BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9506

Length=801
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002284920.3|  PREDICTED: sodium/pyruvate cotransporter BAS...    236   4e-71   Vitis vinifera
emb|CAN76830.1|  hypothetical protein VITISV_002026                     235   1e-70   Vitis vinifera
ref|XP_010656384.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    233   5e-70   
ref|XP_008242696.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    232   1e-69   Prunus mume [ume]
ref|XP_010098952.1|  putative sodium-dependent transporter yocS         231   2e-69   
ref|XP_007013300.1|  Transmembrane domain protein isoform 1             227   1e-67   Theobroma cacao [chocolate]
ref|XP_007202174.1|  hypothetical protein PRUPE_ppa006547mg             226   1e-67   Prunus persica
dbj|BAJ16226.1|  sodium-dependent pyruvate transporter                  227   1e-67   Flaveria trinervia
ref|XP_009587110.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    225   7e-67   Nicotiana tomentosiformis
ref|XP_002514369.1|  sodium-bile acid cotransporter, putative           223   2e-66   
ref|NP_001234028.1|  involved in inorganic sulfate assimilation         223   4e-66   
ref|XP_007013301.1|  Sodium Bile acid symporter family isoform 2        219   8e-66   
ref|XP_009800401.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    221   1e-65   Nicotiana sylvestris
ref|XP_008463345.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    221   3e-65   Cucumis melo [Oriental melon]
gb|KHG22637.1|  putative sodium-dependent transporter yocS              220   6e-65   Gossypium arboreum [tree cotton]
ref|XP_004149855.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    219   8e-65   Cucumis sativus [cucumbers]
emb|CDP03385.1|  unnamed protein product                                219   2e-64   Coffea canephora [robusta coffee]
ref|XP_008344090.1|  PREDICTED: LOW QUALITY PROTEIN: sodium/pyruv...    215   2e-64   
ref|XP_011012598.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    218   2e-64   Populus euphratica
gb|KJB64837.1|  hypothetical protein B456_010G067700                    218   3e-64   Gossypium raimondii
ref|XP_009371418.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    216   2e-63   Pyrus x bretschneideri [bai li]
ref|XP_006343176.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    215   4e-63   Solanum tuberosum [potatoes]
gb|ACZ98535.1|  transmembrane domain protein                            215   6e-63   Malus domestica [apple tree]
ref|XP_008354390.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    214   7e-63   
gb|KDO80391.1|  hypothetical protein CISIN_1g014688mg                   213   1e-62   Citrus sinensis [apfelsine]
ref|XP_008386071.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    214   1e-62   
ref|XP_006451036.1|  hypothetical protein CICLE_v10008416mg             213   3e-62   Citrus clementina [clementine]
ref|XP_006475764.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    212   6e-62   Citrus sinensis [apfelsine]
gb|KDO80390.1|  hypothetical protein CISIN_1g014688mg                   212   7e-62   Citrus sinensis [apfelsine]
gb|ABK96238.1|  unknown                                                 212   8e-62   Populus trichocarpa x Populus deltoides
ref|XP_010249921.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    211   1e-61   Nelumbo nucifera [Indian lotus]
ref|XP_010254249.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    211   1e-61   Nelumbo nucifera [Indian lotus]
gb|KCW79752.1|  hypothetical protein EUGRSUZ_C01098                     207   2e-61   Eucalyptus grandis [rose gum]
ref|XP_004287383.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    211   2e-61   Fragaria vesca subsp. vesca
ref|XP_010688119.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    210   3e-61   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010249922.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    209   1e-60   
ref|XP_006829640.1|  PREDICTED: probable sodium/metabolite cotran...    208   2e-60   Amborella trichopoda
ref|XP_010254248.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    207   4e-60   Nelumbo nucifera [Indian lotus]
gb|KJB83147.1|  hypothetical protein B456_013G231400                    204   4e-60   Gossypium raimondii
ref|XP_010047772.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    207   4e-60   Eucalyptus grandis [rose gum]
ref|XP_010557580.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    207   6e-60   Tarenaya hassleriana [spider flower]
gb|KHG10132.1|  putative sodium-dependent transporter yocS              206   8e-60   Gossypium arboreum [tree cotton]
ref|XP_010254250.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    206   9e-60   Nelumbo nucifera [Indian lotus]
gb|KJB83146.1|  hypothetical protein B456_013G231400                    205   1e-59   Gossypium raimondii
ref|XP_004508558.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    205   2e-59   Cicer arietinum [garbanzo]
gb|KJB83144.1|  hypothetical protein B456_013G231400                    205   3e-59   Gossypium raimondii
gb|KJB83143.1|  hypothetical protein B456_013G231400                    204   4e-59   Gossypium raimondii
gb|KJB83145.1|  hypothetical protein B456_013G231400                    204   1e-58   Gossypium raimondii
ref|XP_003609202.1|  Bile acid Na+ symporter family protein             200   2e-57   Medicago truncatula
ref|NP_850089.1|  sodium/pyruvate cotransporter BASS2                   198   1e-56   Arabidopsis thaliana [mouse-ear cress]
gb|AAM18095.1|AF498303_1  putative sodium-dependent bile acid sym...    198   1e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002880845.1|  hypothetical protein ARALYDRAFT_901497             197   2e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_012078691.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    197   2e-56   Jatropha curcas
ref|XP_006411101.1|  hypothetical protein EUTSA_v10016729mg             197   3e-56   Eutrema salsugineum [saltwater cress]
ref|XP_006411100.1|  hypothetical protein EUTSA_v10016729mg             197   4e-56   
ref|XP_010914977.1|  PREDICTED: probable sodium/metabolite cotran...    195   2e-55   Elaeis guineensis
ref|XP_008804047.1|  PREDICTED: probable sodium/metabolite cotran...    194   7e-55   
ref|XP_009387169.1|  PREDICTED: probable sodium/metabolite cotran...    191   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002456043.1|  hypothetical protein SORBIDRAFT_03g029420          191   8e-54   Sorghum bicolor [broomcorn]
ref|XP_003609203.1|  Bile acid Na+ symporter family protein             191   1e-53   
ref|XP_006294303.1|  hypothetical protein CARUB_v10023312mg             190   1e-53   
ref|XP_009387168.1|  PREDICTED: probable sodium/metabolite cotran...    189   2e-53   
ref|XP_009387167.1|  PREDICTED: probable sodium/metabolite cotran...    190   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ88629.1|  predicted protein                                      189   3e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006294304.1|  hypothetical protein CARUB_v10023312mg             189   5e-53   Capsella rubella
emb|CDM83534.1|  unnamed protein product                                188   6e-53   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003569443.1|  PREDICTED: probable sodium/metabolite cotran...    189   6e-53   Brachypodium distachyon [annual false brome]
gb|EMT10994.1|  Putative sodium-dependent transporter yocS              189   7e-53   
gb|EMS55498.1|  putative sodium-dependent transporter yocS              189   1e-52   Triticum urartu
gb|ABK24409.1|  unknown                                                 187   1e-52   Picea sitchensis
ref|XP_009403017.1|  PREDICTED: probable sodium/metabolite cotran...    186   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009403016.1|  PREDICTED: probable sodium/metabolite cotran...    186   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006644431.1|  PREDICTED: probable sodium/metabolite cotran...    185   1e-51   Oryza brachyantha
gb|AAT68201.1|  unknown                                                 178   3e-51   Cynodon dactylon
ref|XP_009141764.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    183   5e-51   Brassica rapa
ref|XP_011081192.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    184   5e-51   Sesamum indicum [beniseed]
ref|NP_001043701.1|  Os01g0645200                                       182   9e-51   
ref|XP_003524523.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    182   1e-50   Glycine max [soybeans]
ref|XP_006600768.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    181   3e-50   Glycine max [soybeans]
gb|EYU30455.1|  hypothetical protein MIMGU_mgv1a005885mg                182   3e-50   Erythranthe guttata [common monkey flower]
ref|XP_006600767.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    182   4e-50   
ref|XP_006371928.1|  hypothetical protein POPTR_0018s06390g             173   2e-49   
emb|CDX74891.1|  BnaA05g06370D                                          179   2e-49   
emb|CDX93303.1|  BnaC04g45930D                                          179   2e-49   
gb|EPS58359.1|  hypothetical protein M569_16455                         176   5e-49   Genlisea aurea
emb|CDY18367.1|  BnaA04g22200D                                          177   8e-49   Brassica napus [oilseed rape]
ref|XP_009143363.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    177   2e-48   Brassica rapa
emb|CDX91487.1|  BnaC04g06630D                                          175   9e-48   
ref|XP_010510842.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    174   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010417834.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    173   4e-47   Camelina sativa [gold-of-pleasure]
ref|XP_007154938.1|  hypothetical protein PHAVU_003G159600g             172   1e-46   Phaseolus vulgaris [French bean]
ref|XP_010541878.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    172   1e-46   Tarenaya hassleriana [spider flower]
ref|XP_010541881.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    171   1e-46   Tarenaya hassleriana [spider flower]
ref|XP_010541879.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    171   1e-46   Tarenaya hassleriana [spider flower]
ref|XP_010541877.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    172   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_010541880.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    170   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_010541876.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    172   2e-46   Tarenaya hassleriana [spider flower]
ref|XP_004969305.1|  PREDICTED: probable sodium/metabolite cotran...    169   1e-45   Setaria italica
ref|XP_001775120.1|  predicted protein                                  166   8e-45   
ref|XP_002975058.1|  hypothetical protein SELMODRAFT_174757             165   5e-44   Selaginella moellendorffii
ref|XP_006371924.1|  hypothetical protein POPTR_0018s06390g             153   1e-42   
gb|AAC32250.1|  putative Na+ dependent ileal bile acid transporter      155   5e-41   Arabidopsis thaliana [mouse-ear cress]
gb|KJB64838.1|  hypothetical protein B456_010G067700                    152   7e-40   Gossypium raimondii
ref|XP_010474527.1|  PREDICTED: sodium/pyruvate cotransporter BAS...    147   4e-38   
ref|XP_006371925.1|  hypothetical protein POPTR_0018s06390g             137   1e-36   
ref|XP_006371923.1|  hypothetical protein POPTR_0018s06390g             136   2e-36   
ref|XP_005650028.1|  SBF-domain-containing protein                      125   5e-30   Coccomyxa subellipsoidea C-169
gb|AAO41972.1|  putative Na+ dependent ileal bile acid transporter      103   2e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002974205.1|  hypothetical protein SELMODRAFT_232260             101   1e-21   
ref|XP_003080041.1|  Na+-bile acid cotransporter (ISS)                87.4    2e-16   
gb|KJB83150.1|  hypothetical protein B456_013G231700                  82.4    2e-16   Gossypium raimondii
emb|CEF98497.1|  Bile acid:sodium symporter                           87.4    3e-16   Ostreococcus tauri
ref|WP_009454312.1|  MULTISPECIES: transporter                        85.5    6e-16   Fischerella thermalis
ref|XP_010273395.1|  PREDICTED: probable sodium/metabolite cotran...  86.3    8e-16   Nelumbo nucifera [Indian lotus]
ref|WP_012376899.1|  transporter                                      84.7    8e-16   Opitutus terrae
ref|XP_009602137.1|  PREDICTED: probable sodium/metabolite cotran...  85.1    2e-15   Nicotiana tomentosiformis
ref|XP_006371927.1|  hypothetical protein POPTR_0018s06390g           80.1    2e-15   
ref|XP_008384767.1|  PREDICTED: probable sodium/metabolite cotran...  82.8    2e-15   
emb|CDP06062.1|  unnamed protein product                              84.3    3e-15   Coffea canephora [robusta coffee]
ref|XP_006371926.1|  hypothetical protein POPTR_0018s06390g           80.9    3e-15   
emb|CDX88454.1|  BnaC06g38980D                                        84.0    4e-15   
ref|XP_006367653.1|  PREDICTED: probable sodium/metabolite cotran...  84.0    5e-15   Solanum tuberosum [potatoes]
ref|XP_004251493.1|  PREDICTED: probable sodium/metabolite cotran...  83.2    7e-15   
emb|CDX86868.1|  BnaA09g22580D                                        83.2    8e-15   
emb|CDY52433.1|  BnaA07g39100D                                        82.8    8e-15   Brassica napus [oilseed rape]
ref|XP_009765749.1|  PREDICTED: probable sodium/metabolite cotran...  83.2    9e-15   Nicotiana sylvestris
ref|XP_008363646.1|  PREDICTED: probable sodium/metabolite cotran...  82.8    1e-14   
ref|XP_010644063.1|  PREDICTED: probable sodium/metabolite cotran...  82.8    1e-14   
gb|KFK42231.1|  hypothetical protein AALP_AA2G228600                  82.4    1e-14   Arabis alpina [alpine rockcress]
ref|XP_008226350.1|  PREDICTED: probable sodium/metabolite cotran...  82.8    1e-14   Prunus mume [ume]
ref|XP_005824633.1|  hypothetical protein GUITHDRAFT_144786           82.8    2e-14   Guillardia theta CCMP2712
ref|XP_005648900.1|  BASS family transporter: sodium ion/bile acid    81.6    2e-14   Coccomyxa subellipsoidea C-169
gb|EYU38235.1|  hypothetical protein MIMGU_mgv1a007506mg              82.0    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_010098229.1|  putative sodium-dependent transporter yocS       82.0    2e-14   
ref|WP_010568485.1|  transporter                                      80.9    2e-14   Leptospira broomii
ref|XP_009106563.1|  PREDICTED: probable sodium/metabolite cotran...  81.6    2e-14   Brassica rapa
gb|KHG18566.1|  putative sodium-dependent transporter yocS            81.6    3e-14   Gossypium arboreum [tree cotton]
ref|WP_044134750.1|  bile acid transporter family protein             80.1    3e-14   
ref|XP_006389975.1|  hypothetical protein EUTSA_v10018656mg           81.6    3e-14   Eutrema salsugineum [saltwater cress]
ref|XP_006301266.1|  hypothetical protein CARUB_v10021666mg           81.3    3e-14   Capsella rubella
ref|XP_008463794.1|  PREDICTED: LOW QUALITY PROTEIN: probable sod...  81.3    3e-14   Cucumis melo [Oriental melon]
ref|XP_005832174.1|  hypothetical protein GUITHDRAFT_108836           80.5    4e-14   Guillardia theta CCMP2712
ref|XP_004146013.1|  PREDICTED: probable sodium/metabolite cotran...  80.9    4e-14   Cucumis sativus [cucumbers]
ref|XP_009344611.1|  PREDICTED: probable sodium/metabolite cotran...  80.9    6e-14   Pyrus x bretschneideri [bai li]
ref|XP_002960410.1|  hypothetical protein SELMODRAFT_164064           80.5    6e-14   
ref|XP_007149504.1|  hypothetical protein PHAVU_005G0758000g          77.4    1e-13   Phaseolus vulgaris [French bean]
gb|KJB12927.1|  hypothetical protein B456_002G045800                  79.7    1e-13   Gossypium raimondii
ref|WP_002998741.1|  sodium Bile acid symporter family protein        78.6    1e-13   Leptospira weilii
gb|EMO25867.1|  sodium Bile acid symporter domain protein             76.3    1e-13   Leptospira interrogans serovar Bataviae str. HAI135
gb|KDO41538.1|  hypothetical protein CISIN_1g014898mg                 79.7    1e-13   Citrus sinensis [apfelsine]
ref|XP_006477810.1|  PREDICTED: probable sodium/metabolite cotran...  79.7    1e-13   Citrus sinensis [apfelsine]
ref|WP_002179802.1|  sodium Bile acid symporter family protein        78.2    2e-13   Leptospira noguchii
ref|WP_010409753.1|  transporter                                      78.6    2e-13   Leptospira inadai
ref|WP_017213483.1|  transporter                                      78.2    2e-13   Leptospira noguchii
ref|XP_004968299.1|  PREDICTED: probable sodium/metabolite cotran...  79.0    2e-13   Setaria italica
ref|XP_008368370.1|  PREDICTED: LOW QUALITY PROTEIN: probable sod...  79.0    2e-13   
ref|XP_010694752.1|  PREDICTED: probable sodium/metabolite cotran...  79.0    3e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004982573.1|  PREDICTED: probable sodium/metabolite cotran...  78.6    3e-13   Setaria italica
ref|XP_006853461.1|  PREDICTED: probable sodium/metabolite cotran...  78.6    3e-13   Amborella trichopoda
ref|WP_018047033.1|  hypothetical protein                             77.4    4e-13   
ref|XP_003077930.1|  bile acid:sodium symporter family protein (ISS)  77.8    4e-13   
ref|WP_040851682.1|  transporter                                      77.0    4e-13   Nitrosospira lacus
ref|NP_565182.1|  sodium Bile acid symporter family                   78.2    4e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006442338.1|  hypothetical protein CICLE_v10020318mg           78.2    4e-13   Citrus clementina [clementine]
ref|WP_032810125.1|  MULTISPECIES: transporter                        77.0    4e-13   Leptospira
ref|XP_010417455.1|  PREDICTED: probable sodium/metabolite cotran...  78.2    4e-13   Camelina sativa [gold-of-pleasure]
emb|CEF96953.1|  Bile acid:sodium symporter                           77.0    4e-13   Ostreococcus tauri
ref|WP_004446543.1|  sodium Bile acid symporter family protein        77.0    4e-13   Leptospira noguchii
ref|XP_010472685.1|  PREDICTED: probable sodium/metabolite cotran...  75.5    4e-13   
ref|WP_004428403.1|  sodium Bile acid symporter family protein        77.0    5e-13   Leptospira noguchii
ref|WP_032919300.1|  transporter                                      77.0    5e-13   Leptospira santarosai
ref|WP_026131306.1|  transporter                                      77.0    5e-13   Leptospira santarosai
ref|WP_040082892.1|  sodium transporter                               77.0    5e-13   Bacillus
ref|WP_014664271.1|  sodium transporter                               77.0    5e-13   Bacillus sp. JS
ref|WP_004435694.1|  sodium Bile acid symporter family protein        76.6    6e-13   Leptospira noguchii
ref|XP_010062765.1|  PREDICTED: probable sodium/metabolite cotran...  77.8    6e-13   Eucalyptus grandis [rose gum]
ref|XP_004488981.1|  PREDICTED: probable sodium/metabolite cotran...  77.4    6e-13   Cicer arietinum [garbanzo]
ref|XP_006377710.1|  hypothetical protein POPTR_0011s10450g           75.9    6e-13   
ref|WP_004426040.1|  transporter                                      76.6    6e-13   Leptospira noguchii
ref|XP_005538599.1|  probable sodium-dependent transporter            77.4    8e-13   Cyanidioschyzon merolae strain 10D
ref|WP_038170766.1|  bile acid transporter family protein             76.6    8e-13   Verrucomicrobium sp. BvORR106
ref|WP_025041403.1|  transporter                                      76.3    8e-13   Nitrosospira briensis
ref|WP_019258653.1|  sodium transporter                               76.3    8e-13   Bacillus subtilis
dbj|BAK05955.1|  predicted protein                                    77.0    8e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002464355.1|  hypothetical protein SORBIDRAFT_01g016820        77.0    9e-13   Sorghum bicolor [broomcorn]
ref|WP_010579217.1|  transporter                                      76.3    1e-12   Leptospira alexanderi
ref|WP_003241646.1|  sodium-dependent transporter                     76.3    1e-12   Bacillus subtilis
ref|WP_024715378.1|  sodium transporter                               76.3    1e-12   Bacillus tequilensis
ref|WP_004764442.1|  sodium Bile acid symporter family protein        75.9    1e-12   Leptospira kirschneri
ref|WP_020985373.1|  sodium Bile acid symporter family protein        75.9    1e-12   Leptospira kmetyi
ref|XP_003572442.1|  PREDICTED: probable sodium/metabolite cotran...  76.6    1e-12   
ref|WP_020766540.1|  sodium Bile acid symporter family protein        75.9    1e-12   Leptospira
ref|WP_004780689.1|  sodium Bile acid symporter family protein        75.9    1e-12   Leptospira kirschneri
ref|WP_004454588.1|  sodium Bile acid symporter family protein        75.5    1e-12   Leptospira noguchii
ref|WP_032927139.1|  transporter                                      75.9    1e-12   Leptospira santarosai
ref|WP_026053809.1|  transporter                                      75.9    1e-12   Leptospira santarosai
ref|WP_004448575.1|  sodium Bile acid symporter family protein        75.5    1e-12   Leptospira noguchii
ref|WP_032920941.1|  transporter                                      75.5    2e-12   Leptospira santarosai
ref|WP_016551297.1|  sodium Bile acid symporter family protein        75.5    2e-12   Leptospira fainei
ref|WP_026053546.1|  transporter                                      75.5    2e-12   Leptospira santarosai
ref|XP_007022022.1|  Sodium Bile acid symporter family isoform 2      75.9    2e-12   
gb|KHN36938.1|  Putative sodium-dependent transporter yocS            76.3    2e-12   Glycine soja [wild soybean]
ref|WP_017697159.1|  sodium transporter                               75.5    2e-12   Bacillus subtilis
ref|WP_015383869.1|  putative sodium-dependent transporter            75.1    2e-12   Bacillus subtilis
ref|WP_038829949.1|  sodium transporter                               74.7    2e-12   Bacillus subtilis
ref|WP_043857674.1|  sodium transporter                               75.1    2e-12   
ref|WP_041351149.1|  sodium transporter                               75.1    2e-12   Bacillus subtilis
ref|WP_014480025.1|  hypothetical protein                             75.1    2e-12   Bacillus
ref|WP_021481467.1|  sodium transporter                               75.1    2e-12   Bacillus subtilis
ref|WP_038429129.1|  sodium transporter                               75.1    2e-12   Bacillus subtilis
ref|WP_020158510.1|  transporter                                      75.5    2e-12   Methylobacter marinus
ref|WP_041053957.1|  sodium transporter                               75.1    2e-12   Bacillus subtilis
ref|XP_009376715.1|  PREDICTED: probable sodium/metabolite cotran...  76.3    2e-12   Pyrus x bretschneideri [bai li]
ref|WP_024572776.1|  sodium transporter                               75.1    2e-12   Bacillus
ref|WP_004399225.1|  MULTISPECIES: sodium transporter                 75.1    2e-12   Bacillales
ref|WP_000448528.1|  Sodium-dependent transporter                     75.1    2e-12   Leptospira interrogans
ref|XP_009376713.1|  PREDICTED: probable sodium/metabolite cotran...  76.3    2e-12   Pyrus x bretschneideri [bai li]
ref|WP_014477076.1|  sodium transporter                               75.1    2e-12   Bacillus subtilis
ref|XP_001752354.1|  predicted protein                                75.5    2e-12   
ref|WP_019712212.1|  sodium transporter                               75.1    2e-12   Bacillus
ref|WP_032725977.1|  sodium transporter                               75.1    2e-12   Bacillus subtilis
ref|WP_041514441.1|  transporter                                      74.7    3e-12   Nitrosospira sp. NpAV
gb|AFQ57875.1|  Putative sodium-dependent transporter                 75.1    3e-12   Bacillus subtilis QB928
ref|XP_010537693.1|  PREDICTED: probable sodium/metabolite cotran...  75.9    3e-12   Tarenaya hassleriana [spider flower]
ref|WP_029726822.1|  sodium transporter                               75.1    3e-12   Bacillus
ref|XP_007022021.1|  Sodium Bile acid symporter family isoform 1      75.9    3e-12   
gb|KJJ42428.1|  sodium transporter                                    74.7    3e-12   Bacillus subtilis
ref|XP_002889199.1|  bile acid:sodium symporter family protein        75.5    3e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_005827510.1|  hypothetical protein GUITHDRAFT_75425            75.5    3e-12   Guillardia theta CCMP2712
ref|WP_045384460.1|  sodium transporter                               75.1    3e-12   
ref|WP_036243826.1|  transporter                                      74.3    3e-12   
ref|WP_041906927.1|  sodium transporter                               74.7    3e-12   
ref|XP_011006844.1|  PREDICTED: probable sodium/metabolite cotran...  75.5    3e-12   Populus euphratica
ref|WP_003220128.1|  sodium transporter                               74.7    4e-12   Bacillus subtilis
ref|XP_003543183.1|  PREDICTED: probable sodium/metabolite cotran...  75.5    4e-12   Glycine max [soybeans]
ref|XP_010429683.1|  PREDICTED: probable sodium/metabolite cotran...  75.1    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_009392828.1|  PREDICTED: probable sodium/metabolite cotran...  75.1    5e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|WP_044445279.1|  sodium transporter                               74.3    5e-12   
ref|WP_036247339.1|  transporter                                      74.3    5e-12   Methylobacter sp. BBA5.1
ref|WP_017365455.1|  transporter                                      74.3    5e-12   Methylococcus capsulatus
ref|WP_016753439.1|  transporter                                      73.9    5e-12   Leptospira kirschneri
ref|WP_004756245.1|  transporter                                      73.9    5e-12   Leptospira kirschneri
ref|WP_002101302.1|  sodium Bile acid symporter family protein        73.9    6e-12   Leptospira interrogans
ref|WP_000448522.1|  transporter                                      73.9    6e-12   Leptospira interrogans
ref|WP_000448523.1|  transporter                                      73.9    6e-12   Leptospira interrogans
ref|WP_016560727.1|  sodium Bile acid symporter family protein        73.9    6e-12   Leptospira kirschneri
ref|WP_017853737.1|  transporter                                      73.9    6e-12   Leptospira interrogans
ref|WP_000448524.1|  transporter                                      73.9    6e-12   Leptospira interrogans
ref|WP_020762608.1|  sodium Bile acid symporter family protein        73.9    6e-12   Leptospira kirschneri
ref|WP_045193578.1|  transporter                                      73.9    7e-12   Leptospira interrogans
ref|WP_000448527.1|  Sodium-dependent transporter                     73.9    7e-12   Leptospira interrogans
ref|WP_004757679.1|  sodium Bile acid symporter family protein        73.9    7e-12   Leptospira kirschneri
ref|WP_020779210.1|  sodium Bile acid symporter family protein        73.6    7e-12   Leptospira kirschneri
gb|EMP08026.1|  sodium Bile acid symporter family protein             72.4    7e-12   Leptospira interrogans serovar Pyrogenes str. 200701872
ref|WP_002624984.1|  sodium Bile acid symporter family protein        73.6    7e-12   Leptospira weilii
ref|WP_004495214.1|  MULTISPECIES: transporter                        73.6    7e-12   Leptospira
ref|XP_011082810.1|  PREDICTED: probable sodium/metabolite cotran...  74.3    7e-12   Sesamum indicum [beniseed]
ref|XP_002531245.1|  sodium-bile acid cotransporter, putative         74.3    8e-12   Ricinus communis
ref|WP_024123849.1|  bile acid:Na+ symporter (BASS) family            73.6    8e-12   Thermosynechococcus sp. NK55a
ref|WP_016751618.1|  transporter                                      73.6    9e-12   Leptospira kirschneri
ref|XP_002967310.1|  hypothetical protein SELMODRAFT_23490            73.6    9e-12   
ref|WP_004772068.1|  sodium Bile acid symporter family protein        73.6    9e-12   Leptospira kirschneri
ref|WP_014114087.1|  sodium transporter                               73.6    1e-11   Bacillus
ref|WP_019714642.1|  sodium transporter                               73.2    1e-11   Bacillus subtilis
ref|WP_003231236.1|  sodium transporter                               73.2    1e-11   Bacillus
ref|WP_002768994.1|  transporter                                      73.2    1e-11   Leptonema illini
ref|WP_033884551.1|  sodium transporter                               73.2    1e-11   
ref|WP_032730396.1|  sodium transporter                               73.2    1e-11   Bacillus subtilis
ref|WP_017850257.1|  transporter                                      73.2    1e-11   Leptospira interrogans
ref|WP_000448526.1|  Sodium-dependent transporter                     72.8    1e-11   
ref|XP_010929025.1|  PREDICTED: probable sodium/metabolite cotran...  73.6    1e-11   Elaeis guineensis
ref|XP_008789759.1|  PREDICTED: probable sodium/metabolite cotran...  73.6    1e-11   Phoenix dactylifera
ref|WP_000448519.1|  Sodium-dependent transporter                     72.8    2e-11   Leptospira interrogans
ref|WP_018969825.1|  hypothetical protein                             72.8    2e-11   Rubritalea marina
ref|WP_000448517.1|  Sodium-dependent transporter                     72.8    2e-11   Leptospira interrogans
ref|WP_002749670.1|  sodium Bile acid symporter family protein        72.4    2e-11   Leptospira mayottensis
ref|WP_000448520.1|  transporter                                      72.4    2e-11   Leptospira interrogans
ref|WP_001972505.1|  sodium Bile acid symporter family protein        72.4    2e-11   Leptospira interrogans
ref|WP_004506848.1|  sodium Bile acid symporter family protein        72.4    2e-11   Leptospira weilii
ref|XP_004294172.1|  PREDICTED: probable sodium/metabolite cotran...  73.2    2e-11   
gb|ABB74933.1|  Bile acid:sodium symporter                            72.8    2e-11   
ref|WP_028462011.1|  transporter                                      72.4    2e-11   
ref|WP_013966914.1|  transporter                                      72.0    2e-11   
ref|WP_010331306.1|  sodium transporter                               72.0    3e-11   
ref|XP_011396657.1|  putative sodium-dependent transporter YocS       72.0    3e-11   
dbj|BAG87453.1|  unnamed protein product                              71.2    3e-11   
ref|WP_036296549.1|  transporter                                      72.0    3e-11   
ref|XP_001418553.1|  BASS family transporter: sodium ion/bile acid    71.6    3e-11   
gb|EPS66417.1|  hypothetical protein M569_08357                       72.0    3e-11   
ref|WP_028462006.1|  transporter                                      71.6    3e-11   
gb|EPG56038.1|  sodium Bile acid symporter family protein             71.6    3e-11   
ref|WP_032850925.1|  transporter                                      71.6    4e-11   
ref|XP_012087613.1|  PREDICTED: probable sodium/metabolite cotran...  72.4    4e-11   
ref|WP_010961127.1|  transporter                                      71.6    4e-11   
ref|WP_002732116.1|  sodium Bile acid symporter family protein        71.6    4e-11   
ref|WP_002765848.1|  MULTISPECIES: sodium Bile acid symporter fam...  71.6    4e-11   
gb|EMK13775.1|  sodium Bile acid symporter family protein             71.2    5e-11   
gb|EKQ93436.1|  sodium Bile acid symporter family protein             71.2    5e-11   
ref|XP_006652126.1|  PREDICTED: probable sodium/metabolite cotran...  72.0    5e-11   
gb|EKP11734.1|  sodium Bile acid symporter family protein             71.6    5e-11   
gb|KEH38546.1|  sodium bile acid symporter family protein             72.4    5e-11   
ref|WP_026579553.1|  MULTISPECIES: sodium transporter                 71.2    5e-11   
ref|WP_040209279.1|  MULTISPECIES: sodium transporter                 71.2    5e-11   
ref|WP_023857353.1|  sodium transporter                               71.2    6e-11   
ref|WP_020451818.1|  putative sodium-dependent transporter YocS       71.2    6e-11   
ref|XP_008664744.1|  PREDICTED: probable sodium/metabolite cotran...  70.9    6e-11   
ref|WP_036041348.1|  transporter                                      71.2    6e-11   
ref|WP_003466662.1|  bile acid/sodium symporter (BASS) family pro...  71.2    6e-11   
ref|WP_026798871.1|  sodium transporter                               71.2    6e-11   
gb|EMJ96811.1|  sodium Bile acid symporter family protein             70.9    6e-11   
ref|WP_036704258.1|  sodium transporter                               70.9    7e-11   
emb|CAN78610.1|  hypothetical protein VITISV_026295                   72.0    7e-11   
gb|EEE60873.1|  hypothetical protein OsJ_14528                        71.2    7e-11   
ref|WP_040508579.1|  transporter                                      70.9    8e-11   
ref|XP_005716654.1|  sodium-dependent transporter                     71.2    9e-11   
ref|WP_039074179.1|  sodium transporter                               70.5    9e-11   
gb|EPG65864.1|  sodium Bile acid symporter family protein             70.5    9e-11   
ref|XP_005704853.1|  bile acid:Na+ symporter, BASS family             71.2    9e-11   
ref|WP_026587473.1|  sodium transporter                               70.5    1e-10   
ref|WP_000448525.1|  transporter                                      70.5    1e-10   
ref|WP_029418394.1|  sodium transporter                               70.5    1e-10   
ref|NP_001052601.1|  Os04g0381100                                     70.9    1e-10   
emb|CAH66374.1|  OSIGBa0092E09.1                                      70.9    1e-10   
ref|XP_002983351.1|  hypothetical protein SELMODRAFT_45175            70.1    1e-10   
gb|AII45896.1|  hypothetical protein KR49_05425                       70.1    1e-10   
ref|WP_041056023.1|  sodium transporter                               69.7    2e-10   
ref|XP_003539630.2|  PREDICTED: probable sodium/metabolite cotran...  70.5    2e-10   
gb|ENW88611.1|  hypothetical protein F905_02317                       69.7    2e-10   
ref|WP_034598041.1|  MULTISPECIES: sodium transporter                 69.7    2e-10   
ref|WP_043696840.1|  sodium dependent transporter                     69.7    2e-10   
ref|WP_045796560.1|  sodium transporter                               69.7    2e-10   
ref|WP_043928046.1|  sodium transporter                               69.7    2e-10   
ref|WP_003182690.1|  MULTISPECIES: sodium transporter                 69.7    2e-10   
ref|XP_007509244.1|  bile acid:sodium symporter                       70.1    2e-10   
ref|WP_008105034.1|  transporter                                      69.3    3e-10   
ref|WP_024984011.1|  sodium transporter                               69.3    3e-10   
ref|WP_045511319.1|  sodium transporter                               69.3    3e-10   
ref|WP_041352498.1|  transporter                                      69.3    3e-10   
ref|WP_003389831.1|  bile acid:sodium symporter                       69.3    3e-10   
ref|WP_019149366.1|  hypothetical protein                             69.3    3e-10   
ref|WP_035744509.1|  sodium transporter                               68.9    3e-10   
ref|WP_036576976.1|  sodium transporter                               68.9    3e-10   
ref|XP_007149507.1|  hypothetical protein PHAVU_005G076100g           69.7    3e-10   
ref|WP_035711678.1|  sodium transporter                               68.6    4e-10   
ref|WP_024728245.1|  sodium transporter                               68.9    4e-10   
dbj|BAD79350.1|  sodium-dependent transporter                         68.6    5e-10   
ref|WP_017841091.1|  transporter                                      68.6    5e-10   
ref|WP_022261157.1|  bile acid transporter                            68.6    5e-10   
ref|WP_011377543.1|  MULTISPECIES: transporter                        68.6    5e-10   
ref|WP_015683030.1|  sodium Bile acid symporter family protein        68.6    5e-10   
ref|WP_014150060.1|  transporter                                      68.2    6e-10   
ref|WP_045865569.1|  Bile acid:sodium symporter                       68.2    6e-10   
ref|WP_019547113.1|  Na+-dependent transporter                        68.6    6e-10   
ref|WP_043072375.1|  sodium transporter                               68.2    6e-10   
ref|WP_043068710.1|  sodium transporter                               68.2    7e-10   
ref|WP_006566015.1|  sodium transporter                               68.2    7e-10   
ref|WP_026437271.1|  sodium transporter                               68.2    7e-10   
ref|WP_035250461.1|  bile acid:sodium symporter                       68.2    7e-10   
ref|WP_024121728.1|  sodium transporter                               68.2    8e-10   
ref|WP_021622279.1|  bile acid transporter                            68.2    8e-10   
ref|WP_028550558.1|  sodium transporter                               67.8    9e-10   
gb|EYU40662.1|  hypothetical protein MIMGU_mgv1a006964mg              68.2    9e-10   
ref|WP_042250691.1|  sodium:bile acid symporter                       67.8    1e-09   
gb|EPR27620.1|  Transporter, Sodium/bile acid symporter family pr...  65.1    1e-09   
gb|KHN19475.1|  Putative sodium-dependent transporter yocS            67.8    1e-09   
ref|WP_000448529.1|  Sodium-dependent transporter                     67.4    1e-09   
ref|WP_016936605.1|  sodium transporter                               67.4    1e-09   
ref|WP_031379030.1|  sodium transporter                               67.4    1e-09   
ref|WP_045926167.1|  sodium transporter                               67.4    1e-09   
ref|WP_018932961.1|  sodium transporter                               67.4    1e-09   
ref|WP_003325795.1|  MULTISPECIES: sodium transporter                 67.4    1e-09   
ref|WP_002980721.1|  sodium Bile acid symporter family protein        67.4    1e-09   
ref|WP_010788926.1|  Sodium-dependent transporter                     67.4    1e-09   
ref|WP_016909623.1|  Na+-dependent transporter                        67.4    2e-09   
ref|WP_029761260.1|  sodium transporter                               67.0    2e-09   
ref|WP_044742882.1|  sodium transporter                               67.0    2e-09   
ref|WP_013648053.1|  transporter                                      66.6    2e-09   
ref|WP_014470300.1|  MULTISPECIES: sodium transporter                 67.0    2e-09   
ref|XP_010242296.1|  PREDICTED: probable sodium/metabolite cotran...  67.0    2e-09   
ref|WP_013352530.1|  sodium transporter                               66.6    2e-09   
ref|WP_044156834.1|  sodium transporter                               66.6    2e-09   
ref|WP_014279545.1|  sodium transporter                               66.6    2e-09   
ref|WP_017434233.1|  sodium transporter                               66.2    3e-09   
ref|XP_005851737.1|  hypothetical protein CHLNCDRAFT_10632            66.2    3e-09   
ref|WP_009288917.1|  sodium transporter                               66.2    3e-09   
ref|WP_034291949.1|  bile acid:sodium symporter                       66.2    4e-09   
ref|WP_042503076.1|  sodium dependent transporter                     66.2    4e-09   
ref|WP_038563185.1|  sodium transporter                               66.2    4e-09   
gb|KJB10834.1|  hypothetical protein B456_001G228400                  66.2    4e-09   
ref|XP_002263202.1|  PREDICTED: probable sodium/metabolite cotran...  66.2    4e-09   
ref|WP_042220616.1|  sodium transporter                               65.9    4e-09   
gb|KDD76520.1|  sodium Bile acid symporter                            66.2    5e-09   
ref|WP_024007303.1|  sodium transporter                               65.9    5e-09   
ref|WP_035232140.1|  bile acid:sodium symporter                       65.5    5e-09   
emb|CAE07150.1|  Sodium/bile acid cotransporter family                66.2    5e-09   
ref|WP_010334581.1|  sodium transporter                               65.9    5e-09   
gb|KJB10835.1|  hypothetical protein B456_001G228400                  65.9    5e-09   
ref|XP_010914978.1|  PREDICTED: probable sodium/metabolite cotran...  65.9    5e-09   
ref|WP_025372147.1|  sodium transporter                               65.5    6e-09   
ref|WP_037731834.1|  hypothetical protein                             65.5    6e-09   
ref|WP_003153767.1|  sodium transporter                               65.5    6e-09   
ref|WP_032866238.1|  MULTISPECIES: sodium transporter                 65.5    6e-09   
ref|WP_029974244.1|  MULTISPECIES: sodium transporter                 65.5    6e-09   
ref|WP_007407974.1|  MULTISPECIES: sodium transporter                 65.5    6e-09   
ref|WP_020770041.1|  sodium Bile acid symporter family protein        65.5    6e-09   
ref|WP_015388118.1|  sodium transporter                               65.5    6e-09   
ref|WP_014418117.1|  MULTISPECIES: sodium transporter                 65.5    6e-09   
ref|WP_043867204.1|  sodium transporter                               65.5    6e-09   
ref|WP_032857905.1|  sodium transporter                               65.5    6e-09   
ref|WP_042380791.1|  sodium transporter                               65.5    6e-09   
ref|WP_020279325.1|  MULTISPECIES: sodium-dependent transporter yocS  65.5    6e-09   
ref|WP_027445370.1|  sodium transporter                               65.5    6e-09   
ref|WP_017417964.1|  MULTISPECIES: sodium transporter                 65.5    7e-09   
ref|WP_044053336.1|  sodium transporter                               65.5    7e-09   
ref|WP_037852465.1|  Bile acid:sodium symporter                       65.5    7e-09   
ref|XP_010678956.1|  PREDICTED: probable sodium/metabolite cotran...  65.9    7e-09   
ref|WP_008880099.1|  MULTISPECIES: sodium transporter                 65.1    8e-09   
gb|ABR17845.1|  unknown                                               65.5    8e-09   
gb|KKB74971.1|  sodium transporter                                    65.1    8e-09   
ref|WP_026412301.1|  hypothetical protein                             63.2    9e-09   
ref|XP_005717770.1|  unnamed protein product                          65.5    9e-09   
ref|WP_008588953.1|  transporter                                      65.1    9e-09   
ref|WP_029574421.1|  sodium transporter                               65.1    1e-08   
ref|WP_033843810.1|  sodium transporter                               64.7    1e-08   
ref|WP_031409307.1|  sodium transporter                               64.7    1e-08   
ref|WP_040255022.1|  Bile acid:sodium symporter                       64.7    1e-08   
ref|WP_017814229.1|  sodium transporter                               64.7    1e-08   
ref|WP_020955934.1|  putative sodium-dependent transporter            64.7    1e-08   
ref|WP_044738840.1|  sodium transporter                               64.7    1e-08   
ref|WP_025284856.1|  sodium transporter                               64.7    1e-08   
ref|WP_022553226.1|  MULTISPECIES: Solute carrier family 10 member 6  64.7    1e-08   
ref|WP_004839785.1|  sodium transporter                               64.7    1e-08   
ref|WP_037986347.1|  sodium transporter                               64.7    1e-08   
ref|WP_007428556.1|  sodium transporter                               64.7    1e-08   
ref|WP_039270345.1|  sodium transporter                               64.3    1e-08   
ref|WP_044802218.1|  sodium transporter                               64.3    1e-08   
ref|WP_029515995.1|  sodium transporter                               64.3    1e-08   
ref|WP_013308549.1|  sodium transporter                               64.3    1e-08   
ref|WP_007611964.1|  MULTISPECIES: sodium transporter                 64.3    2e-08   
gb|AFM13629.1|  Bile acid:sodium symporter                            64.3    2e-08   
ref|WP_002119155.1|  MULTISPECIES: sodium Bile acid symporter fam...  64.3    2e-08   
ref|XP_005847384.1|  hypothetical protein CHLNCDRAFT_134211           63.5    2e-08   
ref|WP_042347094.1|  sodium transporter                               64.3    2e-08   
ref|WP_019767341.1|  MULTISPECIES: sodium transporter                 63.9    2e-08   
ref|WP_041949425.1|  hypothetical protein                             63.9    2e-08   
ref|WP_007015037.1|  transporter                                      64.3    2e-08   
ref|WP_012117748.1|  sodium transporter                               64.3    2e-08   
ref|XP_001760363.1|  predicted protein                                63.9    2e-08   
ref|WP_038546137.1|  sodium dependent transporter                     63.9    2e-08   
gb|EQA46405.1|  sodium Bile acid symporter family protein             63.5    2e-08   
ref|WP_025038914.1|  MULTISPECIES: sodium transporter                 63.9    2e-08   
ref|WP_014195953.1|  sodium transporter                               63.9    2e-08   
ref|WP_010973987.1|  symporter                                        62.4    2e-08   
ref|WP_015863769.1|  sodium transporter                               63.9    2e-08   
ref|WP_013741903.1|  sodium transporter                               63.9    2e-08   
ref|WP_033008760.1|  sodium transporter                               63.9    2e-08   
ref|WP_029282995.1|  sodium transporter                               63.9    2e-08   
ref|WP_016253146.1|  BASS family bile acid:Na+ symporter              63.9    2e-08   
ref|XP_008781515.1|  PREDICTED: probable sodium/metabolite cotran...  63.9    2e-08   
ref|WP_037708412.1|  MULTISPECIES: Bile acid:sodium symporter         63.9    2e-08   
ref|WP_019994981.1|  sodium transporter                               63.9    2e-08   
ref|WP_035264849.1|  sodium transporter                               63.9    2e-08   
gb|KCV61869.1|  sodium Bile acid symporter family protein             63.9    2e-08   
emb|CCU61955.1|  Sodium-dependent transporter                         63.5    2e-08   
ref|WP_033017038.1|  sodium transporter                               63.5    2e-08   
ref|WP_042918632.1|  sodium transporter                               61.2    3e-08   
gb|EWM27587.1|  bile acid:sodium symporter family protein             63.9    3e-08   
ref|WP_033025472.1|  sodium transporter                               63.5    3e-08   
gb|EPS74376.1|  hypothetical protein M569_00378                       63.9    3e-08   
ref|WP_025950731.1|  sodium transporter                               63.5    3e-08   
ref|WP_002975621.1|  sodium Bile acid symporter family protein        63.5    3e-08   
ref|WP_032873418.1|  sodium transporter                               63.5    3e-08   
gb|KJB77947.1|  hypothetical protein B456_012G169500                  63.5    3e-08   
ref|WP_023118730.1|  BASS family bile acid:Na+ symporter              63.5    3e-08   
ref|WP_022248339.1|  putative Na+-dependent transporter               63.5    3e-08   
ref|XP_010030162.1|  PREDICTED: probable sodium/metabolite cotran...  63.9    3e-08   
ref|WP_011978929.1|  bile acid:sodium symporter                       63.5    3e-08   
gb|KJB77945.1|  hypothetical protein B456_012G169500                  63.9    3e-08   
ref|WP_015374939.1|  putative sodium-dependent transporter protein    63.5    3e-08   
ref|WP_015417628.1|  putative sodium-dependent transporter            63.5    3e-08   
ref|WP_045207721.1|  sodium transporter                               63.5    3e-08   
ref|WP_023986785.1|  MULTISPECIES: sodium transporter                 63.5    3e-08   
ref|WP_019392099.1|  MULTISPECIES: hypothetical protein               63.5    3e-08   
ref|WP_025721888.1|  sodium transporter                               63.5    3e-08   
ref|WP_025716738.1|  sodium transporter                               63.5    3e-08   
ref|WP_031184150.1|  Bile acid:sodium symporter                       63.5    3e-08   
ref|WP_033574662.1|  MULTISPECIES: sodium transporter                 63.5    3e-08   
ref|WP_032036255.1|  sodium transporter                               63.5    3e-08   
gb|KJB77946.1|  hypothetical protein B456_012G169500                  63.5    3e-08   
ref|WP_033876137.1|  sodium transporter                               61.6    3e-08   
ref|XP_008781516.1|  PREDICTED: sodium/pyruvate cotransporter BAS...  63.5    3e-08   
ref|WP_020777207.1|  sodium Bile acid symporter family protein        63.2    3e-08   
gb|KJB77948.1|  hypothetical protein B456_012G169500                  63.5    3e-08   
ref|WP_033974932.1|  sodium transporter                               63.2    3e-08   
gb|ETA62676.1|  sodium Bile acid symporter domain protein             60.1    4e-08   
ref|WP_009647170.1|  sodium transporter                               63.2    4e-08   
ref|WP_034022182.1|  sodium transporter                               63.2    4e-08   
ref|WP_005487720.1|  Sodium-dependent transporter                     63.2    4e-08   
ref|WP_017398967.1|  sodium transporter                               63.2    4e-08   
ref|WP_003162227.1|  Sodium-dependent transporter                     63.2    4e-08   



