103710542    130   2e-31   Phoenix dactylifera
ref|XP_008812464.1|  PREDICTED: protein CCA1-like isoform X1            130   2e-31   Phoenix dactylifera
ref|NP_001236066.1|  MYB transcription factor MYB177                    129   2e-31   
gb|KHN39497.1|  Protein CCA1                                            129   2e-31   Glycine soja [wild soybean]
gb|EMT23919.1|  Myb-like protein G                                      122   2e-31   
ref|XP_010099677.1|  Myb-like protein G                                 129   2e-31   
ref|XP_006284219.1|  hypothetical protein CARUB_v10005376mg             127   2e-31   Capsella rubella
ref|XP_004953478.1|  PREDICTED: uncharacterized protein LOC101769...    129   2e-31   Setaria italica
ref|XP_011655141.1|  PREDICTED: protein REVEILLE 1-like isoform X1      129   2e-31   Cucumis sativus [cucumbers]
ref|XP_003573469.1|  PREDICTED: protein CCA1                            131   2e-31   Brachypodium distachyon [annual false brome]
ref|XP_003616176.1|  MYB transcription factor                           129   2e-31   Medicago truncatula
ref|XP_003519315.1|  PREDICTED: myb-like protein H-like                 129   3e-31   Glycine max [soybeans]
gb|AFW57285.1|  putative MYB DNA-binding domain superfamily protein     121   3e-31   
ref|NP_001147482.1|  LHY protein                                        131   3e-31   
ref|XP_003563237.1|  PREDICTED: protein REVEILLE 1-like isoform X1      129   3e-31   Brachypodium distachyon [annual false brome]
ref|XP_008677179.1|  PREDICTED: LHY protein isoform X1                  131   3e-31   
ref|XP_003062228.1|  predicted protein                                  131   3e-31   Micromonas pusilla CCMP1545
ref|XP_003534089.1|  PREDICTED: protein CCA1 isoform 1                  129   4e-31   Glycine max [soybeans]
gb|EMS48519.1|  Protein LHY                                             121   4e-31   Triticum urartu
ref|XP_006656522.1|  PREDICTED: dentin sialophosphoprotein-like         128   4e-31   Oryza brachyantha
ref|XP_010239468.1|  PREDICTED: protein REVEILLE 2-like isoform X2      128   4e-31   Brachypodium distachyon [annual false brome]
ref|XP_008661387.1|  PREDICTED: LHY protein isoform X3                  130   4e-31   
ref|NP_001061032.1|  Os08g0157600                                       130   4e-31   
ref|NP_001131529.2|  LHY protein                                        130   4e-31   Zea mays [maize]
ref|XP_004972798.1|  PREDICTED: protein LHY-like isoform X1             130   4e-31   Setaria italica
gb|EEC82927.1|  hypothetical protein OsI_27882                          130   5e-31   Oryza sativa Indica Group [Indian rice]
dbj|BAC99516.1|  putative LHY protein                                   130   5e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006647697.1|  PREDICTED: protein CCA1-like                       128   5e-31   
ref|XP_006659137.1|  PREDICTED: protein CCA1-like isoform X1            130   5e-31   
ref|XP_006659144.1|  PREDICTED: protein CCA1-like isoform X8            130   5e-31   
ref|XP_008661386.1|  PREDICTED: LHY protein isoform X2                  130   5e-31   
emb|CBI27347.3|  unnamed protein product                                128   5e-31   
ref|XP_008463161.1|  PREDICTED: protein REVEILLE 1-like isoform X1      128   5e-31   
ref|XP_010440832.1|  PREDICTED: protein REVEILLE 2-like                 126   5e-31   
ref|XP_002267976.2|  PREDICTED: protein REVEILLE 1                      128   6e-31   
ref|XP_008661383.1|  PREDICTED: LHY protein isoform X1                  130   6e-31   
ref|NP_001144028.1|  uncharacterized protein LOC100276850               127   6e-31   
gb|ADW09013.1|  LHY                                                     129   7e-31   
gb|AAR20887.1|  circadian oscillator component                          129   7e-31   
dbj|BAJ92173.1|  predicted protein                                      130   7e-31   
ref|XP_004966528.1|  PREDICTED: protein CCA1-like isoform X2            127   7e-31   
ref|XP_004966527.1|  PREDICTED: protein CCA1-like isoform X1            127   7e-31   
gb|KJB53101.1|  hypothetical protein B456_008G293600                    128   7e-31   
gb|AEW48245.1|  circadian clock associated 1                            130   7e-31   
ref|XP_010435556.1|  PREDICTED: protein REVEILLE 2-like                 125   7e-31   
emb|CAN68733.1|  hypothetical protein VITISV_012100                     128   8e-31   
gb|AES70883.2|  myb transcription factor                                126   8e-31   
ref|XP_007209215.1|  hypothetical protein PRUPE_ppa006715mg             127   9e-31   
gb|ADU60099.1|  circadian clock associated protein 1                    129   9e-31   
ref|XP_010450482.1|  PREDICTED: protein REVEILLE 2-like                 125   1e-30   
ref|XP_009385655.1|  PREDICTED: protein REVEILLE 1-like isoform X2      127   1e-30   
gb|ACN27058.1|  unknown                                                 127   2e-30   
dbj|BAI39992.1|  circadian clock-associated protein 1b                  129   2e-30   
ref|XP_010537508.1|  PREDICTED: protein REVEILLE 7 isoform X2           125   2e-30   
gb|AEV91181.1|  MYB-related protein                                     126   2e-30   
gb|EPS59701.1|  hypothetical protein M569_15103                         121   2e-30   
ref|XP_002443890.1|  hypothetical protein SORBIDRAFT_07g003870          128   3e-30   
ref|NP_001058645.1|  Os06g0728700                                       126   3e-30   
ref|XP_007139035.1|  hypothetical protein PHAVU_009G259600g             118   3e-30   
gb|ACF60466.1|  myb transcription factor                                125   3e-30   
gb|EEC81347.1|  hypothetical protein OsI_24535                          125   4e-30   
dbj|BAJ86643.1|  predicted protein                                      125   4e-30   
ref|XP_003572833.2|  PREDICTED: uncharacterized protein LOC100829508    125   4e-30   
ref|XP_008244198.1|  PREDICTED: protein CCA1                            118   5e-30   
gb|ABH02918.1|  MYB transcription factor MYB114                         120   5e-30   
ref|NP_001047765.1|  Os02g0685200                                       125   7e-30   
gb|EAY87102.1|  hypothetical protein OsI_08501                          125   7e-30   
dbj|BAI39991.1|  circadian clock-associated protein 1a                  127   7e-30   
ref|XP_001782277.1|  cca1a circadian clock protein CCA1a                117   7e-30   
dbj|BAP76056.1|  putative LHY                                           128   7e-30   
ref|XP_008676826.1|  PREDICTED: putative MYB DNA-binding domain s...    125   7e-30   
gb|KDO44079.1|  hypothetical protein CISIN_1g021851mg                   123   8e-30   
gb|KFK42494.1|  protein late elongated hypocotyl                        126   8e-30   
gb|AEV91182.1|  MYB-related protein                                     125   9e-30   
gb|AEA50876.1|  lhy2                                                    116   1e-29   
ref|XP_010474690.1|  PREDICTED: protein LHY                             126   1e-29   
ref|XP_002507825.1|  predicted protein                                  126   1e-29   
gb|AAZ85376.1|  putative At5g37260                                      124   1e-29   
emb|CDY15205.1|  BnaC05g00840D                                          125   2e-29   
gb|ABH02880.1|  MYB transcription factor MYB174                         122   2e-29   
gb|KHN11366.1|  Protein LHY                                             126   2e-29   
ref|XP_006604920.1|  PREDICTED: protein LHY isoform X3                  126   2e-29   
ref|XP_010480692.1|  PREDICTED: protein LHY isoform X1                  125   2e-29   
ref|XP_008788724.1|  PREDICTED: protein LHY-like isoform X1             126   2e-29   
ref|XP_002964171.1|  hypothetical protein SELMODRAFT_29451              116   2e-29   
emb|CDX78737.1|  BnaA03g06490D                                          123   2e-29   
gb|AIB05807.1|  MYB-related transcription factor                        124   2e-29   
ref|XP_003600632.1|  MYB transcription factor MYB174                    123   2e-29   
emb|CDX90004.1|  BnaA10g00780D                                          125   2e-29   
ref|NP_001146835.1|  LOC100280442                                       123   2e-29   
gb|ACG29096.1|  hypothetical protein                                    123   2e-29   
emb|CBI38726.3|  unnamed protein product                                120   2e-29   
gb|AEA50874.1|  lhy1                                                    118   2e-29   
gb|AGH20047.1|  CCA1-like protein                                       125   2e-29   
ref|XP_008788728.1|  PREDICTED: protein LHY-like isoform X3             125   2e-29   
ref|XP_009119664.1|  PREDICTED: protein LHY                             125   2e-29   
ref|NP_171614.1|  protein LHY                                           125   2e-29   
ref|NP_001077437.1|  protein LHY                                        125   2e-29   
emb|CAA07004.1|  late elongated hypocotyl                               125   2e-29   
gb|AAS09977.1|  MYB transcription factor                                125   2e-29   
dbj|BAH19541.1|  AT1G01060                                              125   3e-29   
ref|XP_006306976.1|  hypothetical protein CARUB_v10008551mg             125   3e-29   
ref|XP_008811397.1|  PREDICTED: protein LHY-like                        125   3e-29   
ref|XP_006604918.1|  PREDICTED: protein LHY isoform X1                  125   3e-29   
ref|XP_006604919.1|  PREDICTED: protein LHY isoform X2                  125   3e-29   
emb|CDX70747.1|  BnaC03g08310D                                          122   4e-29   
ref|XP_010559160.1|  PREDICTED: protein CCA1-like isoform X3            125   4e-29   
gb|ABN06082.1|  Homeodomain-related                                     118   4e-29   
ref|XP_010559151.1|  PREDICTED: protein CCA1-like isoform X1            125   4e-29   
ref|XP_010559161.1|  PREDICTED: protein CCA1-like isoform X4            124   4e-29   
ref|XP_010099675.1|  Myb-like protein G                                 122   4e-29   
ref|XP_010457176.1|  PREDICTED: protein LHY-like                        124   4e-29   
ref|XP_010556648.1|  PREDICTED: protein LHY-like isoform X3             125   4e-29   
gb|KJB41647.1|  hypothetical protein B456_007G113900                    125   4e-29   
ref|XP_010934912.1|  PREDICTED: LOW QUALITY PROTEIN: protein LHY-...    125   5e-29   
ref|XP_010559159.1|  PREDICTED: protein CCA1-like isoform X2            124   5e-29   
ref|XP_009620290.1|  PREDICTED: protein LHY                             125   5e-29   
emb|CDP08615.1|  unnamed protein product                                125   5e-29   
ref|XP_006418373.1|  hypothetical protein EUTSA_v10007028mg             124   5e-29   
gb|AEV91166.1|  MYB-related protein                                     123   5e-29   
gb|KHF99862.1|  Protein LHY -like protein                               124   5e-29   
ref|XP_006418374.1|  hypothetical protein EUTSA_v10007028mg             124   6e-29   
ref|XP_004248416.1|  PREDICTED: protein LHY                             124   6e-29   
ref|XP_009794791.1|  PREDICTED: protein LHY                             124   6e-29   
ref|XP_009335251.1|  PREDICTED: protein LHY-like isoform X1             124   6e-29   
gb|KHN16397.1|  Protein LHY                                             124   7e-29   
ref|NP_001236400.1|  MYB transcription factor MYB114                    124   7e-29   
gb|AAF26474.1|AC007323_15  T25K16.6                                     124   7e-29   
ref|XP_010556640.1|  PREDICTED: protein LHY-like isoform X1             124   7e-29   
emb|CDY61862.1|  BnaAnng17890D                                          123   7e-29   
ref|XP_006352623.1|  PREDICTED: protein LHY-like                        124   7e-29   
ref|XP_002892995.1|  early-phytochrome-responsive1                      121   8e-29   
ref|XP_010525244.1|  PREDICTED: protein CCA1                            124   8e-29   
ref|XP_006305253.1|  hypothetical protein CARUB_v10009624mg             121   8e-29   
emb|CDY19206.1|  BnaC05g14070D                                          121   8e-29   
ref|XP_007218929.1|  hypothetical protein PRUPE_ppa001765mg             124   9e-29   
dbj|BAK19069.1|  late elongated hypocotyl homolog                       124   9e-29   
gb|AII99804.1|  late elongated hypocotyl a                              124   1e-28   
gb|EPS72249.1|  hypothetical protein M569_02508                         115   1e-28   
gb|KFK37450.1|  protein late elongated hypocotyl                        122   1e-28   
ref|XP_002880268.1|  hypothetical protein ARALYDRAFT_904154             123   1e-28   
gb|AAQ73524.1|  circadian clock associated1                             124   1e-28   
ref|XP_008676825.1|  PREDICTED: putative MYB DNA-binding domain s...    121   1e-28   
emb|CDX80750.1|  BnaC03g00040D                                          122   1e-28   
gb|KJB49652.1|  hypothetical protein B456_008G132000                    123   1e-28   
gb|EMT08106.1|  Myb-like protein G                                      121   1e-28   
gb|KJB49656.1|  hypothetical protein B456_008G132000                    123   1e-28   
ref|XP_008343467.1|  PREDICTED: protein LHY-like                        123   2e-28   
ref|XP_009385737.1|  PREDICTED: protein LHY-like isoform X6             123   2e-28   
ref|XP_002301448.2|  hypothetical protein POPTR_0002s18190g             122   2e-28   
dbj|BAD97866.1|  LHY homologue1                                         121   2e-28   
ref|XP_009385736.1|  PREDICTED: protein LHY-like isoform X5             123   2e-28   
ref|XP_009385735.1|  PREDICTED: protein LHY-like isoform X4             123   2e-28   
ref|XP_009385734.1|  PREDICTED: protein LHY-like isoform X3             123   2e-28   
ref|XP_009385732.1|  PREDICTED: protein LHY-like isoform X1             123   2e-28   
ref|XP_010687317.1|  PREDICTED: protein LHY-like isoform X1             123   2e-28   
gb|AIR93784.1|  circadian clock-associated 1                            123   2e-28   
ref|XP_009385738.1|  PREDICTED: protein LHY-like isoform X7             122   2e-28   
ref|XP_010542804.1|  PREDICTED: protein LHY-like isoform X3             123   2e-28   
gb|KHG16794.1|  Protein LHY                                             123   2e-28   
ref|NP_850460.1|  protein CCA1                                          122   2e-28   
dbj|BAD97870.1|  LHY homologue1                                         122   2e-28   
ref|XP_010459445.1|  PREDICTED: protein REVEILLE 7-like                 120   2e-28   
emb|CAZ68125.1|  putative CCA1 protein                                  122   2e-28   
ref|XP_006652697.1|  PREDICTED: uncharacterized protein LOC102715571    120   2e-28   
gb|AFA35964.1|  late elongated hypocotyl                                123   2e-28   
ref|XP_011093093.1|  PREDICTED: protein LHY-like                        123   2e-28   
ref|XP_003528756.1|  PREDICTED: protein LHY isoform X1                  123   2e-28   
ref|XP_009131586.1|  PREDICTED: protein REVEILLE 1-like isoform X1      120   2e-28   
gb|KCW78515.1|  hypothetical protein EUGRSUZ_D026512                    112   3e-28   
ref|XP_006829218.1|  PREDICTED: protein LHY                             123   3e-28   
gb|ABK96054.1|  unknown                                                 122   3e-28   
ref|XP_010507964.1|  PREDICTED: protein CCA1-like isoform X2            121   3e-28   
ref|XP_010941176.1|  PREDICTED: LOW QUALITY PROTEIN: protein LHY-...    122   3e-28   
ref|NP_001288892.1|  protein REVEILLE 7                                 119   3e-28   
emb|CAD12767.2|  LHY protein                                            122   3e-28   
ref|XP_004306608.1|  PREDICTED: protein LHY-like                        122   3e-28   
ref|XP_010542811.1|  PREDICTED: protein LHY-like isoform X7             122   3e-28   
ref|NP_001235187.1|  late elongated hypocotyl and circadian clock...    122   3e-28   
ref|XP_006598673.1|  PREDICTED: late elongated hypocotyl and circ...    122   3e-28   
gb|EYU30891.1|  hypothetical protein MIMGU_mgv1a018822mg                117   3e-28   
ref|XP_006375393.1|  hypothetical protein POPTR_0014s10240g             115   3e-28   
ref|XP_006386665.1|  hypothetical protein POPTR_0002s18190g             122   3e-28   
ref|XP_002515093.1|  conserved hypothetical protein                     122   3e-28   
gb|AHW98794.1|  LATE ELONGATED HYPOCOTYL                                122   3e-28   
gb|KHN15871.1|  Protein LHY                                             122   3e-28   
emb|CDY26169.1|  BnaA06g12480D                                          119   3e-28   
ref|XP_010518365.1|  PREDICTED: protein CCA1-like isoform X2            121   3e-28   
ref|XP_009131587.1|  PREDICTED: protein REVEILLE 1-like isoform X2      119   4e-28   
ref|XP_008676827.1|  PREDICTED: putative MYB DNA-binding domain s...    119   4e-28   
gb|ABH02923.1|  MYB transcription factor MYB186                         113   4e-28   
ref|XP_010507962.1|  PREDICTED: protein CCA1-like isoform X1            121   4e-28   
ref|XP_004494878.1|  PREDICTED: protein LHY-like isoform X1             122   4e-28   
ref|XP_010542805.1|  PREDICTED: protein LHY-like isoform X4             122   5e-28   
ref|XP_010661511.1|  PREDICTED: protein LHY-like isoform X3             122   5e-28   
ref|XP_010518363.1|  PREDICTED: protein CCA1-like isoform X1            121   5e-28   
gb|AIR93783.1|  circadian clock-associated 1                            122   5e-28   
gb|AAU20773.1|  late elongated hypocotyl                                122   5e-28   
dbj|BAH09382.1|  transcription factor LHY                               122   5e-28   
ref|XP_006386663.1|  hypothetical protein POPTR_0002s18190g             122   5e-28   
ref|XP_009142594.1|  PREDICTED: protein CCA1 isoform X2                 120   6e-28   
emb|CDX80051.1|  BnaA05g01050D                                          120   6e-28   
ref|XP_010518366.1|  PREDICTED: protein CCA1-like isoform X3            120   6e-28   
ref|XP_006416617.1|  hypothetical protein EUTSA_v10008035mg             119   6e-28   
gb|EAZ31766.1|  hypothetical protein OsJ_15918                          119   7e-28   
ref|NP_001053666.1|  Os04g0583900                                       119   7e-28   
ref|XP_010542803.1|  PREDICTED: protein LHY-like isoform X2             121   7e-28   
ref|NP_001288869.1|  cataract, congenital, cerulean type, 1             120   7e-28   
ref|XP_010542800.1|  PREDICTED: protein LHY-like isoform X1             121   7e-28   
ref|NP_173269.1|  early-phytochrome-responsive1                         118   7e-28   
gb|EMS59783.1|  Protein LHY                                             121   7e-28   
ref|XP_004140527.1|  PREDICTED: protein LHY-like isoform X2             121   7e-28   
ref|XP_011025352.1|  PREDICTED: protein LHY-like                        121   7e-28   
ref|XP_011656823.1|  PREDICTED: protein LHY-like isoform X1             121   8e-28   
ref|XP_007513081.1|  putative At5g37260-like protein                    122   8e-28   
gb|EAY95301.1|  hypothetical protein OsI_17126                          119   8e-28   
ref|XP_012083087.1|  PREDICTED: protein LHY                             121   8e-28   
ref|XP_011039495.1|  PREDICTED: protein LHY-like isoform X2             121   8e-28   
gb|ACL81163.1|  late elongated hypocotyl-like protein                   121   8e-28   
ref|XP_009111205.1|  PREDICTED: protein LHY-like                        120   8e-28   
dbj|BAH09383.1|  transcription factor LHY                               121   9e-28   
ref|XP_008459828.1|  PREDICTED: protein LHY-like isoform X2             121   9e-28   
ref|XP_011039461.1|  PREDICTED: protein LHY-like isoform X1             121   9e-28   
ref|XP_008459822.1|  PREDICTED: protein LHY-like isoform X1             121   1e-27   
ref|XP_006293847.1|  hypothetical protein CARUB_v10022831mg             120   1e-27   
ref|XP_009420434.1|  PREDICTED: protein LHY-like isoform X1             120   1e-27   
ref|NP_683543.1|  myb family transcription factor                       117   1e-27   
ref|NP_001117304.1|  early-phytochrome-responsive1                      117   1e-27   
dbj|BAD97871.1|  LHY homologue2                                         118   2e-27   
gb|EYU38862.1|  hypothetical protein MIMGU_mgv1a001704mg                120   2e-27   
ref|XP_010558667.1|  PREDICTED: protein REVEILLE 1-like isoform X1      118   2e-27   
ref|XP_010687373.1|  PREDICTED: protein LHY-like isoform X2             120   2e-27   
emb|CCI55329.1|  PH01B001I13.25                                         119   2e-27   
ref|XP_007218999.1|  hypothetical protein PRUPE_ppa004107mg             118   2e-27   
ref|XP_002889388.1|  hypothetical protein ARALYDRAFT_470177             119   2e-27   
ref|XP_008808261.1|  PREDICTED: protein LHY isoform X3                  120   2e-27   
ref|XP_002962328.1|  hypothetical protein SELMODRAFT_78481              110   2e-27   
ref|XP_008808259.1|  PREDICTED: protein LHY isoform X1                  120   2e-27   
ref|XP_010558668.1|  PREDICTED: protein REVEILLE 1-like isoform X2      117   2e-27   
gb|KHG02360.1|  Protein LHY -like protein                               120   2e-27   
gb|EMT17444.1|  Myb-like protein G                                      117   2e-27   
ref|XP_008808260.1|  PREDICTED: protein LHY isoform X2                  120   2e-27   
gb|AAF25987.1|AC013354_6  F15H18.16                                     117   3e-27   
ref|XP_006491393.1|  PREDICTED: protein LHY-like isoform X5             119   3e-27   
gb|KDO86645.1|  hypothetical protein CISIN_1g004262mg                   119   3e-27   
ref|XP_002526271.1|  conserved hypothetical protein                     117   3e-27   
gb|KJB49647.1|  hypothetical protein B456_008G131800                    119   3e-27   
gb|KJB49649.1|  hypothetical protein B456_008G131800                    119   3e-27   
gb|EMT28549.1|  Myb-like protein G                                      119   3e-27   
ref|XP_010477007.1|  PREDICTED: protein REVEILLE 7                      116   3e-27   
ref|XP_010919035.1|  PREDICTED: protein LHY-like isoform X2             119   4e-27   
ref|XP_010919033.1|  PREDICTED: protein LHY-like isoform X1             119   4e-27   



>ref|XP_004235390.1| PREDICTED: protein REVEILLE 7 [Solanum lycopersicum]
Length=458

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 130/168 (77%), Gaps = 4/168 (2%)
 Frame = +2

Query  164  MVAEAMDQSDGNSGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTE  343
            MVA+A++Q +G+    SS ++SK+ET+ TQ    + L +E + K RKPYTITKQRE+WTE
Sbjct  1    MVADAVNQVEGSQQGASSMISSKLETVATQGKAPTCLANENVLKARKPYTITKQREKWTE  60

Query  344  EEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGD---GPIEI  514
            EEHQRF+EALKLYGRAWR+IEE+VG+KT IQIRSHAQKFF KV RD GNDGD     I+I
Sbjct  61   EEHQRFLEALKLYGRAWRQIEEYVGSKTAIQIRSHAQKFFAKVARDSGNDGDESLNAIDI  120

Query  515  ppprpkkkplhpyprkMVDSSKPEMEVLGQSERSPSKMYNGERDNQSP  658
            PPPRPKKKPLHPYPRKM DSS     V GQ ERSPS   +G R++ SP
Sbjct  121  PPPRPKKKPLHPYPRKMADSSIANKAVSGQPERSPSPNASG-RESCSP  167



>ref|XP_009618565.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Nicotiana tomentosiformis]
Length=441

 Score =   174 bits (441),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 112/168 (67%), Positives = 126/168 (75%), Gaps = 4/168 (2%)
 Frame = +2

Query  164  MVAEAMDQSDGNSGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTE  343
            MVAEA++Q +G     SS ++SK+ET+ TQ    + L +E   KVRKPYTITKQRE+WTE
Sbjct  1    MVAEALNQDEGARRGGSSMISSKLETVATQGKALTCLANEITLKVRKPYTITKQREKWTE  60

Query  344  EEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGD---GPIEI  514
            EEHQRFVEALKLYGRAWR+IEEHVGTKT IQIRSHAQKFF KV RD G DGD     I+I
Sbjct  61   EEHQRFVEALKLYGRAWRQIEEHVGTKTAIQIRSHAQKFFAKVARDSGTDGDESLNAIDI  120

Query  515  ppprpkkkplhpyprkMVDSSKPEMEVLGQSERSPSKMYNGERDNQSP  658
            PPPRPKKKPLHPYPRKM DS      V GQ ERS S   +G RD+ SP
Sbjct  121  PPPRPKKKPLHPYPRKMDDSPITNKSVSGQPERSSSPNASG-RDSCSP  167



>ref|XP_009768903.1| PREDICTED: uncharacterized protein LOC104219851 isoform X1 [Nicotiana 
sylvestris]
Length=468

 Score =   174 bits (442),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 125/168 (74%), Gaps = 4/168 (2%)
 Frame = +2

Query  164  MVAEAMDQSDGNSGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTE  343
            MVAEA++Q +G     SS ++SK+ET+ TQ    + L +E   KVRKPYTITKQRE+WTE
Sbjct  1    MVAEALNQDEGARRGGSSMISSKLETVATQGKALTCLANEITLKVRKPYTITKQREKWTE  60

Query  344  EEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGD---GPIEI  514
            EEHQRFVEALKLYGRAWR+IEEHVGTKT IQIRSHAQKFF KV RD G DGD     I+I
Sbjct  61   EEHQRFVEALKLYGRAWRQIEEHVGTKTAIQIRSHAQKFFAKVARDSGTDGDESLNAIDI  120

Query  515  ppprpkkkplhpyprkMVDSSKPEMEVLGQSERSPSKMYNGERDNQSP  658
            PPPRPKKKPLHPYPRKM DS      V GQ ERS     +G RD+ SP
Sbjct  121  PPPRPKKKPLHPYPRKMADSPVTNKSVSGQPERSSPPNASG-RDSCSP  167



>ref|XP_011072049.1| PREDICTED: protein REVEILLE 7-like isoform X2 [Sesamum indicum]
Length=458

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 127/172 (74%), Gaps = 13/172 (8%)
 Frame = +2

Query  164  MVAEAMDQSDGNSGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTE  343
            MVAEA DQ+ G       AV+S++E++TTQ+   SS G+ Y PKVRKPYTITKQRERWTE
Sbjct  1    MVAEAKDQTAGPCRDAFVAVSSQLESVTTQSKALSSNGNGYAPKVRKPYTITKQRERWTE  60

Query  344  EEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDG---PIEI  514
            EEH+RFVEALKLYGRAWR+IEEHV TKT IQIRSHAQKFF KV RD   D +G   PIEI
Sbjct  61   EEHKRFVEALKLYGRAWRQIEEHVATKTAIQIRSHAQKFFAKVTRDPCVDAEGSLSPIEI  120

Query  515  ppprpkkkplhpyprkMVDSSKPEM----EVLGQSERSPSKMYNGERDNQSP  658
            PPPRPKKKPLHPYPRK VD +  E+    +V G +E +       ER+N SP
Sbjct  121  PPPRPKKKPLHPYPRKTVDPANTEVVVSNQVGGTTESA------AERENYSP  166



>gb|AAU90342.2| Myb-like DNA-binding protein, putative [Solanum demissum]
Length=532

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 122/162 (75%), Gaps = 4/162 (2%)
 Frame = +2

Query  182  DQSDGNSGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRF  361
            +Q +G     SS ++SK+ET+ TQ    + L +E + K RKPYTITKQRE+WTEEEHQRF
Sbjct  62   NQVEGAQQGASSMISSKLETVATQGKAPTCLANENVLKARKPYTITKQREKWTEEEHQRF  121

Query  362  VEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGD---GPIEIppprpk  532
            +EALKLYGRAWR+IEE+VG+KT IQIRSHAQKFF K+ RD GNDGD     I+IPPPRPK
Sbjct  122  LEALKLYGRAWRQIEEYVGSKTAIQIRSHAQKFFAKIARDSGNDGDESLNAIDIPPPRPK  181

Query  533  kkplhpyprkMVDSSKPEMEVLGQSERSPSKMYNGERDNQSP  658
            KKPLHPYPRK+ DSS     V  Q ERSPS   +G RD+ SP
Sbjct  182  KKPLHPYPRKIADSSVANKAVSSQPERSPSPNASG-RDSCSP  222



>ref|XP_009618566.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Nicotiana tomentosiformis]
Length=423

 Score =   160 bits (405),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 114/149 (77%), Gaps = 4/149 (3%)
 Frame = +2

Query  221  VNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRK  400
            ++SK+ET+ TQ    + L +E   KVRKPYTITKQRE+WTEEEHQRFVEALKLYGRAWR+
Sbjct  2    ISSKLETVATQGKALTCLANEITLKVRKPYTITKQREKWTEEEHQRFVEALKLYGRAWRQ  61

Query  401  IEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGD---GPIEIppprpkkkplhpyprkMVD  571
            IEEHVGTKT IQIRSHAQKFF KV RD G DGD     I+IPPPRPKKKPLHPYPRKM D
Sbjct  62   IEEHVGTKTAIQIRSHAQKFFAKVARDSGTDGDESLNAIDIPPPRPKKKPLHPYPRKMDD  121

Query  572  SSKPEMEVLGQSERSPSKMYNGERDNQSP  658
            S      V GQ ERS S   +G RD+ SP
Sbjct  122  SPITNKSVSGQPERSSSPNASG-RDSCSP  149



>ref|XP_011072048.1| PREDICTED: protein REVEILLE 7-like isoform X1 [Sesamum indicum]
Length=468

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 124/171 (73%), Gaps = 13/171 (8%)
 Frame = +2

Query  167  VAEAMDQSDGNSGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEE  346
            V   MDQ+ G       AV+S++E++TTQ+   SS G+ Y PKVRKPYTITKQRERWTEE
Sbjct  12   VGFCMDQTAGPCRDAFVAVSSQLESVTTQSKALSSNGNGYAPKVRKPYTITKQRERWTEE  71

Query  347  EHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDG---PIEIp  517
            EH+RFVEALKLYGRAWR+IEEHV TKT IQIRSHAQKFF KV RD   D +G   PIEIP
Sbjct  72   EHKRFVEALKLYGRAWRQIEEHVATKTAIQIRSHAQKFFAKVTRDPCVDAEGSLSPIEIP  131

Query  518  pprpkkkplhpyprkMVDSSKPEM----EVLGQSERSPSKMYNGERDNQSP  658
            PPRPKKKPLHPYPRK VD +  E+    +V G +E +       ER+N SP
Sbjct  132  PPRPKKKPLHPYPRKTVDPANTEVVVSNQVGGTTESA------AERENYSP  176



>ref|XP_009768904.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Nicotiana sylvestris]
 ref|XP_009768905.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Nicotiana sylvestris]
Length=450

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 102/149 (68%), Positives = 113/149 (76%), Gaps = 4/149 (3%)
 Frame = +2

Query  221  VNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRK  400
            ++SK+ET+ TQ    + L +E   KVRKPYTITKQRE+WTEEEHQRFVEALKLYGRAWR+
Sbjct  2    ISSKLETVATQGKALTCLANEITLKVRKPYTITKQREKWTEEEHQRFVEALKLYGRAWRQ  61

Query  401  IEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGD---GPIEIppprpkkkplhpyprkMVD  571
            IEEHVGTKT IQIRSHAQKFF KV RD G DGD     I+IPPPRPKKKPLHPYPRKM D
Sbjct  62   IEEHVGTKTAIQIRSHAQKFFAKVARDSGTDGDESLNAIDIPPPRPKKKPLHPYPRKMAD  121

Query  572  SSKPEMEVLGQSERSPSKMYNGERDNQSP  658
            S      V GQ ERS     +G RD+ SP
Sbjct  122  SPVTNKSVSGQPERSSPPNASG-RDSCSP  149



>ref|XP_011086968.1| PREDICTED: protein REVEILLE 2-like isoform X1 [Sesamum indicum]
 ref|XP_011086971.1| PREDICTED: protein REVEILLE 2-like isoform X1 [Sesamum indicum]
Length=474

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 121/169 (72%), Gaps = 4/169 (2%)
 Frame = +2

Query  164  MVAEAMDQSDGNSGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTE  343
            MVAEA +Q    S   S  VNS++E++  Q+    S GS Y  KVRKPYTITKQRERWTE
Sbjct  1    MVAEAKEQVVATSEDASFMVNSQLESVAGQSKSLRSNGSSYTLKVRKPYTITKQRERWTE  60

Query  344  EEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDG---PIEI  514
            EEHQ+F+EALKLYGRAWR IEE+VGTKT IQIRSHAQKFF KV RD   D +G   PI+I
Sbjct  61   EEHQKFLEALKLYGRAWRHIEEYVGTKTAIQIRSHAQKFFAKVTRDSSMDAEGSLDPIQI  120

Query  515  ppprpkkkplhpyprkMVDSSKPEMEVLGQSERSPSKMYN-GERDNQSP  658
            PPPRPKKKPLHPYPRK VD    E+ V  + E S S   +  E+DN SP
Sbjct  121  PPPRPKKKPLHPYPRKFVDPVNREITVPNRLEISHSPDASVPEKDNLSP  169



>ref|XP_010101053.1| Myb-like protein G [Morus notabilis]
 gb|EXB86763.1| Myb-like protein G [Morus notabilis]
Length=469

 Score =   150 bits (378),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 129/176 (73%), Gaps = 9/176 (5%)
 Frame = +2

Query  146  VEISATMVAEAMDQSDGNSGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQ  325
            +E S    A A+ + D N G+V  + N+   +++ Q     S G++Y PKVRKPYTITKQ
Sbjct  1    MEGSTVSTAAAVQECD-NGGSVFPSGNAI--SLSVQLKDHFSCGNDYSPKVRKPYTITKQ  57

Query  326  RERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDL--GN-DG  496
            RERWTEEEH++F+EALKLYGRAWRKIEEHVGTKT +QIRSHAQKFF KV RD   GN + 
Sbjct  58   RERWTEEEHRKFLEALKLYGRAWRKIEEHVGTKTAVQIRSHAQKFFYKVARDPNGGNTNS  117

Query  497  DGPIEIppprpkkkplhpyprkMVDSSKPEMEVLGQ--SERSPSKMYNGERDNQSP  658
            + PIEIPPPRPK+KP+HPYPRK+VDS K E+ +     S  SP+ +   E++NQSP
Sbjct  118  EDPIEIPPPRPKRKPMHPYPRKLVDSPKKEIPLAEHTTSALSPN-LSLSEQENQSP  172



>emb|CDO98602.1| unnamed protein product [Coffea canephora]
Length=535

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 123/171 (72%), Gaps = 5/171 (3%)
 Frame = +2

Query  158  ATMVAEAMDQSDGNSGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERW  337
            A +V    D  +G S  VS  + + +ET   Q    + +G+ Y  KVRKPYTI KQRE+W
Sbjct  58   AYVVCPNWDLIEGTSHDVSLGMRAHLETTAAQTQALTEMGNGYALKVRKPYTIKKQREKW  117

Query  338  TEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDG---PI  508
            TEEEHQRF+EALKLYGRAWR+IEEHVGTKT IQIRSHAQKFF KV RD  N+ +G   PI
Sbjct  118  TEEEHQRFLEALKLYGRAWRQIEEHVGTKTAIQIRSHAQKFFAKVARD-SNECEGSLNPI  176

Query  509  EIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSPSKMYNG-ERDNQSP  658
            EIPPPRPKKKP HPYPRK++D +K  ++   Q E++P    +G ER+++SP
Sbjct  177  EIPPPRPKKKPAHPYPRKVMDVTKTTLDDPHQPEQAPPFKRSGEERNSRSP  227



>ref|XP_010675239.1| PREDICTED: protein REVEILLE 2 isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=443