>ref|XP_002284920.3| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
isoform X1 [Vitis vinifera]
 emb|CBI28133.3| unnamed protein product [Vitis vinifera]
Length=417

 Score =   236 bits (602),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 161/211 (76%), Gaps = 2/211 (1%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            MAS+SRFV KD +   FD    PS     RRI + +  R G S  E  +N L IQNK   
Sbjct  1    MASMSRFVLKDCKLQPFDALYGPSSCSLARRIHTRVEVRGGCSLPEKGRN-LAIQNKQHS  59

Query  347  SVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVI  526
            S+  +   SSI   A     + CKAA NVSGD+PG++ +GMSQYERIIETLTTLFPVWVI
Sbjct  60   SIVALSGPSSI-IQASRNSHILCKAAANVSGDVPGNTPAGMSQYERIIETLTTLFPVWVI  118

Query  527  LGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYL  706
            LGTVIGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYL
Sbjct  119  LGTVIGIYKPAAVTWLETDLFTICLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYL  178

Query  707  IKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            IKP+LG+ I   LKLSAPLATGLILVSCCPG
Sbjct  179  IKPMLGFFIVMTLKLSAPLATGLILVSCCPG  209



>emb|CAN76830.1| hypothetical protein VITISV_002026 [Vitis vinifera]
Length=433

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 161/211 (76%), Gaps = 2/211 (1%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            MAS+SRFV KD +   FD    PS     RRI + +  R G S  E  +N L IQNK   
Sbjct  1    MASMSRFVLKDCKLQPFDALYGPSSCSLARRIHTRVEVRGGCSLPEKGRN-LAIQNKQHS  59

Query  347  SVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVI  526
            S+  +   SSI   A     + CKAA NVSGD+PG++ +GMSQYERIIETLTTLFPVWVI
Sbjct  60   SIVALSGPSSI-IQASRNSHILCKAAANVSGDVPGNTPAGMSQYERIIETLTTLFPVWVI  118

Query  527  LGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYL  706
            LGTVIGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYL
Sbjct  119  LGTVIGIYKPAAVTWLETDLFTICLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYL  178

Query  707  IKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            IKP+LG+ I   LKLSAPLATGLILVSCCPG
Sbjct  179  IKPMLGFFIVMTLKLSAPLATGLILVSCCPG  209



>ref|XP_010656384.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
isoform X2 [Vitis vinifera]
Length=416

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 161/211 (76%), Gaps = 3/211 (1%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            MAS+SRFV KD +   FD    PS     RRI + +  R G S  E  +N L IQNK   
Sbjct  1    MASMSRFVLKDCKLQPFDALYGPSSCSLARRIHTRV-VRGGCSLPEKGRN-LAIQNKQHS  58

Query  347  SVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVI  526
            S+  +   SSI   A     + CKAA NVSGD+PG++ +GMSQYERIIETLTTLFPVWVI
Sbjct  59   SIVALSGPSSI-IQASRNSHILCKAAANVSGDVPGNTPAGMSQYERIIETLTTLFPVWVI  117

Query  527  LGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYL  706
            LGTVIGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYL
Sbjct  118  LGTVIGIYKPAAVTWLETDLFTICLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYL  177

Query  707  IKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            IKP+LG+ I   LKLSAPLATGLILVSCCPG
Sbjct  178  IKPMLGFFIVMTLKLSAPLATGLILVSCCPG  208



>ref|XP_008242696.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Prunus mume]
 ref|XP_008242697.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Prunus mume]
Length=410

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 166/211 (79%), Gaps = 9/211 (4%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            M+S+SRF  KD +  + D   +PS   S RR+Q+HL  R  +S  E  ++C  IQ+KP  
Sbjct  1    MSSMSRFSVKDFKLRTCDAFCRPSSSLSARRLQTHLDLRGLLSVPENGRSC-AIQSKPWS  59

Query  347  SVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVI  526
             +  +++  S  +  L      CKA+TN+SGD+PG +SSGMSQYERIIETLTTLFPVWVI
Sbjct  60   PI--VVQSKSRNSEVL------CKASTNLSGDLPGSTSSGMSQYERIIETLTTLFPVWVI  111

Query  527  LGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYL  706
            LGT++GIYKPSAVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY+
Sbjct  112  LGTILGIYKPSAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYM  171

Query  707  IKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            IKPLLG+ I+  LKLSAP+ATGLILVSCCPG
Sbjct  172  IKPLLGFVIALTLKLSAPIATGLILVSCCPG  202



>ref|XP_010098952.1| putative sodium-dependent transporter yocS [Morus notabilis]
 gb|EXB76254.1| putative sodium-dependent transporter yocS [Morus notabilis]
Length=405

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 161/212 (76%), Gaps = 4/212 (2%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHG-FSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQ  343
            MASISR   KD  F +     +PS   F+ RR+Q+HL  R G S TE  + C  I++K  
Sbjct  1    MASISRLATKDCNFYTCHAFHRPSTALFARRRLQTHLDLRSGFSVTENGRTC-TIRSKTW  59

Query  344  VSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWV  523
              V  +   S I++      ++ CKAATNVSGD+P  S SGMSQYERIIETLTTLFPVWV
Sbjct  60   SPVVALGVPSIIQSSR--HSQVVCKAATNVSGDVPDSSPSGMSQYERIIETLTTLFPVWV  117

Query  524  ILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQY  703
            ILGT+IGIYKP+AVTWLETDLFT  LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY
Sbjct  118  ILGTIIGIYKPAAVTWLETDLFTGCLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQY  177

Query  704  LIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            LIKP+LG+  +  LKLSAPLATGLILVSCCPG
Sbjct  178  LIKPILGFTFAMILKLSAPLATGLILVSCCPG  209



>ref|XP_007013300.1| Transmembrane domain protein isoform 1 [Theobroma cacao]
 gb|EOY30919.1| Transmembrane domain protein isoform 1 [Theobroma cacao]
Length=417

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 165/213 (77%), Gaps = 6/213 (3%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSP-RRIQS-HLCFRDGVSKTEPKKNCLRIQNKP  340
            MAS+SRFV KD    ++D   +      P RR+Q+ HL  R G+S  E  K    I+ KP
Sbjct  1    MASLSRFVIKDCNLHTYDAVHRRPWSLIPARRLQAAHLDVRAGISVPENGKG-WAIERKP  59

Query  341  QVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVW  520
               +  +   SSI  PA   L++ CKAATNVSGDIP  + +GM+QYERIIE LTTLFPVW
Sbjct  60   SSPLVSLAAPSSI-IPASRNLQVMCKAATNVSGDIP--TPNGMNQYERIIEILTTLFPVW  116

Query  521  VILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQ  700
            VILGT+IGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQ
Sbjct  117  VILGTIIGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQ  176

Query  701  YLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            YLIKP+LG+AI+ ALKLSAPLATGLILVSCCPG
Sbjct  177  YLIKPMLGFAIAMALKLSAPLATGLILVSCCPG  209



>ref|XP_007202174.1| hypothetical protein PRUPE_ppa006547mg [Prunus persica]
 gb|EMJ03373.1| hypothetical protein PRUPE_ppa006547mg [Prunus persica]
Length=406

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 164/211 (78%), Gaps = 13/211 (6%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            M+S+SRF  KD +  + D   +PS   S RR+Q+HL     +S  E  ++C  IQ+KP  
Sbjct  1    MSSMSRFSVKDFKLRTCDAFCRPSSSLSARRLQTHL----DLSVPENGRSC-AIQSKPWS  55

Query  347  SVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVI  526
             +  +L+  S  +  L      CKAA N+SGD+PG +SSGMSQYERIIETLTTLFPVWVI
Sbjct  56   PI--VLQSKSRNSEVL------CKAARNLSGDLPGSTSSGMSQYERIIETLTTLFPVWVI  107

Query  527  LGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYL  706
            LGT++GIYKPSAVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY+
Sbjct  108  LGTILGIYKPSAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYM  167

Query  707  IKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            IKPLLG+ I+  LKLSAP+ATGLILVSCCPG
Sbjct  168  IKPLLGFVIALTLKLSAPIATGLILVSCCPG  198



>dbj|BAJ16226.1| sodium-dependent pyruvate transporter [Flaveria trinervia]
Length=414

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 140/217 (65%), Positives = 164/217 (76%), Gaps = 17/217 (8%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPS-QKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNK--  337
            MASIS  VGK+  F S +    +P      R IQ+H+  R GV  ++  K CL IQNK  
Sbjct  1    MASISSIVGKNCNFQSRNAVVHRPRCDLPSRLIQNHVSLRRGVCSSDDGKRCLAIQNKRF  60

Query  338  -PQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIP--GDSSSGMSQYERIIETLTTL  508
             P +       L S+ + +    ++ C+AATNV GD+P   ++SSGMS YE+IIETLTTL
Sbjct  61   FPAI-------LQSLDSSS----KIQCQAATNVPGDVPTNANNSSGMSTYEKIIETLTTL  109

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            FP+WVI+GT+IGIYKPSAVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVG
Sbjct  110  FPLWVIIGTIIGIYKPSAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVG  169

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            FLAQYLIKP+LGY I+ ALKLSAPLATGLILVSCCPG
Sbjct  170  FLAQYLIKPVLGYFIAVALKLSAPLATGLILVSCCPG  206



>ref|XP_009587110.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Nicotiana tomentosiformis]
Length=413

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 142/212 (67%), Positives = 166/212 (78%), Gaps = 13/212 (6%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            MAS+SRF+ KD +  +     +PS  ++PR   +H   R G    E  +  L IQNK Q+
Sbjct  1    MASLSRFIVKDCKLHAL---HRPS--YAPRT-PTHFSIRSG---HETGRCNLFIQNKHQI  51

Query  347  S-VDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWV  523
            S V   ++ S I   +L   ++SCKAATNVSGD+P   SSGMSQYE+IIETLTTLFP+WV
Sbjct  52   SDVAFPVQSSFIGITSLRNSKISCKAATNVSGDLP---SSGMSQYEKIIETLTTLFPLWV  108

Query  524  ILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQY  703
            ILGT++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY
Sbjct  109  ILGTILGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQY  168

Query  704  LIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             IKPLLG+AI+ ALKLSAPLATGLILVSCCPG
Sbjct  169  FIKPLLGFAIAMALKLSAPLATGLILVSCCPG  200



>ref|XP_002514369.1| sodium-bile acid cotransporter, putative [Ricinus communis]
 gb|EEF48323.1| sodium-bile acid cotransporter, putative [Ricinus communis]
Length=387

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 165/214 (77%), Gaps = 8/214 (4%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQ-  343
            MAS+SRFV KD +  + +   +PS GF  R   S L  R+G    +  + C  IQ+KP  
Sbjct  1    MASMSRFVLKDCKLQTCESIYRPSSGFPSRLTISSLDIRNGSFLADKGRTC-AIQSKPTS  59

Query  344  --VSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPV  517
              V+VD   ++  I+T +  K ++ CKAA +VS D+P  + +GMS YE+IIETLTTLFPV
Sbjct  60   PVVAVDAPFRV--IQTSS--KSQVLCKAAADVSEDVPNSTPAGMSMYEKIIETLTTLFPV  115

Query  518  WVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLA  697
            WVILGT++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLA
Sbjct  116  WVILGTIVGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLA  175

Query  698  QYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            QYLIKP+LG+A++  LKLSAPLATGLILVSCCPG
Sbjct  176  QYLIKPMLGFALAMTLKLSAPLATGLILVSCCPG  209



>ref|NP_001234028.1| involved in inorganic sulfate assimilation [Solanum lycopersicum]
 gb|AAU03362.1| putative anion:sodium symporter [Solanum lycopersicum]
Length=407

 Score =   223 bits (567),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 160/211 (76%), Gaps = 12/211 (6%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            MAS+SRF+GK  +    D  Q+PS+GF  RR  +HL           + N    QN+ + 
Sbjct  1    MASLSRFIGKQCKLQCSDTLQRPSYGFCVRRSPTHLSMGMRNKDEIGRYNLFINQNQSKT  60

Query  347  SVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVI  526
            S+        +++P   K+ + C+AA+NVSG+    SS+GM+QYE+IIETLTTLFP+WVI
Sbjct  61   SL--------VQSPCNRKI-VCCEAASNVSGE---SSSTGMTQYEKIIETLTTLFPLWVI  108

Query  527  LGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYL  706
            LGT+IGIYKPSAVTWLETDLFTL LGFLMLSMGLTLTFDDFRRCLRNPWTVGVGFLAQY 
Sbjct  109  LGTIIGIYKPSAVTWLETDLFTLGLGFLMLSMGLTLTFDDFRRCLRNPWTVGVGFLAQYF  168

Query  707  IKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            IKPLLG+ I+ ALKLSAPLATGLILVSCCPG
Sbjct  169  IKPLLGFTIAMALKLSAPLATGLILVSCCPG  199



>ref|XP_007013301.1| Sodium Bile acid symporter family isoform 2, partial [Theobroma 
cacao]
 gb|EOY30920.1| Sodium Bile acid symporter family isoform 2, partial [Theobroma 
cacao]
Length=316

 Score =   219 bits (558),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 160/209 (77%), Gaps = 6/209 (3%)
 Frame = +2

Query  179  SRFVGKDSRFLSFDPSQKPSHGFSP-RRIQS-HLCFRDGVSKTEPKKNCLRIQNKPQVSV  352
            S FV KD    ++D   +      P RR+Q+ HL  R G+S  E  K    I+ KP   +
Sbjct  8    SLFVIKDCNLHTYDAVHRRPWSLIPARRLQAAHLDVRAGISVPENGKG-WAIERKPSSPL  66

Query  353  DGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILG  532
              +   SSI  PA   L++ CKAATNVSGDIP  + +GM+QYERIIE LTTLFPVWVILG
Sbjct  67   VSLAAPSSI-IPASRNLQVMCKAATNVSGDIP--TPNGMNQYERIIEILTTLFPVWVILG  123

Query  533  TVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIK  712
            T+IGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIK
Sbjct  124  TIIGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIK  183

Query  713  PLLGYAISRALKLSAPLATGLILVSCCPG  799
            P+LG+AI+ ALKLSAPLATGLILVSCCPG
Sbjct  184  PMLGFAIAMALKLSAPLATGLILVSCCPG  212



>ref|XP_009800401.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Nicotiana sylvestris]
Length=411

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 165/212 (78%), Gaps = 10/212 (5%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            MAS+SRF+ KD +  +     +PS  ++PR   +H   R G    E  +  L IQNK Q+
Sbjct  1    MASLSRFIVKDCKLYAL---HRPS--YAPRT-PTHFSIRSG---HETGRCNLFIQNKHQI  51

Query  347  S-VDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWV  523
            S V   ++ S I   +L   ++SCKAATNVSGD+P  SSSGMSQYE+IIETLTTLFP+WV
Sbjct  52   SDVAFPVQSSFIGITSLRNSKISCKAATNVSGDLPSSSSSGMSQYEKIIETLTTLFPLWV  111

Query  524  ILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQY  703
            ILGT++GIYKP+ VTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY
Sbjct  112  ILGTILGIYKPATVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQY  171

Query  704  LIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             IKPLLG+AI+  LKLSAPLATGLILVSCCPG
Sbjct  172  FIKPLLGFAIAMVLKLSAPLATGLILVSCCPG  203



>ref|XP_008463345.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Cucumis melo]
Length=420

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 158/216 (73%), Gaps = 9/216 (4%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQN----  334
            MASIS+F   D   + FD     +  FS  + QSHL FR  +  ++  +  L +      
Sbjct  1    MASISKFAFNDCSIMRFDALYNRNFHFSAGKFQSHLDFRGKLCLSDSGRRRLVVAQSMLL  60

Query  335  KPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDI-PGDSSSGMSQYERIIETLTTLF  511
            KP VS      +         KL++ CKAA++VSG+I PGDS  GMS YER+IETLTTLF
Sbjct  61   KPLVSSASPCAIGVTSR----KLQILCKAASDVSGEIVPGDSPDGMSTYERVIETLTTLF  116

Query  512  PVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGF  691
            PVWVILGT+IGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGF
Sbjct  117  PVWVILGTIIGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGF  176

Query  692  LAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            LAQYLIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  177  LAQYLIKPMLGFVIAMTLKLSAPLATGLILVSCCPG  212



>gb|KHG22637.1| putative sodium-dependent transporter yocS [Gossypium arboreum]
Length=417

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 158/213 (74%), Gaps = 6/213 (3%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRI--QSHLCFRDGVSKTEPKKNCLRIQNKP  340
            MA++SRFV KD  F       + S    P R   ++HL  R G+S  E  K    IQ KP
Sbjct  1    MATLSRFVAKDCNFHKHHAVCRTSSSLIPSRTLRRAHLDVRAGISLPENGKG-FAIQRKP  59

Query  341  QVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVW  520
               +  +   +SI TPA    ++ C AA NVSGDIP  + SGMS+YERIIETLTTLFPVW
Sbjct  60   SGPLVSLAAPASI-TPASRDPKVICNAAANVSGDIP--TPSGMSKYERIIETLTTLFPVW  116

Query  521  VILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQ  700
            VILGT+IGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQ
Sbjct  117  VILGTIIGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQ  176

Query  701  YLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            YLIKP LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  177  YLIKPFLGFVIAMTLKLSAPLATGLILVSCCPG  209



>ref|XP_004149855.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Cucumis sativus]
 gb|KGN65391.1| hypothetical protein Csa_1G404660 [Cucumis sativus]
Length=420

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 163/218 (75%), Gaps = 13/218 (6%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQN----  334
            MASIS+    D R   FD     +  FSP ++QSHL  R  +  ++ ++  L +      
Sbjct  1    MASISKLAFNDCRMQRFDALHNRNFHFSPGKLQSHLDVRGKLCLSDSRRRSLVVAQSMLL  60

Query  335  KPQVSVDG--MLKLSSIKTPALWKLRLSCKAATNVSGDI-PGDSSSGMSQYERIIETLTT  505
            KP VS      ++++S       KL++ C+AA++VSG+I PGDS  GMS YER+IETLTT
Sbjct  61   KPLVSSASPCAVRVTS------RKLQILCEAASDVSGEIVPGDSPDGMSTYERVIETLTT  114

Query  506  LFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGV  685
            LFPVWVILGT++GIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGV
Sbjct  115  LFPVWVILGTILGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGV  174

Query  686  GFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            GFLAQYLIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  175  GFLAQYLIKPMLGFVIAMTLKLSAPLATGLILVSCCPG  212



>emb|CDP03385.1| unnamed protein product [Coffea canephora]
Length=418

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 157/213 (74%), Gaps = 5/213 (2%)
 Frame = +2

Query  167  MASISRFVGKDSRFL-SFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQ  343
            MASISR V KD + L S +  Q+ S G S R  +++L  R G++  E     L IQNKPQ
Sbjct  1    MASISRIVAKDCKSLQSSEVYQRRSFGLSARTPKTNLSIRSGIAMPEAG---LPIQNKPQ  57

Query  344  VSVDGMLKLSSIKTPALWKL-RLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVW  520
             S+  +   S  +     +  R  C  A NVSGD+P  S   MSQYERIIE LTTLFPVW
Sbjct  58   SSIFAVTPSSLFEDSFESRNGRCYCNTAANVSGDLPSSSPGEMSQYERIIEILTTLFPVW  117

Query  521  VILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQ  700
            VILGT+IGIYKPS VTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQ
Sbjct  118  VILGTIIGIYKPSMVTWLETDLFTIGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQ  177

Query  701  YLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            YLIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  178  YLIKPMLGFFIAMTLKLSAPLATGLILVSCCPG  210



>ref|XP_008344090.1| PREDICTED: LOW QUALITY PROTEIN: sodium/pyruvate cotransporter 
BASS2, chloroplastic-like [Malus domestica]
Length=315

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 160/212 (75%), Gaps = 4/212 (2%)
 Frame = +2

Query  167  MASIS-RFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQ  343
            M+S S +F  KD +  + D   +P+   S RR+QSHL  R  +S  E  + C  IQ+K  
Sbjct  1    MSSJSSKFALKDFKLRTCDAFCRPAASLSARRLQSHLDLRGELSVPENVR-CCAIQSKXW  59

Query  344  VSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWV  523
              +      S I+T      ++ CKAATN+SGD+P  + SGM+ YE+IIETLTTLFPVWV
Sbjct  60   SPIVAKPPSSIIQTSR--NXKVFCKAATNLSGDLPSSTPSGMNLYEKIIETLTTLFPVWV  117

Query  524  ILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQY  703
            ILGT++GIYKP+AVTWL+TDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY
Sbjct  118  ILGTILGIYKPAAVTWLQTDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQY  177

Query  704  LIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            +IKPLLG+ I+  LKLSAP+ATGLILVSCCPG
Sbjct  178  MIKPLLGFVIALTLKLSAPIATGLILVSCCPG  209



>ref|XP_011012598.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Populus euphratica]
Length=420

 Score =   218 bits (556),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 160/219 (73%), Gaps = 15/219 (7%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEP-KKNCLRIQNKPQ  343
            MASISR V +D   LSF    KPS  F   R+++HL  R G+  T P        QNKP+
Sbjct  1    MASISRLVLQDCNLLSFQAIYKPSSCFPSSRLKTHLDPRAGI--TVPWNGRIWTTQNKPR  58

Query  344  VSVDGMLK------LSSIKTPALWKLRLSCKAATNVSGDIPGDSS-SGMSQYERIIETLT  502
                 +        + S + P     ++ C+AATN +GD+P  S+  GMSQYERIIETLT
Sbjct  59   SPTVALTAPSPSSVIHSSRNP-----QVLCRAATNATGDVPDSSTHGGMSQYERIIETLT  113

Query  503  TLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVG  682
            TLFPVWV+LGT++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVG
Sbjct  114  TLFPVWVVLGTILGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVG  173

Query  683  VGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            VGFLAQYLIKPLLG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  174  VGFLAQYLIKPLLGFVIATTLKLSAPLATGLILVSCCPG  212



>gb|KJB64837.1| hypothetical protein B456_010G067700 [Gossypium raimondii]
Length=417

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 139/213 (65%), Positives = 158/213 (74%), Gaps = 6/213 (3%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRI--QSHLCFRDGVSKTEPKKNCLRIQNKP  340
            MA++SRFV KD  F       + S    P R   ++HL  R G+S  E  K    IQ KP
Sbjct  1    MATLSRFVVKDCNFHKHHAVCRTSSSLVPSRTLRRAHLDVRAGISLPENGKG-FAIQRKP  59

Query  341  QVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVW  520
               +  +   +SI TPA    ++ C AA NVSGDIP  + SGMS+YERIIETLTTLFPVW
Sbjct  60   SGPLVSLAAPASI-TPASRDPQVICNAAANVSGDIP--TPSGMSKYERIIETLTTLFPVW  116

Query  521  VILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQ  700
            VILGT+IGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQ
Sbjct  117  VILGTIIGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQ  176

Query  701  YLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            YLIKP LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  177  YLIKPFLGFVIAMTLKLSAPLATGLILVSCCPG  209



>ref|XP_009371418.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Pyrus x bretschneideri]
Length=417

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 163/212 (77%), Gaps = 4/212 (2%)
 Frame = +2

Query  167  MASIS-RFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQ  343
            M+SIS +FV KD +  + D   +P+   S RR+QSHL F   +S  E  + C  IQ+K  
Sbjct  1    MSSISSKFVLKDFKLRTCDAFFRPAASLSARRLQSHLDFIGELSVPENVR-CCAIQSKTW  59

Query  344  VSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWV  523
              +  ++K SS         ++ CKAATN+SGD+P  + SGM+ YE+IIETLTTLFPVWV
Sbjct  60   SPI--VVKPSSSIIQTSRNSKVFCKAATNLSGDLPSSTPSGMNLYEKIIETLTTLFPVWV  117

Query  524  ILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQY  703
            ILGT++GIYKP+AVTWL+TDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY
Sbjct  118  ILGTILGIYKPAAVTWLQTDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQY  177

Query  704  LIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            +IKPLLG+ I+  LKLSAP+ATGLILVSCCPG
Sbjct  178  MIKPLLGFVIALTLKLSAPIATGLILVSCCPG  209



>ref|XP_006343176.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
[Solanum tuberosum]
Length=406

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 159/213 (75%), Gaps = 17/213 (8%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCF--RDGVSKTEPKKNCLRIQNKP  340
            MAS+SRF+GK  +    D   +PS+GF  R   +HL    R+G           + QNKP
Sbjct  1    MASLSRFIGKQCKLQCSDTLHRPSYGFCVRS-PTHLSMGMRNGDESGRYNLFINQNQNKP  59

Query  341  QVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVW  520
             +          +++P   K+ L C+AA+NVSG+    SS+GM+QYE+IIETLTTLFP+W
Sbjct  60   FL----------VQSPCNPKI-LCCEAASNVSGE---SSSTGMTQYEKIIETLTTLFPLW  105

Query  521  VILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQ  700
            VILGT+IGIYKPSAVTWLETDLFTL LGFLMLSMGLTLTFDDFRRCLRNPWTVGVGFLAQ
Sbjct  106  VILGTIIGIYKPSAVTWLETDLFTLGLGFLMLSMGLTLTFDDFRRCLRNPWTVGVGFLAQ  165

Query  701  YLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            Y IKPLLG+ I+ ALKLSAPLATGLILVSCCPG
Sbjct  166  YFIKPLLGFTIAMALKLSAPLATGLILVSCCPG  198



>gb|ACZ98535.1| transmembrane domain protein [Malus domestica]
Length=444

 Score =   215 bits (548),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 133/212 (63%), Positives = 161/212 (76%), Gaps = 4/212 (2%)
 Frame = +2

Query  167  MASIS-RFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQ  343
            M+SIS +F  KD +  + D   +P+   S RR+QSHL  R  +S  E  + C  IQ+K  
Sbjct  1    MSSISSKFALKDFKLRTCDAFCRPAASLSARRLQSHLDLRGELSVPENVR-CCAIQSKTW  59

Query  344  VSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWV  523
              +      S I+T      ++ CKAATN+SGD+P  + SGM+ YE+IIETLTTLFPVWV
Sbjct  60   SPIVAKPSSSIIQTSR--NSKVFCKAATNLSGDLPSSTPSGMNLYEKIIETLTTLFPVWV  117

Query  524  ILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQY  703
            ILGT++GIYKP+AVTWL+TDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY
Sbjct  118  ILGTILGIYKPAAVTWLQTDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQY  177

Query  704  LIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            +IKPLLG+ I+  LKLSAP+ATGLILVSCCPG
Sbjct  178  MIKPLLGFVIALTLKLSAPIATGLILVSCCPG  209



>ref|XP_008354390.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
[Malus domestica]
Length=417

 Score =   214 bits (546),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 160/212 (75%), Gaps = 4/212 (2%)
 Frame = +2

Query  167  MASIS-RFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQ  343
            M+S S +F  KD +  + D   +P+   S RR+QSHL  R  +S  E  + C  IQ+K  
Sbjct  1    MSSJSSKFALKDFKLRTCDAFCRPAASLSARRLQSHLDLRGELSVPENVR-CCAIQSKKW  59

Query  344  VSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWV  523
              +      S I+T      ++ CKAATN+SGD+P  + SGM+ YE+IIETLTTLFPVWV
Sbjct  60   SPIVAKPPSSIIQTSR--NXKVFCKAATNLSGDLPSSTPSGMNLYEKIIETLTTLFPVWV  117

Query  524  ILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQY  703
            ILGT++GIYKP+AVTWL+TDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY
Sbjct  118  ILGTILGIYKPAAVTWLQTDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQY  177

Query  704  LIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            +IKPLLG+ I+  LKLSAP+ATGLILVSCCPG
Sbjct  178  MIKPLLGFVIALTLKLSAPIATGLILVSCCPG  209



>gb|KDO80391.1| hypothetical protein CISIN_1g014688mg [Citrus sinensis]
Length=377

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 162/214 (76%), Gaps = 5/214 (2%)
 Frame = +2

Query  167  MASI-SRFVGKDSRFL-SFDPSQKPSHGFSPRRI-QSHLCFRDGVSKTEPKKNCLRIQNK  337
            MAS+ SRFV K+   L + + S +P+       + Q+HL  R G+S  +  K+ L I++K
Sbjct  1    MASMTSRFVAKNCTNLHASEASFRPTGSSILVGVAQAHLDLRGGLSAIDHGKS-LAIESK  59

Query  338  PQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPV  517
            PQ  +  +    SI   +    ++ CKAA NVSGD+P  S  GMSQYE+IIE LTTLFPV
Sbjct  60   PQNHIVALAAPYSIIQNSRCS-QVLCKAAANVSGDVPSKSPGGMSQYEQIIEILTTLFPV  118

Query  518  WVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLA  697
            WVILGT+IGIYKPSAVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVG+GFLA
Sbjct  119  WVILGTIIGIYKPSAVTWLETDLFTIGLGFLMLSMGLTLTFEDFRRCLRNPWTVGIGFLA  178

Query  698  QYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            QYLIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  179  QYLIKPMLGFVIAMTLKLSAPLATGLILVSCCPG  212



>ref|XP_008386071.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Malus domestica]
Length=417

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 160/212 (75%), Gaps = 4/212 (2%)
 Frame = +2

Query  167  MASIS-RFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQ  343
            M+S S +F  KD +  + D   +P+   S RR+QSHL  R  +S  E  + C  IQ+K  
Sbjct  1    MSSJSSKFALKDFKLRTCDAFCRPAASLSARRLQSHLDXRGELSVPENVR-CCAIQSKXW  59

Query  344  VSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWV  523
              +      S I+T      ++ CKAATN+SGD+P  + SGM+ YE+IIETLTTLFPVWV
Sbjct  60   SPIVAKPPSSIIQTSR--NXKVFCKAATNLSGDLPSSTPSGMNLYEKIIETLTTLFPVWV  117

Query  524  ILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQY  703
            ILGT++GIYKP+AVTWL+TDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY
Sbjct  118  ILGTILGIYKPAAVTWLQTDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQY  177

Query  704  LIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            +IKPLLG+ I+  LKLSAP+ATGLILVSCCPG
Sbjct  178  MIKPLLGFVIALTLKLSAPIATGLILVSCCPG  209



>ref|XP_006451036.1| hypothetical protein CICLE_v10008416mg [Citrus clementina]
 gb|ESR64276.1| hypothetical protein CICLE_v10008416mg [Citrus clementina]
Length=420

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 136/214 (64%), Positives = 162/214 (76%), Gaps = 5/214 (2%)
 Frame = +2

Query  167  MASI-SRFVGKDSRFL-SFDPSQKPSHGFSPRRI-QSHLCFRDGVSKTEPKKNCLRIQNK  337
            MAS+ SRFV K+   L + + S +P+       + Q+HL  R G+S  +  K+ L I++K
Sbjct  1    MASMTSRFVAKNCTNLHASEASFRPTGSSILVGVAQAHLDLRGGLSAIDHGKS-LAIESK  59

Query  338  PQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPV  517
            PQ  +  +    SI   +    ++ CKAA NVSGD+P  S  GMSQYE+IIE LTTLFPV
Sbjct  60   PQNHIVALAAPYSIIQNSRCS-QVLCKAAANVSGDVPSKSPGGMSQYEKIIEILTTLFPV  118

Query  518  WVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLA  697
            WVILGT+IGIYKPSAVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLA
Sbjct  119  WVILGTIIGIYKPSAVTWLETDLFTIGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLA  178

Query  698  QYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            QYLIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  179  QYLIKPMLGFVIAMTLKLSAPLATGLILVSCCPG  212



>ref|XP_006475764.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
[Citrus sinensis]
Length=420

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 162/214 (76%), Gaps = 5/214 (2%)
 Frame = +2

Query  167  MASI-SRFVGKDSRFL-SFDPSQKPSHGFSPRRI-QSHLCFRDGVSKTEPKKNCLRIQNK  337
            MAS+ SRFV K+   L + + S +P+       + Q+HL  R G+S  +  K+ L I++K
Sbjct  1    MASMTSRFVAKNCTNLHASEASFRPTGSSILVGVAQAHLDLRGGLSAIDHGKS-LAIESK  59

Query  338  PQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPV  517
            PQ  +  +    SI   +    ++ CKAA NVSGD+P  S  GMSQYE+IIE LTTLFPV
Sbjct  60   PQNHIVALAAPYSIIQNSRCS-QVLCKAAANVSGDVPSKSPGGMSQYEQIIEILTTLFPV  118

Query  518  WVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLA  697
            WVILGT+IGIYKPSAVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVG+GFLA
Sbjct  119  WVILGTIIGIYKPSAVTWLETDLFTIGLGFLMLSMGLTLTFEDFRRCLRNPWTVGIGFLA  178

Query  698  QYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            QYLIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  179  QYLIKPMLGFVIAMTLKLSAPLATGLILVSCCPG  212



>gb|KDO80390.1| hypothetical protein CISIN_1g014688mg [Citrus sinensis]
Length=420

 Score =   212 bits (539),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 162/214 (76%), Gaps = 5/214 (2%)
 Frame = +2

Query  167  MASI-SRFVGKDSRFL-SFDPSQKPSHGFSPRRI-QSHLCFRDGVSKTEPKKNCLRIQNK  337
            MAS+ SRFV K+   L + + S +P+       + Q+HL  R G+S  +  K+ L I++K
Sbjct  1    MASMTSRFVAKNCTNLHASEASFRPTGSSILVGVAQAHLDLRGGLSAIDHGKS-LAIESK  59

Query  338  PQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPV  517
            PQ  +  +    SI   +    ++ CKAA NVSGD+P  S  GMSQYE+IIE LTTLFPV
Sbjct  60   PQNHIVALAAPYSIIQNSRCS-QVLCKAAANVSGDVPSKSPGGMSQYEQIIEILTTLFPV  118

Query  518  WVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLA  697
            WVILGT+IGIYKPSAVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVG+GFLA
Sbjct  119  WVILGTIIGIYKPSAVTWLETDLFTIGLGFLMLSMGLTLTFEDFRRCLRNPWTVGIGFLA  178

Query  698  QYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            QYLIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  179  QYLIKPMLGFVIAMTLKLSAPLATGLILVSCCPG  212



>gb|ABK96238.1| unknown [Populus trichocarpa x Populus deltoides]
Length=420

 Score =   212 bits (539),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 138/221 (62%), Positives = 158/221 (71%), Gaps = 19/221 (9%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRI---QNK  337
            MAS+ R V +D   L      KPS  F  RR+ +HL  R G+  T P     RI   QNK
Sbjct  1    MASVFRLVLQDCNLLPCQAIYKPSSCFPSRRLNTHLDPRAGI--TVPGNG--RIWTTQNK  56

Query  338  PQVSVDGMLKLS------SIKTPALWKLRLSCKAATNVSGDIPGDSS-SGMSQYERIIET  496
            P+     +  LS      S + P     ++ C+AA N  GD+P  S+  GMSQYERIIET
Sbjct  57   PRSPTVALTALSPSSIIHSSRNP-----QVLCRAAANAPGDVPDSSTHGGMSQYERIIET  111

Query  497  LTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWT  676
            LTTLFPVWV+LGT++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWT
Sbjct  112  LTTLFPVWVVLGTILGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWT  171

Query  677  VGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            VGVGFLAQYLIKPLLG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  172  VGVGFLAQYLIKPLLGFVIATTLKLSAPLATGLILVSCCPG  212



>ref|XP_010249921.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=420

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 129/211 (61%), Positives = 154/211 (73%), Gaps = 3/211 (1%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            MAS+SRF+ KD++        + S     RR+QSHL  R  +   +     L     P V
Sbjct  5    MASMSRFLQKDTKLQMPSGLYRGSSCLPVRRLQSHLDLRSSLVSNKATWTVLNSVWSPIV  64

Query  347  SVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVI  526
            ++      SSI   +    R+ CKAA +VSG++P    SG++QYE IIETLTTLFP+WVI
Sbjct  65   ALS---SPSSIVQASRRSNRVLCKAAASVSGEVPSSKPSGLNQYESIIETLTTLFPLWVI  121

Query  527  LGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYL  706
            LGT+IGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTFDDFRRCLRNPWTVGVGFLAQY 
Sbjct  122  LGTIIGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFDDFRRCLRNPWTVGVGFLAQYF  181

Query  707  IKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            IKP+LG+ I+ +LKLSAPLATGLILVSCCPG
Sbjct  182  IKPMLGFIIAMSLKLSAPLATGLILVSCCPG  212



>ref|XP_010254249.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=419

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 153/211 (73%), Gaps = 4/211 (2%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            M S+SRFV KD++        + +   S   +Q+HL  R G       +  L I   P V
Sbjct  5    MGSMSRFVLKDTKLKIPSGLHRRTSCSSVNGLQTHLNLRSGSVSNNGTQIVLNIVGSPIV  64

Query  347  SVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVI  526
            +        S+   A    ++ C+AA NVSG++P  + SGMS+YERIIETLTTLFPVWVI
Sbjct  65   ASSS----PSLIAHASRSNQVLCRAAENVSGEVPSSTPSGMSKYERIIETLTTLFPVWVI  120

Query  527  LGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYL  706
            LGT+IGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY 
Sbjct  121  LGTIIGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYF  180

Query  707  IKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            IKP+LG+ I+ +LKLSAPLATGLILVSCCPG
Sbjct  181  IKPMLGFIIAMSLKLSAPLATGLILVSCCPG  211



>gb|KCW79752.1| hypothetical protein EUGRSUZ_C01098 [Eucalyptus grandis]
Length=296

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 150/212 (71%), Gaps = 5/212 (2%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCF-RDGVSKTEPKKNCLRIQNKPQ  343
            MAS+S FV K  +F +       S  +  R + S L   RD           L ++N+ Q
Sbjct  1    MASMSGFVLKGCKFQTRGSRCGSSSCYPARSVVSRLDLSRDNCENGRS----LAVKNRLQ  56

Query  344  VSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWV  523
             S   +        P+  KL   CKAATN  G+IP  +  GMSQYERIIETLTTLFPVWV
Sbjct  57   SSTVAVATTPFPVNPSSRKLTTLCKAATNAPGEIPASTPVGMSQYERIIETLTTLFPVWV  116

Query  524  ILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQY  703
            ILGT+IGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY
Sbjct  117  ILGTIIGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQY  176

Query  704  LIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            LIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  177  LIKPMLGFVIAMTLKLSAPLATGLILVSCCPG  208



>ref|XP_004287383.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=412

 Score =   211 bits (536),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 162/214 (76%), Gaps = 13/214 (6%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNK---  337
            M+S+SRF  KD +  + +   + S   S RR+ +HL  R  +S  E  ++C  IQ+K   
Sbjct  1    MSSLSRFALKDFKLNTCEAYCRQSPCLSSRRLPTHLDVRGEISVPEKGRSC-AIQSKTWG  59

Query  338  PQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPV  517
            P  +   +++ S          ++ CKAATN SGD+P  + SGMSQYERIIETLTTLFP+
Sbjct  60   PIAAGSSIVQTSR-------NSKVLCKAATNASGDLP--TPSGMSQYERIIETLTTLFPL  110

Query  518  WVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLA  697
            WVI+GT++GIYKPSAVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLA
Sbjct  111  WVIIGTIVGIYKPSAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLA  170

Query  698  QYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            QY+IKPLLG++I+  LKLSAP+ATGLILVSCCPG
Sbjct  171  QYIIKPLLGFSIALMLKLSAPIATGLILVSCCPG  204



>ref|XP_010688119.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=421

 Score =   210 bits (535),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 156/213 (73%), Gaps = 2/213 (1%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDP-SQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCL-RIQNKP  340
            MAS+SR V KD +    +    +PS  ++ R +QSHL  R G S  E +  CL   Q K 
Sbjct  1    MASMSRCVFKDCKLQLHEAFYTRPSSCYASRTVQSHLDLRHGSSLLETQITCLVTAQKKN  60

Query  341  QVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVW  520
             +S   +      ++         CKAAT+ SGDIP  +   +SQYE+IIETLTTLFPVW
Sbjct  61   LLSPIVVSSSPISQSSRCRSSSFLCKAATDYSGDIPSSAPKELSQYEKIIETLTTLFPVW  120

Query  521  VILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQ  700
            VILGT+IGI+KP+AVTWL+TDLFTL LGFLMLSMGLTLTFDDF+RCLRNPWTVGVG +AQ
Sbjct  121  VILGTLIGIFKPAAVTWLQTDLFTLGLGFLMLSMGLTLTFDDFKRCLRNPWTVGVGLVAQ  180

Query  701  YLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            Y++KPLLG+A++ ALKLSAPLATGLILVSCCPG
Sbjct  181  YMVKPLLGFAVAMALKLSAPLATGLILVSCCPG  213



>ref|XP_010249922.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X2 [Nelumbo nucifera]
Length=419

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 154/211 (73%), Gaps = 4/211 (2%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            MAS+SRF+ KD++        + S     RR+QSHL  R  +   +     L     P V
Sbjct  5    MASMSRFLQKDTKLQMPSGLYRGSSCLPVRRLQSHLDLRSSLVSNKATWTVLNSVWSPIV  64

Query  347  SVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVI  526
            ++      SSI   A    R+ CKAA +VSG++P    SG++QYE IIETLTTLFP+WVI
Sbjct  65   ALS---SPSSI-VQASRSNRVLCKAAASVSGEVPSSKPSGLNQYESIIETLTTLFPLWVI  120

Query  527  LGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYL  706
            LGT+IGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTFDDFRRCLRNPWTVGVGFLAQY 
Sbjct  121  LGTIIGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFDDFRRCLRNPWTVGVGFLAQYF  180

Query  707  IKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            IKP+LG+ I+ +LKLSAPLATGLILVSCCPG
Sbjct  181  IKPMLGFIIAMSLKLSAPLATGLILVSCCPG  211



>ref|XP_006829640.1| PREDICTED: probable sodium/metabolite cotransporter BASS2, chloroplastic 
[Amborella trichopoda]
 gb|ERM97056.1| hypothetical protein AMTR_s00122p00097060 [Amborella trichopoda]
Length=415

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 154/217 (71%), Gaps = 21/217 (10%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            MAS+S  + KD +         PS G+S RR    L  R G S     ++   ++N    
Sbjct  5    MASMSGLIKKDLKI-------SPSMGYSVRRAPMSLGLRSGFSLASRGRS-FEVEN----  52

Query  347  SVDGMLKLSSIKTPALWKLRLS------CKAATNVSGDIPGDSSSGMSQYERIIETLTTL  508
              DG+       TP L   R S      CKA  NV+GD+P ++ SGMSQYERI+E LTTL
Sbjct  53   --DGLGVSERCPTPILLA-RASRSRIVLCKAEVNVAGDVPSNNPSGMSQYERIVELLTTL  109

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            FPVWVILGT+IGIYKPSAVTWLETDLFT+ LGFLMLSMGLTLTF+DF+RC+RNPWTVGVG
Sbjct  110  FPVWVILGTIIGIYKPSAVTWLETDLFTVGLGFLMLSMGLTLTFEDFKRCMRNPWTVGVG  169

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            FLAQYLIKP+LG+ I+ ALKLSAPLATGLILVSCCPG
Sbjct  170  FLAQYLIKPMLGFFIAMALKLSAPLATGLILVSCCPG  206



>ref|XP_010254248.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X1 [Nelumbo nucifera]
Length=420

 Score =   207 bits (528),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 128/212 (60%), Positives = 153/212 (72%), Gaps = 5/212 (2%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLC-FRDGVSKTEPKKNCLRIQNKPQ  343
            M S+SRFV KD++        + +   S   +Q+HL   R G       +  L I   P 
Sbjct  5    MGSMSRFVLKDTKLKIPSGLHRRTSCSSVNGLQTHLIDLRSGSVSNNGTQIVLNIVGSPI  64

Query  344  VSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWV  523
            V+        S+   A    ++ C+AA NVSG++P  + SGMS+YERIIETLTTLFPVWV
Sbjct  65   VASSS----PSLIAHASRSNQVLCRAAENVSGEVPSSTPSGMSKYERIIETLTTLFPVWV  120

Query  524  ILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQY  703
            ILGT+IGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY
Sbjct  121  ILGTIIGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQY  180

Query  704  LIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             IKP+LG+ I+ +LKLSAPLATGLILVSCCPG
Sbjct  181  FIKPMLGFIIAMSLKLSAPLATGLILVSCCPG  212



>gb|KJB83147.1| hypothetical protein B456_013G231400 [Gossypium raimondii]
Length=293

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 158/214 (74%), Gaps = 9/214 (4%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDP--SQKPSHGFSPRRIQS-HLCFRDGVSKTEPKKNCLRIQNK  337
            MA++SRFV  D+   +++    ++P      RR+ S  L  R G+S      N   +Q+K
Sbjct  1    MAALSRFVVTDTNLHAYEAVIRRRPWSLIPGRRVLSAQLDVRAGISL---YGNGWSMQSK  57

Query  338  PQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPV  517
            P   +  +L  SSI   +    ++ CKAA NVSGD P  +  GM+QYERIIETLTTLFPV
Sbjct  58   PNSPLAALLAPSSIILDSR-NSKVKCKAAANVSGDSP--TPKGMNQYERIIETLTTLFPV  114

Query  518  WVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLA  697
            WV LG ++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLA
Sbjct  115  WVTLGAIVGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLA  174

Query  698  QYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            QYLIKP+LG+AI+  LKLSAPLATGLILVSCCPG
Sbjct  175  QYLIKPMLGFAIATTLKLSAPLATGLILVSCCPG  208



>ref|XP_010047772.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW79751.1| hypothetical protein EUGRSUZ_C01098 [Eucalyptus grandis]
Length=416

 Score =   207 bits (527),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 131/216 (61%), Positives = 151/216 (70%), Gaps = 13/216 (6%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNC-----LRIQ  331
            MAS+S FV K  +F +       S  +  R + S L           + NC     L ++
Sbjct  1    MASMSGFVLKGCKFQTRGSRCGSSSCYPARSVVSRLDLS--------RDNCENGRSLAVK  52

Query  332  NKPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLF  511
            N+ Q S   +        P+  KL   CKAATN  G+IP  +  GMSQYERIIETLTTLF
Sbjct  53   NRLQSSTVAVATTPFPVNPSSRKLTTLCKAATNAPGEIPASTPVGMSQYERIIETLTTLF  112

Query  512  PVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGF  691
            PVWVILGT+IGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGF
Sbjct  113  PVWVILGTIIGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGF  172

Query  692  LAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            LAQYLIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  173  LAQYLIKPMLGFVIAMTLKLSAPLATGLILVSCCPG  208



>ref|XP_010557580.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Tarenaya hassleriana]
Length=422

 Score =   207 bits (526),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 137/217 (63%), Positives = 161/217 (74%), Gaps = 9/217 (4%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFS-PRRIQSHL-CFRDGVSKTEPKKNCLRIQN-K  337
            MASISR V +D R      S      +   RR+++ L C   G  +   K   L IQN K
Sbjct  1    MASISRVVPRDCRLSQCSGSYTLGDSWVLARRVRNRLDCTNLGSVRDVGKS--LAIQNYK  58