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 108/138 (78%), Gaps = 3/138 (2%)
 Frame = +2

Query  254  AGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVI  433
            +G+ S  G  ++PK+RKPYTITKQRERWTEEEH++F+EALKLYGRAWRKIEEHVG+KT +
Sbjct  24   SGIHSGAGESHVPKIRKPYTITKQRERWTEEEHKKFLEALKLYGRAWRKIEEHVGSKTAV  83

Query  434  QIRSHAQKFFTKVVRDLGNDGDG---PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQ  604
            QIRSHAQKFF+KVVR+  N       PIEIPPPRPK+KP HPYPRK+V  S+ +M +  Q
Sbjct  84   QIRSHAQKFFSKVVRETNNTNANSVDPIEIPPPRPKRKPSHPYPRKLVLPSRNDMAMEQQ  143

Query  605  SERSPSKMYNGERDNQSP  658
            +  +    +  E++NQSP
Sbjct  144  ARSASPNSWISEQENQSP  161



>ref|XP_011086969.1| PREDICTED: protein REVEILLE 2-like isoform X2 [Sesamum indicum]
Length=456

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 112/150 (75%), Gaps = 4/150 (3%)
 Frame = +2

Query  221  VNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRK  400
            VNS++E++  Q+    S GS Y  KVRKPYTITKQRERWTEEEHQ+F+EALKLYGRAWR 
Sbjct  2    VNSQLESVAGQSKSLRSNGSSYTLKVRKPYTITKQRERWTEEEHQKFLEALKLYGRAWRH  61

Query  401  IEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDG---PIEIppprpkkkplhpyprkMVD  571
            IEE+VGTKT IQIRSHAQKFF KV RD   D +G   PI+IPPPRPKKKPLHPYPRK VD
Sbjct  62   IEEYVGTKTAIQIRSHAQKFFAKVTRDSSMDAEGSLDPIQIPPPRPKKKPLHPYPRKFVD  121

Query  572  SSKPEMEVLGQSERSPSKMYN-GERDNQSP  658
                E+ V  + E S S   +  E+DN SP
Sbjct  122  PVNREITVPNRLEISHSPDASVPEKDNLSP  151



>ref|XP_010246196.1| PREDICTED: protein REVEILLE 1-like [Nelumbo nucifera]
Length=510

 Score =   145 bits (365),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 106/133 (80%), Gaps = 3/133 (2%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S G E+ PKVRKPYTITKQRERWTEEEH++F+EALKLYGRAWR+IEEHVGTKT +QIRSH
Sbjct  41   SCGDEFPPKVRKPYTITKQRERWTEEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSH  100

Query  449  AQKFFTKVVRD-LGNDGDG--PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSP  619
            AQKFF+KVVR+  G++     PIEIPPPRPK+KP+HPYPRK+V S +  + V  Q ERS 
Sbjct  101  AQKFFSKVVRESTGSNASSVKPIEIPPPRPKRKPMHPYPRKLVHSLQKGISVPEQPERSR  160

Query  620  SKMYNGERDNQSP  658
            S   +    NQSP
Sbjct  161  SPNLSTSEANQSP  173



>ref|XP_008368744.1| PREDICTED: protein REVEILLE 1-like [Malus domestica]
Length=238

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 115/162 (71%), Gaps = 5/162 (3%)
 Frame = +2

Query  188  SDGNSGAVSSAVNSKVETMTTQAGVSS-SLGSEYLPKVRKPYTITKQRERWTEEEHQRFV  364
            S G+ G VS++    V     Q      S G+++ PKVRKPYTITKQRERWTEEEH++F+
Sbjct  47   STGSDGVVSASNGISVSAGGVQLKDDQFSGGNDFTPKVRKPYTITKQRERWTEEEHKKFL  106

Query  365  EALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVR--DLGNDG-DGPIEIppprpkk  535
            EALKLYGRAWRKIEEHVG KT +QIRSHAQKFF+KV R  + GN   + PI+IPPPRPK+
Sbjct  107  EALKLYGRAWRKIEEHVGAKTAVQIRSHAQKFFSKVARXPNGGNTASEEPIDIPPPRPKR  166

Query  536  kplhpyprkMVDSSKPEMEVLGQSERSPS-KMYNGERDNQSP  658
            KP+ PYPRK+V     E   + QS RS S  +   E++NQSP
Sbjct  167  KPMRPYPRKLVHPLNKETSTVEQSARSASPNLSVSEQENQSP  208



>ref|XP_002317724.1| EARLY-PHYTOCHROME-RESPONSIVE1 family protein [Populus trichocarpa]
 gb|EEE95944.1| EARLY-PHYTOCHROME-RESPONSIVE1 family protein [Populus trichocarpa]
Length=487

 Score =   142 bits (357),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 108/137 (79%), Gaps = 11/137 (8%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S GS+ +PKVRKPYTITKQRE+WT+EEHQRF+EALKLYGR WR+I+EHVGTKT +QIRSH
Sbjct  42   SFGSDNVPKVRKPYTITKQREKWTDEEHQRFLEALKLYGRGWRRIQEHVGTKTAVQIRSH  101

Query  449  AQKFFTKVVRDLGNDGDG---PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQS---E  610
            AQK+F+KVVR+ G   +    PIEIPPPRPK+KP HPYPRK V+     +EV G S   E
Sbjct  102  AQKYFSKVVREPGGINESSLKPIEIPPPRPKRKPAHPYPRKPVNV----LEVTGASSQLE  157

Query  611  RSPSKMYN-GERDNQSP  658
            RSPS   +  E++NQSP
Sbjct  158  RSPSPNSSVSEKENQSP  174



>ref|XP_007037069.1| Homeodomain-like superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY21570.1| Homeodomain-like superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=484

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 116/157 (74%), Gaps = 6/157 (4%)
 Frame = +2

Query  200  SGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKL  379
            SG   S  + + ET+T Q     +   ++ PKVRKPYTITKQRE+WTEEEHQ+F+EAL+L
Sbjct  18   SGICCSNSSPQCETLT-QFQELYTFKHDHTPKVRKPYTITKQREKWTEEEHQKFLEALRL  76

Query  380  YGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDG---PIEIppprpkkkplhp  550
            YGR WR+IEEHVGTKT +QIRSHAQKFF+KVVR+     +G   PIEIPPPRPK+KP+HP
Sbjct  77   YGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVVRESNGGFEGSINPIEIPPPRPKRKPVHP  136

Query  551  yprkMVDSSKPEMEVLGQSERSPS-KMYNGERDNQSP  658
            YPRK VDS K  +    + ERSPS   +  E+DN+SP
Sbjct  137  YPRKSVDSLK-GISPSSEPERSPSPSQFVREQDNKSP  172



>ref|XP_010525035.1| PREDICTED: protein REVEILLE 1 [Tarenaya hassleriana]
Length=447

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 104/129 (81%), Gaps = 4/129 (3%)
 Frame = +2

Query  284  YLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFF  463
            + PKVRKPYTITK+RERW +EEH++FVEALKLYGRAWR+IEEHVGTKT +QIRSHAQKFF
Sbjct  48   FAPKVRKPYTITKERERWADEEHKKFVEALKLYGRAWRRIEEHVGTKTAVQIRSHAQKFF  107

Query  464  TKVVRD-LGNDGDG--PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSPSKMYN  634
            +KV RD  G++G    PI IPPPRPK+KP+HPYPRK+ ++S  E+    QS RS S   +
Sbjct  108  SKVARDTTGSNGSSVEPIVIPPPRPKRKPVHPYPRKLGNTSVKEISSTDQSRRSVSPNLS  167

Query  635  G-ERDNQSP  658
              ERDNQSP
Sbjct  168  ALERDNQSP  176



>ref|XP_009790907.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Nicotiana sylvestris]
Length=484

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 17/132 (13%)
 Frame = +2

Query  164  MVAEAM-DQSDGNSGAVSSAVNSKVETMTTQAGVSSSL----------GSEYLPKVRKPY  310
            M +E M DQ  G    + S + S    +++  G SS+             EY PK RKPY
Sbjct  1    MASEEMVDQDQGGESGMDS-IRSSRNGISSDVGASSTRSIQLKEQVASADEYAPKARKPY  59

Query  311  TITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGN  490
            TI+KQRERWTEEEH++F+EA+KLYGRAWR+IEEHVGTKT +QIRSHAQKFF+KVVR+  N
Sbjct  60   TISKQRERWTEEEHKKFLEAIKLYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRE-SN  118

Query  491  DGDG----PIEI  514
            +GD     PIEI
Sbjct  119  NGDASSVKPIEI  130



>ref|XP_008240377.1| PREDICTED: protein REVEILLE 7-like isoform X2 [Prunus mume]
Length=454

 Score =   139 bits (349),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 101/126 (80%), Gaps = 9/126 (7%)
 Frame = +2

Query  266  SSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRS  445
            SS G+++ PK+RKPYTITKQRE+WTEEEH +F+EALKLYGR WR+IEEHVGTKT +QIRS
Sbjct  39   SSFGNDHTPKIRKPYTITKQREKWTEEEHHKFLEALKLYGRGWRQIEEHVGTKTAVQIRS  98

Query  446  HAQKFFTKVVRDLGNDGDG---PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERS  616
            HAQKFF+KV ++     +G   PIEIPPPRPK+KP+HPYPRK VDS      ++G  ERS
Sbjct  99   HAQKFFSKVSKESSGPSEGSITPIEIPPPRPKRKPVHPYPRKSVDS------LIGSPERS  152

Query  617  PSKMYN  634
            PS  ++
Sbjct  153  PSPHFS  158



>ref|XP_002305260.2| hypothetical protein POPTR_0004s07270g [Populus trichocarpa]
 gb|EEE85771.2| hypothetical protein POPTR_0004s07270g [Populus trichocarpa]
Length=429

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S GS+Y PK RKPYTITKQRERWTEEEH++F+EALKLYGRAWR+IEEHVGTKT +QIRSH
Sbjct  39   SCGSDYSPKARKPYTITKQRERWTEEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSH  98

Query  449  AQKFFTKVVRDLG  487
            AQKFF+KVVR+ G
Sbjct  99   AQKFFSKVVRESG  111



>ref|XP_010537507.1| PREDICTED: protein REVEILLE 7 isoform X1 [Tarenaya hassleriana]
Length=388

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 75/91 (82%), Gaps = 4/91 (4%)
 Frame = +2

Query  251  QAGVSSSLGSE----YLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVG  418
              GV++ +GS+     LPKVRKPYTITKQRE+WTEEEHQ+F+EA+KLYGR WR+IEEHVG
Sbjct  21   HGGVNTEMGSQSGENILPKVRKPYTITKQREKWTEEEHQKFLEAVKLYGRGWRQIEEHVG  80

Query  419  TKTVIQIRSHAQKFFTKVVRDLGNDGDGPIE  511
            TKT +QIRSHAQKFF+KV R+  N  D P++
Sbjct  81   TKTAVQIRSHAQKFFSKVARETDNVNDSPVK  111



>ref|XP_008240374.1| PREDICTED: protein REVEILLE 7-like isoform X1 [Prunus mume]
 ref|XP_008240375.1| PREDICTED: protein REVEILLE 7-like isoform X1 [Prunus mume]
 ref|XP_008240376.1| PREDICTED: protein REVEILLE 7-like isoform X1 [Prunus mume]
Length=465

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 101/126 (80%), Gaps = 9/126 (7%)
 Frame = +2

Query  266  SSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRS  445
            SS G+++ PK+RKPYTITKQRE+WTEEEH +F+EALKLYGR WR+IEEHVGTKT +QIRS
Sbjct  39   SSFGNDHTPKIRKPYTITKQREKWTEEEHHKFLEALKLYGRGWRQIEEHVGTKTAVQIRS  98

Query  446  HAQKFFTKVVRDLGNDGDG---PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERS  616
            HAQKFF+KV ++     +G   PIEIPPPRPK+KP+HPYPRK VDS      ++G  ERS
Sbjct  99   HAQKFFSKVSKESSGPSEGSITPIEIPPPRPKRKPVHPYPRKSVDS------LIGSPERS  152

Query  617  PSKMYN  634
            PS  ++
Sbjct  153  PSPHFS  158



>ref|XP_012074729.1| PREDICTED: protein REVEILLE 1 isoform X2 [Jatropha curcas]
 gb|KDP35732.1| hypothetical protein JCGZ_10504 [Jatropha curcas]
Length=498

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 10/120 (8%)
 Frame = +2

Query  152  ISATMVAEAMDQSDGNSGAVSSAVNSKVETMTTQAGVSS----------SLGSEYLPKVR  301
            +   +V+ AM   D   G  S+ V      ++  AG+ +          + G+EY PKVR
Sbjct  2    VGGLVVSAAMAVQDQCGGTRSNTVLPAGNGISLNAGLHNLTGAQIKEQFTCGNEYCPKVR  61

Query  302  KPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRD  481
            KPYTITKQRERWTE+EH++F+EALKLYGRAWR+IEEHVGTKT +QIRSHAQKFF+KVVR+
Sbjct  62   KPYTITKQRERWTEDEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRE  121



>ref|XP_012074728.1| PREDICTED: protein REVEILLE 1 isoform X1 [Jatropha curcas]
Length=502

 Score =   139 bits (349),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 10/120 (8%)
 Frame = +2

Query  152  ISATMVAEAMDQSDGNSGAVSSAVNSKVETMTTQAGVSS----------SLGSEYLPKVR  301
            +   +V+ AM   D   G  S+ V      ++  AG+ +          + G+EY PKVR
Sbjct  2    VGGLVVSAAMAVQDQCGGTRSNTVLPAGNGISLNAGLHNLTGAQIKEQFTCGNEYCPKVR  61

Query  302  KPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRD  481
            KPYTITKQRERWTE+EH++F+EALKLYGRAWR+IEEHVGTKT +QIRSHAQKFF+KVVR+
Sbjct  62   KPYTITKQRERWTEDEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRE  121



>ref|XP_011649662.1| PREDICTED: protein REVEILLE 7-like [Cucumis sativus]
Length=480

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 106/135 (79%), Gaps = 5/135 (4%)
 Frame = +2

Query  266  SSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRS  445
            SS G+E   KVRKPYTI+KQRE+WTEEEHQRF+EALKLYGR WR+I+EHVGTKT +QIRS
Sbjct  39   SSYGNESALKVRKPYTISKQREKWTEEEHQRFLEALKLYGRGWRQIKEHVGTKTAVQIRS  98

Query  446  HAQKFFTKVVRDLGNDGD---GPIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERS  616
            HAQKFF+KVVR+     +    PIEIPPPRPK+KPLHPYPRK VDS K  + V  +SERS
Sbjct  99   HAQKFFSKVVRESSGSNESSINPIEIPPPRPKRKPLHPYPRKAVDSLK-AISVARESERS  157

Query  617  PS-KMYNGERDNQSP  658
            PS  +   E++  SP
Sbjct  158  PSPNLSLAEKETHSP  172



>ref|XP_011000774.1| PREDICTED: protein REVEILLE 7-like [Populus euphratica]
Length=488

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 106/137 (77%), Gaps = 11/137 (8%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S GS+ +PKVRKPYTITKQRE+WT+EEHQRF+EALKLYGR WR+I+EHVGTKT +QIRSH
Sbjct  42   SFGSDNVPKVRKPYTITKQREKWTDEEHQRFLEALKLYGRGWRRIQEHVGTKTAVQIRSH  101

Query  449  AQKFFTKVVRDLGNDGDG---PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQS---E  610
            AQK+F+KVVR  G   +    PIEIPPPRPK+KP HPYPRK V+     +E  G S   E
Sbjct  102  AQKYFSKVVRYSGGSNESSLKPIEIPPPRPKRKPAHPYPRKPVNV----LEGTGASSQLE  157

Query  611  RSPSKMYN-GERDNQSP  658
            RSPS   +  E++NQSP
Sbjct  158  RSPSPNSSVSEKENQSP  174



>ref|XP_008439595.1| PREDICTED: protein REVEILLE 2-like [Cucumis melo]
Length=482

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 106/135 (79%), Gaps = 5/135 (4%)
 Frame = +2

Query  266  SSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRS  445
            SS G+E   KVRKPYTI+KQRE+WTEEEHQRF+EALKLYGR WR+I+EHVGTKT +QIRS
Sbjct  39   SSYGNENALKVRKPYTISKQREKWTEEEHQRFLEALKLYGRGWRQIKEHVGTKTAVQIRS  98

Query  446  HAQKFFTKVVRDLGNDGD---GPIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERS  616
            HAQKFF+KVVR+     +    PIEIPPPRPK+KPLHPYPRK VDS K  + V  +SERS
Sbjct  99   HAQKFFSKVVRESSGSNESSINPIEIPPPRPKRKPLHPYPRKAVDSLK-AISVARESERS  157

Query  617  PS-KMYNGERDNQSP  658
            PS  +   E++  SP
Sbjct  158  PSPNLSLAEKETHSP  172



>ref|XP_006384118.1| hypothetical protein POPTR_0004s07270g [Populus trichocarpa]
 gb|ERP61915.1| hypothetical protein POPTR_0004s07270g [Populus trichocarpa]
Length=485

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/73 (82%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S GS+Y PK RKPYTITKQRERWTEEEH++F+EALKLYGRAWR+IEEHVGTKT +QIRSH
Sbjct  39   SCGSDYSPKARKPYTITKQRERWTEEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSH  98

Query  449  AQKFFTKVVRDLG  487
            AQKFF+KVVR+ G
Sbjct  99   AQKFFSKVVRESG  111



>gb|KDO44076.1| hypothetical protein CISIN_1g021851mg [Citrus sinensis]
 gb|KDO44077.1| hypothetical protein CISIN_1g021851mg [Citrus sinensis]
 gb|KDO44078.1| hypothetical protein CISIN_1g021851mg [Citrus sinensis]
Length=306

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S  ++ LPKVRKPYTITKQRE+WTEEEHQRF++ALK+YGR WR+IEEHVGTKT +QIRSH
Sbjct  7    SFENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSH  66

Query  449  AQKFFTKVVRDLGNDGDG---PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSP  619
            AQKFF+KVVR+     +    PIEIPPPRPK+KP+HPYPRK VDS K       Q   + 
Sbjct  67   AQKFFSKVVRESNGSSESSIMPIEIPPPRPKRKPVHPYPRKSVDSLKATSVSNQQENFTS  126

Query  620  SKMYNGERDNQSP  658
            S     ++D QSP
Sbjct  127  SNALVSDKDRQSP  139



>ref|XP_008381387.1| PREDICTED: protein REVEILLE 1-like [Malus domestica]
Length=486

 Score =   137 bits (345),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 118/174 (68%), Gaps = 7/174 (4%)
 Frame = +2

Query  155  SATMVAEAMDQSDGNSGAVSSAVNSKVETMTTQAGVSS-SLGSEYLPKVRKPYTITKQRE  331
            S+ M A+    S G+ G VS+           Q      S G+++ PKVRKPYTITK+RE
Sbjct  3    SSDMAAQEQFGSTGSBGVVSAGNGISPSAGGVQLKDDQFSTGNDFTPKVRKPYTITKERE  62

Query  332  RWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDG---  502
            RWTEEEH++F+EALKLYGRAWRKIE+HVGTKT +QIRSHAQKFF+KV R   N G+    
Sbjct  63   RWTEEEHKKFLEALKLYGRAWRKIEKHVGTKTAVQIRSHAQKFFSKVAR-YPNGGNATSE  121

Query  503  -PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSPS-KMYNGERDNQSP  658
             PI+IPPPRPKKKP+ PYPRK+V     E  ++ Q  RS S  +   E++NQSP
Sbjct  122  EPIDIPPPRPKKKPMRPYPRKLVHPLDKETSIVEQPTRSASPNLSVSEQENQSP  175



>emb|CDX69388.1| BnaA10g17370D [Brassica napus]
Length=374

 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +2

Query  209  VSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGR  388
             SS + + V+   T+  +S   G++Y PKVRKPYTITK+RERWT+EEH +FVEALKL+GR
Sbjct  2    ASSPLTTNVQGAKTKIQLSDQEGNDYAPKVRKPYTITKERERWTDEEHNKFVEALKLHGR  61

Query  389  AWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDG  502
            AWRKIEEHVGTKT +QIRSHAQKFF+KV ++  + G+G
Sbjct  62   AWRKIEEHVGTKTAVQIRSHAQKFFSKVAKE-ASGGNG  98



>ref|XP_010062320.1| PREDICTED: protein REVEILLE 2 [Eucalyptus grandis]
Length=438

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 71/81 (88%), Gaps = 3/81 (4%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S  ++Y PKVRKPYTITKQRERWTEEEH++F+EALKLYGRAWR+IEEHVGTKT +QIRSH
Sbjct  41   SCANDYAPKVRKPYTITKQRERWTEEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSH  100

Query  449  AQKFFTKVVRDLGNDGDGPIE  511
            AQKFF+KVV+D     DG +E
Sbjct  101  AQKFFSKVVKD---PTDGKVE  118



>ref|XP_002526589.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF35801.1| DNA binding protein, putative [Ricinus communis]
Length=468

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/71 (83%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S GS+Y PK RKPYTITKQRERWTEEEH++F+EALKLYGRAWR+IEEHVGTKT +QIRSH
Sbjct  20   SCGSDYSPKARKPYTITKQRERWTEEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSH  79

Query  449  AQKFFTKVVRD  481
            AQKFF+KVVR+
Sbjct  80   AQKFFSKVVRE  90



>ref|XP_011085926.1| PREDICTED: protein REVEILLE 1 [Sesamum indicum]
Length=481

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/75 (80%), Positives = 68/75 (91%), Gaps = 1/75 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G ++ PK RKPYTITKQRERWTEEEH++F+EALKLYGRAWRKIEEHVGTKT +QIRSHAQ
Sbjct  45   GDDFAPKARKPYTITKQRERWTEEEHKKFIEALKLYGRAWRKIEEHVGTKTAVQIRSHAQ  104

Query  455  KFFTKVVRDLGNDGD  499
            KFF+KVVR+  N GD
Sbjct  105  KFFSKVVRE-SNTGD  118



>gb|AIL81922.1| RVE1-like protein [Euphorbia esula]
Length=482

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 86/111 (77%), Gaps = 3/111 (3%)
 Frame = +2

Query  152  ISATMVAEAMDQSDGNSGAVSSAVNSKVETMTT-QAGVSSSLGSEYLPKVRKPYTITKQR  328
            ISA M  +  DQS G+  +    +N+ V  +T+ Q     S G+++  KVRKPYTITKQR
Sbjct  7    ISAAMAVQ--DQSGGSRSSSVLPLNAGVHVVTSSQLKEQISCGNDFSLKVRKPYTITKQR  64

Query  329  ERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRD  481
            ERWTEEEH++F+EALKLYGRAWR+IEEHVG+KT +QIRSHAQKFF+KVVR+
Sbjct  65   ERWTEEEHKKFLEALKLYGRAWRRIEEHVGSKTAVQIRSHAQKFFSKVVRE  115



>ref|XP_004299482.1| PREDICTED: protein REVEILLE 7-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=362

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 3/86 (3%)
 Frame = +2

Query  266  SSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRS  445
            SS G++   KVRKPYTITKQRE+WTEEEHQ+F+EALKLYGR WR+IEEHVGTKT +QIRS
Sbjct  40   SSFGNDQALKVRKPYTITKQREKWTEEEHQKFLEALKLYGRGWRQIEEHVGTKTAVQIRS  99

Query  446  HAQKFFTKVVRDLGNDGDG---PIEI  514
            HAQKFF+KV ++L   G+G   PIEI
Sbjct  100  HAQKFFSKVAKELPGTGEGSLKPIEI  125



>gb|KHN24174.1| Myb-like protein G [Glycine soja]
Length=287

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 109/134 (81%), Gaps = 4/134 (3%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S G++Y  KVRKPYTITKQRERWT+EEH++F+EALKLYGRAWR+IEEHVGTKT +QIRSH
Sbjct  40   SCGNDYALKVRKPYTITKQRERWTDEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSH  99

Query  449  AQKFFTKVVRD-LGNDGDG--PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSP  619
            AQKFF+KV+ D  GN+ +    IEIPPPRPK+KP+HPYPRK+V++   E+ +  Q  +S 
Sbjct  100  AQKFFSKVLHDPTGNNTNTVESIEIPPPRPKRKPMHPYPRKLVETPNKEISIPEQPMKSN  159

Query  620  S-KMYNGERDNQSP  658
            S K  + +++NQSP
Sbjct  160  SLKSSDFDQENQSP  173



>ref|NP_001236032.1| MYB transcription factor MYB173 [Glycine max]
 gb|ABH02863.1| MYB transcription factor MYB173 [Glycine max]
Length=287

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 109/134 (81%), Gaps = 4/134 (3%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S G++Y  KVRKPYTITKQRERWT+EEH++F+EALKLYGRAWR+IEEHVGTKT +QIRSH
Sbjct  40   SCGNDYALKVRKPYTITKQRERWTDEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSH  99

Query  449  AQKFFTKVVRD-LGNDGDG--PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSP  619
            AQKFF+KV+ D  GN+ +    IEIPPPRPK+KP+HPYPRK+V++   E+ +  Q  +S 
Sbjct  100  AQKFFSKVLHDPTGNNTNTVESIEIPPPRPKRKPMHPYPRKLVETPNKEISIPEQPMKSN  159

Query  620  S-KMYNGERDNQSP  658
            S K  + +++NQSP
Sbjct  160  SLKSSDFDQENQSP  173



>gb|AHZ13511.1| RVE1-like protein [Euphorbia esula]
Length=482

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 86/111 (77%), Gaps = 3/111 (3%)
 Frame = +2

Query  152  ISATMVAEAMDQSDGNSGAVSSAVNSKVETMTT-QAGVSSSLGSEYLPKVRKPYTITKQR  328
            ISA M  +  DQS G+  +    +N+ V  +T+ Q     S G+++  KVRKPYTITKQR
Sbjct  7    ISAAMAVQ--DQSGGSRSSSVLPLNAGVHVVTSSQLKEQISCGNDFSLKVRKPYTITKQR  64

Query  329  ERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRD  481
            ERWTEEEH++F+EALKLYGRAWR+IEEHVG+KT +QIRSHAQKFF+KVVR+
Sbjct  65   ERWTEEEHKKFLEALKLYGRAWRRIEEHVGSKTAVQIRSHAQKFFSKVVRE  115



>gb|AIL81923.1| RVE1-like protein [Euphorbia esula]
Length=482

 Score =   137 bits (344),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 86/111 (77%), Gaps = 3/111 (3%)
 Frame = +2

Query  152  ISATMVAEAMDQSDGNSGAVSSAVNSKVETMTT-QAGVSSSLGSEYLPKVRKPYTITKQR  328
            ISA M  +  DQS G+  +    +N+ V  +T+ Q     S G+++  KVRKPYTITKQR
Sbjct  7    ISAAMAVQ--DQSGGSRSSSVLPLNAGVHVVTSSQLKEQISCGNDFSLKVRKPYTITKQR  64

Query  329  ERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRD  481
            ERWTEEEH++F+EALKLYGRAWR+IEEHVG+KT +QIRSHAQKFF+KVVR+
Sbjct  65   ERWTEEEHKKFLEALKLYGRAWRRIEEHVGSKTAVQIRSHAQKFFSKVVRE  115



>gb|ABW22144.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVRD  N GD 
Sbjct  83   KFFSKVVRDSSN-GDA  97



>gb|ABW22142.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVRD  N GD 
Sbjct  83   KFFSKVVRDSSN-GDA  97



>gb|AEO52898.1| hypothetical protein, partial [Solanum peruvianum]
Length=445

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVRD  N GD 
Sbjct  83   KFFSKVVRDSSN-GDA  97



>gb|ABW22136.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVRD  N GD 
Sbjct  83   KFFSKVVRDSSN-GDA  97



>ref|XP_011013212.1| PREDICTED: protein REVEILLE 1-like [Populus euphratica]
Length=481

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 79/109 (72%), Gaps = 7/109 (6%)
 Frame = +2

Query  182  DQSDGN-SGAVSSAVNSKVETMTTQAGVSS------SLGSEYLPKVRKPYTITKQRERWT  340
            DQ  GN S  V  A N  + + T Q           S GS+Y PK RKPYTITKQRERWT
Sbjct  5    DQCGGNRSNLVLPAGNGILPSATLQKATDHQLKEQFSCGSDYSPKARKPYTITKQRERWT  64

Query  341  EEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLG  487
            EEEH++F++ALKLYGRAWR+IEEH+GTKT +QIRSHAQKFF+KV R+ G
Sbjct  65   EEEHKKFLDALKLYGRAWRRIEEHLGTKTAVQIRSHAQKFFSKVARESG  113



>ref|XP_009790908.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Nicotiana sylvestris]
Length=474

 Score =   136 bits (343),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 88/122 (72%), Gaps = 7/122 (6%)
 Frame = +2

Query  164  MVAEAM-DQSDGNSGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWT  340
            M +E M DQ  G    + S + S    +++  G SS+   +   + RKPYTI+KQRERWT
Sbjct  1    MASEEMVDQDQGGESGMDS-IRSSRNGISSDVGASSTRSIQLKEQARKPYTISKQRERWT  59

Query  341  EEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDG----PI  508
            EEEH++F+EA+KLYGRAWR+IEEHVGTKT +QIRSHAQKFF+KVVR+  N+GD     PI
Sbjct  60   EEEHKKFLEAIKLYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRE-SNNGDASSVKPI  118

Query  509  EI  514
            EI
Sbjct  119  EI  120



>ref|XP_008227906.1| PREDICTED: LOW QUALITY PROTEIN: protein REVEILLE 1 [Prunus mume]
Length=491

 Score =   136 bits (342),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 122/172 (71%), Gaps = 6/172 (3%)
 Frame = +2

Query  152  ISATMVAEAMDQSDGN-SGAVSSAVNSKVETMT-TQAGVSSSLGSEYLPKVRKPYTITKQ  325
            +S  M A A DQ DG+ S +V SA N    +++  Q     S G++  PK RKPYTITKQ
Sbjct  7    LSPDMDA-AQDQYDGSRSESVLSANNGVSFSVSGLQLKDQFSNGNDSAPKARKPYTITKQ  65

Query  326  RERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDGP  505
            RERWTEEEH++F+EALKLYGRAWRKIEEHVGTKT +QIRSHAQKFF+KV RD  ++G   
Sbjct  66   RERWTEEEHKKFLEALKLYGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVARD--SNGSNX  123

Query  506  IEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSPS-KMYNGERDNQSP  658
            I+IPPPRPK+KP+ PYPRK+V     E  ++ +  RS S  +   E +NQSP
Sbjct  124  IDIPPPRPKRKPMRPYPRKLVHPVNKETFIVERPTRSASPNLSVSEPENQSP  175



>ref|XP_009121398.1| PREDICTED: protein REVEILLE 1-like [Brassica rapa]
Length=374

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 79/98 (81%), Gaps = 1/98 (1%)
 Frame = +2

Query  209  VSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGR  388
             SS + + V+   T+  +S   G++Y PKVRKPYTITK+RERWT+EEH +FVEALKL+GR
Sbjct  2    ASSPLTTNVQGAKTKIQLSDQEGNDYAPKVRKPYTITKERERWTDEEHNKFVEALKLHGR  61

Query  389  AWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDG  502
            AWRKIEEH+GTKT +QIRSHAQKFF+KV ++  + G+G
Sbjct  62   AWRKIEEHLGTKTAVQIRSHAQKFFSKVAKE-ASGGNG  98



>gb|KGN63974.1| hypothetical protein Csa_1G032440 [Cucumis sativus]
Length=810

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 106/135 (79%), Gaps = 5/135 (4%)
 Frame = +2

Query  266  SSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRS  445
            SS G+E   KVRKPYTI+KQRE+WTEEEHQRF+EALKLYGR WR+I+EHVGTKT +QIRS
Sbjct  369  SSYGNESALKVRKPYTISKQREKWTEEEHQRFLEALKLYGRGWRQIKEHVGTKTAVQIRS  428

Query  446  HAQKFFTKVVRDLGNDGD---GPIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERS  616
            HAQKFF+KVVR+     +    PIEIPPPRPK+KPLHPYPRK VDS K  + V  +SERS
Sbjct  429  HAQKFFSKVVRESSGSNESSINPIEIPPPRPKRKPLHPYPRKAVDSLK-AISVARESERS  487

Query  617  PS-KMYNGERDNQSP  658
            PS  +   E++  SP
Sbjct  488  PSPNLSLAEKETHSP  502



>ref|XP_006441350.1| hypothetical protein CICLE_v10020130mg [Citrus clementina]
 ref|XP_006441351.1| hypothetical protein CICLE_v10020130mg [Citrus clementina]
 gb|ESR54590.1| hypothetical protein CICLE_v10020130mg [Citrus clementina]
 gb|ESR54591.1| hypothetical protein CICLE_v10020130mg [Citrus clementina]
Length=448

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S  ++ LPKVRKPYTITKQRE+WTEEEHQRF++ALK+YGR WR+IEEHVGTKT +QIRSH
Sbjct  7    SFENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSH  66

Query  449  AQKFFTKVVRDLGNDGDG---PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSP  619
            AQKFF+KVVR+     +    PIEIPPPRPK+KP+HPYPRK VDS K       Q   + 
Sbjct  67   AQKFFSKVVRESNGSSESSIMPIEIPPPRPKRKPVHPYPRKSVDSLKATSVSNQQENFTS  126

Query  620  SKMYNGERDNQSP  658
            S     ++D QSP
Sbjct  127  SNALVSDKDRQSP  139



>ref|XP_007152597.1| hypothetical protein PHAVU_004G143400g [Phaseolus vulgaris]
 gb|ESW24591.1| hypothetical protein PHAVU_004G143400g [Phaseolus vulgaris]
Length=472

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +2

Query  173  EAMDQSDGNSGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEH  352
            E  DQ +     +S + +        Q+   +S+G+ + PKVRKPYTITKQRE+WTEEEH
Sbjct  2    EMQDQIESTRSTISGSASYCHSNGGKQSETVASVGNSHTPKVRKPYTITKQREKWTEEEH  61

Query  353  QRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRD  481
            Q+F+EALKLYGR WR+IEEH+GTKT +QIRSHAQKFF+KVVR+
Sbjct  62   QKFLEALKLYGRGWRQIEEHIGTKTAVQIRSHAQKFFSKVVRE  104



>ref|NP_568344.2| myb family transcription factor RVE1 [Arabidopsis thaliana]
 sp|F4KGY6.1|RVE1_ARATH RecName: Full=Protein REVEILLE 1 [Arabidopsis thaliana]
 gb|AED92410.1| myb family transcription factor [Arabidopsis thaliana]
Length=387

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 3/83 (4%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G++Y PKVRKPYTITK+RERWT+EEH++FVEALKLYGRAWR+IEEHVG+KT +QIRSHAQ
Sbjct  38   GNDYAPKVRKPYTITKERERWTDEEHKKFVEALKLYGRAWRRIEEHVGSKTAVQIRSHAQ  97

Query  455  KFFTKVVRD-LGNDGDG--PIEI  514
            KFF+KV R+  G DG    PI I
Sbjct  98   KFFSKVAREATGGDGSSVEPIVI  120



>ref|XP_011464451.1| PREDICTED: protein REVEILLE 7-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=453

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 73/86 (85%), Gaps = 3/86 (3%)
 Frame = +2

Query  266  SSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRS  445
            SS G++   KVRKPYTITKQRE+WTEEEHQ+F+EALKLYGR WR+IEEHVGTKT +QIRS
Sbjct  40   SSFGNDQALKVRKPYTITKQREKWTEEEHQKFLEALKLYGRGWRQIEEHVGTKTAVQIRS  99

Query  446  HAQKFFTKVVRDLGNDGDG---PIEI  514
            HAQKFF+KV ++L   G+G   PIEI
Sbjct  100  HAQKFFSKVAKELPGTGEGSLKPIEI  125



>ref|XP_010453914.1| PREDICTED: protein REVEILLE 1 isoform X1 [Camelina sativa]
 ref|XP_010453915.1| PREDICTED: protein REVEILLE 1 isoform X2 [Camelina sativa]
Length=392

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G++Y PK+RKPYTITK+RERWT+EEH++FVEALKLYGRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  39   GNDYAPKIRKPYTITKERERWTDEEHKKFVEALKLYGRAWRRIEEHVGTKTAVQIRSHAQ  98