Query  338  PQVSVDGMLKLSSIKTPALWKLRLSCKAATNV---SGDIPGDSSSGMSQYERIIETLTTL  508
            P  S+  +   S++ T +   +R++CKAAT+V   SGD+P  SSSGMS YE+IIE LTTL
Sbjct  59   PCSSIVALTSTSAV-TCSSRTMRIACKAATDVPGESGDVPDSSSSGMSNYEKIIELLTTL  117

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            FPVWVILGT+IGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVG
Sbjct  118  FPVWVILGTLIGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVG  177

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            FLAQYLIKP LG+ I+ +LKLSAPLATGLILVSCCPG
Sbjct  178  FLAQYLIKPALGFVIAMSLKLSAPLATGLILVSCCPG  214



>gb|KHG10132.1| putative sodium-dependent transporter yocS [Gossypium arboreum]
Length=416

 Score =   206 bits (525),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 159/214 (74%), Gaps = 9/214 (4%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDP--SQKPSHGFSPRRIQS-HLCFRDGVSKTEPKKNCLRIQNK  337
            MA++SRFV KD+   +++    ++P      RRI S  L  R G+S      N   +Q+K
Sbjct  1    MAALSRFVVKDTNLHAYEAVIRRRPWSLIPGRRILSAQLDVRAGISL---YGNGWSMQSK  57

Query  338  PQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPV  517
            P   +  +L  SSI   A    ++ CKAA NVSGD P  +  GM+QYERIIETLTTLFPV
Sbjct  58   PNSPLAALLAPSSIIL-ASRNSKVKCKAAANVSGDSP--TPKGMNQYERIIETLTTLFPV  114

Query  518  WVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLA  697
            WV LG ++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWT+GVGFLA
Sbjct  115  WVTLGAIVGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTLGVGFLA  174

Query  698  QYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            QYLIKP+LG+AI+  LKLSAPLATGLILVSCCPG
Sbjct  175  QYLIKPMLGFAIATTLKLSAPLATGLILVSCCPG  208



>ref|XP_010254250.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X3 [Nelumbo nucifera]
Length=419

 Score =   206 bits (525),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 155/216 (72%), Gaps = 14/216 (6%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLC-FRDGVSKTEPKKNCLRIQNKPQ  343
            M S+SRFV KD++        + +   S   +Q+HL   R G       +  L I   P 
Sbjct  5    MGSMSRFVLKDTKLKIPSGLHRRTSCSSVNGLQTHLIDLRSGSVSNNGTQIVLNIVGSPI  64

Query  344  VSVDGMLKLSSIKTPALW----KLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLF  511
            V+           +P+L     + ++ C+AA NVSG++P  + SGMS+YERIIETLTTLF
Sbjct  65   VASS---------SPSLIAHASRNQVLCRAAENVSGEVPSSTPSGMSKYERIIETLTTLF  115

Query  512  PVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGF  691
            PVWVILGT+IGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGF
Sbjct  116  PVWVILGTIIGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGF  175

Query  692  LAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            LAQY IKP+LG+ I+ +LKLSAPLATGLILVSCCPG
Sbjct  176  LAQYFIKPMLGFIIAMSLKLSAPLATGLILVSCCPG  211



>gb|KJB83146.1| hypothetical protein B456_013G231400 [Gossypium raimondii]
Length=374

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 158/214 (74%), Gaps = 9/214 (4%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDP--SQKPSHGFSPRRIQS-HLCFRDGVSKTEPKKNCLRIQNK  337
            MA++SRFV  D+   +++    ++P      RR+ S  L  R G+S      N   +Q+K
Sbjct  1    MAALSRFVVTDTNLHAYEAVIRRRPWSLIPGRRVLSAQLDVRAGISL---YGNGWSMQSK  57

Query  338  PQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPV  517
            P   +  +L  SSI   +    ++ CKAA NVSGD P  +  GM+QYERIIETLTTLFPV
Sbjct  58   PNSPLAALLAPSSIILDSR-NSKVKCKAAANVSGDSP--TPKGMNQYERIIETLTTLFPV  114

Query  518  WVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLA  697
            WV LG ++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLA
Sbjct  115  WVTLGAIVGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLA  174

Query  698  QYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            QYLIKP+LG+AI+  LKLSAPLATGLILVSCCPG
Sbjct  175  QYLIKPMLGFAIATTLKLSAPLATGLILVSCCPG  208



>ref|XP_004508558.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
[Cicer arietinum]
Length=415

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 158/213 (74%), Gaps = 8/213 (4%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRR--IQSHLCFRDGVSKTEPKKNCLRIQNKP  340
            MASI + + +D R  ++D   KP++ + PRR  + ++L  R      E  K+  R  N  
Sbjct  1    MASIPKVILRDHRIGTYDAFLKPNYSYFPRRNLVNANLDVRTDFFVKENGKS-FRGPNPI  59

Query  341  QVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVW  520
              S     +L  +   +    ++ C A+ N+SGDIP +S+ G+SQYE++IETLTTLFPVW
Sbjct  60   VASA----RLPLLHVTSKRNSQILCSASANISGDIP-ESAGGLSQYEKVIETLTTLFPVW  114

Query  521  VILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQ  700
            VILG V+GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCL+NPWTVGVGFLAQ
Sbjct  115  VILGAVVGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLKNPWTVGVGFLAQ  174

Query  701  YLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            YLIKP+LG+AI+  LKLSAPLATGLILVSCCPG
Sbjct  175  YLIKPMLGFAIAMTLKLSAPLATGLILVSCCPG  207



>gb|KJB83144.1| hypothetical protein B456_013G231400 [Gossypium raimondii]
Length=419

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 158/214 (74%), Gaps = 9/214 (4%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDP--SQKPSHGFSPRRIQS-HLCFRDGVSKTEPKKNCLRIQNK  337
            MA++SRFV  D+   +++    ++P      RR+ S  L  R G+S      N   +Q+K
Sbjct  1    MAALSRFVVTDTNLHAYEAVIRRRPWSLIPGRRVLSAQLDVRAGISL---YGNGWSMQSK  57

Query  338  PQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPV  517
            P   +  +L  SSI   +    ++ CKAA NVSGD P  +  GM+QYERIIETLTTLFPV
Sbjct  58   PNSPLAALLAPSSIILDS-RNSKVKCKAAANVSGDSP--TPKGMNQYERIIETLTTLFPV  114

Query  518  WVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLA  697
            WV LG ++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLA
Sbjct  115  WVTLGAIVGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLA  174

Query  698  QYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            QYLIKP+LG+AI+  LKLSAPLATGLILVSCCPG
Sbjct  175  QYLIKPMLGFAIATTLKLSAPLATGLILVSCCPG  208



>gb|KJB83143.1| hypothetical protein B456_013G231400 [Gossypium raimondii]
Length=416

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 158/214 (74%), Gaps = 9/214 (4%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDP--SQKPSHGFSPRRIQS-HLCFRDGVSKTEPKKNCLRIQNK  337
            MA++SRFV  D+   +++    ++P      RR+ S  L  R G+S      N   +Q+K
Sbjct  1    MAALSRFVVTDTNLHAYEAVIRRRPWSLIPGRRVLSAQLDVRAGISL---YGNGWSMQSK  57

Query  338  PQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPV  517
            P   +  +L  SSI   +    ++ CKAA NVSGD P  +  GM+QYERIIETLTTLFPV
Sbjct  58   PNSPLAALLAPSSIILDSR-NSKVKCKAAANVSGDSP--TPKGMNQYERIIETLTTLFPV  114

Query  518  WVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLA  697
            WV LG ++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLA
Sbjct  115  WVTLGAIVGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLA  174

Query  698  QYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            QYLIKP+LG+AI+  LKLSAPLATGLILVSCCPG
Sbjct  175  QYLIKPMLGFAIATTLKLSAPLATGLILVSCCPG  208



>gb|KJB83145.1| hypothetical protein B456_013G231400 [Gossypium raimondii]
Length=443

 Score =   204 bits (519),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 158/214 (74%), Gaps = 9/214 (4%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDP--SQKPSHGFSPRRIQS-HLCFRDGVSKTEPKKNCLRIQNK  337
            MA++SRFV  D+   +++    ++P      RR+ S  L  R G+S      N   +Q+K
Sbjct  1    MAALSRFVVTDTNLHAYEAVIRRRPWSLIPGRRVLSAQLDVRAGISL---YGNGWSMQSK  57

Query  338  PQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPV  517
            P   +  +L  SSI   +    ++ CKAA NVSGD P  +  GM+QYERIIETLTTLFPV
Sbjct  58   PNSPLAALLAPSSIILDSR-NSKVKCKAAANVSGDSP--TPKGMNQYERIIETLTTLFPV  114

Query  518  WVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLA  697
            WV LG ++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLA
Sbjct  115  WVTLGAIVGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLA  174

Query  698  QYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            QYLIKP+LG+AI+  LKLSAPLATGLILVSCCPG
Sbjct  175  QYLIKPMLGFAIATTLKLSAPLATGLILVSCCPG  208



>ref|XP_003609202.1| Bile acid Na+ symporter family protein [Medicago truncatula]
 gb|AES91399.1| bile acid:sodium symporter [Medicago truncatula]
 gb|AFK39404.1| unknown [Medicago truncatula]
Length=410

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 159/213 (75%), Gaps = 13/213 (6%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRR--IQSHLCFRDGVSKTEPKKNCLRIQNKP  340
            MAS+ R + +D   L      KP++ + PRR  + +H   ++   +    ++ L+  N P
Sbjct  1    MASMPRVIFRDHAIL------KPNYTYLPRRNLLNNHFDVKEN-GRNFAIRSELQGPN-P  52

Query  341  QVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVW  520
             V+    L L  +K+      ++ C A+TN+SGD+P +S+ G+SQYE+IIETLTTLFPVW
Sbjct  53   VVAAAAKLPLVHLKSKR--NSQILCSASTNISGDVP-ESAGGLSQYEKIIETLTTLFPVW  109

Query  521  VILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQ  700
            VILG ++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTFDDFRRCLRNPWTVGVGFLAQ
Sbjct  110  VILGALLGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFDDFRRCLRNPWTVGVGFLAQ  169

Query  701  YLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            YLIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  170  YLIKPVLGFFIAMTLKLSAPLATGLILVSCCPG  202



>ref|NP_850089.1| sodium/pyruvate cotransporter BASS2 [Arabidopsis thaliana]
 sp|Q1EBV7.1|BASS2_ARATH RecName: Full=Sodium/pyruvate cotransporter BASS2, chloroplastic; 
AltName: Full=Bile acid transporter 1; AltName: Full=Bile 
acid-sodium symporter family protein 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|ABG25066.1| At2g26900 [Arabidopsis thaliana]
 gb|AEC07905.1| sodium/pyruvate cotransporter BASS2 [Arabidopsis thaliana]
Length=409

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 153/213 (72%), Gaps = 14/213 (7%)
 Frame = +2

Query  167  MASISRFVGKDSRF--LSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKP  340
            MASISR +  D R      + S  PS      R Q+HL F   VS +    + LRIQN  
Sbjct  1    MASISRILPTDGRLSQCRINTSWVPST----TRTQTHLDFPKLVSVSNSGIS-LRIQNSK  55

Query  341  QVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVW  520
             +S    L+ +S +       R+ CKAA  VSGD+P  +   +SQYE+IIE LTTLFP+W
Sbjct  56   PISPVFALEATSSR-------RVVCKAAAGVSGDLPESTPKELSQYEKIIELLTTLFPLW  108

Query  521  VILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQ  700
            VILGT++GI+KPS VTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQ
Sbjct  109  VILGTLVGIFKPSLVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQ  168

Query  701  YLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            Y+IKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  169  YMIKPILGFLIAMTLKLSAPLATGLILVSCCPG  201



>gb|AAM18095.1|AF498303_1 putative sodium-dependent bile acid symporter [Arabidopsis thaliana]
Length=409

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 129/213 (61%), Positives = 153/213 (72%), Gaps = 14/213 (7%)
 Frame = +2

Query  167  MASISRFVGKDSRF--LSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKP  340
            MASISR +  D R      + S  PS      R Q+HL F   VS +    + LRIQN  
Sbjct  1    MASISRILPTDGRLSQCRINTSWVPST----TRTQTHLDFPKLVSVSNSGIS-LRIQNSK  55

Query  341  QVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVW  520
             +S    L+ +S +       R+ CKAA  VSGD+P  +   +SQYE+IIE LTTLFP+W
Sbjct  56   PISPVFALEATSSR-------RVVCKAAAGVSGDLPESTPKELSQYEKIIELLTTLFPLW  108

Query  521  VILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQ  700
            VILGT++GI+KPS VTWLETDLF+L LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQ
Sbjct  109  VILGTLVGIFKPSLVTWLETDLFSLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQ  168

Query  701  YLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            Y+IKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  169  YMIKPILGFLIAMTLKLSAPLATGLILVSCCPG  201



>ref|XP_002880845.1| hypothetical protein ARALYDRAFT_901497 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57104.1| hypothetical protein ARALYDRAFT_901497 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 156/213 (73%), Gaps = 14/213 (7%)
 Frame = +2

Query  167  MASISRFVGKDSRF--LSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKP  340
            MASISR +  D R      + S  P+      R Q+HL +   VS ++   + LRIQN  
Sbjct  1    MASISRILPTDGRLSQCRINTSWVPAT----TRPQTHLDYPKLVSVSKSGIS-LRIQNSK  55

Query  341  QVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVW  520
             +S    L+ ++ +       R++CKAAT VSGD+P  +   +SQYE+IIE LTTLFP+W
Sbjct  56   PISPVFALEATTSR-------RVACKAATGVSGDVPESTPKELSQYEKIIELLTTLFPLW  108

Query  521  VILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQ  700
            VILGT++GI+KPS VTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQ
Sbjct  109  VILGTLVGIFKPSLVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQ  168

Query  701  YLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            Y+IKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  169  YMIKPILGFLIAMTLKLSAPLATGLILVSCCPG  201



>ref|XP_012078691.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Jatropha curcas]
 gb|KDP32335.1| hypothetical protein JCGZ_13260 [Jatropha curcas]
Length=410

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 111/132 (84%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +2

Query  404  RLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETD  583
            ++ CKAAT+V GD+P  S SGM+ YERIIETLTTLFPVWVILGT++GIYKPSAVTWLETD
Sbjct  71   QILCKAATDVPGDVPSSSPSGMTTYERIIETLTTLFPVWVILGTIVGIYKPSAVTWLETD  130

Query  584  lftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPL  763
            LFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKP+LG+ I+  LKLSAPL
Sbjct  131  LFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPMLGFTIAMTLKLSAPL  190

Query  764  ATGLILVSCCPG  799
            ATGLILVSCCPG
Sbjct  191  ATGLILVSCCPG  202



>ref|XP_006411101.1| hypothetical protein EUTSA_v10016729mg [Eutrema salsugineum]
 dbj|BAJ33731.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52554.1| hypothetical protein EUTSA_v10016729mg [Eutrema salsugineum]
Length=412

 Score =   197 bits (501),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 156/212 (74%), Gaps = 9/212 (4%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQN-KPQ  343
            MASISR +  D R    +     S   + RR QSHL     +S ++   + LRIQN KP 
Sbjct  1    MASISRILPTDGRLSQCNSGIGASWVPATRRAQSHLVSPKLLSVSKAGIS-LRIQNSKPL  59

Query  344  VSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWV  523
             SV  +   +S  +      R++CKAA ++SGD+P ++   + QYE+IIE LTTLFP+WV
Sbjct  60   RSVFALESAASRSS------RVACKAAADLSGDVP-ETPKELGQYEKIIELLTTLFPLWV  112

Query  524  ILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQY  703
            ILGT++GI+KPS VTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY
Sbjct  113  ILGTLVGIFKPSLVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQY  172

Query  704  LIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            LIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  173  LIKPILGFLIAMTLKLSAPLATGLILVSCCPG  204



>ref|XP_006411100.1| hypothetical protein EUTSA_v10016729mg [Eutrema salsugineum]
 gb|ESQ52553.1| hypothetical protein EUTSA_v10016729mg [Eutrema salsugineum]
Length=411

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 155/212 (73%), Gaps = 10/212 (5%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQN-KPQ  343
            MASISR +  D R    +     S   + RR QSHL     +S ++   + LRIQN KP 
Sbjct  1    MASISRILPTDGRLSQCNSGIGASWVPATRRAQSHLVSPKLLSVSKAGIS-LRIQNSKPL  59

Query  344  VSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWV  523
             SV  +   +S         R++CKAA ++SGD+P ++   + QYE+IIE LTTLFP+WV
Sbjct  60   RSVFALESAASSS-------RVACKAAADLSGDVP-ETPKELGQYEKIIELLTTLFPLWV  111

Query  524  ILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQY  703
            ILGT++GI+KPS VTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY
Sbjct  112  ILGTLVGIFKPSLVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQY  171

Query  704  LIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            LIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  172  LIKPILGFLIAMTLKLSAPLATGLILVSCCPG  203



>ref|XP_010914977.1| PREDICTED: probable sodium/metabolite cotransporter BASS2, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=416

 Score =   195 bits (495),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/129 (82%), Positives = 121/129 (94%), Gaps = 0/129 (0%)
 Frame = +2

Query  413  CKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlft  592
            CKA TN+SGD+P  +SSGMS+YERI+E LTTLFPVWVI+GTVIGIYKP+AVTWLETDLFT
Sbjct  79   CKAETNISGDVPNSASSGMSKYERIVELLTTLFPVWVIIGTVIGIYKPAAVTWLETDLFT  138

Query  593  lslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATG  772
            + LGFLMLSMGLTLTF+DF+RC+RNPWTVG+GFLAQYLIKP+LG+ I+  LKLSAPLATG
Sbjct  139  VGLGFLMLSMGLTLTFEDFKRCMRNPWTVGIGFLAQYLIKPMLGFFIAMTLKLSAPLATG  198

Query  773  LILVSCCPG  799
            LILVSCCPG
Sbjct  199  LILVSCCPG  207



>ref|XP_008804047.1| PREDICTED: probable sodium/metabolite cotransporter BASS2, chloroplastic 
[Phoenix dactylifera]
Length=417

 Score =   194 bits (492),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  383  TPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSA  562
             PA    ++ CKA  N+SGD P  +SSGMSQYERI+E LTTLFPVWVI+GT++GIYKP+A
Sbjct  70   VPASRTRQVLCKAEANISGDAPNSASSGMSQYERIVELLTTLFPVWVIIGTIVGIYKPAA  129

Query  563  VTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRA  742
            VTWLETDLFT+ LGFLMLSMGLTLTF+DFRRC+RNPWTVG+GF+AQYLIKP+LG+ I+  
Sbjct  130  VTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCMRNPWTVGIGFIAQYLIKPMLGFFIAMT  189

Query  743  LKLSAPLATGLILVSCCPG  799
            LKLSAPLATGLILVSCCPG
Sbjct  190  LKLSAPLATGLILVSCCPG  208



>ref|XP_009387169.1| PREDICTED: probable sodium/metabolite cotransporter BASS2, chloroplastic 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=368

 Score =   191 bits (484),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 119/138 (86%), Gaps = 0/138 (0%)
 Frame = +2

Query  386  PALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAV  565
            P L   ++ CKA  N SGD P +  + MSQYE I+E LTTLFPVWVILGT+IGIYKPS V
Sbjct  22   PVLRSRQVLCKAEANASGDFPNNPVAEMSQYENIVELLTTLFPVWVILGTIIGIYKPSMV  81

Query  566  TWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRAL  745
            TWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKPLLG+AI+  L
Sbjct  82   TWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPLLGFAIAMTL  141

Query  746  KLSAPLATGLILVSCCPG  799
            KLSAPLATGLILVSCCPG
Sbjct  142  KLSAPLATGLILVSCCPG  159



>ref|XP_002456043.1| hypothetical protein SORBIDRAFT_03g029420 [Sorghum bicolor]
 gb|EES01163.1| hypothetical protein SORBIDRAFT_03g029420 [Sorghum bicolor]
Length=414

 Score =   191 bits (484),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +2

Query  383  TPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSA  562
            TP L   ++ CKA  NVS ++P    +G+SQYE+I+E LTTLFPVWVILGT+IGIYKPS 
Sbjct  67   TPVLRSRQILCKAEANVSSNLPDTLPTGVSQYEKIVELLTTLFPVWVILGTIIGIYKPSM  126

Query  563  VTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRA  742
            VTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKP+LG++I+ A
Sbjct  127  VTWLETDLFTMGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPMLGFSIALA  186

Query  743  LKLSAPLATGLILVSCCPG  799
            LKLSAPLATGLILVSCCPG
Sbjct  187  LKLSAPLATGLILVSCCPG  205



>ref|XP_003609203.1| Bile acid Na+ symporter family protein [Medicago truncatula]
Length=423

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 127/226 (56%), Positives = 159/226 (70%), Gaps = 26/226 (12%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRR--IQSHLCFRDGVSKTEPKKNCLRIQNKP  340
            MAS+ R + +D   L      KP++ + PRR  + +H   ++   +    ++ L+  N P
Sbjct  1    MASMPRVIFRDHAIL------KPNYTYLPRRNLLNNHFDVKEN-GRNFAIRSELQGPN-P  52

Query  341  QVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVW  520
             V+    L L  +K+      ++ C A+TN+SGD+P +S+ G+SQYE+IIETLTTLFPVW
Sbjct  53   VVAAAAKLPLVHLKSKR--NSQILCSASTNISGDVP-ESAGGLSQYEKIIETLTTLFPVW  109

Query  521  VILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWT--------  676
            VILG ++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTFDDFRRCLRNPWT        
Sbjct  110  VILGALLGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFDDFRRCLRNPWTVRDNYLCL  169

Query  677  -----VGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
                 VGVGFLAQYLIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  170  EQMLSVGVGFLAQYLIKPVLGFFIAMTLKLSAPLATGLILVSCCPG  215



>ref|XP_006294303.1| hypothetical protein CARUB_v10023312mg [Capsella rubella]
 gb|EOA27201.1| hypothetical protein CARUB_v10023312mg [Capsella rubella]
Length=399

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 149/219 (68%), Gaps = 23/219 (11%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNC-------LR  325
            MASISR +  D R   F  +   +   S  R Q+ L        + PK  C       LR
Sbjct  1    MASISRILPTDGRLSQFRINTCCAPATS--RAQTLL-------DSSPKLVCVRSSGISLR  51

Query  326  IQN-KPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLT  502
            +QN KP  SV  +   SS     +      CKAA  VSGD+P  +   +SQYE+ IE LT
Sbjct  52   VQNCKPLRSVSALEATSSRSRSVV------CKAAAGVSGDVPESTPKELSQYEKTIELLT  105

Query  503  TLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVG  682
            TLFP+WVILGT++GI+KPS VTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVG
Sbjct  106  TLFPLWVILGTLVGIFKPSLVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVG  165

Query  683  VGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            VGFLAQYLIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  166  VGFLAQYLIKPVLGFLIAMTLKLSAPLATGLILVSCCPG  204



>ref|XP_009387168.1| PREDICTED: probable sodium/metabolite cotransporter BASS2, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=401

 Score =   189 bits (481),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +2

Query  368  LSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGI  547
            ++S   P L   ++ CKA  N SGD P +  + MSQYE I+E LTTLFPVWVILGT+IGI
Sbjct  79   MASPIIPVLRSRQVLCKAEANASGDFPNNPVAEMSQYENIVELLTTLFPVWVILGTIIGI  138

Query  548  YKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGY  727
            YKPS VTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKPLLG+
Sbjct  139  YKPSMVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPLLGF  198

Query  728  AISRALKLSAPLATGLILVSCCPG  799
            AI+  LKLSAPLATGLILVSCCPG
Sbjct  199  AIAMTLKLSAPLATGLILVSCCPG  222



>ref|XP_009387167.1| PREDICTED: probable sodium/metabolite cotransporter BASS2, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=431

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = +2

Query  368  LSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGI  547
            ++S   P L   ++ CKA  N SGD P +  + MSQYE I+E LTTLFPVWVILGT+IGI
Sbjct  79   MASPIIPVLRSRQVLCKAEANASGDFPNNPVAEMSQYENIVELLTTLFPVWVILGTIIGI  138

Query  548  YKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGY  727
            YKPS VTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKPLLG+
Sbjct  139  YKPSMVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPLLGF  198

Query  728  AISRALKLSAPLATGLILVSCCPG  799
            AI+  LKLSAPLATGLILVSCCPG
Sbjct  199  AIAMTLKLSAPLATGLILVSCCPG  222



>dbj|BAJ88629.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=413

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +2

Query  371  SSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIY  550
            S+   P +   ++ CKA  N+S ++P    +G SQYE+I+E LTTLFPVWVILGTVIGIY
Sbjct  62   STTLVPVVRSRQIFCKAEANISSNLPASGPTGASQYEKIVELLTTLFPVWVILGTVIGIY  121

Query  551  KPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYA  730
            KPS VTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKP+LGYA
Sbjct  122  KPSMVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPMLGYA  181

Query  731  ISRALKLSAPLATGLILVSCCPG  799
            I+  LKLSAPLATGLILVSCCPG
Sbjct  182  IALTLKLSAPLATGLILVSCCPG  204



>ref|XP_006294304.1| hypothetical protein CARUB_v10023312mg [Capsella rubella]
 gb|EOA27202.1| hypothetical protein CARUB_v10023312mg [Capsella rubella]
Length=412

 Score =   189 bits (479),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 149/219 (68%), Gaps = 23/219 (11%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNC-------LR  325
            MASISR +  D R   F  +   +   S  R Q+ L        + PK  C       LR
Sbjct  1    MASISRILPTDGRLSQFRINTCCAPATS--RAQTLL-------DSSPKLVCVRSSGISLR  51

Query  326  IQN-KPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLT  502
            +QN KP  SV  +   SS     +      CKAA  VSGD+P  +   +SQYE+ IE LT
Sbjct  52   VQNCKPLRSVSALEATSSRSRSVV------CKAAAGVSGDVPESTPKELSQYEKTIELLT  105

Query  503  TLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVG  682
            TLFP+WVILGT++GI+KPS VTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVG
Sbjct  106  TLFPLWVILGTLVGIFKPSLVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVG  165

Query  683  VGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            VGFLAQYLIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  166  VGFLAQYLIKPVLGFLIAMTLKLSAPLATGLILVSCCPG  204



>emb|CDM83534.1| unnamed protein product [Triticum aestivum]
Length=413

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +2

Query  386  PALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAV  565
            P +   ++ CKA  N+S ++P    +G SQYE+I+E LTTLFPVWVILGTVIGIYKPS V
Sbjct  67   PVVRSRQIFCKAEANISSNLPASEPTGASQYEKIVELLTTLFPVWVILGTVIGIYKPSMV  126

Query  566  TWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRAL  745
            TWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKP+LGYAI+  L
Sbjct  127  TWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPMLGYAIALTL  186

Query  746  KLSAPLATGLILVSCCPG  799
            KLSAPLATGLILVSCCPG
Sbjct  187  KLSAPLATGLILVSCCPG  204



>ref|XP_003569443.1| PREDICTED: probable sodium/metabolite cotransporter BASS2, chloroplastic 
[Brachypodium distachyon]
Length=417

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 150/220 (68%), Gaps = 14/220 (6%)
 Frame = +2

Query  140  PTAASSNQPMASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNC  319
            P+A      MAS+SR +    R L+   +  P  G   R   S   +     KTE   + 
Sbjct  3    PSATCPPHSMASVSRALRPRPR-LATACTAAPRLGCGSRVACSVPAYGGATEKTE---HG  58

Query  320  LRIQNKPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETL  499
            L I +           L++   P +   ++ CKA  N+S ++P   ++G+SQYE+I+E L
Sbjct  59   LAIAST----------LAATVGPVVRSRQILCKAEANISSNLPESVANGVSQYEKIVELL  108

Query  500  TTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTV  679
            TTLFPVWVILGTVIGIYKPS VTWLETDLFT+ LGFLMLSMGLTLTF+DFRRC++NPWTV
Sbjct  109  TTLFPVWVILGTVIGIYKPSMVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCMKNPWTV  168

Query  680  GVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            GVGF+AQY IKPLLGYAI+  LKLSAPLATGLILVSCCPG
Sbjct  169  GVGFIAQYFIKPLLGYAIALTLKLSAPLATGLILVSCCPG  208



>gb|EMT10994.1| Putative sodium-dependent transporter yocS [Aegilops tauschii]
Length=449

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +2

Query  386  PALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAV  565
            P +   ++ CKA  N+S ++P    +G SQYE+I+E LTTLFPVWVILGTVIGIYKPS V
Sbjct  67   PVVRSRQIFCKAEANISSNLPASEPTGASQYEKIVELLTTLFPVWVILGTVIGIYKPSMV  126

Query  566  TWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRAL  745
            TWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKP+LGYAI+  L
Sbjct  127  TWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPMLGYAIALTL  186

Query  746  KLSAPLATGLILVSCCPG  799
            KLSAPLATGLILVSCCPG
Sbjct  187  KLSAPLATGLILVSCCPG  204



>gb|EMS55498.1| putative sodium-dependent transporter yocS [Triticum urartu]
Length=457

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +2

Query  404  RLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETD  583
            ++ CKA  N+S ++P    +G SQYE+I+E LTTLFPVWVILGTVIGIYKPS VTWLETD
Sbjct  89   QIFCKAEANISSNLPASKPTGASQYEKIVELLTTLFPVWVILGTVIGIYKPSMVTWLETD  148

Query  584  lftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPL  763
            LFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKP+LGYAI+ +LKLSAPL
Sbjct  149  LFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPMLGYAIALSLKLSAPL  208

Query  764  ATGLILVSCCPG  799
            ATGLILVSCCPG
Sbjct  209  ATGLILVSCCPG  220



>gb|ABK24409.1| unknown [Picea sitchensis]
Length=423

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +2

Query  398  KLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLE  577
            ++++ CKA  N  GD+PG +SS MS +ER++E LTTLFPVWV++G  IGIYKPS VTWL+
Sbjct  81   RMQMLCKAEANAVGDVPGSASSEMSPFERVVELLTTLFPVWVVIGAAIGIYKPSVVTWLQ  140

Query  578  TDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSA  757
            TDLFTL LGFLMLSMGLTL FDDF+RCLRNPWTVGVGFLAQYLIKPLLG+AI+ +LKLSA
Sbjct  141  TDLFTLGLGFLMLSMGLTLKFDDFKRCLRNPWTVGVGFLAQYLIKPLLGFAIALSLKLSA  200

Query  758  PLATGLILVSCCPG  799
            PLATGLILVSCCPG
Sbjct  201  PLATGLILVSCCPG  214



>ref|XP_009403017.1| PREDICTED: probable sodium/metabolite cotransporter BASS2, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=381

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +2

Query  368  LSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGI  547
            ++S   P L   ++ CKA  NVSGDI     + MSQYERIIE LTTLFPVWV+LGT+IGI
Sbjct  79   MTSTIIPVLRSRQVLCKAEANVSGDILNSPVAEMSQYERIIELLTTLFPVWVMLGTIIGI  138

Query  548  YKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGY  727
             KPS VTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKP+LG+
Sbjct  139  NKPSMVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPMLGF  198

Query  728  AISRALKLSAPLATGLILVSCCPG  799
             I+  LKLSAPLATGLILVSCCPG
Sbjct  199  TIAMTLKLSAPLATGLILVSCCPG  222



>ref|XP_009403016.1| PREDICTED: probable sodium/metabolite cotransporter BASS2, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=431

 Score =   186 bits (473),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = +2