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KV R+    GDG
Sbjct  99   KFFSKVARE-ATGGDG  113



>dbj|BAO57283.1| Myb family transcription factor [Ipomoea nil]
Length=487

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 85/127 (67%), Gaps = 18/127 (14%)
 Frame = +2

Query  164  MVAEAMDQSDGNSGAVSSAVNSKVETMTTQAGVSSSL-------GSEYLPKVRKPYTITK  322
            MV+  M   D N G    A        +T  GVS++          E+ PK RKPYTITK
Sbjct  1    MVSTGMAVQDQNGGTSIPA--------STDMGVSAARSIQHLTPADEHAPKARKPYTITK  52

Query  323  QRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDL-GNDGD  499
            QRERWTEEEH +F+EALKLYGRAWR+IEEHVGTKT +QIRSHAQKFF+KVVR+  G D +
Sbjct  53   QRERWTEEEHNKFLEALKLYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRESNGTDVN  112

Query  500  G--PIEI  514
               PIEI
Sbjct  113  SVKPIEI  119



>gb|KHN08771.1| Myb-like protein G [Glycine soja]
Length=361

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 110/134 (82%), Gaps = 4/134 (3%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S G++Y  KVRKPYTITKQRERWT+EEH++F+EALKLYGRAWR+IEEHVGTKT +QIRSH
Sbjct  41   SCGNDYALKVRKPYTITKQRERWTDEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSH  100

Query  449  AQKFFTKVVRD-LGNDGDG--PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSP  619
            AQKFF+K++RD  GN+ +    IEIPPPRPK+KP+HPYPRK+V++   E+ +  Q  +S 
Sbjct  101  AQKFFSKLLRDPTGNNTNTVESIEIPPPRPKRKPVHPYPRKLVETPNKEILIPEQLMKSN  160

Query  620  S-KMYNGERDNQSP  658
            S K  + +++NQSP
Sbjct  161  SLKSSDFDQENQSP  174



>gb|ADL36788.1| MYBR domain class transcription factor [Malus domestica]
Length=461

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 91/132 (69%), Gaps = 6/132 (5%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S GS++ PKVRKPYTITKQR +WTEEEHQ+F+EALKLYGR WR+IEEHVGTKT +QIRSH
Sbjct  35   SFGSDHAPKVRKPYTITKQRAKWTEEEHQKFLEALKLYGRGWRQIEEHVGTKTAVQIRSH  94

Query  449  AQKFFTKVVRDLGNDGDGPIEIppprpkkkplhpyprkMVDSSKPEMEVL-GQSERSPSK  625
            AQKFF+KV +    +  GP E      +  P  P  + +    +  ++ L G  ERSPS 
Sbjct  95   AQKFFSKVSK----ESCGPSEGSIRPIEIPPPRPKRKPVHPYPRKSVDCLNGTPERSPSP  150

Query  626  MYNGE-RDNQSP  658
             ++ + +D QSP
Sbjct  151  QFSAQGKDQQSP  162



>ref|XP_009355963.1| PREDICTED: protein REVEILLE 7-like [Pyrus x bretschneideri]
Length=461

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 91/132 (69%), Gaps = 6/132 (5%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S GS++ PKVRKPYTITKQR +WTEEEHQ+F+EALKLYGR WR+IEEHVGTKT +QIRSH
Sbjct  35   SFGSDHAPKVRKPYTITKQRAKWTEEEHQKFLEALKLYGRGWRQIEEHVGTKTAVQIRSH  94

Query  449  AQKFFTKVVRDLGNDGDGPIEIppprpkkkplhpyprkMVDSSKPEMEVL-GQSERSPSK  625
            AQKFF+KV ++      GP E      +  P  P  + +    +  ++ L G  ERSPS 
Sbjct  95   AQKFFSKVSKESC----GPSEGSIRPIEIPPPRPKRKPVHPYPRKSVDCLNGTPERSPSP  150

Query  626  MYNGE-RDNQSP  658
             ++ + +D QSP
Sbjct  151  QFSAQGKDQQSP  162



>ref|NP_001289226.1| protein REVEILLE 7-like [Pyrus x bretschneideri]
 gb|AIN75623.1| transcription factor MYBR [Pyrus x bretschneideri]
Length=461

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 91/132 (69%), Gaps = 6/132 (5%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S GS++ PKVRKPYTITKQR +WTEEEHQ+F+EALKLYGR WR+IEEHVGTKT +QIRSH
Sbjct  35   SFGSDHAPKVRKPYTITKQRAKWTEEEHQKFLEALKLYGRGWRQIEEHVGTKTAVQIRSH  94

Query  449  AQKFFTKVVRDLGNDGDGPIEIppprpkkkplhpyprkMVDSSKPEMEVL-GQSERSPSK  625
            AQKFF+KV ++      GP E      +  P  P  + +    +  ++ L G  ERSPS 
Sbjct  95   AQKFFSKVSKESC----GPSEGSIRPIEIPPPRPKRKPVHPYPRKSVDCLNGTPERSPSP  150

Query  626  MYNGE-RDNQSP  658
             ++ + +D QSP
Sbjct  151  QFSAQGKDQQSP  162



>ref|XP_003553057.1| PREDICTED: protein LHY [Glycine max]
Length=361

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 110/134 (82%), Gaps = 4/134 (3%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S G++Y  KVRKPYTITKQRERWT+EEH++F+EALKLYGRAWR+IEEHVGTKT +QIRSH
Sbjct  41   SCGNDYALKVRKPYTITKQRERWTDEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSH  100

Query  449  AQKFFTKVVRD-LGNDGDG--PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSP  619
            AQKFF+K++RD  GN+ +    IEIPPPRPK+KP+HPYPRK+V++   E+ +  Q  +S 
Sbjct  101  AQKFFSKLLRDPTGNNTNTVESIEIPPPRPKRKPVHPYPRKLVETPNKEILIPEQLMKSN  160

Query  620  S-KMYNGERDNQSP  658
            S K  + +++NQSP
Sbjct  161  SLKSSDFDQENQSP  174



>ref|NP_198542.1| MYB family transcription factor Circadian 1 [Arabidopsis thaliana]
 sp|F4K5X6.1|RVE2_ARATH RecName: Full=Protein REVEILLE 2; AltName: Full=MYB family transcription 
factor Circadian 1 [Arabidopsis thaliana]
 gb|AED94158.1| MYB family transcription factor Circadian 1 [Arabidopsis thaliana]
Length=287

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 110/147 (75%), Gaps = 7/147 (5%)
 Frame = +2

Query  218  AVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWR  397
            A+  + E++ +   +SSS    +  K RKPYTITKQRE+WTE EH++FVEALKLYGRAWR
Sbjct  2    AMQERCESLCSDELISSS--DAFYLKTRKPYTITKQREKWTEAEHEKFVEALKLYGRAWR  59

Query  398  KIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDGPIEIppprpkkkplhpyprkMVDSS  577
            +IEEHVGTKT +QIRSHAQKFFTKV RD G   +  IEIPPPRPK+KP+HPYPRK+V   
Sbjct  60   RIEEHVGTKTAVQIRSHAQKFFTKVARDFGVSSES-IEIPPPRPKRKPMHPYPRKLV---  115

Query  578  KPEMEVLGQSERSPSKMYNGERDNQSP  658
             P+ + +  +E + SK+   E DN+SP
Sbjct  116  IPDAKEMVYAELTGSKLIQDE-DNRSP  141



>gb|ADV29615.1| At5g37260-like protein, partial [Solanum arcanum]
Length=446

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAS09985.1| MYB transcription factor [Arabidopsis thaliana]
Length=287

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 110/147 (75%), Gaps = 7/147 (5%)
 Frame = +2

Query  218  AVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWR  397
            A+  + E++ +   +SSS    +  K RKPYTITKQRE+WTE EH++FVEALKLYGRAWR
Sbjct  2    AMQERCESLCSDELISSS--DAFYLKTRKPYTITKQREKWTEAEHEKFVEALKLYGRAWR  59

Query  398  KIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDGPIEIppprpkkkplhpyprkMVDSS  577
            +IEEHVGTKT +QIRSHAQKFFTKV RD G   +  IEIPPPRPK+KP+HPYPRK+V   
Sbjct  60   RIEEHVGTKTAVQIRSHAQKFFTKVARDFGVSSES-IEIPPPRPKRKPMHPYPRKLV---  115

Query  578  KPEMEVLGQSERSPSKMYNGERDNQSP  658
             P+ + +  +E + SK+   E DN+SP
Sbjct  116  IPDAKEMVYAELTGSKLIQDE-DNRSP  141



>ref|XP_006405937.1| hypothetical protein EUTSA_v10028153mg [Eutrema salsugineum]
 gb|ESQ47390.1| hypothetical protein EUTSA_v10028153mg [Eutrema salsugineum]
Length=283

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 77/101 (76%), Gaps = 3/101 (3%)
 Frame = +2

Query  218  AVNSKVETMTTQAG--VSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRA  391
            A+    E++  +A   + SS  + YL K RKPYTITKQRE+WTE EH++FVEALKLYGRA
Sbjct  2    AMQEHCESLCDRASDELISSTDAFYL-KTRKPYTITKQREKWTEAEHEKFVEALKLYGRA  60

Query  392  WRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDGPIEI  514
            WR+IEEHVGTKT +QIRSHAQKFFTKV RD G   +  IEI
Sbjct  61   WRRIEEHVGTKTAVQIRSHAQKFFTKVARDYGVSSEKSIEI  101



>gb|ABW22150.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22137.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>dbj|BAB10517.1| unnamed protein product [Arabidopsis thaliana]
Length=385

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 72/83 (87%), Gaps = 3/83 (4%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G++Y PKVRKPYTITK+RERWT+EEH++FVEALKLYGRAWR+IEEHVG+KT +QIRSHAQ
Sbjct  36   GNDYAPKVRKPYTITKERERWTDEEHKKFVEALKLYGRAWRRIEEHVGSKTAVQIRSHAQ  95

Query  455  KFFTKVVRD-LGNDGDG--PIEI  514
            KFF+KV R+  G DG    PI I
Sbjct  96   KFFSKVAREATGGDGSSVEPIVI  118



>ref|XP_006287913.1| hypothetical protein CARUB_v10001147mg [Capsella rubella]
 gb|EOA20811.1| hypothetical protein CARUB_v10001147mg [Capsella rubella]
Length=390

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G++Y PKVRKPYTITK+RERWT++EH++FVEALKLYGRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  38   GNDYAPKVRKPYTITKERERWTDDEHKKFVEALKLYGRAWRRIEEHVGTKTAVQIRSHAQ  97

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KV R+    GDG
Sbjct  98   KFFSKVARE-ATGGDG  112



>ref|XP_010453916.1| PREDICTED: protein REVEILLE 1 isoform X3 [Camelina sativa]
Length=390

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G++Y PK+RKPYTITK+RERWT+EEH++FVEALKLYGRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  37   GNDYAPKIRKPYTITKERERWTDEEHKKFVEALKLYGRAWRRIEEHVGTKTAVQIRSHAQ  96

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KV R+    GDG
Sbjct  97   KFFSKVARE-ATGGDG  111



>ref|XP_010420440.1| PREDICTED: protein REVEILLE 1-like [Camelina sativa]
 ref|XP_010420441.1| PREDICTED: protein REVEILLE 1-like [Camelina sativa]
Length=392

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G++Y PK+RKPYTITK+RERWT+EEH++FVEALKLYGRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  39   GNDYAPKIRKPYTITKERERWTDEEHKKFVEALKLYGRAWRRIEEHVGTKTAVQIRSHAQ  98

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KV R+    GDG
Sbjct  99   KFFSKVARE-ATGGDG  113



>gb|ABW22133.1| putative At5g37260-like protein, partial [Solanum peruvianum]
 gb|ABW22141.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=443

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAX44338.1| putative At5g37260, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAX44336.1| putative At5g37260, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22157.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=446

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22132.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=443

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAX44342.1| putative At5g37260, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAX44337.1| putative At5g37260, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22171.1| putative At5g37260-like protein, partial [Solanum chilense]
 gb|ABW22172.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=446

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22153.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29610.1| At5g37260-like protein, partial [Solanum arcanum]
Length=446

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22165.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=446

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22151.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22138.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>ref|XP_004231624.1| PREDICTED: protein REVEILLE 1 [Solanum lycopersicum]
Length=464

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  40   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  99

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  100  KFFSKVVRESSN-GDA  114



>gb|ABW22145.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29645.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22170.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=446

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AEO52901.1| hypothetical protein, partial [Solanum peruvianum]
Length=445

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAX44333.1| putative At5g37260, partial [Solanum peruvianum]
 gb|AAX44334.1| putative At5g37260, partial [Solanum peruvianum]
 gb|AAX44335.1| putative At5g37260, partial [Solanum peruvianum]
 gb|AAX44339.1| putative At5g37260, partial [Solanum peruvianum]
Length=443

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAX44341.1| putative At5g37260, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AEO52891.1| hypothetical protein, partial [Solanum peruvianum]
 gb|AEO52892.1| hypothetical protein, partial [Solanum peruvianum]
Length=445

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22147.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=443

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22127.1| putative At5g37260-like protein, partial [Solanum peruvianum]
 gb|ABW22135.1| putative At5g37260-like protein, partial [Solanum peruvianum]
 gb|ABW22139.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=443

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAX44353.1| putative At5g37260, partial [Solanum habrochaites]
 gb|AAX44354.1| putative At5g37260, partial [Solanum habrochaites]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29607.1| At5g37260-like protein, partial [Solanum arcanum]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29622.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22128.1| putative At5g37260-like protein, partial [Solanum peruvianum]
 gb|ABW22134.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=443

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AEO52893.1| hypothetical protein, partial [Solanum peruvianum]
Length=442

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHV TKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVATKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVRD  N GD 
Sbjct  83   KFFSKVVRDSSN-GDA  97



>gb|ABW22152.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22146.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22140.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29646.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29648.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29649.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29650.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22169.1| putative At5g37260-like protein, partial [Solanum chilense]
 gb|AEO52799.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22160.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29614.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29617.1| At5g37260-like protein, partial [Solanum arcanum]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22148.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>ref|XP_007215304.1| hypothetical protein PRUPE_ppa005083mg [Prunus persica]
 gb|EMJ16503.1| hypothetical protein PRUPE_ppa005083mg [Prunus persica]
Length=478

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 115/168 (68%), Gaps = 6/168 (4%)
 Frame = +2

Query  173  EAMDQSDGN-SGAVSSAVNS-KVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEE  346
            +A DQ DG+ S +V SA N         Q     S G++  PK RKPYTITKQRERWTEE
Sbjct  9    KAHDQYDGSRSESVLSANNGFSFSASGLQLKDQFSNGNDSAPKARKPYTITKQRERWTEE  68

Query  347  EHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDG---DGPIEIp  517
            EH++F+EALKLYGRAWRKIEEHVGTKT +QIRSHAQKFF+KV RD        + PI+IP
Sbjct  69   EHKKFLEALKLYGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVARDSNGSNEISEEPIDIP  128

Query  518  pprpkkkplhpyprkMVDSSKPEMEVLGQSERSPS-KMYNGERDNQSP  658
            PPRPK+KP+ PYPRK+V     E  ++ +  RS S  +   E +NQSP
Sbjct  129  PPRPKRKPMRPYPRKLVHPVNKETFIVERPTRSASPNLSVSEPENQSP  176



>gb|AEO52895.1| hypothetical protein, partial [Solanum peruvianum]
 gb|AEO52896.1| hypothetical protein, partial [Solanum peruvianum]
Length=442

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29557.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29561.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29562.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29563.1| At5g37260-like protein, partial [Solanum habrochaites]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22158.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22167.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=441

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AEO52801.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22124.1| putative At5g37260-like protein, partial [Solanum peruvianum]
 gb|ABW22125.1| putative At5g37260-like protein, partial [Solanum peruvianum]
 gb|ABW22126.1| putative At5g37260-like protein, partial [Solanum peruvianum]
 gb|ABW22131.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29577.1| At5g37260-like protein, partial [Solanum habrochaites]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22154.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22174.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=441

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAX44355.1| putative At5g37260, partial [Solanum habrochaites]
 gb|AAX44356.1| putative At5g37260, partial [Solanum habrochaites]
 gb|AAX44357.1| putative At5g37260, partial [Solanum habrochaites]
 gb|AAX44358.1| putative At5g37260, partial [Solanum habrochaites]
 gb|ADV29554.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29555.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29556.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29558.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29559.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29560.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29565.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29566.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29567.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29571.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29572.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29573.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29574.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29576.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29578.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29579.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29580.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29581.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29582.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29583.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29584.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29585.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29586.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29587.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29588.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29589.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29590.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29592.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29593.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29594.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29595.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29596.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29597.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29598.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29599.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29601.1| At5g37260-like protein, partial [Solanum habrochaites]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29591.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29600.1| At5g37260-like protein, partial [Solanum habrochaites]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29570.1| At5g37260-like protein, partial [Solanum habrochaites]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29564.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29568.1| At5g37260-like protein, partial [Solanum habrochaites]
 gb|ADV29569.1| At5g37260-like protein, partial [Solanum habrochaites]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22129.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHV TKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVATKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVRD  N GD 
Sbjct  83   KFFSKVVRDSSN-GDA  97



>gb|ABL63123.1| MYB transcription factor, partial [Catharanthus roseus]
Length=455

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  281  EYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKF  460
            + LPKVRKPYTITKQRERWTEEEH++F+EALKLYGRAWR+IEEHVG+KT +QIRSHAQKF
Sbjct  32   DCLPKVRKPYTITKQRERWTEEEHKKFLEALKLYGRAWRRIEEHVGSKTAVQIRSHAQKF  91

Query  461  FTKVVRDLGNDGDG  502
            F+KVVR+  N   G
Sbjct  92   FSKVVRESTNGDSG  105



>ref|XP_011035339.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Populus euphratica]
Length=488

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 107/135 (79%), Gaps = 5/135 (4%)
 Frame = +2

Query  269  SLGSEYL-PKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRS  445
            S GS++  PK RKPYTITKQRERWTEEEH++F+EALKLYGRAWR+IEEHVGTKT +QIRS
Sbjct  41   SCGSDFSSPKARKPYTITKQRERWTEEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRS  100