Query  368  LSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGI  547
            ++S   P L   ++ CKA  NVSGDI     + MSQYERIIE LTTLFPVWV+LGT+IGI
Sbjct  79   MTSTIIPVLRSRQVLCKAEANVSGDILNSPVAEMSQYERIIELLTTLFPVWVMLGTIIGI  138

Query  548  YKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGY  727
             KPS VTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKP+LG+
Sbjct  139  NKPSMVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPMLGF  198

Query  728  AISRALKLSAPLATGLILVSCCPG  799
             I+  LKLSAPLATGLILVSCCPG
Sbjct  199  TIAMTLKLSAPLATGLILVSCCPG  222



>ref|XP_006644431.1| PREDICTED: probable sodium/metabolite cotransporter BASS2, chloroplastic-like 
[Oryza brachyantha]
Length=418

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +2

Query  404  RLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETD  583
            ++ CKA  N+S ++P    SG +QYE+I+E LTTLFPVWVILGT+IGIYKPS VTWLETD
Sbjct  78   QILCKAEANISSNLPESIPSGENQYEKIVELLTTLFPVWVILGTIIGIYKPSMVTWLETD  137

Query  584  lftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPL  763
            LFT+ LGFLMLSMGLTLTF+DFRRC+RNPWTVGVGFLAQYLIKP+LG+AI+ +LKLSAPL
Sbjct  138  LFTVGLGFLMLSMGLTLTFEDFRRCMRNPWTVGVGFLAQYLIKPMLGFAIAMSLKLSAPL  197

Query  764  ATGLILVSCCPG  799
            ATGLILVSCCPG
Sbjct  198  ATGLILVSCCPG  209



>gb|AAT68201.1| unknown [Cynodon dactylon]
Length=219

 Score =   178 bits (452),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 119/139 (86%), Gaps = 7/139 (5%)
 Frame = +2

Query  404  RLSCKAATNVSGDIPG-------DSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSA  562
            ++ CKA  N+S +IP        +S   +SQYE+++E LTTLFPVWVILGT+IGIYKPS 
Sbjct  8    QILCKAEVNISSNIPESLPSSVPESKPEVSQYEKVVELLTTLFPVWVILGTIIGIYKPSM  67

Query  563  VTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRA  742
            VTWLETDLFTL LGFLMLSMGLTLTFDDF+RCLRNPWTVGVGF+AQYLIKPLLG+AI+ +
Sbjct  68   VTWLETDLFTLGLGFLMLSMGLTLTFDDFKRCLRNPWTVGVGFVAQYLIKPLLGFAIATS  127

Query  743  LKLSAPLATGLILVSCCPG  799
            L LSAPLATGL+LVSCCPG
Sbjct  128  LNLSAPLATGLVLVSCCPG  146



>ref|XP_009141764.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Brassica rapa]
Length=411

 Score =   183 bits (465),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 155/222 (70%), Gaps = 30/222 (14%)
 Frame = +2

Query  167  MASISRFVGKDSRF---LSFDP------SQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNC  319
            MASISR +  D R     S+ P      +Q P     P  ++     + GVS        
Sbjct  1    MASISRVLPTDGRLSHCTSWVPVTLVRRAQTP-----PDSLKLFPVSKAGVS--------  47

Query  320  LRIQN--KPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIE  493
            LRIQN  +P  SV       ++++P+    R++C AA ++SGD P  +   +S+YE+IIE
Sbjct  48   LRIQNSSRPLRSV------FALESPSSRSSRVACNAAADLSGDAPESTPKELSKYEKIIE  101

Query  494  TLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPW  673
             LTTLFP+WVILGT++GI+KPS VTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPW
Sbjct  102  LLTTLFPLWVILGTLVGIFKPSFVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPW  161

Query  674  TVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            TVGVGFLAQY+IKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  162  TVGVGFLAQYMIKPVLGFLIAMTLKLSAPLATGLILVSCCPG  203



>ref|XP_011081192.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
[Sesamum indicum]
Length=445

 Score =   184 bits (467),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 116/132 (88%), Gaps = 2/132 (2%)
 Frame = +2

Query  404  RLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETD  583
            R+ CKAAT  SGD    +   MSQYERIIE LTTLFPVWVILGT+IGIYKP+ VTWLETD
Sbjct  108  RVHCKAAT--SGDFSSSAPGQMSQYERIIEILTTLFPVWVILGTIIGIYKPAMVTWLETD  165

Query  584  lftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPL  763
            LFT+ LGFLMLSMGLTLTFDDF+RCLRNPWTVGVGFLAQYLIKP+LG+ I+  LKLSAPL
Sbjct  166  LFTVGLGFLMLSMGLTLTFDDFKRCLRNPWTVGVGFLAQYLIKPMLGFFIAMTLKLSAPL  225

Query  764  ATGLILVSCCPG  799
            ATGLILVSCCPG
Sbjct  226  ATGLILVSCCPG  237



>ref|NP_001043701.1| Os01g0645200 [Oryza sativa Japonica Group]
 sp|Q5VRB2.1|BASS2_ORYSJ RecName: Full=Probable sodium/metabolite cotransporter BASS2, 
chloroplastic; AltName: Full=Bile acid-sodium symporter family 
protein 2; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD68006.1| Na(+) dependent transporter-like [Oryza sativa Japonica Group]
 dbj|BAF05615.1| Os01g0645200 [Oryza sativa Japonica Group]
 dbj|BAG91387.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71176.1| hypothetical protein OsI_03049 [Oryza sativa Indica Group]
 gb|EEE55076.1| hypothetical protein OsJ_02805 [Oryza sativa Japonica Group]
Length=419

 Score =   182 bits (463),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +2

Query  404  RLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETD  583
            +L CKA  N+S ++P    S  +QYE+I+E LTTLFPVWVILGT+IGIYKPS VTWLETD
Sbjct  79   QLLCKAEANISSNLPESIPSEANQYEKIVELLTTLFPVWVILGTIIGIYKPSMVTWLETD  138

Query  584  lftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPL  763
            LFT+ LGFLMLSMGLTLTF+DFRRC+RNPWTVGVGFLAQYLIKP+LG+AI+  LKLSAPL
Sbjct  139  LFTVGLGFLMLSMGLTLTFEDFRRCMRNPWTVGVGFLAQYLIKPMLGFAIAMTLKLSAPL  198

Query  764  ATGLILVSCCPG  799
            ATGLILVSCCPG
Sbjct  199  ATGLILVSCCPG  210



>ref|XP_003524523.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
[Glycine max]
 gb|KHN27388.1| Putative sodium-dependent transporter yocS [Glycine soja]
Length=414

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 121/132 (92%), Gaps = 1/132 (1%)
 Frame = +2

Query  404  RLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETD  583
            ++ C A T++SGDIP +S+  +SQYE++IETLTTLFPVWV+LG ++GIYKP+AVTWL TD
Sbjct  76   QIFCNATTDISGDIP-ESAGELSQYEKVIETLTTLFPVWVVLGAIVGIYKPTAVTWLATD  134

Query  584  lftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPL  763
            LF+L LGFLMLSMGLTLTF+DFRRCL+NPWTVG+GFLAQYLIKP+LG+AI+  LKLSAPL
Sbjct  135  LFSLGLGFLMLSMGLTLTFEDFRRCLQNPWTVGIGFLAQYLIKPMLGFAIAMTLKLSAPL  194

Query  764  ATGLILVSCCPG  799
            ATGLILV+CCPG
Sbjct  195  ATGLILVACCPG  206



>ref|XP_006600768.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X2 [Glycine max]
 gb|KHN15133.1| Putative sodium-dependent transporter yocS [Glycine soja]
Length=418

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = +2

Query  404  RLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETD  583
            ++ C A T++SGDIP +S+  +SQYE++IE LT LFPVWVILG ++GIYKP+AVTWL TD
Sbjct  80   KILCNATTDISGDIP-ESAGELSQYEKVIEILTALFPVWVILGAIVGIYKPTAVTWLATD  138

Query  584  lftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPL  763
            LF+L  GFL+LSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKP+LG+AI+  LKLSAPL
Sbjct  139  LFSLGFGFLILSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPMLGFAIAMTLKLSAPL  198

Query  764  ATGLILVSCCPG  799
            ATGLILV+CCPG
Sbjct  199  ATGLILVACCPG  210



>gb|EYU30455.1| hypothetical protein MIMGU_mgv1a005885mg [Erythranthe guttata]
 gb|EYU30456.1| hypothetical protein MIMGU_mgv1a005885mg [Erythranthe guttata]
Length=466

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 118/132 (89%), Gaps = 2/132 (2%)
 Frame = +2

Query  404  RLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETD  583
            ++ C A+T  SGD+ G +   MSQYE+IIETLTTLFPVWVILGTVIGIYKPS VTWL+TD
Sbjct  129  KVHCNAST--SGDLSGSTPGQMSQYEKIIETLTTLFPVWVILGTVIGIYKPSMVTWLQTD  186

Query  584  lftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPL  763
            LFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKP+LG+ ++  LKLSAPL
Sbjct  187  LFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPMLGFFLAMTLKLSAPL  246

Query  764  ATGLILVSCCPG  799
            ATGLILVSCCPG
Sbjct  247  ATGLILVSCCPG  258



>ref|XP_006600767.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X1 [Glycine max]
Length=446

 Score =   182 bits (461),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = +2

Query  404  RLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETD  583
            ++ C A T++SGDIP +S+  +SQYE++IE LT LFPVWVILG ++GIYKP+AVTWL TD
Sbjct  108  KILCNATTDISGDIP-ESAGELSQYEKVIEILTALFPVWVILGAIVGIYKPTAVTWLATD  166

Query  584  lftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPL  763
            LF+L  GFL+LSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKP+LG+AI+  LKLSAPL
Sbjct  167  LFSLGFGFLILSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPMLGFAIAMTLKLSAPL  226

Query  764  ATGLILVSCCPG  799
            ATGLILV+CCPG
Sbjct  227  ATGLILVACCPG  238



>ref|XP_006371928.1| hypothetical protein POPTR_0018s06390g [Populus trichocarpa]
 gb|ERP49725.1| hypothetical protein POPTR_0018s06390g [Populus trichocarpa]
Length=203

 Score =   173 bits (439),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 138/202 (68%), Gaps = 13/202 (6%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            MAS+ R V +D   L      KPS  F  RR+ +HL  R G++           QNKP+ 
Sbjct  1    MASVFRLVLQDCNLLPCQAIYKPSSCFPSRRLNTHLDPRAGIT-VPGNGRIWTTQNKPRS  59

Query  347  SVDGMLKLS------SIKTPALWKLRLSCKAATNVSGDIPGDSS-SGMSQYERIIETLTT  505
                +  LS      S + P     ++ C+AA N  GD+P  S+  GMSQYERIIETLTT
Sbjct  60   PTVALTALSPSSIIHSSRNP-----QVLCRAAANAPGDVPDSSTHGGMSQYERIIETLTT  114

Query  506  LFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGV  685
            LFPVWV+LGT++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGV
Sbjct  115  LFPVWVVLGTILGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGV  174

Query  686  GFLAQYLIKPLLGYAISRALKL  751
            GFLAQYLIKPLLG+ +  +L L
Sbjct  175  GFLAQYLIKPLLGFLLRSSLIL  196



>emb|CDX74891.1| BnaA05g06370D [Brassica napus]
Length=409

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 152/215 (71%), Gaps = 18/215 (8%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNC---LRIQN-  334
            MAS+SR +  D+R      S+ PS   + RR Q+     D + K  P  N    LR+QN 
Sbjct  1    MASLSRVLPTDARVRIQCTSRLPS--LTTRRSQAQ--SLDSL-KLFPVSNVGLSLRVQNS  55

Query  335  KPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFP  514
            KP  SV  +   SS  +      ++ C AA ++SG+    S   +SQYE+ IE LTTLFP
Sbjct  56   KPLSSVFALESASSRSS------KVVCNAAADLSGE---SSPKELSQYEKTIELLTTLFP  106

Query  515  VWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFL  694
            +WVILGT++GI+KPS VTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFL
Sbjct  107  LWVILGTLVGIFKPSLVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFL  166

Query  695  AQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            AQY+IKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  167  AQYMIKPVLGFLIAMTLKLSAPLATGLILVSCCPG  201



>emb|CDX93303.1| BnaC04g45930D [Brassica napus]
Length=411

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 125/217 (58%), Positives = 151/217 (70%), Gaps = 20/217 (9%)
 Frame = +2

Query  167  MASISRFVGKDSRF---LSFDPSQKPSHG-FSPRRIQSHLCFRDGVSKTEPKKNCLRIQN  334
            MASISR +  D R     S+ P    S    SP  ++     + GVS        LRIQN
Sbjct  1    MASISRILPTDGRLSHCTSWVPVTLMSRAQTSPDSLKLFPVGKAGVS--------LRIQN  52

Query  335  --KPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTL  508
              +P  SV       ++++ +    R+ C AA ++SGD P  +   +SQYE+ IE LTTL
Sbjct  53   SCRPLRSV------FALESASSRSSRVVCNAAADLSGDAPESTPKEISQYEKTIELLTTL  106

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            FP+WVILGT++GI+KPS VTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVG
Sbjct  107  FPLWVILGTLVGIFKPSLVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVG  166

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            FLAQY+IKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  167  FLAQYMIKPVLGFLIAMTLKLSAPLATGLILVSCCPG  203



>gb|EPS58359.1| hypothetical protein M569_16455, partial [Genlisea aurea]
Length=318

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 110/165 (67%), Positives = 127/165 (77%), Gaps = 10/165 (6%)
 Frame = +2

Query  305  PKKNCLRIQNKPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYER  484
            P+  CL+   KP       L  +  + P ++     C AA   SGDI  ++   +SQYE+
Sbjct  63   PESLCLK---KPADPGRASLMHNVFRNPGVY-----CSAAG--SGDILSNAPGKLSQYEK  112

Query  485  IIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLR  664
            IIETLTTLFPVWVILGT+IGIYKP+ VTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLR
Sbjct  113  IIETLTTLFPVWVILGTIIGIYKPALVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLR  172

Query  665  NPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            NPWTVGVGFLAQY+IKP LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  173  NPWTVGVGFLAQYVIKPALGFFIAMTLKLSAPLATGLILVSCCPG  217



>emb|CDY18367.1| BnaA04g22200D [Brassica napus]
Length=411

 Score =   177 bits (450),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 152/220 (69%), Gaps = 26/220 (12%)
 Frame = +2

Query  167  MASISRFVGKDSRF---LSFDP------SQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNC  319
            MASISR +  D R     S+ P      +Q P     P  ++     + GVS        
Sbjct  1    MASISRVLPTDGRLSHCTSWVPVTLVRRAQTP-----PDSLKLFPVGKAGVS--------  47

Query  320  LRIQNKPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETL  499
            LRIQN    S   +  + ++++ +    R++C AA ++SGD P  +   +SQYE+IIE L
Sbjct  48   LRIQN----SCRPLRSVFALESASSRSSRVACNAAADISGDAPESTPKELSQYEKIIELL  103

Query  500  TTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTV  679
            TTLFP+WVILGT++GI+KPS V WLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTV
Sbjct  104  TTLFPLWVILGTLVGIFKPSLVIWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTV  163

Query  680  GVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            GVGFLAQY+IKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  164  GVGFLAQYMIKPVLGFLIAMTLKLSAPLATGLILVSCCPG  203



>ref|XP_009143363.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
[Brassica rapa]
Length=411

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 121/212 (57%), Positives = 148/212 (70%), Gaps = 12/212 (6%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQN-KPQ  343
            MAS+SR +  D+R      S+ PS   + RR Q+       +         LR+Q+ KP 
Sbjct  3    MASLSRVLPTDARVRIQCTSRLPS--LTTRRSQAQSLDSIKLFPVGKTGVSLRVQSSKPL  60

Query  344  VSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWV  523
             SV  +   SS  +      ++ C AA ++SG+    S   +SQYE+ IE LTTLFP+WV
Sbjct  61   SSVFALESASSRSS------KVVCNAAADLSGE---SSPKELSQYEKTIELLTTLFPLWV  111

Query  524  ILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQY  703
            ILGT++GI+KPS VTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY
Sbjct  112  ILGTLVGIFKPSLVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQY  171

Query  704  LIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            +IKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  172  MIKPVLGFLIAMTLKLSAPLATGLILVSCCPG  203



>emb|CDX91487.1| BnaC04g06630D [Brassica napus]
Length=412

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 152/215 (71%), Gaps = 17/215 (8%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNC---LRIQN-  334
            MAS+SR +  DSR      S+ PS   + RR Q+     D + K  P  N    LR+Q+ 
Sbjct  3    MASLSRVLPTDSRVRIQCTSRLPS--LTTRRSQTQ--SLDSL-KLFPVSNVGLSLRVQSS  57

Query  335  KPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFP  514
            KP  SV  +   SS +       ++ C AA ++SG+    S   +SQYE+ IE LTTLFP
Sbjct  58   KPLSSVFALESASSSR-----SSKVVCNAAADLSGE---GSPKELSQYEKTIELLTTLFP  109

Query  515  VWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFL  694
            +WVILGT++GI+KPS VTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFL
Sbjct  110  LWVILGTLVGIFKPSLVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFL  169

Query  695  AQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            AQY+IKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  170  AQYMIKPVLGFLIAMTLKLSAPLATGLILVSCCPG  204



>ref|XP_010510842.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010510844.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=410

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 129/161 (80%), Gaps = 9/161 (6%)
 Frame = +2

Query  320  LRIQN-KPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIET  496
            LRIQN KP   V  +   ++ ++ ++      CKAA   +GD+P  +   +SQYE+ IE 
Sbjct  50   LRIQNSKPLRPVSALEATTTSRSSSV-----VCKAA---AGDVPESAPKELSQYEKTIEL  101

Query  497  LTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWT  676
            LTTLFP+WVILGT++GI+KPS VTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWT
Sbjct  102  LTTLFPLWVILGTLVGIFKPSLVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWT  161

Query  677  VGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            VGVGFLAQYLIKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  162  VGVGFLAQYLIKPVLGFLIAMTLKLSAPLATGLILVSCCPG  202



>ref|XP_010417834.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Camelina sativa]
Length=412

 Score =   173 bits (438),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 101/129 (78%), Positives = 114/129 (88%), Gaps = 3/129 (2%)
 Frame = +2

Query  413  CKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlft  592
            CKAA   +GD+P  +   +SQYE+ IE LTTLFP+WVILGT++GI+KPS VTWLETDLFT
Sbjct  79   CKAA---AGDVPESTPKELSQYEKTIELLTTLFPLWVILGTLVGIFKPSLVTWLETDLFT  135

Query  593  lslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATG  772
            L LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKP+LG+ I+  LKLSAPLATG
Sbjct  136  LGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPVLGFLIAMTLKLSAPLATG  195

Query  773  LILVSCCPG  799
            LILVSCCPG
Sbjct  196  LILVSCCPG  204



>ref|XP_007154938.1| hypothetical protein PHAVU_003G159600g [Phaseolus vulgaris]
 gb|ESW26932.1| hypothetical protein PHAVU_003G159600g [Phaseolus vulgaris]
Length=420

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 118/223 (53%), Positives = 148/223 (66%), Gaps = 23/223 (10%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGF--------SPRRIQSHLCF----RDGVSKTEPK  310
            MAS+S  + +D R  ++D   KPS           S   ++ H       R    +++ +
Sbjct  1    MASMSINILRDHRIGAYDALLKPSFRTPIWKKFRNSHLEVKGHFYLSESGRSRAIRSDLR  60

Query  311  KNCLRIQNKPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERII  490
               + I   P +++ G  + +S         ++  KA  + SGDIP +S+  MSQYE++I
Sbjct  61   GPVVAIVEFP-LTLQGFRRRNS---------QIFYKATADKSGDIP-ESAGEMSQYEKVI  109

Query  491  ETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNP  670
            ETL  LFPVWVILG ++GI KP+AVTWLE DLFTL LGFLMLSMGLTLTF+DFRRC RNP
Sbjct  110  ETLIILFPVWVILGAIVGICKPTAVTWLEKDLFTLGLGFLMLSMGLTLTFEDFRRCFRNP  169

Query  671  WTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            WTVGVGFLAQYLIKP+LG+AI   LKLSAPLATGLILVSCCPG
Sbjct  170  WTVGVGFLAQYLIKPMLGFAIVMTLKLSAPLATGLILVSCCPG  212



>ref|XP_010541878.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X3 [Tarenaya hassleriana]
Length=416

 Score =   172 bits (435),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 138/209 (66%), Gaps = 13/209 (6%)
 Frame = +2

Query  173  SISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQVSV  352
            SI+R V  D        ++  +     RR+Q+ L F  G +          IQ+K   + 
Sbjct  5    SITRIVPTDCGLRQSSGTKLCNFRLPTRRVQNRLDFGKGSA----------IQSKKSSNS  54

Query  353  DGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILG  532
               L  +S  T +    R++CK AT+VSGD    S SG + Y++IIE LTTLFPVWVILG
Sbjct  55   MVALASASTVTHSSRTTRIACKGATDVSGD---SSPSGTNTYQKIIELLTTLFPVWVILG  111

Query  533  TVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIK  712
            TVIGI KP+AVTW + DL TL + FLMLSMG+TLTF DF RCLRNPWTV VGFL QYLIK
Sbjct  112  TVIGINKPAAVTWFKADLSTLGMKFLMLSMGMTLTFKDFGRCLRNPWTVVVGFLVQYLIK  171

Query  713  PLLGYAISRALKLSAPLATGLILVSCCPG  799
            P+LG+ I+ +LKLS PLATGLILVSCCPG
Sbjct  172  PMLGFVIATSLKLSRPLATGLILVSCCPG  200



>ref|XP_010541881.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X6 [Tarenaya hassleriana]
Length=370

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 138/209 (66%), Gaps = 13/209 (6%)
 Frame = +2

Query  173  SISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQVSV  352
            SI+R V  D        ++  +     RR+Q+ L F  G +          IQ+K   + 
Sbjct  5    SITRIVPTDCGLRQSSGTKLCNFRLPTRRVQNRLDFGKGSA----------IQSKKSSNS  54

Query  353  DGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILG  532
               L  +S  T +    R++CK AT+VSGD    S SG + Y++IIE LTTLFPVWVILG
Sbjct  55   MVALASASTVTHSSRTTRIACKGATDVSGD---SSPSGTNTYQKIIELLTTLFPVWVILG  111

Query  533  TVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIK  712
            TVIGI KP+AVTW + DL TL + FLMLSMG+TLTF DF RCLRNPWTV VGFL QYLIK
Sbjct  112  TVIGINKPAAVTWFKADLSTLGMKFLMLSMGMTLTFKDFGRCLRNPWTVVVGFLVQYLIK  171

Query  713  PLLGYAISRALKLSAPLATGLILVSCCPG  799
            P+LG+ I+ +LKLS PLATGLILVSCCPG
Sbjct  172  PMLGFVIATSLKLSRPLATGLILVSCCPG  200



>ref|XP_010541879.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X4 [Tarenaya hassleriana]
Length=409

 Score =   171 bits (434),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 138/209 (66%), Gaps = 13/209 (6%)
 Frame = +2

Query  173  SISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQVSV  352
            SI+R V  D        ++  +     RR+Q+ L F  G +          IQ+K   + 
Sbjct  5    SITRIVPTDCGLRQSSGTKLCNFRLPTRRVQNRLDFGKGSA----------IQSKKSSNS  54

Query  353  DGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILG  532
               L  +S  T +    R++CK AT+VSGD    S SG + Y++IIE LTTLFPVWVILG
Sbjct  55   MVALASASTVTHSSRTTRIACKGATDVSGD---SSPSGTNTYQKIIELLTTLFPVWVILG  111

Query  533  TVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIK  712
            TVIGI KP+AVTW + DL TL + FLMLSMG+TLTF DF RCLRNPWTV VGFL QYLIK
Sbjct  112  TVIGINKPAAVTWFKADLSTLGMKFLMLSMGMTLTFKDFGRCLRNPWTVVVGFLVQYLIK  171

Query  713  PLLGYAISRALKLSAPLATGLILVSCCPG  799
            P+LG+ I+ +LKLS PLATGLILVSCCPG
Sbjct  172  PMLGFVIATSLKLSRPLATGLILVSCCPG  200



>ref|XP_010541877.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=440

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 138/209 (66%), Gaps = 13/209 (6%)
 Frame = +2

Query  173  SISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQVSV  352
            SI+R V  D        ++  +     RR+Q+ L F  G +          IQ+K   + 
Sbjct  5    SITRIVPTDCGLRQSSGTKLCNFRLPTRRVQNRLDFGKGSA----------IQSKKSSNS  54

Query  353  DGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILG  532
               L  +S  T +    R++CK AT+VSGD    S SG + Y++IIE LTTLFPVWVILG
Sbjct  55   MVALASASTVTHSSRTTRIACKGATDVSGD---SSPSGTNTYQKIIELLTTLFPVWVILG  111

Query  533  TVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIK  712
            TVIGI KP+AVTW + DL TL + FLMLSMG+TLTF DF RCLRNPWTV VGFL QYLIK
Sbjct  112  TVIGINKPAAVTWFKADLSTLGMKFLMLSMGMTLTFKDFGRCLRNPWTVVVGFLVQYLIK  171

Query  713  PLLGYAISRALKLSAPLATGLILVSCCPG  799
            P+LG+ I+ +LKLS PLATGLILVSCCPG
Sbjct  172  PMLGFVIATSLKLSRPLATGLILVSCCPG  200



>ref|XP_010541880.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X5 [Tarenaya hassleriana]
Length=377

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 138/209 (66%), Gaps = 13/209 (6%)
 Frame = +2

Query  173  SISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQVSV  352
            SI+R V  D        ++  +     RR+Q+ L F  G +          IQ+K   + 
Sbjct  5    SITRIVPTDCGLRQSSGTKLCNFRLPTRRVQNRLDFGKGSA----------IQSKKSSNS  54

Query  353  DGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILG  532
               L  +S  T +    R++CK AT+VSGD    S SG + Y++IIE LTTLFPVWVILG
Sbjct  55   MVALASASTVTHSSRTTRIACKGATDVSGD---SSPSGTNTYQKIIELLTTLFPVWVILG  111

Query  533  TVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIK  712
            TVIGI KP+AVTW + DL TL + FLMLSMG+TLTF DF RCLRNPWTV VGFL QYLIK
Sbjct  112  TVIGINKPAAVTWFKADLSTLGMKFLMLSMGMTLTFKDFGRCLRNPWTVVVGFLVQYLIK  171

Query  713  PLLGYAISRALKLSAPLATGLILVSCCPG  799
            P+LG+ I+ +LKLS PLATGLILVSCCPG
Sbjct  172  PMLGFVIATSLKLSRPLATGLILVSCCPG  200



>ref|XP_010541876.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=447

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 113/209 (54%), Positives = 138/209 (66%), Gaps = 13/209 (6%)
 Frame = +2

Query  173  SISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQVSV  352
            SI+R V  D        ++  +     RR+Q+ L F  G +          IQ+K   + 
Sbjct  5    SITRIVPTDCGLRQSSGTKLCNFRLPTRRVQNRLDFGKGSA----------IQSKKSSNS  54

Query  353  DGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILG  532
               L  +S  T +    R++CK AT+VSGD    S SG + Y++IIE LTTLFPVWVILG
Sbjct  55   MVALASASTVTHSSRTTRIACKGATDVSGD---SSPSGTNTYQKIIELLTTLFPVWVILG  111

Query  533  TVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIK  712
            TVIGI KP+AVTW + DL TL + FLMLSMG+TLTF DF RCLRNPWTV VGFL QYLIK
Sbjct  112  TVIGINKPAAVTWFKADLSTLGMKFLMLSMGMTLTFKDFGRCLRNPWTVVVGFLVQYLIK  171

Query  713  PLLGYAISRALKLSAPLATGLILVSCCPG  799
            P+LG+ I+ +LKLS PLATGLILVSCCPG
Sbjct  172  PMLGFVIATSLKLSRPLATGLILVSCCPG  200



>ref|XP_004969305.1| PREDICTED: probable sodium/metabolite cotransporter BASS2, chloroplastic-like 
[Setaria italica]
Length=421

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 121/161 (75%), Gaps = 18/161 (11%)
 Frame = +2

Query  371  SSIKTPALWKLRLSCKAATNVSGDIPG------------------DSSSGMSQYERIIET  496
            S+  TPAL + ++ C+A  N+S ++P                      + +SQYE+I+E 
Sbjct  52   SATVTPALRRRQILCQAEANISNNLPEKLPAKVSQPAKVSQPAEVSQPAEVSQYEKIVEL  111

Query  497  LTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWT  676
            LTTLFPVWVI+GTVIGIYKP+ VTWL+TDLFT+ LG LMLSMGLTLTF+DFRRCLRNPWT
Sbjct  112  LTTLFPVWVIIGTVIGIYKPAMVTWLDTDLFTIGLGLLMLSMGLTLTFEDFRRCLRNPWT  171

Query  677  VGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            VG+GFLAQY +KPLLG AI+  LKL APLATGLILVSCCPG
Sbjct  172  VGIGFLAQYCVKPLLGLAIATTLKLPAPLATGLILVSCCPG  212



>ref|XP_001775120.1| predicted protein [Physcomitrella patens]
 gb|EDQ60092.1| predicted protein [Physcomitrella patens]
Length=360

 Score =   166 bits (419),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +2

Query  407  LSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDl  586
            + C A    SG     +   ++ +E++++ LTT+FPVWVILGT+IGIYKPSAVTWL TDL
Sbjct  21   IVCGAEVGASGGAEVSAPRELNSFEKVVDVLTTMFPVWVILGTLIGIYKPSAVTWLNTDL  80

Query  587  ftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLA  766
            FTL LGFLMLSMGLTLT +DFRRCLRNPWTVGVGF+AQYL+KP+LG+ I+ ALKLSAPLA
Sbjct  81   FTLCLGFLMLSMGLTLTVEDFRRCLRNPWTVGVGFVAQYLVKPVLGFVIAHALKLSAPLA  140

Query  767  TGLILVSCCPG  799
            TGLILVSCCPG
Sbjct  141  TGLILVSCCPG  151



>ref|XP_002975058.1| hypothetical protein SELMODRAFT_174757 [Selaginella moellendorffii]
 gb|EFJ23843.1| hypothetical protein SELMODRAFT_174757 [Selaginella moellendorffii]
Length=410

 Score =   165 bits (417),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 114/131 (87%), Gaps = 4/131 (3%)
 Frame = +2

Query  407  LSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDl  586
            + C AA + +G+IP      +S +ER++E LTT+FPVWVILGTVIGI KP+AVTWL+TDL
Sbjct  75   VECHAAAS-AGEIPEKE---LSTFERVVELLTTMFPVWVILGTVIGIVKPTAVTWLQTDL  130

Query  587  ftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLA  766
            FT+ LGFLMLSMGLTLTFDDFRRCLRNPWTVGVGFLAQY +KP+LG+ I+ +LKLSAPLA
Sbjct  131  FTVGLGFLMLSMGLTLTFDDFRRCLRNPWTVGVGFLAQYAVKPILGFLIALSLKLSAPLA  190

Query  767  TGLILVSCCPG  799
            TGLILVSCCPG
Sbjct  191  TGLILVSCCPG  201



>ref|XP_006371924.1| hypothetical protein POPTR_0018s06390g [Populus trichocarpa]
 gb|ERP49721.1| hypothetical protein POPTR_0018s06390g [Populus trichocarpa]
Length=133

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/116 (78%), Positives = 102/116 (88%), Gaps = 1/116 (1%)
 Frame = +2