Query  446  HAQKFFTKVVRDLGNDGDG---PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERS  616
            HAQKFF+KVVR+ G+        IEIPPPRPK+KP+HPYPRK+    + E+ +  +S RS
Sbjct  101  HAQKFFSKVVRESGDSNTSSVESIEIPPPRPKRKPMHPYPRKLAHPLEKELLIPEKSLRS  160

Query  617  PSKMYN-GERDNQSP  658
             S  ++  E++NQSP
Sbjct  161  SSPNFSISEQENQSP  175



>gb|ADV29630.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29636.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29638.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29612.1| At5g37260-like protein, partial [Solanum arcanum]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAX44374.1| putative At5g37260, partial [Solanum pimpinellifolium]
 gb|AAX44378.1| putative At5g37260, partial [Solanum pimpinellifolium]
Length=447

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AEO52806.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AEO52800.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29634.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29640.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29641.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29643.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29644.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29647.1| At5g37260-like protein, partial [Solanum arcanum]
Length=446

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAX44369.1| putative At5g37260, partial [Solanum pimpinellifolium]
 gb|AAX44370.1| putative At5g37260, partial [Solanum pimpinellifolium]
 gb|AAX44371.1| putative At5g37260, partial [Solanum pimpinellifolium]
 gb|AAX44372.1| putative At5g37260, partial [Solanum pimpinellifolium]
 gb|AAX44373.1| putative At5g37260, partial [Solanum pimpinellifolium]
 gb|AAX44375.1| putative At5g37260, partial [Solanum pimpinellifolium]
 gb|AAX44376.1| putative At5g37260, partial [Solanum pimpinellifolium]
 gb|AAX44377.1| putative At5g37260, partial [Solanum pimpinellifolium]
Length=447

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29611.1| At5g37260-like protein, partial [Solanum arcanum]
Length=446

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AEO52894.1| hypothetical protein, partial [Solanum peruvianum]
Length=445

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AEO52804.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22180.1| putative At5g37260-like protein, partial [Solanum chilense]
 gb|ABW22183.1| putative At5g37260-like protein, partial [Solanum chilense]
 gb|ABW22186.1| putative At5g37260-like protein, partial [Solanum chilense]
 gb|ABW22188.1| putative At5g37260-like protein, partial [Solanum chilense]
 gb|ABW22189.1| putative At5g37260-like protein, partial [Solanum chilense]
 gb|ABW22190.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22176.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AEO52797.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22162.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>ref|XP_011035338.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Populus euphratica]
Length=503

 Score =   134 bits (338),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 107/135 (79%), Gaps = 5/135 (4%)
 Frame = +2

Query  269  SLGSEYL-PKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRS  445
            S GS++  PK RKPYTITKQRERWTEEEH++F+EALKLYGRAWR+IEEHVGTKT +QIRS
Sbjct  56   SCGSDFSSPKARKPYTITKQRERWTEEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRS  115

Query  446  HAQKFFTKVVRDLGNDGDG---PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERS  616
            HAQKFF+KVVR+ G+        IEIPPPRPK+KP+HPYPRK+    + E+ +  +S RS
Sbjct  116  HAQKFFSKVVRESGDSNTSSVESIEIPPPRPKRKPMHPYPRKLAHPLEKELLIPEKSLRS  175

Query  617  PSKMYN-GERDNQSP  658
             S  ++  E++NQSP
Sbjct  176  SSPNFSISEQENQSP  190



>gb|AEO52798.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22161.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AEO52900.1| hypothetical protein, partial [Solanum peruvianum]
Length=442

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAX44340.1| putative At5g37260, partial [Solanum peruvianum]
Length=441

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAX44343.1| putative At5g37260, partial [Solanum chilense]
 gb|AAX44345.1| putative At5g37260, partial [Solanum chilense]
 gb|AAX44347.1| putative At5g37260, partial [Solanum chilense]
 gb|AAX44349.1| putative At5g37260, partial [Solanum chilense]
 gb|AAX44350.1| putative At5g37260, partial [Solanum chilense]
 gb|AAX44351.1| putative At5g37260, partial [Solanum chilense]
 gb|AAX44352.1| putative At5g37260, partial [Solanum chilense]
 gb|AEO52803.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29637.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29618.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22166.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>ref|XP_008393486.1| PREDICTED: protein REVEILLE 7-like [Malus domestica]
Length=441

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 118/169 (70%), Gaps = 11/169 (7%)
 Frame = +2

Query  164  MVAEAMDQSDGNSGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTE  343
            M  E   ++ G++ +V+    S      + A + S  G+++ PKVRKPYTITKQRE+WTE
Sbjct  1    MAVEDQIEAAGSNASVAVGNCSSNGDAQSNAEICS-FGNDHAPKVRKPYTITKQREKWTE  59

Query  344  EEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDGP---IEI  514
            EEHQ+F+EALKLYGR WR+IEE+VGTKT +QIRSHAQKFF+KV ++     +G    IEI
Sbjct  60   EEHQKFLEALKLYGRGWRQIEEYVGTKTAVQIRSHAQKFFSKVSKESCGPSEGSTRLIEI  119

Query  515  ppprpkkkplhpyprkMVDSSKPEMEVLGQSERSPSKMYNGE-RDNQSP  658
            PPPRPK+KP+HPYPRK VD       + G  ERSPS  ++ + +D QSP
Sbjct  120  PPPRPKRKPVHPYPRKSVDY------LNGSPERSPSPQFSAQGKDQQSP  162



>gb|ADV29620.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29624.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAX44344.1| putative At5g37260, partial [Solanum chilense]
 gb|AAX44346.1| putative At5g37260, partial [Solanum chilense]
 gb|AAX44348.1| putative At5g37260, partial [Solanum chilense]
 gb|ABW22164.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29642.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29633.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22149.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29575.1| At5g37260-like protein, partial [Solanum habrochaites]
Length=446

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AEO52802.1| hypothetical protein, partial [Solanum chilense]
 gb|AEO52805.1| hypothetical protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29629.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29628.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29626.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29623.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22181.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|KDO57321.1| hypothetical protein CISIN_1g0126251mg, partial [Citrus sinensis]
Length=335

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 7/107 (7%)
 Frame = +2

Query  182  DQSDGN-SGAVSSAVN-----SKVETMT-TQAGVSSSLGSEYLPKVRKPYTITKQRERWT  340
            D+  GN S +V SA N     S + T+T  +     S G+++ PK RKPYTITKQRERWT
Sbjct  5    DECGGNHSNSVFSAGNGIESSSGLHTVTGLEVKDQFSCGNDFAPKPRKPYTITKQRERWT  64

Query  341  EEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRD  481
            EEEH++F+EALKL+GRAWRKIEEHVGTKT +QIRSHAQKFF+KVVR+
Sbjct  65   EEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRE  111



>gb|ADV29631.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29602.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29603.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29604.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29605.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29606.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29609.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22173.1| putative At5g37260-like protein, partial [Solanum chilense]
 gb|ABW22175.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29639.1| At5g37260-like protein, partial [Solanum arcanum]
Length=442

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22155.1| putative At5g37260-like protein, partial [Solanum chilense]
 gb|ABW22163.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22130.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHV TKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVATKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVRD  N GD 
Sbjct  83   KFFSKVVRDSSN-GDA  97



>gb|ADV29625.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29627.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AAX44359.1| putative At5g37260, partial [Solanum chmielewskii]
 gb|AAX44360.1| putative At5g37260, partial [Solanum chmielewskii]
 gb|AAX44361.1| putative At5g37260, partial [Solanum chmielewskii]
 gb|AAX44362.1| putative At5g37260, partial [Solanum chmielewskii]
 gb|AAX44363.1| putative At5g37260, partial [Solanum chmielewskii]
 gb|AAX44364.1| putative At5g37260, partial [Solanum chmielewskii]
 gb|AAX44365.1| putative At5g37260, partial [Solanum chmielewskii]
 gb|AAX44366.1| putative At5g37260, partial [Solanum chmielewskii]
 gb|AAX44367.1| putative At5g37260, partial [Solanum chmielewskii]
 gb|AAX44368.1| putative At5g37260, partial [Solanum chmielewskii]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29651.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29619.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29621.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>emb|CDP01692.1| unnamed protein product [Coffea canephora]
Length=475

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 3/81 (4%)
 Frame = +2

Query  281  EYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKF  460
            +Y  KVRKPYTITKQRERWTE+EH++F+EALKLYGRAWR+IEEHVGTKT +QIRSHAQKF
Sbjct  31   DYAQKVRKPYTITKQRERWTEDEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSHAQKF  90

Query  461  FTKVVRDLGNDGDG---PIEI  514
            F+KVVR+  N   G   PIEI
Sbjct  91   FSKVVRESNNGDSGSVKPIEI  111



>gb|ADV29608.1| At5g37260-like protein, partial [Solanum arcanum]
 gb|ADV29613.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ADV29632.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>ref|XP_009613640.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Nicotiana tomentosiformis]
Length=488

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 70/82 (85%), Gaps = 5/82 (6%)
 Frame = +2

Query  281  EYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKF  460
            EY PK RK YTI+KQRERWTEEEH++F+EA+KLYGRAWR+IEEHVGTKT +QIRSHAQKF
Sbjct  50   EYAPKARKAYTISKQRERWTEEEHRKFLEAIKLYGRAWRRIEEHVGTKTAVQIRSHAQKF  109

Query  461  FTKVVRDLGNDGDG----PIEI  514
            F+KVVR+  N GD     PIEI
Sbjct  110  FSKVVRE-SNSGDASSVKPIEI  130



>gb|ADV29616.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AEO52888.1| hypothetical protein, partial [Solanum peruvianum]
Length=445

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22123.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=443

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHV TKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVATKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVRD  N GD 
Sbjct  83   KFFSKVVRDSSN-GDA  97



>ref|XP_006350462.1| PREDICTED: uncharacterized protein LOC102602066 [Solanum tuberosum]
Length=476

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  40   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  99

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  100  KFFSKVVRESSN-GDA  114



>gb|AEO52897.1| hypothetical protein, partial [Solanum peruvianum]
Length=446

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|KCW69450.1| hypothetical protein EUGRSUZ_F02906 [Eucalyptus grandis]
Length=646

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 71/81 (88%), Gaps = 3/81 (4%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S  ++Y PKVRKPYTITKQRERWTEEEH++F+EALKLYGRAWR+IEEHVGTKT +QIRSH
Sbjct  249  SCANDYAPKVRKPYTITKQRERWTEEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSH  308

Query  449  AQKFFTKVVRDLGNDGDGPIE  511
            AQKFF+KVV+D     DG +E
Sbjct  309  AQKFFSKVVKD---PTDGKVE  326



>gb|KDO57322.1| hypothetical protein CISIN_1g0126251mg, partial [Citrus sinensis]
Length=353

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 7/107 (7%)
 Frame = +2

Query  182  DQSDGN-SGAVSSAVN-----SKVETMT-TQAGVSSSLGSEYLPKVRKPYTITKQRERWT  340
            D+  GN S +V SA N     S + T+T  +     S G+++ PK RKPYTITKQRERWT
Sbjct  5    DECGGNHSNSVFSAGNGIESSSGLHTVTGLEVKDQFSCGNDFAPKPRKPYTITKQRERWT  64

Query  341  EEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRD  481
            EEEH++F+EALKL+GRAWRKIEEHVGTKT +QIRSHAQKFF+KVVR+
Sbjct  65   EEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRE  111



>ref|XP_010492675.1| PREDICTED: protein REVEILLE 1-like [Camelina sativa]
Length=392

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G++Y PK+RKPYTITK+RERWT+EEH++FVEALKLYGRAWR+IEEHVG+KT +QIRSHAQ
Sbjct  39   GNDYAPKIRKPYTITKERERWTDEEHKKFVEALKLYGRAWRRIEEHVGSKTAVQIRSHAQ  98

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KV R+    GDG
Sbjct  99   KFFSKVARE-ATGGDG  113



>ref|XP_002873821.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50080.1| myb family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=387

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 69/75 (92%), Gaps = 1/75 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G++Y PKVRKPYTITK+RERWT+EEH++FVEALKLYGRAWR+IEEHVG+KT +QIRSHAQ
Sbjct  38   GNDYAPKVRKPYTITKERERWTDEEHKKFVEALKLYGRAWRRIEEHVGSKTAVQIRSHAQ  97

Query  455  KFFTKVVRD-LGNDG  496
            KFF+KV R+  G DG
Sbjct  98   KFFSKVAREATGGDG  112



>ref|XP_011047787.1| PREDICTED: protein REVEILLE 7-like [Populus euphratica]
Length=485

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 73/94 (78%), Gaps = 3/94 (3%)
 Frame = +2

Query  242  MTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGT  421
            M  Q     S GS+ +PKVRKPYTITKQRE+WTEEEHQRF+EALKLYGR WRKI+EHVGT
Sbjct  33   MVLQLNELHSFGSDNIPKVRKPYTITKQREKWTEEEHQRFLEALKLYGRGWRKIQEHVGT  92

Query  422  KTVIQIRSHAQKFFTKVV--RDLGNDGD-GPIEI  514
            KT +QIRSHAQK F+KVV     GN+    PIEI
Sbjct  93   KTAVQIRSHAQKIFSKVVWESSGGNESSLKPIEI  126



>ref|XP_006372412.1| hypothetical protein POPTR_0017s01380g [Populus trichocarpa]
 gb|ERP50209.1| hypothetical protein POPTR_0017s01380g [Populus trichocarpa]
Length=479

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 78/109 (72%), Gaps = 7/109 (6%)
 Frame = +2

Query  182  DQSDGN-SGAVSSAVNSKVETMTTQAGVSS------SLGSEYLPKVRKPYTITKQRERWT  340
            DQ  G  S  V  A N  + + T Q           S GS+Y PK RKPYTITKQRERWT
Sbjct  5    DQCGGTRSNLVLPAGNGILPSATLQKATDHQLKEQFSCGSDYSPKARKPYTITKQRERWT  64

Query  341  EEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLG  487
            EEEH++F++ALKLYGRAWR+IEEH+GTKT +QIRSHAQKFF+KV R+ G
Sbjct  65   EEEHKKFLDALKLYGRAWRRIEEHLGTKTAVQIRSHAQKFFSKVARESG  113



>ref|XP_002868495.1| hypothetical protein ARALYDRAFT_493689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44754.1| hypothetical protein ARALYDRAFT_493689, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=289

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 110/147 (75%), Gaps = 8/147 (5%)
 Frame = +2

Query  218  AVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWR  397
            A+  + E++  +  + SS  + YL K RKPYTITKQRE+WTE EH++FVEALKLYGRAWR
Sbjct  2    AMQERCESLCDE--LISSTDAFYL-KTRKPYTITKQREKWTEAEHEKFVEALKLYGRAWR  58

Query  398  KIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDGPIEIppprpkkkplhpyprkMVDSS  577
            +IEEHVGTKT +QIRSHAQKFFTKV RD G   +  IEIPPPRPK+KP+HPYPRK+V   
Sbjct  59   RIEEHVGTKTAVQIRSHAQKFFTKVARDFGVSSES-IEIPPPRPKRKPMHPYPRKLVI--  115

Query  578  KPEMEVLGQSERSPSKMYNGERDNQSP  658
             P+ + +   E + SKM   E DN+SP
Sbjct  116  -PDAKEMAYVELTGSKMVQDE-DNRSP  140



>ref|XP_009144670.1| PREDICTED: protein REVEILLE 2 [Brassica rapa]
 emb|CDY38566.1| BnaA05g12950D [Brassica napus]
Length=321

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +2

Query  284  YLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFF  463
            +  K RKPYTITKQRE+WTE EH++FVEALKLYGRAWR+IEEHVGTKT +QIRSHAQKFF
Sbjct  41   FCLKTRKPYTITKQREKWTEAEHEKFVEALKLYGRAWRRIEEHVGTKTAVQIRSHAQKFF  100

Query  464  TKVVRDLGNDGDGPIEI  514
            TKV RD G   +  IEI
Sbjct  101  TKVARDCGVTSEKSIEI  117



>ref|XP_006374255.1| hypothetical protein POPTR_0015s05430g [Populus trichocarpa]
 gb|ERP52052.1| hypothetical protein POPTR_0015s05430g [Populus trichocarpa]
Length=472

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 3/86 (3%)
 Frame = +2

Query  266  SSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRS  445
            +S GS+ +PKVRKPYTITKQRE+WTEEEHQRF+EALKLYGR WRKI+EHVGTKT +QIRS
Sbjct  41   NSFGSDNIPKVRKPYTITKQREKWTEEEHQRFLEALKLYGRGWRKIQEHVGTKTAVQIRS  100

Query  446  HAQKFFTKVV--RDLGNDGD-GPIEI  514
            HAQK F+KVV     GN+    PIEI
Sbjct  101  HAQKIFSKVVWESSGGNESSLKPIEI  126



>ref|XP_006855608.1| PREDICTED: uncharacterized protein LOC18445408 [Amborella trichopoda]
 gb|ERN17075.1| hypothetical protein AMTR_s00044p00072910 [Amborella trichopoda]
Length=546

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G E   KVRKPYTITKQRERWTEEEH++F+EALKLYGRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  45   GDEQAAKVRKPYTITKQRERWTEEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSHAQ  104

Query  455  KFFTKVVRDLGNDG  496
            KFF+KV RD  N G
Sbjct  105  KFFSKVARDSNNGG  118



>ref|XP_010037005.1| PREDICTED: protein REVEILLE 7 [Eucalyptus grandis]
 ref|XP_010037006.1| PREDICTED: protein REVEILLE 7 [Eucalyptus grandis]
 ref|XP_010037007.1| PREDICTED: protein REVEILLE 7 [Eucalyptus grandis]
 gb|KCW48643.1| hypothetical protein EUGRSUZ_K02302 [Eucalyptus grandis]
Length=483

 Score =   134 bits (336),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 100/122 (82%), Gaps = 5/122 (4%)
 Frame = +2

Query  272  LGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHA  451
            L ++  PKVRKPYTI+KQRE+WT+EEH+RF+EALKLYGR WR+IEEHVGTKT +QIRSHA
Sbjct  41   LENDQTPKVRKPYTISKQREKWTDEEHERFLEALKLYGRGWRQIEEHVGTKTAVQIRSHA  100

Query  452  QKFFTKVVRDLGNDGDG---PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSPS  622
            QKFF+KV R +    +G   PIEIPPPRPK+KP+HPYPRK VDS   E+++  Q ERSPS
Sbjct  101  QKFFSKVARGVSGSSEGVIKPIEIPPPRPKRKPMHPYPRKSVDSK--EVKLSYQQERSPS  158

Query  623  KM  628
             +
Sbjct  159  PI  160



>ref|XP_009782662.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Nicotiana sylvestris]
Length=467

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 69/73 (95%), Gaps = 1/73 (1%)
 Frame = +2

Query  281  EYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKF  460
            EY PK+RKPYTI+KQRERW++EEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQKF
Sbjct  29   EYAPKIRKPYTISKQRERWSDEEHRKFIEALKLHGRAWRRIEEHVGTKTAVQIRSHAQKF  88

Query  461  FTKVVRDLGNDGD  499
            F+KVVR+  N+GD
Sbjct  89   FSKVVRE-SNNGD  100



>emb|CDY26997.1| BnaC06g12130D [Brassica napus]
Length=321

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +2

Query  284  YLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFF  463
            +  K RKPYTITKQRE+WTE EH++FVEALKLYGRAWR+IEEHVGTKT +QIRSHAQKFF
Sbjct  41   FCLKTRKPYTITKQREKWTEAEHEKFVEALKLYGRAWRRIEEHVGTKTAVQIRSHAQKFF  100

Query  464  TKVVRDLGNDGDGPIEI  514
            TKV RD G   +  IEI
Sbjct  101  TKVARDCGVTSEKSIEI  117



>ref|XP_009413064.1| PREDICTED: protein REVEILLE 5-like [Musa acuminata subsp. malaccensis]
Length=501

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 104/135 (77%), Gaps = 11/135 (8%)
 Frame = +2

Query  278  SEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQK  457
            +E  P+VRKPYTITKQRERWTEEEH +F+EAL+ YGRAWR+IEEH+GTKT +QIRSHAQK
Sbjct  51   TEQAPRVRKPYTITKQRERWTEEEHNKFLEALQQYGRAWRRIEEHIGTKTAVQIRSHAQK  110

Query  458  FFTKVVRDLG-NDGDGP---IEIppprpkkkplhpyprkMVDSSKPEMEVLGQSER----  613
            FF+KVVR+ G ND  G    IEIPPPRPK+KP+HPYPRK+  SS  E+  L Q ER    
Sbjct  111  FFSKVVRESGSNDNTGTSKGIEIPPPRPKRKPVHPYPRKLSHSSNKEIPALKQLERPRLQ  170

Query  614  SPSKMYNGERDNQSP  658
            SP      E+DN+SP
Sbjct  171  SP---IICEQDNRSP  182



>gb|KJB08184.1| hypothetical protein B456_001G069700 [Gossypium raimondii]
 gb|KJB08185.1| hypothetical protein B456_001G069700 [Gossypium raimondii]
Length=457

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 103/134 (77%), Gaps = 5/134 (4%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            +   ++ PK RKPYTITKQRE+WTEEEH+RF+EAL+LYGR WR+IEEHVGTK+ +QIRSH
Sbjct  35   TFNHDHTPKARKPYTITKQREKWTEEEHERFLEALRLYGRGWRQIEEHVGTKSAVQIRSH  94

Query  449  AQKFFTKVVRDLGNDGDG---PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSP  619
            AQKFF+KVVR+     DG   PI IPPPRPK+KP+HPYPRK VD  K +     Q ERSP
Sbjct  95   AQKFFSKVVRESNGGFDGSIKPIVIPPPRPKRKPVHPYPRKSVDLVKGKSPS-SQPERSP  153

Query  620  S-KMYNGERDNQSP  658
            S   +  E+DN+SP
Sbjct  154  SPNQFFREQDNKSP  167



>ref|XP_009609237.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Nicotiana tomentosiformis]
Length=468

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 69/73 (95%), Gaps = 1/73 (1%)
 Frame = +2

Query  281  EYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKF  460
            EY PK+RKPYTI+KQRERW++EEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQKF
Sbjct  29   EYAPKIRKPYTISKQRERWSDEEHRKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQKF  88

Query  461  FTKVVRDLGNDGD  499
            F+KVVR+  N+GD
Sbjct  89   FSKVVRE-SNNGD  100



>ref|XP_010935334.1| PREDICTED: protein CCA1 [Elaeis guineensis]
Length=510

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  263  SSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIR  442
            S S G E+  KVRKPYTITKQRERWTEEEH++F+EALKLYGRAWR+IEEH+GTKT +QIR
Sbjct  39   SGSSGDEHAIKVRKPYTITKQRERWTEEEHEKFLEALKLYGRAWRRIEEHIGTKTAVQIR  98

Query  443  SHAQKFFTKVVRDLG  487
            SHAQKFF+KVVR+ G
Sbjct  99   SHAQKFFSKVVREPG  113



>ref|XP_009370571.1| PREDICTED: protein REVEILLE 1 [Pyrus x bretschneideri]
Length=482

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 104/134 (78%), Gaps = 4/134 (3%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S G+++ PKVRKPYTITKQRERWTEEEH++F+EALKLYGRAWRKIE+HV TKT +QIRSH
Sbjct  41   SSGNDFTPKVRKPYTITKQRERWTEEEHKKFLEALKLYGRAWRKIEDHVVTKTAVQIRSH  100

Query  449  AQKFFTKVVRDL--GNDG-DGPIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSP  619
            AQKFF+KV RD   GN   + PI+IPPPRPK+KP+ PYPRK+V     E   + QS  S 
Sbjct  101  AQKFFSKVARDPNGGNTASEEPIDIPPPRPKRKPMRPYPRKLVHPLNKETSTVEQSAMST  160

Query  620  S-KMYNGERDNQSP  658
            S  +   E++NQSP
Sbjct  161  SPNLSVLEQENQSP  174



>ref|XP_009385654.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=481

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 58/75 (77%), Positives = 69/75 (92%), Gaps = 1/75 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G E  P++RKPYTITKQRERWTEEEH+RF+EAL+LYGRAWR+IEEH+GTKT +QIRSHAQ
Sbjct  43   GEEQAPRIRKPYTITKQRERWTEEEHRRFLEALQLYGRAWRRIEEHIGTKTAVQIRSHAQ  102

Query  455  KFFTKVVRDLGNDGD  499
            KFF+KVVR+ G+ GD
Sbjct  103  KFFSKVVRESGS-GD  116



>gb|KHG17751.1| Protein LHY -like protein [Gossypium arboreum]
Length=457

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 102/134 (76%), Gaps = 5/134 (4%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            +   ++ PK RKPYTITKQRE+WTEEEHQRF+EAL+LYGR WR+IEEH+GTK+ +QIRSH
Sbjct  35   TFNHDHTPKARKPYTITKQREKWTEEEHQRFLEALRLYGRGWRQIEEHIGTKSAVQIRSH  94

Query  449  AQKFFTKVVRDLGNDGDG---PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSP  619
            AQKFF+KV R+     DG   PI IPPPRPK+KP+HPYPRK VD  K +     Q ERSP
Sbjct  95   AQKFFSKVARESNGGFDGSIKPIVIPPPRPKRKPVHPYPRKSVDLVKGKSPS-SQPERSP  153

Query  620  S-KMYNGERDNQSP  658
            S   +  E+DN+SP
Sbjct  154  SPNQFFREQDNKSP  167



>emb|CDY16939.1| BnaC09g40660D [Brassica napus]
Length=300

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G++Y PKVRKPYTITK+RERWT+EEH +FVEALKL+GRAWRKIEEHVGTKT +QIRSHAQ
Sbjct  28   GNDYAPKVRKPYTITKERERWTDEEHNKFVEALKLHGRAWRKIEEHVGTKTAVQIRSHAQ  87

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KV ++  + G+G
Sbjct  88   KFFSKVAKE-ASGGNG  102



>ref|XP_006430409.1| hypothetical protein CICLE_v10011554mg [Citrus clementina]
 gb|ESR43649.1| hypothetical protein CICLE_v10011554mg [Citrus clementina]
Length=496

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 7/107 (7%)
 Frame = +2

Query  182  DQSDGN-SGAVSSAVN-----SKVETMT-TQAGVSSSLGSEYLPKVRKPYTITKQRERWT  340
            D+  GN S +V SA N     S + T+T  +     S G+++ PK RKPYTITKQRERWT
Sbjct  5    DECGGNHSNSVFSAANGIESSSGLHTVTGLEVKDQFSCGNDFAPKPRKPYTITKQRERWT  64

Query  341  EEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRD  481
            EEEH++F+EALKL+GRAWRKIEEHVGTKT +QIRSHAQKFF+KVVR+
Sbjct  65   EEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSHAQKFFSKVVRE  111



>ref|XP_004515250.1| PREDICTED: uncharacterized protein LOC101509066 [Cicer arietinum]
Length=459

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 104/134 (78%), Gaps = 9/134 (7%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G+   PKVRKPYTITKQRE+WT++EHQ+FV+ALKLYGR WR+IEEH+GTKT +QIRSHAQ
Sbjct  44   GNNLTPKVRKPYTITKQREKWTDKEHQKFVDALKLYGRGWRQIEEHIGTKTAVQIRSHAQ  103

Query  455  KFFTKVVRDLGNDGDG-----PIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSP  619
            KFF+KVVR+  +DG       PI IPPPRPK+KPLHPYPRK VDS K +  V  +SE SP
Sbjct  104  KFFSKVVRE--HDGSAESSIQPIVIPPPRPKRKPLHPYPRKSVDSIKGQ-PVPNKSETSP  160

Query  620  S-KMYNGERDNQSP  658
            S  +   E D QSP
Sbjct  161  SVNLSVAENDTQSP  174



>gb|ABH02924.1| MYB transcription factor MYB131 [Glycine max]
Length=321

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +2

Query  212  SSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRA  391
            +S ++S  E  +       S+G+   PKVRKPYTITKQRE+WTEEEHQ+F+EALKLYGR 
Sbjct  58   ASNIHSNGEKQSENVAHIPSVGNNQTPKVRKPYTITKQREKWTEEEHQKFLEALKLYGRG  117

Query  392  WRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDGPIE  511
            WR+IEEH+GTK  +QIRSHAQKFF+KVVR+     +  I+
Sbjct  118  WRQIEEHIGTKNAVQIRSHAQKFFSKVVRESEGSAESSIQ  157



>ref|XP_007146984.1| hypothetical protein PHAVU_006G086700g [Phaseolus vulgaris]
 gb|ESW18978.1| hypothetical protein PHAVU_006G086700g [Phaseolus vulgaris]
Length=361

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S GS+Y  KVRKPYTITKQRERWT+EEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSH
Sbjct  41   SCGSDYALKVRKPYTITKQRERWTDEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSH  100

Query  449  AQKFFTKVVRD  481
            AQKFF+KV+RD
Sbjct  101  AQKFFSKVLRD  111



>gb|EYU38934.1| hypothetical protein MIMGU_mgv1a008764mg [Erythranthe guttata]
Length=363

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/78 (81%), Positives = 69/78 (88%), Gaps = 5/78 (6%)
 Frame = +2

Query  293  KVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKV  472
            KVRKPYTITKQRERWTEEEH++F+EALKLYGRAWRKIEEHVGTKT +QIRSHAQKFF+KV
Sbjct  32   KVRKPYTITKQRERWTEEEHKKFLEALKLYGRAWRKIEEHVGTKTAVQIRSHAQKFFSKV  91

Query  473  VRDLGNDGDG----PIEI  514
            VR+  N  DG    PIEI
Sbjct  92   VRE-SNTIDGIPVKPIEI  108



>ref|XP_006481961.1| PREDICTED: uncharacterized protein LOC102630458 [Citrus sinensis]
Length=498

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S G+++ PK RKPYTITKQRERWTEEEH++F+EALKL+GRAWRKIEEHVGTKT +QIRSH
Sbjct  43   SCGNDFAPKPRKPYTITKQRERWTEEEHKKFLEALKLFGRAWRKIEEHVGTKTAVQIRSH  102

Query  449  AQKFFTKVVRD  481
            AQKFF+KVVR+
Sbjct  103  AQKFFSKVVRE  113



>gb|ABW22179.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=446

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVG KT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGAKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABH02927.1| MYB transcription factor MYB140 [Glycine max]
Length=141

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  290  PKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTK  469
            PKVRKPYTITKQRE+WTEEEHQ+F+EALKLYGR WR+IEEH+GTKT +QIRSHAQKFF+K
Sbjct  34   PKVRKPYTITKQREKWTEEEHQKFLEALKLYGRGWRQIEEHIGTKTAVQIRSHAQKFFSK  93

Query  470  VVRDLGNDGDGPIE  511
            VVR+     +G I+
Sbjct  94   VVRESEVSDEGSIQ  107



>gb|ABW22178.1| putative At5g37260-like protein, partial [Solanum chilense]
 gb|ABW22187.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=446

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHV TKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVATKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22143.1| putative At5g37260-like protein, partial [Solanum peruvianum]
Length=443

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHV TKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVATKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22177.1| putative At5g37260-like protein, partial [Solanum chilense]
 gb|ABW22185.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=446

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHV TKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVATKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>ref|XP_008804812.1| PREDICTED: protein REVEILLE 7-like [Phoenix dactylifera]
Length=510

 Score =   132 bits (333),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +2

Query  251  QAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTV  430
            Q+  SS  G E+  KVRKPYTITKQRERWTEEEH++F+EALKLYGRAWR+IEEH+GTKT 
Sbjct  35   QSKESSLSGDEHAIKVRKPYTITKQRERWTEEEHEKFLEALKLYGRAWRRIEEHIGTKTA  94

Query  431  IQIRSHAQKFFTKVVRDLG  487
            +QIRSHAQKFF+KVVR+ G
Sbjct  95   VQIRSHAQKFFSKVVREPG  113



>gb|EYU22283.1| hypothetical protein MIMGU_mgv1a024824mg [Erythranthe guttata]
Length=332

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 67/77 (87%), Gaps = 3/77 (4%)
 Frame = +2

Query  293  KVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKV  472
            KVRKPYTITKQRE+WTEEEHQ+F+EALKLYGRAWR+IEEHVGTKT IQIRSHAQKFF KV
Sbjct  6    KVRKPYTITKQREKWTEEEHQKFLEALKLYGRAWRQIEEHVGTKTAIQIRSHAQKFFAKV  65

Query  473  VRDLGNDGDG---PIEI  514
             R+   D +G   PIEI
Sbjct  66   ARESCFDAEGSLDPIEI  82



>gb|ABW22156.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=446

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHV TKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVATKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|AEO52889.1| hypothetical protein, partial [Solanum peruvianum]
Length=442

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHV TKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVATKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>ref|XP_006478113.1| PREDICTED: uncharacterized protein LOC102614255 isoform X1 [Citrus 
sinensis]
 ref|XP_006478114.1| PREDICTED: uncharacterized protein LOC102614255 isoform X2 [Citrus 
sinensis]
Length=448

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S  ++ LPKVRKPYTITKQRE+WTEEEHQRF++ALK+YGR WR+IEEHVGTKT +QIRSH
Sbjct  7    SFENDSLPKVRKPYTITKQREKWTEEEHQRFLDALKMYGRGWRQIEEHVGTKTAVQIRSH  66

Query  449  AQKFFTKVVRDLGNDGDGPI  508
            AQKFF+KVVR+     +  I
Sbjct  67   AQKFFSKVVRESNGSSESSI  86



>gb|AEO52890.1| hypothetical protein, partial [Solanum peruvianum]
 gb|AEO52899.1| hypothetical protein, partial [Solanum peruvianum]
Length=445

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHV TKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVATKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>ref|XP_006400263.1| hypothetical protein EUTSA_v10013821mg [Eutrema salsugineum]
 dbj|BAJ34195.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41716.1| hypothetical protein EUTSA_v10013821mg [Eutrema salsugineum]
Length=380

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 3/83 (4%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G++Y PK RKPYTITK+RERWT+EEH +FVEALKLYGRAWR+IEEHVGTKT +QIRSHAQ
Sbjct  38   GNDYAPKARKPYTITKERERWTDEEHNKFVEALKLYGRAWRRIEEHVGTKTAVQIRSHAQ  97

Query  455  KFFTKVVRD-LGNDGDG--PIEI  514
            KFF+KV R+  G +G    PI I
Sbjct  98   KFFSKVAREATGGNGSSLEPIVI  120



>gb|AHB59600.1| putative MYB-related protein 13 [Arachis hypogaea]
Length=428

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/71 (80%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S G++Y PKVRKPYTITKQRERWT++EH++F+EALKLYGRAWR+IEEHVGTKT +QIRSH
Sbjct  41   SCGNDYSPKVRKPYTITKQRERWTDDEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSH  100

Query  449  AQKFFTKVVRD  481
            AQKFF +VVRD
Sbjct  101  AQKFFWQVVRD  111



>gb|ADV29635.1| At5g37260-like protein, partial [Solanum arcanum]
Length=443

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 68/74 (92%), Gaps = 1/74 (1%)
 Frame = +2

Query  281  EYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKF  460
            EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHVGTKT +QIRSHAQKF
Sbjct  25   EYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVGTKTAVQIRSHAQKF  84

Query  461  FTKVVRDLGNDGDG  502
            F+KVVR+  N GD 
Sbjct  85   FSKVVRESSN-GDA  97



>gb|KEH26846.1| myb transcription factor [Medicago truncatula]
Length=467

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 93/138 (67%), Gaps = 13/138 (9%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S+G+   PKVRKPYTITKQRE+WT+EEHQ+F+EALKLYGR WR+IEEH+G+KT IQIRSH
Sbjct  38   SVGNNLAPKVRKPYTITKQREKWTDEEHQKFLEALKLYGRGWRQIEEHIGSKTAIQIRSH  97

Query  449  AQKFFTKVVRDLGNDGDGPIEIppprpkkkplhpyprkM-------VDSSKPEMEVLGQS  607
            AQKFF+KVVR    + DG  E P       P  P  + +       VDS K ++ V  +S
Sbjct  98   AQKFFSKVVR----EPDGSAESPIQPIDIPPPRPKRKPLHPYPRKSVDSFKGQL-VPNES  152

Query  608  ERSPS-KMYNGERDNQSP  658
            E SPS  +   E D QSP
Sbjct  153  ETSPSINLSVAENDTQSP  170



>gb|ABW22168.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=441

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHV TKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVATKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22159.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=446