Query  413  CKAATNVSGDIPGDSS-SGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlf  589
            C+AA N  GD+P  S+  GMSQYERIIETLTTLFPVWV+LGT++GIYKP+AVTWLETDLF
Sbjct  13   CRAAANAPGDVPDSSTHGGMSQYERIIETLTTLFPVWVVLGTILGIYKPAAVTWLETDLF  72

Query  590  tlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSA  757
            TL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQYLIKPLLG+ +  +L L  
Sbjct  73   TLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYLIKPLLGFLLRSSLILGV  128



>gb|AAC32250.1| putative Na+ dependent ileal bile acid transporter [Arabidopsis 
thaliana]
Length=338

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 110/149 (74%), Gaps = 19/149 (13%)
 Frame = +2

Query  353  DGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILG  532
            DG L    I T      R+ CKAA  VSGD+P  +   +SQYE+IIE LTTLFP+WV   
Sbjct  11   DGRLSQCRINTS-----RVVCKAAAGVSGDLPESTPKELSQYEKIIELLTTLFPLWV---  62

Query  533  TVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIK  712
                       TWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPWTVGVGFLAQY+IK
Sbjct  63   -----------TWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPWTVGVGFLAQYMIK  111

Query  713  PLLGYAISRALKLSAPLATGLILVSCCPG  799
            P+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  112  PILGFLIAMTLKLSAPLATGLILVSCCPG  140



>gb|KJB64838.1| hypothetical protein B456_010G067700 [Gossypium raimondii]
Length=355

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 128/187 (68%), Gaps = 6/187 (3%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRI--QSHLCFRDGVSKTEPKKNCLRIQNKP  340
            MA++SRFV KD  F       + S    P R   ++HL  R G+S  E  K    IQ KP
Sbjct  1    MATLSRFVVKDCNFHKHHAVCRTSSSLVPSRTLRRAHLDVRAGISLPENGKG-FAIQRKP  59

Query  341  QVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVW  520
               +  +   +SI TPA    ++ C AA NVSGDIP  + SGMS+YERIIETLTTLFPVW
Sbjct  60   SGPLVSLAAPASI-TPASRDPQVICNAAANVSGDIP--TPSGMSKYERIIETLTTLFPVW  116

Query  521  VILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQ  700
            VILGT+IGIYKP+AVTWLETDLFT+ LGFLMLSMGLTLTF+DFRRCLRNPWTV    +  
Sbjct  117  VILGTIIGIYKPAAVTWLETDLFTVGLGFLMLSMGLTLTFEDFRRCLRNPWTVRCSTIGA  176

Query  701  YLIKPLL  721
             ++ PLL
Sbjct  177  IVMTPLL  183



>ref|XP_010474527.1| PREDICTED: sodium/pyruvate cotransporter BASS2, chloroplastic 
[Camelina sativa]
Length=351

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 112/214 (52%), Positives = 138/214 (64%), Gaps = 30/214 (14%)
 Frame = +2

Query  167  MASISRFVGKDSRF------LSFDPSQKPSHGF----SPRRIQSHLCFRDGVSKTEPKKN  316
            MASISR +  D R         + P+ + S       SPR +        G+S       
Sbjct  1    MASISRILPTDGRLSQCRINTCWVPATRRSRAQTLLDSPRLVTVR---SSGIS-------  50

Query  317  CLRIQN-KPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIE  493
             LRIQN KP   V  +   ++ ++ ++      CKAA   +GD+P  +   +SQYE+ IE
Sbjct  51   -LRIQNSKPLRPVSALEATTTSRSSSV-----VCKAA---AGDVPESTPKELSQYEKTIE  101

Query  494  TLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPW  673
             LTTLFP+WVILGT++GI+KPS VTWLETDLFTL LGFLMLSMGLTLTF+DFRRCLRNPW
Sbjct  102  LLTTLFPLWVILGTLVGIFKPSLVTWLETDLFTLGLGFLMLSMGLTLTFEDFRRCLRNPW  161

Query  674  TVGVGFLAQYLIKPLLGYAISRALKLSAPLATGL  775
            TVGVGFLAQYLIKP+LG+ I+  LKLSA    GL
Sbjct  162  TVGVGFLAQYLIKPVLGFLIAMTLKLSAXTYQGL  195



>ref|XP_006371925.1| hypothetical protein POPTR_0018s06390g [Populus trichocarpa]
 gb|ERP49722.1| hypothetical protein POPTR_0018s06390g [Populus trichocarpa]
Length=102

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 90/97 (93%), Gaps = 0/97 (0%)
 Frame = +2

Query  467  MSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDD  646
            MSQYERIIETLTTLFPVWV+LGT++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTF+D
Sbjct  1    MSQYERIIETLTTLFPVWVVLGTILGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFED  60

Query  647  FRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSA  757
            FRRCLRNPWTVGVGFLAQYLIKPLLG+ +  +L L  
Sbjct  61   FRRCLRNPWTVGVGFLAQYLIKPLLGFLLRSSLILGV  97



>ref|XP_006371923.1| hypothetical protein POPTR_0018s06390g [Populus trichocarpa]
 gb|ERP49720.1| hypothetical protein POPTR_0018s06390g [Populus trichocarpa]
Length=98

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/90 (90%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +2

Query  467  MSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDD  646
            MSQYERIIETLTTLFPVWV+LGT++GIYKP+AVTWLETDLFTL LGFLMLSMGLTLTF+D
Sbjct  1    MSQYERIIETLTTLFPVWVVLGTILGIYKPAAVTWLETDLFTLGLGFLMLSMGLTLTFED  60

Query  647  FRRCLRNPWTVGVGFLAQYLIKPLLGYAIS  736
            FRRCLRNPWTVGVGFLAQYLIKPLLG+ I+
Sbjct  61   FRRCLRNPWTVGVGFLAQYLIKPLLGFVIA  90



>ref|XP_005650028.1| SBF-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25484.1| SBF-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=336

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +2

Query  476  YERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRR  655
            +E+  E LTTLFPVWV LG  +GI +PSA+ W ++DLFT  LGFLMLSMGLTLT DDF++
Sbjct  27   FEQFTEVLTTLFPVWVCLGAALGISRPSALLWFKSDLFTYGLGFLMLSMGLTLTLDDFKQ  86

Query  656  CLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            C++NP  +GVG+LAQY++KPLLGY I++ L LS PLA GLILVSCCPG
Sbjct  87   CIKNPVPIGVGYLAQYIVKPLLGYLIAKVLNLSPPLAVGLILVSCCPG  134



>gb|AAO41972.1| putative Na+ dependent ileal bile acid transporter [Arabidopsis 
thaliana]
Length=271

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  641  DDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            +DFRRCLRNPWTVGVGFLAQY+IKP+LG+ I+  LKLSAPLATGLILVSCCPG
Sbjct  11   EDFRRCLRNPWTVGVGFLAQYMIKPILGFLIAMTLKLSAPLATGLILVSCCPG  63



>ref|XP_002974205.1| hypothetical protein SELMODRAFT_232260 [Selaginella moellendorffii]
 gb|EFJ24427.1| hypothetical protein SELMODRAFT_232260 [Selaginella moellendorffii]
Length=272

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +2

Query  641  DDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            +DFRRCLRNPWTVGVGFLAQY IKP+LG+ I+ +LKLSAPLATGLILVSCCPG
Sbjct  11   EDFRRCLRNPWTVGVGFLAQYAIKPILGFLIALSLKLSAPLATGLILVSCCPG  63



>ref|XP_003080041.1| Na+-bile acid cotransporter (ISS) [Ostreococcus tauri]
Length=383

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 64/107 (60%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            +R  ETLT  FPV+V LG V+G   P AV+W   D  T +L   ML MG+TL   DF   
Sbjct  41   KRACETLTHQFPVFVALGAVVGFAMPGAVSWFRGDAVTRALALTMLGMGITLDVKDFENV  100

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L+ PW +G+G   QY + P L + + + L  ++ LA GL+LV CCPG
Sbjct  101  LKQPWKIGMGVALQYTVMPTLAFVVGKVLLSNSSLAAGLVLVGCCPG  147



>gb|KJB83150.1| hypothetical protein B456_013G231700 [Gossypium raimondii]
 gb|KJB83151.1| hypothetical protein B456_013G231700 [Gossypium raimondii]
Length=94

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = +2

Query  326  IQNKPQVSVDGMLKLSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTT  505
            +Q+KP   +  +L  SSI   +    ++ CKAA NVSGD P  +  GM+QYERIIET TT
Sbjct  1    MQSKPNSPLAALLAPSSIILDS-RNSKVKCKAAANVSGDSP--TPKGMNQYERIIETSTT  57

Query  506  LFPVWVILGTVIGIYKPSAVTW  571
            LFPVWV LG ++GIYKP+AV +
Sbjct  58   LFPVWVTLGAIVGIYKPAAVKF  79



>emb|CEF98497.1| Bile acid:sodium symporter [Ostreococcus tauri]
Length=435

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 65/109 (60%), Gaps = 0/109 (0%)
 Frame = +2

Query  473  QYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFR  652
            + +R  ETLT  FPV+V LG V+G   P AV+W   D  T +L   ML MG+TL   DF 
Sbjct  91   RAKRACETLTHQFPVFVALGAVVGFAMPGAVSWFRGDAVTRALALTMLGMGITLDVKDFE  150

Query  653  RCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
              L+ PW +G+G   QY + P L + + + L  ++ LA GL+LV CCPG
Sbjct  151  NVLKQPWKIGMGVALQYTVMPTLAFVVGKVLLSNSSLAAGLVLVGCCPG  199



>ref|WP_009454312.1| MULTISPECIES: transporter [Fischerella]
 gb|EHC19619.1| Bile acid:sodium symporter [Fischerella sp. JSC-11]
Length=325

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 70/111 (63%), Gaps = 6/111 (5%)
 Frame = +2

Query  485  IIETLTTLFPVWVILGTVIGIYKPSAVTW------LETDlftlslgflmlsmgltltfDD  646
            +IE  T LFP+W+++G ++ ++ PS  +W      L T L    L  +ML+MG+TL ++D
Sbjct  15   LIEIATNLFPIWILIGMILALFSPSLFSWYATGKVLGTSLIVWGLAVIMLAMGMTLRWED  74

Query  647  FRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            FR  LR P   G+G +AQYLI P LG+ IS   +L  P A GLILV CCPG
Sbjct  75   FRDLLRMPKAAGIGLVAQYLIMPSLGWFISLLFQLPTPYAVGLILVGCCPG  125



>ref|XP_010273395.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Nelumbo nucifera]
Length=426

 Score = 86.3 bits (212),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 77/130 (59%), Gaps = 0/130 (0%)
 Frame = +2

Query  410  SCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlf  589
            S  ++  +S    G   S     E + E L+TLFP+WV LG ++G+ KPS+  W++  L 
Sbjct  93   SANSSNTISSSGEGGHRSLRGWIELVGEVLSTLFPIWVALGCLLGLLKPSSFNWVQPKLT  152

Query  590  tlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLAT  769
             L L   ML MG+TLT DD R  L  P  +  GF+ QY + PL G+ +S+ LKL +  A 
Sbjct  153  ILGLTLTMLGMGMTLTLDDLRGALAMPKELLTGFVLQYSVMPLSGFFVSKLLKLPSYYAA  212

Query  770  GLILVSCCPG  799
            GLILV+CCPG
Sbjct  213  GLILVACCPG  222



>ref|WP_012376899.1| transporter [Opitutus terrae]
 gb|ACB77371.1| Bile acid:sodium symporter [Opitutus terrae PB90-1]
Length=315

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = +2

Query  482  RIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCL  661
            R++ +LT  FPVWV+  +V+ +++P   TW         L  +ML MGLTL  DDFR   
Sbjct  3    RLLGSLTNAFPVWVVALSVVALFEPGWFTWFSGPWIVWGLAVIMLGMGLTLKLDDFRAIG  62

Query  662  RNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R P  V +GF+AQY I PLLG+A +    L  P A GLILV+CCPG
Sbjct  63   RMPKAVALGFIAQYTIMPLLGWAFAHLYGLERPFAVGLILVACCPG  108



>ref|XP_009602137.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Nicotiana tomentosiformis]
Length=409

 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 77/132 (58%), Gaps = 1/132 (1%)
 Frame = +2

Query  407  LSCKAATN-VSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETD  583
            L C  ++N ++ D      S     + + ET++ LFP+WV LG +IG++KP++  W++  
Sbjct  74   LLCANSSNAITADDNNSKKSLGDWIQTVGETISVLFPLWVALGCLIGLFKPNSFNWVKPQ  133

Query  584  lftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPL  763
                 +   ML MG+TLTFDD R  L  P  +  GF+ QY + PL GY IS+ L L +  
Sbjct  134  WTVTGITLTMLGMGMTLTFDDLRSALAMPKQLFCGFILQYSVMPLSGYFISKLLNLPSHY  193

Query  764  ATGLILVSCCPG  799
            A GLILV CCPG
Sbjct  194  AAGLILVGCCPG  205



>ref|XP_006371927.1| hypothetical protein POPTR_0018s06390g [Populus trichocarpa]
 gb|ERP49724.1| hypothetical protein POPTR_0018s06390g [Populus trichocarpa]
Length=160

 Score = 80.1 bits (196),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 67/126 (53%), Gaps = 13/126 (10%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            MAS+ R V +D   L      KPS  F  RR+ +HL  R G++           QNKP+ 
Sbjct  1    MASVFRLVLQDCNLLPCQAIYKPSSCFPSRRLNTHLDPRAGIT-VPGNGRIWTTQNKPRS  59

Query  347  SVDGMLKLS------SIKTPALWKLRLSCKAATNVSGDIPGDSS-SGMSQYERIIETLTT  505
                +  LS      S + P     ++ C+AA N  GD+P  S+  GMSQYERIIETLTT
Sbjct  60   PTVALTALSPSSIIHSSRNP-----QVLCRAAANAPGDVPDSSTHGGMSQYERIIETLTT  114

Query  506  LFPVWV  523
            LFPVWV
Sbjct  115  LFPVWV  120


 Score = 29.6 bits (65),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 20/33 (61%), Gaps = 0/33 (0%)
 Frame = +1

Query  541  WYLQAFRGDLAGN*PFHS*FGIPHALDGINADF  639
            WYLQA  G + G+ P +    +PHA +G ++D 
Sbjct  128  WYLQASCGYMVGDRPLYPWPWLPHAFNGTDSDI  160



>ref|XP_008384767.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Malus domestica]
Length=245

 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 67/107 (63%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E+L+T FP+WV LG ++G+ KPS+  W+  +   L +   ML MG+TLTFDD R  
Sbjct  104  ELVGESLSTAFPIWVALGCLLGLVKPSSFNWVTPNCTILGITLTMLGMGMTLTFDDLRGA  163

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L  P  +  GF  QY + PL GY +S+ L L +  A GLILV CCPG
Sbjct  164  LSMPKELLAGFFLQYSVMPLSGYFVSKLLNLPSYYAAGLILVGCCPG  210



>emb|CDP06062.1| unnamed protein product [Coffea canephora]
Length=410

 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 75/122 (61%), Gaps = 0/122 (0%)
 Frame = +2

Query  434  SGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflm  613
            S  I  ++SSG S  E + + ++T FP+WV +G ++G+ KPS+  W++     + +   M
Sbjct  85   SSGIASNASSGRSWIEAVGDAISTAFPLWVAIGCLLGLLKPSSYNWVQPKWTIMGITLTM  144

Query  614  lsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCC  793
            L MG+TLTFDD R  L  P  +  GF+ QY I PL G+ +S+ L L +  A GLILV CC
Sbjct  145  LGMGMTLTFDDLRGALAMPKELFSGFVLQYSIMPLSGFFVSKLLNLPSHYAAGLILVGCC  204

Query  794  PG  799
            PG
Sbjct  205  PG  206



>ref|XP_006371926.1| hypothetical protein POPTR_0018s06390g [Populus trichocarpa]
 gb|ERP49723.1| hypothetical protein POPTR_0018s06390g [Populus trichocarpa]
Length=155

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/126 (42%), Positives = 67/126 (53%), Gaps = 13/126 (10%)
 Frame = +2

Query  167  MASISRFVGKDSRFLSFDPSQKPSHGFSPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQV  346
            MAS+ R V +D   L      KPS  F  RR+ +HL  R G++           QNKP+ 
Sbjct  1    MASVFRLVLQDCNLLPCQAIYKPSSCFPSRRLNTHLDPRAGIT-VPGNGRIWTTQNKPRS  59

Query  347  SVDGMLKLS------SIKTPALWKLRLSCKAATNVSGDIPGDSS-SGMSQYERIIETLTT  505
                +  LS      S + P     ++ C+AA N  GD+P  S+  GMSQYERIIETLTT
Sbjct  60   PTVALTALSPSSIIHSSRNP-----QVLCRAAANAPGDVPDSSTHGGMSQYERIIETLTT  114

Query  506  LFPVWV  523
            LFPVWV
Sbjct  115  LFPVWV  120



>emb|CDX88454.1| BnaC06g38980D [Brassica napus]
Length=403

 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 67/107 (63%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E ++T FPVWV LG ++G+ KPSA  W+  DL  + L   ML MG+TLT DD R  
Sbjct  93   EFLGEAVSTAFPVWVSLGCLLGLVKPSAFNWVTPDLTIIGLTVTMLGMGMTLTLDDLRGA  152

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L+ P  +  GFL QY + PL  Y +S+ L L +  A GLILV CCPG
Sbjct  153  LKMPKELFAGFLLQYSVMPLSAYLVSKLLNLPSHYAAGLILVGCCPG  199



>ref|XP_006367653.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic-like 
[Solanum tuberosum]
Length=412

 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 69/107 (64%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            + + ET++ LFP+WV LG +IG+ KPS+  W++ +   + +   ML MG+TLTFDD R  
Sbjct  102  QSVGETISVLFPLWVALGCLIGLLKPSSYNWVKPEWTVMGITLTMLGMGMTLTFDDLRGA  161

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L  P  +  GF+ QY + PL GY +S+ L L +  A GLILV CCPG
Sbjct  162  LAMPKELFCGFVLQYSVMPLSGYFVSKLLNLPSHYAAGLILVGCCPG  208



>ref|XP_004251493.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Solanum lycopersicum]
Length=408

 Score = 83.2 bits (204),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 1/126 (1%)
 Frame = +2

Query  422  ATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlsl  601
            A    GD   + S G    + + ET++ LFP+WV LG +IG+ KPS+  W++     + +
Sbjct  80   AITADGDDNKNKSFG-DWIQSVGETISVLFPLWVALGCLIGLLKPSSYNWVKPQWTVMGI  138

Query  602  gflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLIL  781
               ML MG+TLTFDD R  L  P  +  GF+ QY + PL GY +S+ L L +  A GLIL
Sbjct  139  TLTMLGMGMTLTFDDLRGALAMPKELFCGFILQYSVMPLSGYFVSKLLNLPSHYAAGLIL  198

Query  782  VSCCPG  799
            V CCPG
Sbjct  199  VGCCPG  204



>emb|CDX86868.1| BnaA09g22580D [Brassica napus]
Length=397

 Score = 83.2 bits (204),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 81/149 (54%), Gaps = 6/149 (4%)
 Frame = +2

Query  371  SSIKTPALWKLRLSCKAATNV---SGDIPGDSSSGMS---QYERIIETLTTLFPVWVILG  532
            S +  PA  K R S +  T     S D P +     S     E + E ++T FPVWV LG
Sbjct  45   SRLALPATCKQRRSVELLTRCGVSSNDFPAEKEKKRSFGEWVEFLGEAVSTAFPVWVSLG  104

Query  533  TVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIK  712
             ++G+ KPSA  W+  DL  + L   ML MG+TLT DD R  L+ P  +  GF+ QY + 
Sbjct  105  CLLGLVKPSAFNWVTPDLTIIGLTITMLGMGMTLTLDDLRGALKMPKELFAGFVLQYSVM  164

Query  713  PLLGYAISRALKLSAPLATGLILVSCCPG  799
            PL  + +S+ L L +  A GLILV CCPG
Sbjct  165  PLSAFLVSKLLNLPSHYAAGLILVGCCPG  193



>emb|CDY52433.1| BnaA07g39100D [Brassica napus]
Length=397

 Score = 82.8 bits (203),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 81/149 (54%), Gaps = 6/149 (4%)
 Frame = +2

Query  371  SSIKTPALWKLRLSCKAATNV---SGDIPGDSSSGMS---QYERIIETLTTLFPVWVILG  532
            S +  PA  K R S +  T     S D P +     S     E + E ++T FPVWV LG
Sbjct  45   SRLALPATCKQRRSVELLTRCGVSSNDFPAEKEKKRSFGEWVEFLGEAVSTAFPVWVSLG  104

Query  533  TVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIK  712
             ++G+ KPSA  W+  DL  + L   ML MG+TLT DD R  L+ P  +  GF+ QY + 
Sbjct  105  CLLGLVKPSAFNWVTPDLTIIGLTITMLGMGMTLTLDDLRGALKMPKELFAGFVLQYSVM  164

Query  713  PLLGYAISRALKLSAPLATGLILVSCCPG  799
            PL  + +S+ L L +  A GLILV CCPG
Sbjct  165  PLSAFLVSKLLNLPSHYAAGLILVGCCPG  193



>ref|XP_009765749.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Nicotiana sylvestris]
Length=409

 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 75/128 (59%), Gaps = 4/128 (3%)
 Frame = +2

Query  428  NVSGDIPGDSSSGMSQY----ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftl  595
            N S  I  D ++    +    + + E ++ LFP+WV LG +IG++KP++  W++     +
Sbjct  78   NSSNAITADDNNSKKSFGDWIQTVGEAISVLFPLWVALGCLIGLFKPNSYNWVKPQWTVM  137

Query  596  slgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGL  775
             +   ML MG+TLTFDD R  L  P  +  GF+ QY + PL GY +S+ L L +  A GL
Sbjct  138  GITLTMLGMGMTLTFDDLRSALAMPKQLFCGFVLQYSVMPLSGYFVSKLLNLPSHYAAGL  197

Query  776  ILVSCCPG  799
            ILV CCPG
Sbjct  198  ILVGCCPG  205



>ref|XP_008363646.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
isoform X1 [Malus domestica]
Length=414

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 67/107 (63%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E+L+T FP+WV LG ++G+ KPS+  W+  +   L +   ML MG+TLTFDD R  
Sbjct  104  ELVGESLSTAFPIWVALGCLMGLVKPSSFNWVTPNCTILGITLTMLGMGMTLTFDDLRGA  163

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L  P  +  GF  QY + PL GY +S+ L L +  A GLILV CCPG
Sbjct  164  LSMPKELLAGFFLQYSVMPLSGYFVSKLLNLPSYYAAGLILVGCCPG  210



>ref|XP_010644063.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Vitis vinifera]
 emb|CBI20101.3| unnamed protein product [Vitis vinifera]
Length=420

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 69/106 (65%), Gaps = 0/106 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E L+T FPVWV LG ++G+ +PS+  W++     L +   ML MG+TLTFDD  + 
Sbjct  110  EVVGEALSTAFPVWVALGCLLGLIRPSSFNWVQPKWTVLGITVTMLGMGMTLTFDDLCKA  169

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCP  796
            L  P  +  GF+ QY + PLLG+A+S+ LKL +  A GLILV CCP
Sbjct  170  LAMPKELLAGFVLQYTVMPLLGFAVSKLLKLPSYYAAGLILVGCCP  215



>gb|KFK42231.1| hypothetical protein AALP_AA2G228600 [Arabis alpina]
Length=392

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 71/123 (58%), Gaps = 1/123 (1%)
 Frame = +2

Query  434  SGDIPGDSSSGMSQY-ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgfl  610
            S D P +      ++ E + + ++T FP+WV LG ++G+ +PS   W+  +     L   
Sbjct  66   SNDFPTEKKKSFGEWVEFVGDAVSTAFPIWVSLGCLLGLMRPSTFNWVTPNWTIGGLTIT  125

Query  611  mlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSC  790
            ML MG+TLT DD R  L+ P  +  GF+ QY + PL GY +S+ L L A  A GLILV C
Sbjct  126  MLGMGMTLTLDDLRGALKMPKELFAGFILQYSVMPLSGYLVSKLLNLPAHYAAGLILVGC  185

Query  791  CPG  799
            CPG
Sbjct  186  CPG  188



>ref|XP_008226350.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Prunus mume]
Length=424

 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 68/107 (64%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E ++T FP+WV LG ++G+ KPS+  W+  +L  L +   ML MG+TLTFDD R  
Sbjct  114  EVVGEAVSTAFPIWVALGCLLGLIKPSSFNWVTPNLTILGITLTMLGMGMTLTFDDLRGA  173

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L  P  +  GF+ QY + PL GYA+S  L L +  A GLILV CCPG
Sbjct  174  LAMPKELLAGFVLQYSVMPLSGYAVSMLLNLPSYYAAGLILVGCCPG  220



>ref|XP_005824633.1| hypothetical protein GUITHDRAFT_144786 [Guillardia theta CCMP2712]
 gb|EKX37653.1| hypothetical protein GUITHDRAFT_144786 [Guillardia theta CCMP2712]
Length=461

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 72/122 (59%), Gaps = 8/122 (7%)
 Frame = +2

Query  458  SSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltl-  634
             S + +   I+E L +LFP+WV++  +  I+KP  VTWL+ +  T+++G  M+    T  
Sbjct  117  GSRLKRLAAILEVLASLFPLWVVVAVLAAIFKPETVTWLQGNSITVAVGATMVFTEQTSN  176

Query  635  -------tfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCC  793
                   T DDF R L++P  V +G L QY + P+LG  IS+ LKL   +A GLIL+S C
Sbjct  177  NDKGMTLTIDDFVRILKDPAQVSMGCLCQYTLMPILGVFISKFLKLPKDIAAGLILLSSC  236

Query  794  PG  799
            PG
Sbjct  237  PG  238



>ref|XP_005648900.1| BASS family transporter: sodium ion/bile acid [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24356.1| BASS family transporter: sodium ion/bile acid [Coccomyxa subellipsoidea 
C-169]
Length=357

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 63/100 (63%), Gaps = 0/100 (0%)
 Frame = +2

Query  500  TTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTV  679
            + LFP+W++LG    +  P ++TW + +  T  L   M++MG TLT +DF + +R PW V
Sbjct  36   SNLFPLWLVLGATAAVVHPPSLTWFKKEYTTQCLALTMMAMGTTLTIEDFAQVMRRPWLV  95

Query  680  GVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +G   QY I PL+G+ +SR LKL  P A G+ LV+ CPG
Sbjct  96   ALGATLQYTIMPLMGFTVSRLLKLPVPYAVGICLVASCPG  135



>gb|EYU38235.1| hypothetical protein MIMGU_mgv1a007506mg [Erythranthe guttata]
Length=405

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 78/141 (55%), Gaps = 2/141 (1%)
 Frame = +2

Query  377  IKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKP  556
            + +P + K RL      N S  +  D     S  E + E ++T FPVWV +G ++G+ +P
Sbjct  60   VVSPTISKPRLGHLLCGNSSNTLTTDQKK--SWIEVVGEAISTAFPVWVAVGCLLGLVRP  117

Query  557  SAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAIS  736
            S+  W++     + +   ML MG+TLTFDD R  L  P  +  GFL QY + PL  Y +S
Sbjct  118  SSFNWVQPKWTVMGITLTMLGMGMTLTFDDLRGALAMPKELFTGFLLQYSVMPLSAYFVS  177

Query  737  RALKLSAPLATGLILVSCCPG  799
            R L L +  A GLILV CCPG
Sbjct  178  RLLNLPSYYAAGLILVGCCPG  198



>ref|XP_010098229.1| putative sodium-dependent transporter yocS [Morus notabilis]
 gb|EXB74714.1| putative sodium-dependent transporter yocS [Morus notabilis]
Length=403

 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 68/204 (33%), Positives = 106/204 (52%), Gaps = 18/204 (9%)
 Frame = +2

Query  212  SFDPSQKPSHGFSPRRIQ-------SHLCFRDGVSKTEPKKNCLRIQNKPQVSVDGMLKL  370
            SF+  Q P   FSP   Q         LCF    SKT+P  +   ++N+P  S   + + 
Sbjct  13   SFNLVQIPER-FSPNLAQKTKLSVLEFLCF----SKTKPSSSSSLLRNEP--SGLALCRE  65

Query  371  SSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQYERII-ETLTTLFPVWVILGTVIGI  547
            ++ K        + C  ++N       ++   +  +  +I E ++T FP+WV LG ++G+
Sbjct  66   AATKRKYNETTLVRCGISSN---SYNANTDRSLRDWIEVIGEAISTAFPIWVALGCLLGL  122

Query  548  YKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGY  727
             KPS+  W++ +   L +   ML MG+TLTFDD R  L  P  +  GF+ QY + P+ G+
Sbjct  123  VKPSSFDWVKPEWTVLGITLTMLGMGMTLTFDDLRGALAMPKELLAGFVLQYSVMPISGF  182

Query  728  AISRALKLSAPLATGLILVSCCPG  799
             +S+ L L +  A GLILV CCPG
Sbjct  183  VVSKLLNLPSYYAAGLILVGCCPG  206



>ref|WP_010568485.1| transporter [Leptospira broomii]
Length=321

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 67/106 (63%), Gaps = 0/106 (0%)
 Frame = +2

Query  482  RIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCL  661
            +  E ++ LFPVWVI G  I    PS + W +    T SLG  ML MG+TL  +DF+R  
Sbjct  3    KFFERISLLFPVWVIAGVSISWIYPSWIVWFDGPWITYSLGITMLGMGITLVPEDFKRVF  62

Query  662  RNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            + P  V +G + QY I PL G+AI   L+L +PLATGLI+V+CCPG
Sbjct  63   QTPKAVLIGVVGQYTIMPLAGWAIGILLELPSPLATGLIVVACCPG  108



>ref|XP_009106563.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Brassica rapa]
Length=397

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 72/125 (58%), Gaps = 3/125 (2%)
 Frame = +2

Query  434  SGDIPGDSSSGMS---QYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslg  604
            S D P +     S     E + E ++T FPVWV LG ++G+ KPSA  W+  DL  + L 
Sbjct  69   SNDFPAEKEKKRSFGEWVEFLGEAVSTAFPVWVSLGCLLGLVKPSAFNWVTPDLTIIGLT  128

Query  605  flmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILV  784
              ML MG+TLT DD R  L+ P  +  GF+ QY + PL  + +S+ L L +  A GLILV
Sbjct  129  ITMLGMGMTLTLDDLRGALKMPKELFAGFVLQYSVMPLSAFLVSKLLNLPSHYAAGLILV  188

Query  785  SCCPG  799
             CCPG
Sbjct  189  GCCPG  193



>gb|KHG18566.1| putative sodium-dependent transporter yocS [Gossypium arboreum]
Length=403

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 66/107 (62%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E ++T FP+WV LG ++G++KPS+ TW+        L   ML MG+TLT DD R  
Sbjct  93   EWVGEVISTAFPLWVSLGCLLGLFKPSSFTWVTPSWTIFGLTLTMLGMGMTLTLDDLRGA  152

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L  P  +  GF+ QY + PL GY +S+ L L +  A GLILV CCPG
Sbjct  153  LAMPKELISGFVLQYSVMPLSGYFVSKLLNLPSHYAAGLILVGCCPG  199



>ref|WP_044134750.1| bile acid transporter family protein, partial [Verrucomicrobium 
spinosum]
Length=305

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 65/105 (62%), Gaps = 0/105 (0%)
 Frame = +2