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHV TKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVATKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|ABW22182.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=439

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW+EEEH++F+EALKL+GRAWR+IEEHV TKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSEEEHKKFLEALKLHGRAWRRIEEHVATKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>emb|CDY02714.1| BnaC02g07210D [Brassica napus]
Length=369

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/81 (75%), Positives = 70/81 (86%), Gaps = 3/81 (4%)
 Frame = +2

Query  281  EYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKF  460
            +Y PKVRKPYTITK+RERWT+EEH +FVEALKLYGRAWRKIEEHVGTKT +QIRSHAQKF
Sbjct  31   DYAPKVRKPYTITKERERWTDEEHNKFVEALKLYGRAWRKIEEHVGTKTAVQIRSHAQKF  90

Query  461  FTKVVRD-LGNDGDG--PIEI  514
            F+KV R+  G +G+   PI I
Sbjct  91   FSKVARESSGGNGNSLEPIVI  111



>ref|XP_009367121.1| PREDICTED: protein REVEILLE 1-like isoform X1 [Pyrus x bretschneideri]
Length=508

 Score =   132 bits (332),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S G+++ PKVRKPYTI K+RERWTEEEH++F+EALKLYGRAWRKIEEH+GTKT +QIRSH
Sbjct  42   SSGNDFTPKVRKPYTIKKERERWTEEEHKKFLEALKLYGRAWRKIEEHIGTKTAVQIRSH  101

Query  449  AQKFFTKVVRDLGNDGDGPIE  511
            AQKFF+KV R   N G  P E
Sbjct  102  AQKFFSKVAR-YPNGGKAPAE  121



>ref|XP_003548314.1| PREDICTED: protein CCA1 [Glycine max]
 gb|KHN24535.1| Myb-like protein G [Glycine soja]
Length=477

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = +2

Query  212  SSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRA  391
            +S ++S  E  +       S+G+   PKVRKPYTITKQRE+WTEEEHQ+F+EALKLYGR 
Sbjct  18   ASNIHSNGEKQSENVAHIPSVGNNQTPKVRKPYTITKQREKWTEEEHQKFLEALKLYGRG  77

Query  392  WRKIEEHVGTKTVIQIRSHAQKFFTKVVRD  481
            WR+IEEH+GTK  +QIRSHAQKFF+KVVR+
Sbjct  78   WRQIEEHIGTKNAVQIRSHAQKFFSKVVRE  107



>dbj|BAP76057.1| putative LHY [Cryptomeria japonica]
Length=695

 Score =   133 bits (335),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 70/82 (85%), Gaps = 2/82 (2%)
 Frame = +2

Query  257  GVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQ  436
            G  SS G E   KVRKPYTITKQRERWTEEEHQ+F+EALKLYGRAWR+IEEH+GTKT +Q
Sbjct  9    GDISSSGDELAAKVRKPYTITKQRERWTEEEHQKFLEALKLYGRAWRRIEEHIGTKTAVQ  68

Query  437  IRSHAQKFFTKVVRDLGNDGDG  502
            IRSHAQKFF+K+VR  G+ G G
Sbjct  69   IRSHAQKFFSKLVR--GSSGRG  88



>gb|AGM20683.1| EPR [Populus tomentosa]
Length=687

 Score =   133 bits (334),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S GS+ +PKVRKPYTITKQRE+WT+EEHQRF+EALKLYGR WR+I+EHVGTKT +QIRSH
Sbjct  42   SFGSDNVPKVRKPYTITKQREKWTDEEHQRFLEALKLYGRGWRRIQEHVGTKTAVQIRSH  101

Query  449  AQKFFTKVVRDLG  487
            AQK+F+KVVR+ G
Sbjct  102  AQKYFSKVVRESG  114



>ref|XP_010528596.1| PREDICTED: protein REVEILLE 2 [Tarenaya hassleriana]
Length=334

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +2

Query  293  KVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKV  472
            K RKPYTITKQRE+WTEEEH +FV+ALKLYGRAWR I+EHVGTKT +QIRSHAQKFFTKV
Sbjct  32   KARKPYTITKQREKWTEEEHMKFVDALKLYGRAWRCIQEHVGTKTAVQIRSHAQKFFTKV  91

Query  473  VRDLGNDGDGPIEI  514
             RD G   D  IEI
Sbjct  92   ARDCGVTSDESIEI  105



>gb|KHG08399.1| Protein LHY -like protein [Gossypium arboreum]
Length=478

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 113/158 (72%), Gaps = 8/158 (5%)
 Frame = +2

Query  200  SGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKL  379
            SG   S  + + ET+T Q         ++ PKVRKPYTITKQRE+WTEEEHQ+F+EAL+L
Sbjct  18   SGLCCSIGSGQSETLT-QLQELYGFKHDHTPKVRKPYTITKQREKWTEEEHQKFLEALRL  76

Query  380  YGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDG----DGPIEIppprpkkkplh  547
            YGR WR+IEEHVGTKT +QIRSHAQKFF+KV R+  NDG       IEIPPPRPK+KP H
Sbjct  77   YGRGWRQIEEHVGTKTAVQIRSHAQKFFSKVARE-SNDGFESSVKSIEIPPPRPKRKPTH  135

Query  548  pyprkMVDSSKPEMEVLGQSERSPSKMYN-GERDNQSP  658
            PYPRK V + K  +  L Q ERS S  ++  E+DN+SP
Sbjct  136  PYPRKSVTAVK-GISPLSQLERSLSPNHSVSEQDNKSP  172



>gb|ABW22184.1| putative At5g37260-like protein, partial [Solanum chilense]
Length=446

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 68/76 (89%), Gaps = 1/76 (1%)
 Frame = +2

Query  275  GSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQ  454
            G EY PK+RKPYTI+KQRERW++EEH++F+EALKL+GRAWR+IEEHV TKT +QIRSHAQ
Sbjct  23   GEEYAPKIRKPYTISKQRERWSDEEHKKFLEALKLHGRAWRRIEEHVATKTAVQIRSHAQ  82

Query  455  KFFTKVVRDLGNDGDG  502
            KFF+KVVR+  N GD 
Sbjct  83   KFFSKVVRESSN-GDA  97



>gb|EPS61622.1| hypothetical protein M569_13174 [Genlisea aurea]
Length=279

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 62/67 (93%), Gaps = 0/67 (0%)
 Frame = +2

Query  281  EYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKF  460
            E+ PK RKPYTITKQRERW+EEEH RF+EALKL+GRAWRKIEEH+GTKT +QIRSHAQKF
Sbjct  14   EFAPKARKPYTITKQRERWSEEEHSRFLEALKLHGRAWRKIEEHIGTKTAVQIRSHAQKF  73

Query  461  FTKVVRD  481
            F KV+RD
Sbjct  74   FCKVIRD  80



>gb|KFK33315.1| hypothetical protein AALP_AA6G359200 [Arabis alpina]
Length=298

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 102/131 (78%), Gaps = 5/131 (4%)
 Frame = +2

Query  266  SSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRS  445
            SS  + YL K RKPYTITKQRE+WTE EH++FVEALKLYGRAWR+IEEHVGTKT +QIRS
Sbjct  19   SSRDAFYL-KTRKPYTITKQREKWTESEHEKFVEALKLYGRAWRRIEEHVGTKTAVQIRS  77

Query  446  HAQKFFTKVVRDLGNDGDGPIEIppprpkkkplhpyprkMVDSSKPEMEVLGQSERSPSK  625
            HAQKFFTKV RD     +  IEIPPPRPK+KP+HPYPRK+V    P+ + +  +E + +K
Sbjct  78   HAQKFFTKVARDYDVSSEKSIEIPPPRPKRKPMHPYPRKLV---IPDAKEMAYAELTGAK  134

Query  626  MYNGERDNQSP  658
            +   E DN+SP
Sbjct  135  LVPDE-DNRSP  144



>gb|KFK25943.1| hypothetical protein AALP_AA8G183100 [Arabis alpina]
Length=378

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/82 (73%), Positives = 72/82 (88%), Gaps = 3/82 (4%)
 Frame = +2

Query  278  SEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQK  457
            ++Y PKVRKPYTITK+RERWT+EEH++FVEALKLYGRAWR+IEEHVGTKT +QIRSHAQK
Sbjct  35   NDYAPKVRKPYTITKERERWTDEEHKKFVEALKLYGRAWRRIEEHVGTKTAVQIRSHAQK  94

Query  458  FFTKVVRDL-GNDGDG--PIEI  514
            FF+KV R++ G +G    PI I
Sbjct  95   FFSKVAREVTGGNGSSLEPIVI  116



>ref|XP_009382073.1| PREDICTED: protein REVEILLE 1-like [Musa acuminata subsp. malaccensis]
Length=459

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 103/136 (76%), Gaps = 6/136 (4%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S G E  P+VRKPYTITKQRE+WTEEEH +F+EAL+LYGRAWR+IEEH+GTKT +QIRSH
Sbjct  33   SSGEEQAPRVRKPYTITKQREKWTEEEHSKFLEALQLYGRAWRRIEEHIGTKTAVQIRSH  92

Query  449  AQKFFTKVVRDLGNDGD----GPIEIppprpkkkplhpyprkMVDSSKPEM-EVLGQSER  613
            AQKFF+KVVR+ G++        IEIPPPRPK+KPL PYPRK  +SS  E    L Q ER
Sbjct  93   AQKFFSKVVRESGSNDSTVTLKAIEIPPPRPKRKPLRPYPRKSGNSSSKETPAALKQLER  152

Query  614  SPSKMYN-GERDNQSP  658
             P + +   E +N+SP
Sbjct  153  PPLQTHTICEEENRSP  168



>gb|ABH02928.1| MYB transcription factor MYB144 [Glycine max]
Length=114

 Score =   123 bits (309),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  290  PKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTK  469
            PKVRKPYTITKQRE+WTEEEHQ+F+EALKLYGR WR+IEEH+GTK  +QIRSHAQKFF+K
Sbjct  21   PKVRKPYTITKQREKWTEEEHQKFLEALKLYGRGWRQIEEHIGTKNAVQIRSHAQKFFSK  80

Query  470  VVRDLGNDGDGPIE  511
            VVR+     +  I+
Sbjct  81   VVRESEGSAESSIQ  94



>ref|XP_001767701.1| cca1b circadian clock protein CCA1b [Physcomitrella patens]
 gb|EDQ67452.1| cca1b circadian clock protein CCA1b, partial [Physcomitrella 
patens]
Length=142

 Score =   124 bits (311),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 62/64 (97%), Gaps = 0/64 (0%)
 Frame = +2

Query  293  KVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKV  472
            KVRKPYTITKQRERWTEEEHQ+F+EALKLYGRAWR+IEEH+GTKT +QIRSHAQKFF+K+
Sbjct  43   KVRKPYTITKQRERWTEEEHQKFLEALKLYGRAWRRIEEHIGTKTAVQIRSHAQKFFSKI  102

Query  473  VRDL  484
             RD+
Sbjct  103  ERDV  106



>ref|XP_004490782.1| PREDICTED: uncharacterized protein LOC101488702 isoform X1 [Cicer 
arietinum]
Length=427

 Score =   130 bits (327),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/77 (75%), Positives = 68/77 (88%), Gaps = 2/77 (3%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S G +Y  KVRKPYTITKQRERWT+EEH++F+EALKLYGRAWR+IEEHVGTKT +QIRSH
Sbjct  28   SCGDDYALKVRKPYTITKQRERWTDEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSH  87

Query  449  AQKFFTKVVRDLGNDGD  499
            AQKFF+K+ RD   DG+
Sbjct  88   AQKFFSKINRD--TDGN  102



>emb|CCU64195.1| ScMYB43 protein [Saccharum hybrid cultivar Co 86032]
Length=616

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +2

Query  266  SSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRS  445
            +S G E + KVRKPYTITKQRERWTE EH+RF+EALKLYGRAW++IEEHVGTKT +QIRS
Sbjct  31   NSSGEETVVKVRKPYTITKQRERWTEAEHKRFLEALKLYGRAWQRIEEHVGTKTAVQIRS  90

Query  446  HAQKFFTKVVRDLGNDGDGP  505
            HAQKFFTK+ ++  N+G  P
Sbjct  91   HAQKFFTKLEKEAMNNGTSP  110



>ref|XP_009126176.1| PREDICTED: protein REVEILLE 1-like [Brassica rapa]
Length=371

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  284  YLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFF  463
            Y PKVRKPYTITK+RERWT+EEH +FVEALKLYGRAWRKIEEHVGTKT +QIRSHAQKFF
Sbjct  32   YAPKVRKPYTITKERERWTDEEHSKFVEALKLYGRAWRKIEEHVGTKTAVQIRSHAQKFF  91

Query  464  TKVVRD  481
            +KV R+
Sbjct  92   SKVARE  97



>ref|XP_009613641.1| PREDICTED: protein REVEILLE 1-like isoform X2 [Nicotiana tomentosiformis]
Length=478

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 83/119 (70%), Gaps = 6/119 (5%)
 Frame = +2

Query  170  AEAMDQSDGNSGAVSSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEE  349
            AE  DQ       V S + S    +++  G SS+   +   + RK YTI+KQRERWTEEE
Sbjct  4    AEMADQDQSGESGVDS-IRSSWNGISSDVGASSTRSIQLKEQARKAYTISKQRERWTEEE  62

Query  350  HQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLGNDGDG----PIEI  514
            H++F+EA+KLYGRAWR+IEEHVGTKT +QIRSHAQKFF+KVVR+  N GD     PIEI
Sbjct  63   HRKFLEAIKLYGRAWRRIEEHVGTKTAVQIRSHAQKFFSKVVRE-SNSGDASSVKPIEI  120



>ref|XP_007141962.1| hypothetical protein PHAVU_008G240700g [Phaseolus vulgaris]
 gb|ESW13956.1| hypothetical protein PHAVU_008G240700g [Phaseolus vulgaris]
Length=449

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/71 (79%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S G++Y  KVRKPYTITKQRERWT+EEH++F+EALKLYGRAWR+IEEHVGTKT +QIRSH
Sbjct  41   SYGNDYALKVRKPYTITKQRERWTDEEHKKFLEALKLYGRAWRRIEEHVGTKTAVQIRSH  100

Query  449  AQKFFTKVVRD  481
            AQKFF+K+VR+
Sbjct  101  AQKFFSKIVRE  111



>ref|XP_010940231.1| PREDICTED: protein CCA1-like [Elaeis guineensis]
Length=478

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  266  SSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRS  445
            SSL  E+  KVRKPYTITKQRERWTEEEH++F+EALKL+GRAWR+IEEH+GTKT +QIRS
Sbjct  39   SSLVDEHAIKVRKPYTITKQRERWTEEEHEKFLEALKLHGRAWRRIEEHIGTKTAVQIRS  98

Query  446  HAQKFFTKVVRDLG  487
            HAQKFF+KVVR+ G
Sbjct  99   HAQKFFSKVVREPG  112



>emb|CDX85462.1| BnaA02g03510D [Brassica napus]
Length=373

 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 63/67 (94%), Gaps = 0/67 (0%)
 Frame = +2

Query  281  EYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSHAQKF  460
            +Y PKVRKPYTITK+RERWT+EEH +FVEAL+LYGRAWRKIEEHVGTKT +QIRSHAQKF
Sbjct  31   DYAPKVRKPYTITKERERWTDEEHNKFVEALRLYGRAWRKIEEHVGTKTAVQIRSHAQKF  90

Query  461  FTKVVRD  481
            F+KV R+
Sbjct  91   FSKVARE  97



>ref|XP_002452742.1| hypothetical protein SORBIDRAFT_04g031590 [Sorghum bicolor]
 gb|EES05718.1| hypothetical protein SORBIDRAFT_04g031590 [Sorghum bicolor]
Length=455

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 54/71 (76%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  269  SLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVGTKTVIQIRSH  448
            S G E++PK RKPYTITKQRE+WTE+EH+RF+EAL+L+GRAWR+I+EH+GTKT +QIRSH
Sbjct  22   SSGEEHVPKARKPYTITKQREKWTEDEHRRFLEALQLHGRAWRRIQEHIGTKTAVQIRSH  81

Query  449  AQKFFTKVVRD  481
            AQKFFTKVVR+
Sbjct  82   AQKFFTKVVRE  92



>ref|XP_008794529.1| PREDICTED: uncharacterized protein LOC103710542 [Phoenix dactylifera]
Length=524

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 110/144 (76%), Gaps = 4/144 (3%)
 Frame = +2

Query  239  TMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRAWRKIEEHVG  418
            T   Q+   +S G E + KVRKPYTITKQRE+WTEEEH++F+EAL+LYGRAWR+IEE++G
Sbjct  31   TCGLQSNEVTSYGDELIHKVRKPYTITKQREKWTEEEHKKFLEALQLYGRAWRRIEEYIG  90

Query  419  TKTVIQIRSHAQKFFTKVVRD-LGNDGDG--PIEIppprpkkkplhpyprkMVDSSKPEM  589
            TKT +QIRSHAQKFF+KVVR+  GN      PIEIPPPRPK+KPLHPYPRK+  SS   +
Sbjct  91   TKTAVQIRSHAQKFFSKVVRESTGNSACTLQPIEIPPPRPKRKPLHPYPRKLGHSSSKRI  150

Query  590  EVLGQSERSPSKMYNG-ERDNQSP  658
             +L Q E+   ++ +  E++N SP
Sbjct  151  AILKQLEKPSLQIPSANEQENGSP  174



>ref|XP_008812464.1| PREDICTED: protein CCA1-like isoform X1 [Phoenix dactylifera]
Length=513

 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 74/92 (80%), Gaps = 6/92 (7%)
 Frame = +2

Query  212  SSAVNSKVETMTTQAGVSSSLGSEYLPKVRKPYTITKQRERWTEEEHQRFVEALKLYGRA  391
            +SAVNS       Q+   SSL  E   KVRKPYTITKQRERWTEEEH++F+EALKLYGRA
Sbjct  28   TSAVNSH------QSKEFSSLVDELAMKVRKPYTITKQRERWTEEEHEKFLEALKLYGRA  81

Query  392  WRKIEEHVGTKTVIQIRSHAQKFFTKVVRDLG  487
            W +IEEH+GTKT +QIRSHAQKFF+KVVR+ G
Sbjct  82   WPRIEEHIGTKTAVQIRSHAQKFFSKVVREPG  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1049455598775