Query  482  RIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCL  661
            R I   T+L+PVWVI   V+G+  P++++W        +L  +ML MG TLT DDFRR L
Sbjct  3    RFINWFTSLYPVWVISFAVVGLLHPTSLSWFTGGWVVWALTLVMLGMGFTLTVDDFRRLL  62

Query  662  RNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCP  796
            R P ++ +GFL  Y I PL G+ ++ AL L    A GLILV+ CP
Sbjct  63   RAPSSLALGFLTHYTIMPLAGWFVAHALNLEPGFAVGLILVASCP  107



>ref|XP_006389975.1| hypothetical protein EUTSA_v10018656mg [Eutrema salsugineum]
 gb|ESQ27261.1| hypothetical protein EUTSA_v10018656mg [Eutrema salsugineum]
Length=402

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 71/123 (58%), Gaps = 1/123 (1%)
 Frame = +2

Query  434  SGDIPGDSSSGMSQY-ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgfl  610
            S D P +      ++ E + E ++T FPVWV LG ++G+ +PS   W+  +   + L   
Sbjct  76   SNDFPAERKKSFGEWVEFVGEAVSTAFPVWVSLGCLLGLMRPSTFNWVTPNWTIVGLTIT  135

Query  611  mlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSC  790
            ML MG+TLT DD R  L+ P  +  GFL QY + PL  + +S+ L L +  A GLILV C
Sbjct  136  MLGMGMTLTLDDLRGALKMPKQLFAGFLLQYSVMPLSAFLVSKLLNLPSHYAAGLILVGC  195

Query  791  CPG  799
            CPG
Sbjct  196  CPG  198



>ref|XP_006301266.1| hypothetical protein CARUB_v10021666mg [Capsella rubella]
 gb|EOA34164.1| hypothetical protein CARUB_v10021666mg [Capsella rubella]
Length=401

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 70/123 (57%), Gaps = 1/123 (1%)
 Frame = +2

Query  434  SGDIPGDSSSGMSQY-ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgfl  610
            S D+P +      ++ E + E ++T FP+WV LG ++G+ +PS   W+  +   + L   
Sbjct  75   SNDLPTEGKKSFGEWVEFVGEAVSTAFPIWVSLGCLLGLLRPSTFNWVTPNWTIVGLTIT  134

Query  611  mlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSC  790
            ML MG+TLT DD R     P  +  GF+ QY + PL GY +SR L L    A GLILV C
Sbjct  135  MLGMGMTLTLDDLRSAFSMPKELFAGFVLQYSVMPLSGYFVSRLLNLPPHYAAGLILVGC  194

Query  791  CPG  799
            CPG
Sbjct  195  CPG  197



>ref|XP_008463794.1| PREDICTED: LOW QUALITY PROTEIN: probable sodium/metabolite cotransporter 
BASS1, chloroplastic [Cucumis melo]
Length=412

 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 77/131 (59%), Gaps = 2/131 (2%)
 Frame = +2

Query  407  LSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDl  586
            L C+ ++N    I G+ S  M   E I E L+T FPVWV LG V+G+ +P++  W++   
Sbjct  85   LRCEPSSN-GNSIQGERSL-MQWIELIGEALSTAFPVWVALGCVLGLLRPASYAWVQPRW  142

Query  587  ftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLA  766
              L +   ML MG+TLT DD R  L  P  +  GF+ QY + P+ G+ +S+ L L +  A
Sbjct  143  TVLGITLTMLGMGMTLTLDDLRGALAMPKELISGFVLQYSVMPISGFLVSKLLNLPSYYA  202

Query  767  TGLILVSCCPG  799
             GLILV CCPG
Sbjct  203  AGLILVGCCPG  213



>ref|XP_005832174.1| hypothetical protein GUITHDRAFT_108836 [Guillardia theta CCMP2712]
 gb|EKX45194.1| hypothetical protein GUITHDRAFT_108836 [Guillardia theta CCMP2712]
Length=345

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            FP+WV+ G V+G+ +P+A+ WL+ DL T SL   ML MG+TL   DF+R +++P  V +G
Sbjct  7    FPLWVLAGGVLGVTRPAALAWLKGDLITASLALTMLFMGMTLDVKDFQRVMQSPRQVFLG  66

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            F+ Q+ I P LG+++++   LS   A GLILVS CPG
Sbjct  67   FMCQFTIMPFLGWSMAKLFGLSPAFAVGLILVSACPG  103



>ref|XP_004146013.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Cucumis sativus]
 gb|KGN55025.1| Sodium-bile acid cotransporter [Cucumis sativus]
Length=414

 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 76/131 (58%), Gaps = 2/131 (2%)
 Frame = +2

Query  407  LSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDl  586
            L C+ ++N  G+      S M   E I E L+T FPVWV LG V+G+ +P++  W++   
Sbjct  87   LRCEPSSN--GNSVQGERSLMQWIELIGEALSTAFPVWVALGCVLGLLRPASYAWVQPRW  144

Query  587  ftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLA  766
              L +   ML MG+TLT DD R  L  P  +  GF+ QY + P+ G+ +S+ L L +  A
Sbjct  145  TVLGITLTMLGMGMTLTLDDLRGALAMPKELISGFVLQYSVMPISGFLVSKLLNLPSYYA  204

Query  767  TGLILVSCCPG  799
             GLILV CCPG
Sbjct  205  AGLILVGCCPG  215



>ref|XP_009344611.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Pyrus x bretschneideri]
Length=414

 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 66/107 (62%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E ++T FP+WV LG ++G+ KPS+  W+  +   L +   ML MG+TLTFDD R  
Sbjct  104  ELVGEYVSTAFPIWVALGCLLGLVKPSSFNWVTPNCTILGITLTMLGMGMTLTFDDLRGA  163

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L  P  +  GF  QY + PL GY +S+ L L +  A GLILV CCPG
Sbjct  164  LSMPKELLAGFFLQYSVMPLSGYFVSKLLNLPSYYAAGLILVGCCPG  210



>ref|XP_002960410.1| hypothetical protein SELMODRAFT_164064 [Selaginella moellendorffii]
 gb|EFJ37949.1| hypothetical protein SELMODRAFT_164064 [Selaginella moellendorffii]
Length=395

 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 70/123 (57%), Gaps = 2/123 (2%)
 Frame = +2

Query  437  GDIPGDSSSG--MSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgfl  610
            GD+P +   G  + + E I   L++LFPVWV +  V  + +PSA  W++  L  + +   
Sbjct  64   GDLPVEEGDGVWIQRLEAIGGVLSSLFPVWVGIACVAALVRPSAFLWIKGQLQMVGITIT  123

Query  611  mlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSC  790
            ML MG+TL+ DD +  L  P  V  G   QY I PL G  ++R L L +  A GL+LVSC
Sbjct  124  MLGMGMTLSIDDLKGALSMPREVAAGVFLQYTIMPLTGATVARVLGLPSHYAAGLVLVSC  183

Query  791  CPG  799
            CPG
Sbjct  184  CPG  186



>ref|XP_007149504.1| hypothetical protein PHAVU_005G0758000g, partial [Phaseolus vulgaris]
 gb|ESW21498.1| hypothetical protein PHAVU_005G0758000g, partial [Phaseolus vulgaris]
Length=200

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 81/145 (56%), Gaps = 1/145 (1%)
 Frame = +2

Query  368  LSSIKTPALWKLRLSCKAATNVSGDIPGDSSSGMSQY-ERIIETLTTLFPVWVILGTVIG  544
            L ++ T  +   R+      N S    G+   G+ ++ E++ E L+T FP WV +G ++G
Sbjct  6    LLNLCTSRICSFRVDPLKCCNSSNGYGGNEGRGLQEWIEQVGEALSTAFPSWVTIGCILG  65

Query  545  IYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLG  724
             ++PS  +W+   L    L  +MLSMG+TLT DD R  L  P  V  GF+ QY + P+ G
Sbjct  66   FFRPSYFSWVSPKLNIFGLTIIMLSMGMTLTLDDLRGALSMPKEVLSGFILQYSVMPISG  125

Query  725  YAISRALKLSAPLATGLILVSCCPG  799
            + +S+ L + +  A GLILV C PG
Sbjct  126  FLVSKILNIPSHYAAGLILVGCFPG  150



>gb|KJB12927.1| hypothetical protein B456_002G045800 [Gossypium raimondii]
Length=403

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 66/107 (62%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E ++T FP+WV LG ++G++KPS+ +W+        L   ML MG+TLT DD R  
Sbjct  93   EWVGEVISTAFPLWVSLGCLLGLFKPSSFSWVTPRWSIFGLTLTMLGMGMTLTLDDLRGA  152

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L  P  +  GF+ QY + PL GY +S+ L L +  A GLILV CCPG
Sbjct  153  LAMPKELISGFVLQYSVMPLSGYFVSKLLNLPSHYAAGLILVGCCPG  199



>ref|WP_002998741.1| sodium Bile acid symporter family protein [Leptospira weilii]
 gb|EMY78456.1| sodium Bile acid symporter family protein [Leptospira weilii 
serovar Ranarum str. ICFT]
Length=314

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 68/110 (62%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ +++ E  T LFPVWV++G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  4    NKLQKVSEIGTILFPVWVLMGSIVSFFFPHWFTWFTGPWITYGLGFTMLGMGITLLPQDF  63

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            +   + P  V VG + QY + P+ G+ I   L L APLATGLI+VSCCPG
Sbjct  64   QEIFKTPIPVFVGVVLQYTVMPISGWGIGVLLDLPAPLATGLIVVSCCPG  113



>gb|EMO25867.1| sodium Bile acid symporter domain protein [Leptospira interrogans 
serovar Bataviae str. HAI135]
Length=151

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+V+  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSVLSFFFPQWFTWFTGAAITYGLGFTMLGMGITLLPRDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   R P  V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFRTPIPVFIGVTLQYTVMPVSGWGIGVLLDLPTPLATGLVVVSCCPG  112



>gb|KDO41538.1| hypothetical protein CISIN_1g014898mg [Citrus sinensis]
Length=416

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 75/131 (57%), Gaps = 2/131 (2%)
 Frame = +2

Query  407  LSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDl  586
            L C  ++N +     +S S     E I E ++T FP+WV LG ++G+ KPS+  W++   
Sbjct  88   LHCGISSNTADA--NNSRSFREWIELIGELISTAFPIWVSLGCLLGLVKPSSFNWVQPKW  145

Query  587  ftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLA  766
              + L   ML MG+TLT DD R  L  P  +  GF+ QY + P+ G+ +S+ L L +  A
Sbjct  146  TIIGLTLTMLGMGMTLTLDDLRGALAMPKEIISGFVLQYSVMPISGFLVSKLLNLPSHYA  205

Query  767  TGLILVSCCPG  799
             GLILV CCPG
Sbjct  206  AGLILVGCCPG  216



>ref|XP_006477810.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic-like 
[Citrus sinensis]
Length=420

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 75/131 (57%), Gaps = 2/131 (2%)
 Frame = +2

Query  407  LSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDl  586
            L C  ++N +     +S S     E I E ++T FP+WV LG ++G+ KPS+  W++   
Sbjct  88   LHCGISSNTAD--ANNSRSFRDWIELIGELISTAFPIWVSLGCLLGLVKPSSFNWVQPKW  145

Query  587  ftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLA  766
              + L   ML MG+TLT DD R  L  P  +  GF+ QY + P+ G+ +S+ L L +  A
Sbjct  146  TIIGLTLTMLGMGMTLTLDDLRGALAMPKEIISGFVLQYSVMPISGFLVSKLLNLPSHYA  205

Query  767  TGLILVSCCPG  799
             GLILV CCPG
Sbjct  206  AGLILVGCCPG  216



>ref|WP_002179802.1| sodium Bile acid symporter family protein [Leptospira interrogans]
 gb|EMO52277.1| sodium Bile acid symporter family protein [Leptospira interrogans 
str. HAI1536]
Length=316

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFPVWV++G+V+  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPVWVLIGSVLSFFFPQWFTWFTGPAITYGLGFTMLGMGITLLPKDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   R P  V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFRTPIPVFIGVTLQYTVMPVSGWGIGVLLDLPMPLATGLVVVSCCPG  112



>ref|WP_010409753.1| transporter [Leptospira inadai]
 gb|EQA35700.1| sodium Bile acid symporter family protein [Leptospira inadai 
serovar Lyme str. 10]
Length=321

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 65/107 (61%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
             +  E ++ LFPVWVI G  I    P+ + W +    T SLG  ML MG+TL  +DF+R 
Sbjct  2    AKFFERISLLFPVWVIAGVSISWIYPAWIIWFDGPWITYSLGVTMLGMGITLVPEDFKRV  61

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             + P  V +G L QY I PL G+ I   L L +PLATGLI+V+CCPG
Sbjct  62   FQAPKAVLIGVLGQYTIMPLAGWGIGILLGLPSPLATGLIVVACCPG  108



>ref|WP_017213483.1| transporter [Leptospira noguchii]
 gb|EQA71657.1| sodium Bile acid symporter family protein [Leptospira noguchii 
serovar Panama str. CZ214]
Length=316

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 66/110 (60%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFPVWV++G+V+  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPVWVLIGSVLSFFFPQWFTWFTGPAITYGLGFTMLGMGITLLPKDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   R P  V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFRTPIPVFIGVTLQYTVMPVSGWGIGVLLDLPMPLATGLVVVSCCPG  112



>ref|XP_004968299.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic-like 
[Setaria italica]
Length=394

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/118 (44%), Positives = 67/118 (57%), Gaps = 0/118 (0%)
 Frame = +2

Query  446  PGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmg  625
            PGD +   S    + E L+  FPVWV     I +++P A  W+      L L F ML MG
Sbjct  73   PGDDTGARSALVLLGEALSLGFPVWVASACAIALWRPPAFLWVGPTAQMLGLSFTMLGMG  132

Query  626  ltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            +TLT DD +  L  P  +  GF+ QY + PL G+ +S+ LKL A  A GLILVSCCPG
Sbjct  133  MTLTLDDLKTALLMPRELAAGFILQYTVMPLSGFFVSKLLKLPAHYAAGLILVSCCPG  190



>ref|XP_008368370.1| PREDICTED: LOW QUALITY PROTEIN: probable sodium/metabolite cotransporter 
BASS1, chloroplastic [Malus domestica]
Length=427

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 66/107 (62%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E ++T FP+WV LG ++G+ KPS+  W+  +   L L   ML MG+TLTF D R  
Sbjct  117  ELVGEAVSTAFPIWVALGCLLGLLKPSSFNWVTPNYNILGLTLTMLGMGMTLTFADLRGA  176

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L  P  +  GF+ QY + PL GY +S+ L L +  A GLILV CCPG
Sbjct  177  LAMPKELLAGFVLQYSVMPLSGYFVSKLLNLPSYYAAGLILVGCCPG  223



>ref|XP_010694752.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=430

 Score = 79.0 bits (193),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E ++T FP+WV LG ++G+ KP + +W++  L    L   ML MG+TLT DD    
Sbjct  114  ETLSEAVSTAFPIWVALGCLMGLLKPDSFSWVKPQLSIWGLTITMLGMGMTLTLDDLSGA  173

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            +  P  V  GFL QY + PL G+ ISR L L +  A GLILV CCPG
Sbjct  174  MAMPKEVIAGFLLQYSVMPLSGFFISRLLGLPSHYAAGLILVGCCPG  220



>ref|XP_004982573.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic-like 
[Setaria italica]
Length=394

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 67/118 (57%), Gaps = 0/118 (0%)
 Frame = +2

Query  446  PGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmg  625
            PGD +   S    + E L+  FPVWV     I +++P A  W+      L + F ML MG
Sbjct  73   PGDDTGARSALVLLGEALSLGFPVWVASACAIALWRPPAFLWVGPTAQMLGISFTMLGMG  132

Query  626  ltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            +TLT DD +  L  P  +  GF+ QY + PL G+ +S+ LKL A  A GLILVSCCPG
Sbjct  133  MTLTLDDLKTALLMPRELAAGFILQYTVMPLSGFFVSKLLKLPAHYAAGLILVSCCPG  190



>ref|XP_006853461.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Amborella trichopoda]
 gb|ERN14928.1| hypothetical protein AMTR_s00032p00193650 [Amborella trichopoda]
Length=466

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 64/108 (59%), Gaps = 0/108 (0%)
 Frame = +2

Query  476  YERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRR  655
            +E I E L+T FP+WV L  V+ +YKP A  W+ ++L    +   ML MG+TLT  D   
Sbjct  154  WEAIGEALSTAFPLWVTLACVLALYKPPAFLWMHSNLKVFGISVTMLGMGMTLTIKDLHA  213

Query  656  CLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             L  P  +  GF+ QY I PL G  +S+ L+L    A GLILV+CCPG
Sbjct  214  ALAMPKELLAGFVLQYTIMPLSGAFVSKLLRLPTHYAAGLILVACCPG  261



>ref|WP_018047033.1| hypothetical protein [Nitrospina sp. AB-629-B06]
Length=323

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 69/111 (62%), Gaps = 0/111 (0%)
 Frame = +2

Query  467  MSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDD  646
            MS+ E++  TL   FPVWV+ G  + ++ PS  TW +     L LG +MLSMGLTL+ +D
Sbjct  1    MSRVEKLFITLANFFPVWVVGGACLALWNPSTATWFQPTWIPLFLGIIMLSMGLTLSLED  60

Query  647  FRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            F R ++ P ++ +G   QY I PLLG+++   L L      G+ILV+CCPG
Sbjct  61   FLRVIQIPRSIALGVGLQYTIMPLLGFSLGTLLNLPMDYVIGIILVACCPG  111



>ref|XP_003077930.1| bile acid:sodium symporter family protein (ISS) [Ostreococcus 
tauri]
Length=358

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 71/119 (60%), Gaps = 3/119 (3%)
 Frame = +2

Query  452  DSSSG---MSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsm  622
             +SSG   M+ +++  E    LFP+W IL  V+G+ +P +  ++ ++ +T  L  LM SM
Sbjct  38   SASSGVVSMATFKQFSEVFANLFPIWTILAAVVGVLRPESFAFMTSNGYTGCLALLMFSM  97

Query  623  gltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            G+TLT DDF+R    P  +G+GF+  Y+I P L + I  AL LS PL  GLILV    G
Sbjct  98   GITLTIDDFKRVFAKPGLIGLGFIMCYVIMPALAFFIGNALGLSGPLLAGLILVGSING  156



>ref|WP_040851682.1| transporter [Nitrosospira sp. APG3]
Length=311

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 69/106 (65%), Gaps = 1/106 (1%)
 Frame = +2

Query  485  IIETLTTLFPVWVILGTVIGIYKPSAVTWL-ETDlftlslgflmlsmgltltfDDFRRCL  661
            +++ L  LFP+W+IL   I +Y+P  +T + +  +  L L F+ML MGLTLT DDFRR  
Sbjct  1    MLQRLALLFPLWMILSGAIALYRPHWLTAMNQGPVMVLLLAFIMLCMGLTLTLDDFRRIA  60

Query  662  RNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R P  V +GF AQY I PLL + +++AL L    A GLILV CCPG
Sbjct  61   RLPKAVAIGFAAQYSIMPLLAWGVAQALSLPPHFAVGLILVGCCPG  106



>ref|NP_565182.1| sodium Bile acid symporter family [Arabidopsis thaliana]
 sp|Q93YR2.1|BASS1_ARATH RecName: Full=Probable sodium/metabolite cotransporter BASS1, 
chloroplastic; AltName: Full=Bile acid transporter 2; AltName: 
Full=Bile acid-sodium symporter family protein 1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL24290.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM65644.1| unknown [Arabidopsis thaliana]
 gb|AAN15343.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE36121.1| sodium Bile acid symporter family [Arabidopsis thaliana]
Length=401

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 70/123 (57%), Gaps = 1/123 (1%)
 Frame = +2

Query  434  SGDIPGDSSSGMSQY-ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgfl  610
            S D+P +      ++ E + E ++T FP+WV LG ++G+ +PS   W+  +   + L   
Sbjct  75   SNDLPTEKKKSFGEWVEFVGEAVSTAFPIWVSLGCLLGLMRPSTFNWVTPNWTIVGLTIT  134

Query  611  mlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSC  790
            ML MG+TLT DD R  L  P  +  GFL QY + PL  + +S+ L L    A GLILV C
Sbjct  135  MLGMGMTLTLDDLRGALSMPKELFAGFLLQYSVMPLSAFFVSKLLNLPPHYAAGLILVGC  194

Query  791  CPG  799
            CPG
Sbjct  195  CPG  197



>ref|XP_006442338.1| hypothetical protein CICLE_v10020318mg [Citrus clementina]
 gb|ESR55578.1| hypothetical protein CICLE_v10020318mg [Citrus clementina]
Length=420

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 75/131 (57%), Gaps = 2/131 (2%)
 Frame = +2

Query  407  LSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDl  586
            L C  ++N +     +S S     E I E ++T FP+WV LG ++G+ KPS+  W++   
Sbjct  88   LHCGISSNTADA--NNSRSFREWIELIGELISTAFPIWVSLGCLLGLVKPSSFNWVQPKW  145

Query  587  ftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLA  766
              + L   ML MG+TLT +D R  L  P  +  GF+ QY + P+ G+ +S+ L L +  A
Sbjct  146  TIIGLTLTMLGMGMTLTLEDLRGALAMPKEIISGFVLQYSVMPISGFLVSKLLNLPSHYA  205

Query  767  TGLILVSCCPG  799
             GLILV CCPG
Sbjct  206  AGLILVGCCPG  216



>ref|WP_032810125.1| MULTISPECIES: transporter [Leptospira]
Length=319

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 67/113 (59%), Gaps = 0/113 (0%)
 Frame = +2

Query  461  SGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltf  640
            S +++ ++I E  T  FPVWV++G+++  + P   TW      T  LGF ML MG+TL  
Sbjct  6    STLNKLQKIGEIGTLFFPVWVLIGSILSFFFPHWFTWFSGPWITYGLGFTMLGMGITLLP  65

Query  641  DDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             DFR   + P  V  G + QY + PL G+ I   L L  PLATGLI+VSCCPG
Sbjct  66   QDFRDVFKTPIPVFAGVVLQYTVMPLSGWGIGILLNLPTPLATGLIVVSCCPG  118



>ref|XP_010417455.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Camelina sativa]
Length=402

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 71/123 (58%), Gaps = 1/123 (1%)
 Frame = +2

Query  434  SGDIPGDSSSGMSQY-ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgfl  610
            S D+P +      ++ E + E ++  FPVWV LG ++G+ +P+   W+  +  T+ L   
Sbjct  76   SNDLPTEKKKSFGEWVEYLGEAVSIAFPVWVSLGCLLGLLRPTTFNWVTPNWTTVGLTIT  135

Query  611  mlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSC  790
            ML MG+TLT DD R  L  P  +  GF+ QY + PL GY +S+ L L    A GLILV C
Sbjct  136  MLGMGMTLTLDDLRGALSMPKELFAGFVLQYSVMPLSGYFVSKLLNLPPHYAAGLILVGC  195

Query  791  CPG  799
            CPG
Sbjct  196  CPG  198



>emb|CEF96953.1| Bile acid:sodium symporter [Ostreococcus tauri]
Length=313

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 67/111 (60%), Gaps = 0/111 (0%)
 Frame = +2

Query  467  MSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDD  646
            M+ +++  E    LFP+W IL  V+G+ +P +  ++ ++ +T  L  LM SMG+TLT DD
Sbjct  1    MATFKQFSEVFANLFPIWTILAAVVGVLRPESFAFMTSNGYTGCLALLMFSMGITLTIDD  60

Query  647  FRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            F+R    P  +G+GF+  Y+I P L + I  AL LS PL  GLILV    G
Sbjct  61   FKRVFAKPGLIGLGFIMCYVIMPALAFFIGNALGLSGPLLAGLILVGSING  111



>ref|WP_004446543.1| sodium Bile acid symporter family protein [Leptospira noguchii]
 gb|EMO88868.1| sodium Bile acid symporter family protein [Leptospira noguchii 
str. 2001034031]
Length=318

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+V+  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSVLSFFFPQWFTWFTGAAITYGLGFTMLGMGITLLPKDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   R P  V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFRTPIPVFIGVALQYTVMPVSGWGIGVLLDLPTPLATGLVVVSCCPG  112



>ref|XP_010472685.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Camelina sativa]
Length=205

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 63/107 (59%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E ++  FPVWV LG ++G+ +P+   W+  +  T  L   ML MG+TLT DD R  
Sbjct  91   EYLGEAVSIAFPVWVSLGCLLGLLRPTTFNWVTPNWTTAGLTITMLGMGMTLTLDDLRGA  150

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L  P  +  GF+ QY + PL GY +S+ L L    A GLILV CCPG
Sbjct  151  LSMPKELFAGFVLQYSVMPLSGYFVSKLLNLPPHYAAGLILVGCCPG  197



>ref|WP_004428403.1| sodium Bile acid symporter family protein [Leptospira noguchii]
 gb|EMN01638.1| sodium Bile acid symporter family protein [Leptospira noguchii 
str. 2007001578]
 gb|EPE84531.1| sodium Bile acid symporter family protein [Leptospira noguchii 
str. 1993005606]
Length=318

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+V+  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSVLSFFFPQWFTWFTGAAITYGLGFTMLGMGITLLPKDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   R P  V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFRTPIPVFIGVALQYTVMPVSGWGIGVLLDLPTPLATGLVVVSCCPG  112



>ref|WP_032919300.1| transporter [Leptospira santarosai]
Length=319

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 67/113 (59%), Gaps = 0/113 (0%)
 Frame = +2

Query  461  SGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltf  640
            S +++ ++I E  T  FPVWV++G+++  + P   TW      T  LGF ML MG+TL  
Sbjct  6    STLNKLQKIGEIGTLFFPVWVLIGSILSFFFPHWFTWFSGPWITYGLGFTMLGMGITLLP  65

Query  641  DDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             DFR   + P  V  G + QY + PL G+ I   L L  PLATGLI+VSCCPG
Sbjct  66   QDFRDVFKTPIPVFAGVVLQYTVMPLSGWGIGILLNLPTPLATGLIVVSCCPG  118



>ref|WP_026131306.1| transporter [Leptospira santarosai]
Length=319

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 67/113 (59%), Gaps = 0/113 (0%)
 Frame = +2

Query  461  SGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltf  640
            S +++ ++I E  T  FPVWV++G+++  + P   TW      T  LGF ML MG+TL  
Sbjct  6    STLNKLQKIGEIGTLFFPVWVLIGSILSFFFPHWFTWFSGPWITYGLGFTMLGMGITLLP  65

Query  641  DDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             DFR   + P  V  G + QY + PL G+ I   L L  PLATGLI+VSCCPG
Sbjct  66   QDFRDVFKTPIPVFAGVVLQYTVMPLSGWGIGILLNLPTPLATGLIVVSCCPG  118



>ref|WP_040082892.1| sodium transporter [Bacillus sp. A053]
 gb|KFF56306.1| sodium transporter [Bacillus subtilis]
 gb|KIH39250.1| sodium transporter [Bacillus sp. A053]
Length=321

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  LR PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSFFTWI-SSYITIFLGIIMFGMGLTLQADDFKELLRKPWHVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + +S  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLSIGLHLPAEIAVGVILVGCCPG  110



>ref|WP_014664271.1| sodium transporter [Bacillus sp. JS]
 gb|AFI28651.1| YocS [Bacillus sp. JS]
Length=321

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  LR PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSFFTWI-SSYITIFLGIIMFGMGLTLQADDFKELLRKPWHVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + +S  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLSIGLHLPAEIAVGVILVGCCPG  110



>ref|WP_004435694.1| sodium Bile acid symporter family protein [Leptospira noguchii]
 gb|EMO42716.1| sodium Bile acid symporter family protein [Leptospira noguchii 
serovar Autumnalis str. ZUN142]
Length=316

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+V+  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSVLSFFFPQWFTWFTGAAITYGLGFTMLGMGITLLPRDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   R P  V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFRTPIPVFIGVTLQYTVMPVSGWGIGVLLDLPTPLATGLVVVSCCPG  112



>ref|XP_010062765.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Eucalyptus grandis]
 gb|KCW69896.1| hypothetical protein EUGRSUZ_F03227 [Eucalyptus grandis]
Length=423

 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 73/131 (56%), Gaps = 2/131 (2%)
 Frame = +2

Query  407  LSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDl  586
            L C  +TN     P +  S     E + E ++T FP+WV LG ++G+ KPS   W++   
Sbjct  91   LHCGISTNTFD--PSEGRSFRDWIELVGEVISTAFPIWVALGCLLGLVKPSCYDWVKPKW  148

Query  587  ftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLA  766
              L +   ML MG+TL+FDD R  L  P  +  GFL QY + P+  + +S+ L L +  A
Sbjct  149  SVLGIAVTMLGMGMTLSFDDLRGALAMPKELISGFLLQYSVMPISAFLVSKLLNLPSHYA  208

Query  767  TGLILVSCCPG  799
             GLILV CCPG
Sbjct  209  AGLILVGCCPG  219



>ref|XP_004488981.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic-like 
[Cicer arietinum]
Length=400

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 65/107 (61%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E L+T FP+WV +G V+G+ +PS+  W+   L  + L  +ML MG+TLT DD R  
Sbjct  90   EVVGEALSTAFPLWVTIGCVLGLVRPSSFNWVTPKLSLVGLTVIMLGMGMTLTLDDLRSA  149

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L  P  V  GF  QY + P+  + IS+ L L +  A GLILV CCPG
Sbjct  150  LSMPKEVLSGFFLQYSVMPISAFLISKLLNLPSHYAAGLILVGCCPG  196



>ref|XP_006377710.1| hypothetical protein POPTR_0011s10450g [Populus trichocarpa]
 gb|ERP55507.1| hypothetical protein POPTR_0011s10450g [Populus trichocarpa]
Length=265

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 76/133 (57%), Gaps = 4/133 (3%)
 Frame = +2

Query  404  RLSCKAATNVSGDIPGDSSSGMSQYERII-ETLTTLFPVWVILGTVIGIYKPSAVTWLET  580
            +L C  ++N   D+   S  G+ ++  +I + ++T FP+WV LG ++G+ +P+A  W+  
Sbjct  69   QLHCGISSN---DLSTGSKRGLREWIDVISDAISTAFPIWVSLGCLLGLLRPTAYNWVTP  125

Query  581  DlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAP  760
                + L   ML MG+TLT DD       P  V  GF+ QY + P+ G+ +S+ L L + 
Sbjct  126  KWVGIGLPLTMLGMGMTLTLDDLSNAFAMPKEVLSGFVLQYSVMPISGFLVSKLLNLPSY  185

Query  761  LATGLILVSCCPG  799
             A GLILV CCPG
Sbjct  186  YAAGLILVGCCPG  198



>ref|WP_004426040.1| transporter [Leptospira noguchii]
 gb|EKR71509.1| sodium Bile acid symporter family protein [Leptospira noguchii 
str. 2006001870]
Length=316

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+V+  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSVLSFFFPQWFTWFTGAAITYGLGFTMLGMGITLLPRDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   R P  V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFRTPIPVFIGVTLQYTVMPVSGWGIGVLLDLPTPLATGLVVVSCCPG  112



>ref|XP_005538599.1| probable sodium-dependent transporter [Cyanidioschyzon merolae 
strain 10D]
 dbj|BAM82563.1| probable sodium-dependent transporter [Cyanidioschyzon merolae 
strain 10D]
Length=426

 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 71/110 (65%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            S+ ER++  LT LFP++VILG++     PS   + + +  + +L  +ML+MGLTL+ DDF
Sbjct  112  SRSERVLGLLTNLFPLYVILGSITAATCPSVFAFFKREYISPTLSVIMLAMGLTLSVDDF  171

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
               LR P  V  G LAQY I PLLG+ +SR L L  P A G++LVS CPG
Sbjct  172  VAVLRVPDVVLWGALAQYSIMPLLGWMLSRHLGLPTPYAVGMLLVSSCPG  221



>ref|WP_038170766.1| bile acid transporter family protein [Verrucomicrobium sp. BvORR106]
Length=337

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 45/105 (43%), Positives = 62/105 (59%), Gaps = 0/105 (0%)
 Frame = +2

Query  482  RIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCL  661
            R I   T L+PVWVI   V+G+ +P  +TW        +L  +ML MG TL  +DFRR  
Sbjct  3    RFINWFTGLYPVWVISFAVVGLIRPELLTWFNGPWVVWALTLVMLGMGFTLKVEDFRRLF  62

Query  662  RNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCP  796
            + P ++ +GFLA Y I PL G++++  L L    A GLILV+ CP
Sbjct  63   KAPSSLALGFLAHYTIMPLAGWSVAHLLNLDPGFAVGLILVASCP  107



>ref|WP_025041403.1| transporter [Nitrosospira briensis]
Length=324

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 68/109 (62%), Gaps = 7/109 (6%)
 Frame = +2

Query  485  IIETLTTLFPVWVILGTVIGIYKPSAVTWL----ETDlftlslgflmlsmgltltfDDFR  652
            +++ LT LFPVW++L   I +  P   TWL    +  +  L L F+ML MGLTLT +DFR
Sbjct  1    MLQRLTLLFPVWMVLSGAIALCWP---TWLVAMNQGSVMVLVLAFIMLCMGLTLTLEDFR  57

Query  653  RCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R  R P  V +GF AQY I PLLG+ ++ AL L    A GLILV CCPG
Sbjct  58   RIARMPRAVAIGFAAQYTIMPLLGWGVANALNLPPHFAVGLILVGCCPG  106



>ref|WP_019258653.1| sodium transporter [Bacillus subtilis]
Length=321

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  LR PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELLRKPWHVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>dbj|BAK05955.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=398

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 74/133 (56%), Gaps = 7/133 (5%)
 Frame = +2

Query  413  CKAATNVSGD-IPGDS---SSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLET  580
            C AA   +GD +P  S   S   +   R+ E L+  FP+WV     + +++P++  W+  
Sbjct  64   CHAA---AGDPVPAPSLAPSGARAALVRVGEALSLGFPLWVASACALALWRPASFLWVTP  120

Query  581  DlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAP  760
                + L F ML MG+TLT DD R  L  P  +  GFL QY + PL GY ISR L L + 
Sbjct  121  TAQMVGLSFTMLGMGMTLTLDDLRTALLMPKELAAGFLLQYTVMPLSGYLISRLLNLPSH  180

Query  761  LATGLILVSCCPG  799
             A GLILVSCCPG
Sbjct  181  YAAGLILVSCCPG  193



>ref|XP_002464355.1| hypothetical protein SORBIDRAFT_01g016820 [Sorghum bicolor]
 gb|EER91353.1| hypothetical protein SORBIDRAFT_01g016820 [Sorghum bicolor]
Length=395

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 64/187 (34%), Positives = 91/187 (49%), Gaps = 15/187 (8%)
 Frame = +2

Query  248  SPRRIQSHLCFRDGVSKTEPKKNCLRIQNKPQVSVDGMLKLSSIKTPALWKLRLSCKAAT  427
            +PRRI      R   + T P+  CLR++    +   G+        P+    R  C+AA 
Sbjct  17   APRRILLAPHRRLNATSTPPRLACLRLRPATPLRARGI--------PS----RTGCRAAA  64

Query  428  NVS---GDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftls  598
            +        PG          R+ E L+  FPVWV     + +++P A  W+      L 
Sbjct  65   DADAAPSQAPGGDGGVRGAVVRVGEALSLGFPVWVASACALALWRPPAFLWVGPTAQMLG  124

Query  599  lgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLI  778
            L F ML MG+TLT DD +  L  P  +  GF+ QY + PL G+ +S+ LKL +  A GLI
Sbjct  125  LSFTMLGMGMTLTLDDLKTALLMPRELAAGFILQYTVMPLSGFFVSKLLKLPSHYAAGLI  184

Query  779  LVSCCPG  799
            LV+CCPG
Sbjct  185  LVACCPG  191



>ref|WP_010579217.1| transporter [Leptospira alexanderi]
 gb|EQA61866.1| sodium Bile acid symporter family protein [Leptospira alexanderi 
serovar Manhao 3 str. L 60]
Length=314

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 66/110 (60%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP+WV+ G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  4    NKLQKIGEIGTLLFPIWVLTGSILSFFFPEWFTWFTGIWITYGLGFTMLGMGITLLPQDF  63

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G + QY + PL G+ I     L APLATGLI+VSCCPG
Sbjct  64   RNVFQTPIPVFLGVILQYTVMPLSGWGIGILFDLPAPLATGLIVVSCCPG  113



>ref|WP_003241646.1| sodium-dependent transporter [Bacillus subtilis]
 gb|ELS59505.1| sodium-dependent transporter [Bacillus subtilis subsp. inaquosorum 
KCTC 13429]
Length=321

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  LR PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELLRKPWHVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_024715378.1| sodium transporter [Bacillus tequilensis]
Length=321

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  LR PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSFFTWI-SSYITIFLGIIMFGMGLTLQTDDFKELLRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_004764442.1| sodium Bile acid symporter family protein [Leptospira kirschneri]
 gb|EKO17085.1| sodium Bile acid symporter family protein [Leptospira kirschneri 
str. H1]
 gb|EKO60039.1| sodium Bile acid symporter family protein [Leptospira kirschneri 
str. H2]
Length=316

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 66/110 (60%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSILSFFFPEWFTWFTGPAITYGLGFTMLGMGITLLPKDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G + QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPIPVFIGVVLQYTVMPVSGWGIGVLLDLPTPLATGLVVVSCCPG  112



>ref|WP_020985373.1| sodium Bile acid symporter family protein [Leptospira kmetyi]
 gb|EQA55467.1| sodium Bile acid symporter family protein [Leptospira kmetyi 
serovar Malaysia str. Bejo-Iso9]
Length=316

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 67/110 (61%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFPVWV+ G+++  + P   TW +    T  LGF ML MG+TL   DF
Sbjct  4    NKVQKIGEIGTLLFPVWVLTGSILSFFFPHWFTWFKGPWITYGLGFTMLGMGITLLPQDF  63

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            +   + P  V  G + QY + P+ G+AI   L L AP ATGLI+VSCCPG
Sbjct  64   KDVFKTPIPVFAGVVLQYTVMPISGWAIGVLLDLPAPFATGLIVVSCCPG  113



>ref|XP_003572442.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Brachypodium distachyon]
Length=406

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 65/181 (36%), Positives = 89/181 (49%), Gaps = 20/181 (11%)
 Frame = +2

Query  296  KTEPKKNCLRIQNKPQVSVDGMLKLSSIKTPALWKL-----RLSCKAATNVSGD------  442
            ++    N LRI+  P      +L L+  + PA   L        C AA   +GD      
Sbjct  25   QSPAAANPLRIRTPP----SSLLPLAHPRPPAASSLVGGIPSSRCHAA---AGDTAPSAP  77

Query  443  -IP-GDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflml  616
             +P G   S  +   R+ E L+  FPVWV     + +++P+   W++     + L F ML
Sbjct  78   VVPDGGGGSARAALVRVGEALSLGFPVWVASACALALWRPATFLWVDPTTQMVGLAFTML  137

Query  617  smgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCP  796
             MG+TLT DD R  L  P  +  GFL QY + PL G+ IS+ L L    A GLILVSCCP
Sbjct  138  GMGMTLTLDDLRAALLMPKELAAGFLLQYTVMPLSGFLISKLLNLPNHYAAGLILVSCCP  197

Query  797  G  799
            G
Sbjct  198  G  198



>ref|WP_020766540.1| sodium Bile acid symporter family protein [Leptospira santarosai]
 gb|EMK04960.1| sodium Bile acid symporter family protein [Leptospira santarosai 
str. CBC613]
Length=316

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 66/110 (60%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSILSFFFPEWFTWFTGPAITYGLGFTMLGMGITLLPKDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G + QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPIPVFIGVVLQYTVMPVSGWGIGVLLDLPMPLATGLVVVSCCPG  112



>ref|WP_004780689.1| sodium Bile acid symporter family protein [Leptospira kirschneri]
 gb|EKP07012.1| sodium Bile acid symporter family protein [Leptospira kirschneri 
str. 2008720114]
Length=316

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 66/110 (60%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSILSFFFPEWFTWFTGPAITYGLGFTMLGMGITLLPKDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G + QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPIPVFIGVVLQYTVMPVSGWGIGVLLDLPMPLATGLVVVSCCPG  112



>ref|WP_004454588.1| sodium Bile acid symporter family protein [Leptospira noguchii]
 gb|EMS88787.1| sodium Bile acid symporter family protein [Leptospira noguchii 
str. Hook]
Length=316

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 48/110 (44%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+V+  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSVLSFFFPQWFTWFTGAAITYGLGFTMLGMGITLLPKDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPIPVFIGVTLQYTVMPVSGWGIGVLLDLPTPLATGLVVVSCCPG  112



>ref|WP_032927139.1| transporter [Leptospira santarosai]
Length=319

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 66/113 (58%), Gaps = 0/113 (0%)
 Frame = +2

Query  461  SGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltf  640
            S +++ ++I E  T  FPVWV+ G+++  + P   TW      T  LGF ML MG+TL  
Sbjct  6    STLNKLQKIGEIGTLFFPVWVLTGSILSFFFPHWFTWFSGPWITYGLGFTMLGMGITLLP  65

Query  641  DDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             DFR   + P  V  G + QY + PL G+ I   L L  PLATGLI+VSCCPG
Sbjct  66   QDFRDVFKTPIPVFAGVVLQYTVMPLSGWGIGILLNLPTPLATGLIVVSCCPG  118



>ref|WP_026053809.1| transporter [Leptospira santarosai]
Length=319

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 66/113 (58%), Gaps = 0/113 (0%)
 Frame = +2

Query  461  SGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltf  640
            S +++ ++I E  T  FPVWV+ G+++  + P   TW      T  LGF ML MG+TL  
Sbjct  6    STLNKLQKIGEIGTLFFPVWVLTGSILSFFFPHWFTWFSGPWITYGLGFTMLGMGITLLP  65

Query  641  DDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             DFR   + P  V  G + QY + PL G+ I   L L  PLATGLI+VSCCPG
Sbjct  66   QDFRDVFKTPIPVFAGVVLQYTVMPLSGWGIGILLNLPTPLATGLIVVSCCPG  118



>ref|WP_004448575.1| sodium Bile acid symporter family protein [Leptospira noguchii]
 gb|EMI72023.1| sodium Bile acid symporter family protein [Leptospira noguchii 
str. Bonito]
 gb|EMS86722.1| sodium Bile acid symporter family protein [Leptospira noguchii 
str. Cascata]
Length=314

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSILSFFFPQWFTWFTGSAITYGLGFTMLGMGITLLPKDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPIPVFIGVTLQYTVMPVSGWGIGVLLDLPTPLATGLVVVSCCPG  112



>ref|WP_032920941.1| transporter [Leptospira santarosai]
Length=319

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 66/113 (58%), Gaps = 0/113 (0%)
 Frame = +2

Query  461  SGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltf  640
            S +++ ++I E  T  FPVWV+ G+++  + P   TW      T  LGF ML MG+TL  
Sbjct  6    STLNKLQKIGEIGTLFFPVWVLTGSILSFFFPHWFTWFSGPWITYGLGFTMLGMGITLLP  65

Query  641  DDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             DFR   + P  V  G + QY + PL G+ I   L L  PLATGLI+VSCCPG
Sbjct  66   QDFRDVFKTPIPVFAGVVLQYTVMPLSGWGIGILLNLPTPLATGLIVVSCCPG  118



>ref|WP_016551297.1| sodium Bile acid symporter family protein [Leptospira fainei]
 gb|EPG72732.1| sodium Bile acid symporter family protein [Leptospira fainei 
serovar Hurstbridge str. BUT 6]
Length=321

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 64/107 (60%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
             R  E  + LFP WVI G  I    P+ + W +    T SLG  ML MG+TL  +DF+R 
Sbjct  2    ARFFERASLLFPFWVIAGVSISWIYPTWIAWFDGPWITYSLGLTMLGMGITLVPEDFKRV  61

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             + P  V VG + QY I PL G+ I   L+L +PL+TGLI+V+CCPG
Sbjct  62   FQTPKAVLVGVVGQYTIMPLAGWGIGILLELPSPLSTGLIVVACCPG  108



>ref|WP_026053546.1| transporter [Leptospira santarosai]
Length=319

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 66/113 (58%), Gaps = 0/113 (0%)
 Frame = +2

Query  461  SGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltf  640
            S +++ ++I E  T  FPVWV+ G+++  + P   TW      T  LGF ML MG+TL  
Sbjct  6    STLNKLQKIGEIGTLFFPVWVLTGSILSFFFPHWFTWFSGPWITYGLGFTMLGMGITLLP  65

Query  641  DDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             DFR   + P  V  G + QY + PL G+ I   L L  PLATGLI+VSCCPG
Sbjct  66   QDFRDVFKTPIPVFAGVVLQYTVMPLSGWGIGILLNLPTPLATGLIVVSCCPG  118



>ref|XP_007022022.1| Sodium Bile acid symporter family isoform 2 [Theobroma cacao]
 gb|EOY13547.1| Sodium Bile acid symporter family isoform 2 [Theobroma cacao]
Length=366

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = +2

Query  398  KLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLE  577
            + +L C  ++  S ++  + S G    E + E ++T FP+WV LG + G+ KP++ +W+ 
Sbjct  69   RFQLQCSISSE-SYNLNNEKSFG-DWVEWLGEVISTAFPIWVSLGCLFGLLKPTSFSWVT  126

Query  578  TDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSA  757
                   L   ML MG+TLT DD R  L  P  +  GF+ QY + PL G+ +S+ L L +
Sbjct  127  PRWNIFGLTLTMLGMGMTLTLDDLRGALAMPKELISGFVLQYSVMPLSGFLVSKLLNLPS  186

Query  758  PLATGLILVSCCPG  799
              A GLILV CCPG
Sbjct  187  HYAAGLILVGCCPG  200



>gb|KHN36938.1| Putative sodium-dependent transporter yocS [Glycine soja]
Length=415

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = +2

Query  491  ETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNP  670
            E L+T FP+WV + +V+G+ KPS   W+   L  + L  +ML MG+TLT DD R  L  P
Sbjct  113  EVLSTGFPLWVTIASVLGLMKPSYFNWVTPKLSIMGLNIIMLGMGMTLTLDDLRGVLAMP  172

Query  671  WTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
              V  GFL QY + PL G+ IS+ L L +  A GLIL+ CCPG
Sbjct  173  KEVLSGFLIQYSVMPLSGFLISKLLNLPSHSAAGLILLGCCPG  215



>ref|WP_017697159.1| sodium transporter [Bacillus subtilis]
 gb|KIN38768.1| hypothetical protein B4070_2092 [Bacillus subtilis]
Length=321

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FDIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_015383869.1| putative sodium-dependent transporter [Bacillus subtilis]
 gb|AGE63767.1| putative sodium-dependent transporter [Bacillus subtilis XF-1]
 gb|AGI29252.1| putative sodium-dependent transporter [Bacillus subtilis subsp. 
subtilis str. BAB-1]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_038829949.1| sodium transporter, partial [Bacillus subtilis]
Length=295

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_043857674.1| sodium transporter [Bacillus subtilis]
 gb|KIU11229.1| sodium-dependent transporter [Bacillus subtilis]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGVIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_041351149.1| sodium transporter [Bacillus subtilis]
 gb|KIN33066.1| hypothetical protein B4069_1999 [Bacillus subtilis]
 gb|KIN47866.1| hypothetical protein B4072_2006 [Bacillus subtilis]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FDIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_014480025.1| hypothetical protein [Bacillus subtilis]
 dbj|BAI85603.1| hypothetical protein BSNT_08498 [Bacillus subtilis subsp. natto 
BEST195]
 dbj|GAK81223.1| putative sodium-dependent transporter [Bacillus subtilis Miyagi-4]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_021481467.1| sodium transporter [Bacillus sp. EGD-AK10]
 gb|ERI42364.1| sodium transporter [Bacillus sp. EGD-AK10]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_038429129.1| sodium transporter [Bacillus subtilis]
 gb|AIX07727.1| Sodium Bile acid symporter family protein [Bacillus subtilis]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_020158510.1| transporter [Methylobacter marinus]
Length=336

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = +2

Query  482  RIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCL  661
            R+   L  LFP WV++ + + ++ P+  TW    +    L  +M+ MG+TL+F+DF R  
Sbjct  3    RLFNLLANLFPFWVLIFSGLALFFPAWFTWFSGSMIVWGLAVIMIGMGITLSFEDFHRVT  62

Query  662  RNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R+   V +G  AQ+ + PLLG+AI+ A  L   LA GLILV+CCPG
Sbjct  63   RSARPVLIGIAAQFAVMPLLGWAIASAFALETQLAVGLILVACCPG  108



>ref|WP_041053957.1| sodium transporter [Bacillus subtilis]
 gb|KIL32518.1| hypothetical protein B4067_2151 [Bacillus subtilis subsp. subtilis]
 gb|KIN31712.1| hypothetical protein B4068_1922 [Bacillus subtilis]
 gb|KIN43133.1| hypothetical protein B4071_1974 [Bacillus subtilis]
 gb|KIN46087.1| hypothetical protein B4073_2116 [Bacillus subtilis]
 gb|KIN56586.1| hypothetical protein B4145_2091 [Bacillus subtilis]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|XP_009376715.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
 ref|XP_009376716.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=424

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E ++T  P+WV LG ++G+ KPS+  W+  +     L   ML MG+TLTF D R  
Sbjct  114  ELVGEAVSTAIPIWVALGCLLGLLKPSSFNWVTPNYNIFGLTLTMLGMGMTLTFADLRGA  173

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L  P  +  GF+ QY + PL GY +S+ L L +  A GLILV CCPG
Sbjct  174  LAMPKELLAGFVLQYSVMPLSGYFVSKLLNLPSYYAAGLILVGCCPG  220



>ref|WP_024572776.1| sodium transporter [Bacillus subtilis]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_004399225.1| MULTISPECIES: sodium transporter [Bacillus]
 ref|NP_389817.1| sodium-dependent transporter YocS [Bacillus subtilis subsp. subtilis 
str. 168]
 sp|O34524.1|YOCS_BACSU RecName: Full=Uncharacterized sodium-dependent transporter YocS 
[Bacillus subtilis subsp. subtilis str. 168]
 gb|AAB84443.1| putative transporter [Bacillus subtilis]
 emb|CAB13827.1| putative sodium-dependent transporter [Bacillus subtilis subsp. 
subtilis str. 168]
 gb|ADV92838.1| putative sodium-dependent transporter [Bacillus subtilis BSn5]
 dbj|BAM52599.1| sodium-dependent transporter [Synechocystis sp. PCC 6803] [Synechocystis 
sp. PCC 6803]
 dbj|BAM58174.1| sodium-dependent transporter [Bacillus subtilis BEST7003]
 gb|AGA23423.1| Transporter protein YocS [Bacillus subtilis subsp. subtilis str. 
BSP1]
 gb|EME05300.1| bile acid transporter family protein [Bacillus subtilis MB73/2]
 gb|AGG61320.1| putative sodium-dependent transporter YocS [Bacillus subtilis 
subsp. subtilis 6051-HGW]
 gb|AHA77983.1| putative sodium-dependent transporter yocS [Bacillus subtilis 
PY79]
 gb|AIC40365.1| sodium-dependent transporter [Bacillus subtilis subsp. subtilis 
str. JH642 substr. AG174]
 gb|AIC44597.1| sodium-dependent transporter [Bacillus subtilis subsp. subtilis 
str. AG1839]
 gb|KFH36030.1| sodium transporter [Bacillus subtilis subsp. subtilis]
 gb|KFH37225.1| sodium transporter [Bacillus subtilis subsp. subtilis]
 emb|CEI57137.1| sodium-dependent transporter YocS [Bacillus subtilis]
 emb|CEJ77562.1| sodium-dependent transporter YocS [Bacillus sp.]
 gb|AIY93254.1| sodium transporter [Bacillus subtilis subsp. subtilis str. 168]
 gb|AIY97561.1| sodium transporter [Bacillus subtilis]
 gb|AJE94634.1| sodium transporter [Bacillus subtilis subsp. subtilis]
 gb|KIN53184.1| hypothetical protein B4146_2107 [Bacillus subtilis]
 gb|KIO59348.1| hypothetical protein B4143_2076 [Bacillus subtilis]
 gb|AJO58555.1| sodium transporter [Bacillus sp. YP1]
 gb|KIX80511.1| putative sodium-dependent transporter YocS [Bacillus subtilis]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_000448528.1| Sodium-dependent transporter [Leptospira interrogans]
 gb|EMJ37303.1| sodium Bile acid symporter family protein [Leptospira interrogans 
str. FPW1039]
Length=316

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 66/110 (60%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSILSFFFPQWFTWFTGPAITYGLGFTMLGMGITLLPRDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P +V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPISVFIGVALQYTVMPVSGWGIGVLLDLPIPLATGLVVVSCCPG  112



>ref|XP_009376713.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009376714.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=424

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E ++T  P+WV LG ++G+ KPS+  W+  +     L   ML MG+TLTF D R  
Sbjct  114  ELVGEAVSTAIPIWVALGCLLGLLKPSSFNWVTPNYNIFGLTLTMLGMGMTLTFADLRGA  173

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L  P  +  GF+ QY + PL GY +S+ L L +  A GLILV CCPG
Sbjct  174  LAMPKELLAGFVLQYSVMPLSGYFVSKLLNLPSYYAAGLILVGCCPG  220



>ref|WP_014477076.1| sodium transporter [Bacillus subtilis]
 gb|AEP91131.1| bile acid transporter family protein [Bacillus subtilis subsp. 
subtilis str. RO-NN-1]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|XP_001752354.1| predicted protein [Physcomitrella patens]
 gb|EDQ83087.1| predicted protein [Physcomitrella patens]
Length=345

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 63/110 (57%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            +  E   E L++ FP+WV    V G+ KP+A TW++  +  + L   ML MG+T++ DD 
Sbjct  26   TSIEAFGEALSSGFPIWVAAACVAGLVKPAAFTWIQGQVQIIGLSITMLGMGMTMSLDDL  85

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            +  L  P  +  G L QY + P  G  +SR L L A  A GLILVSCCPG
Sbjct  86   KGALAMPKELVAGVLLQYTVMPTAGALVSRLLNLPANYAAGLILVSCCPG  135



>ref|WP_019712212.1| sodium transporter [Bacillus subtilis]
 gb|KFC30342.1| sodium transporter [Bacillus subtilis]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_032725977.1| sodium transporter [Bacillus subtilis]
 emb|CCU58612.1| Sodium-dependent transporter [Bacillus subtilis E1]
Length=321

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_041514441.1| transporter [Nitrosospira sp. NpAV]
 gb|KIO48507.1| transporter [Nitrosospira sp. NpAV]
Length=311

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 69/106 (65%), Gaps = 1/106 (1%)
 Frame = +2

Query  485  IIETLTTLFPVWVILGTVIGIYKPSAVTWL-ETDlftlslgflmlsmgltltfDDFRRCL  661
            +++ L  LFP+W+IL   I +Y P  +T + +  +  L L F+MLSMGLTLTF+DFRR  
Sbjct  1    MLQRLALLFPLWMILSGAIALYWPHGLTAMNQGPVMVLVLAFIMLSMGLTLTFEDFRRVA  60

Query  662  RNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R P  V +GF AQY I PLL + ++ AL L    A GLILV CCPG
Sbjct  61   RLPRAVAIGFAAQYSIMPLLAWGVAHALALPPHFAVGLILVGCCPG  106



>gb|AFQ57875.1| Putative sodium-dependent transporter [Bacillus subtilis QB928]
Length=340

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  34   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  92

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  93   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  129



>ref|XP_010537693.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Tarenaya hassleriana]
Length=408

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 72/123 (59%), Gaps = 1/123 (1%)
 Frame = +2

Query  434  SGDIPGDSSSGMSQY-ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgfl  610
            S + P +      ++ E + E ++T FP+WV +G ++G+ KPSA +W+      + L   
Sbjct  82   SEEFPTERKKSFGEWVEWLGEVVSTAFPIWVSVGCLLGLLKPSAFSWVTPRWTIIGLTIT  141

Query  611  mlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSC  790
            ML MG+TLT DD R  L  P  +  GF+ QY I P+ G+ +S+ L L +  A GLILV C
Sbjct  142  MLGMGMTLTLDDLRGALSMPKELLSGFVLQYSIMPMSGFLVSKLLNLPSHYAAGLILVGC  201

Query  791  CPG  799
            CPG
Sbjct  202  CPG  204



>ref|WP_029726822.1| sodium transporter [Bacillus subtilis]
 gb|AIC98523.1| sodium transporter [Bacillus subtilis subsp. subtilis str. OH 
131.1]
Length=321

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWQVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAQIAVGVILVGCCPG  110



>ref|XP_007022021.1| Sodium Bile acid symporter family isoform 1 [Theobroma cacao]
 gb|EOY13546.1| Sodium Bile acid symporter family isoform 1 [Theobroma cacao]
Length=404

 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/134 (38%), Positives = 76/134 (57%), Gaps = 2/134 (1%)
 Frame = +2

Query  398  KLRLSCKAATNVSGDIPGDSSSGMSQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLE  577
            + +L C  ++  S ++  + S G    E + E ++T FP+WV LG + G+ KP++ +W+ 
Sbjct  69   RFQLQCSISSE-SYNLNNEKSFG-DWVEWLGEVISTAFPIWVSLGCLFGLLKPTSFSWVT  126

Query  578  TDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSA  757
                   L   ML MG+TLT DD R  L  P  +  GF+ QY + PL G+ +S+ L L +
Sbjct  127  PRWNIFGLTLTMLGMGMTLTLDDLRGALAMPKELISGFVLQYSVMPLSGFLVSKLLNLPS  186

Query  758  PLATGLILVSCCPG  799
              A GLILV CCPG
Sbjct  187  HYAAGLILVGCCPG  200



>gb|KJJ42428.1| sodium transporter [Bacillus subtilis]
Length=321

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 62/97 (64%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFSFPSLFTWI-SSYITIFLGIIMFGMGLTLQADDFKELVRKPWHVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             +AQY I PL+ + ++  L L A +A G+ILV CCPG
Sbjct  74   VIAQYTIMPLVAFGLAFGLHLPAEIAVGVILVGCCPG  110



>ref|XP_002889199.1| bile acid:sodium symporter family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH65458.1| bile acid:sodium symporter family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=399

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 69/123 (56%), Gaps = 1/123 (1%)
 Frame = +2

Query  434  SGDIPGDSSSGMSQY-ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgfl  610
            S D+P +      ++ E + E ++T FP+WV LG ++G+ +PS   W+  +     L   
Sbjct  73   SNDLPTEKKKSFGEWVEFVGEAVSTAFPIWVSLGCLLGLMRPSTFNWVTPNWTIAGLTIT  132

Query  611  mlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSC  790
            ML MG+TLTFDD R     P  +  GF+ QY + PL  + +S+ L L    A GLILV C
Sbjct  133  MLGMGMTLTFDDLRGAFSMPKELFAGFVLQYSVMPLSAFFVSKLLNLPPHYAAGLILVGC  192

Query  791  CPG  799
            CPG
Sbjct  193  CPG  195



>ref|XP_005827510.1| hypothetical protein GUITHDRAFT_75425 [Guillardia theta CCMP2712]
 gb|EKX40530.1| hypothetical protein GUITHDRAFT_75425 [Guillardia theta CCMP2712]
Length=365

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 3/109 (3%)
 Frame = +2

Query  476  YERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETD-lftlslgflmlsmgltltfDDFR  652
            Y ++IETLT LFP+W  + + I +Y P +  WL T+    L L  +MLS+G +L   D  
Sbjct  54   YFKVIETLTLLFPLWTFVLSGIALYNPDSFGWLTTEPGTLLFLSVVMLSIGTSLNAKDLY  113

Query  653  RCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   N + +G+ ++ +Y + PLLG  +SR   LS  LATGLIL+SCCPG
Sbjct  114  RVRDNLYPIGIAYVCRYAMTPLLGLLVSRF--LSESLATGLILLSCCPG  160



>ref|WP_045384460.1| sodium transporter [Bacillus subtilis]
Length=342

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFTFPSFFTWI-SSYITIFLGIIMFGMGLTLQADDFKELIRKPWHVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             + QY I PL+ + +S  L L A +A G+ILV CCPG
Sbjct  74   VIVQYTIMPLVAFGLSFGLHLPAEIAVGVILVGCCPG  110



>ref|WP_036243826.1| transporter, partial [Methylobacter luteus]
Length=306

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 63/106 (59%), Gaps = 0/106 (0%)
 Frame = +2

Query  482  RIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCL  661
            R+   L  LFP WV++ + + ++ P   TW    +    L  +M+ MG+TL+F+DFRR  
Sbjct  3    RLFNLLANLFPFWVLIFSGLALFFPGWFTWFSGPMIVWGLAVIMIGMGITLSFEDFRRVT  62

Query  662  RNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R P  V +G  AQ+ + PLLG+ I+    L   LA GLILV+CCPG
Sbjct  63   RTPRPVLIGVAAQFAVMPLLGWTIASGFSLETQLAVGLILVACCPG  108



>ref|WP_041906927.1| sodium transporter [Bacillus sp. BSC154]
 gb|KFI01359.1| sodium transporter [Bacillus sp. BSC154]
Length=321

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFTFPSFFTWI-SSYITIFLGIIMFGMGLTLQADDFKELIRKPWHVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             + QY I PL+ + +S  L L A +A G+ILV CCPG
Sbjct  74   VIVQYTIMPLVAFGLSFGLHLPAEIAVGVILVGCCPG  110



>ref|XP_011006844.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Populus euphratica]
Length=402

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 76/133 (57%), Gaps = 4/133 (3%)
 Frame = +2

Query  404  RLSCKAATNVSGDIPGDSSSGMSQY-ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLET  580
            +L C  ++N   D+   S  G+ ++ E I + ++T FP+WV LG ++G+ +P++  W+  
Sbjct  69   QLHCGISSN---DLSSGSKRGLREWIEVISDAISTAFPIWVSLGCLLGLLRPTSYNWVTP  125

Query  581  DlftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAP  760
                + L   ML MG+TLT DD       P  V  GF+ QY + P+ G+ +S+ L L + 
Sbjct  126  KWVGIGLPLTMLGMGMTLTLDDLSNAFAMPKEVLSGFVLQYSVMPISGFLVSKLLNLPSY  185

Query  761  LATGLILVSCCPG  799
             A GLILV CCPG
Sbjct  186  YAAGLILVGCCPG  198



>ref|WP_003220128.1| sodium transporter [Bacillus subtilis]
 gb|EFG93236.1| putative sodium-dependent transporter [Bacillus subtilis subsp. 
spizizenii ATCC 6633]
 gb|ADM38108.1| putative sodium-dependent transporter [Bacillus subtilis subsp. 
spizizenii str. W23]
 gb|KFK77645.1| bile acid transporter family protein [Bacillus subtilis]
 gb|AJD36649.1| sodium transporter [Bacillus subtilis subsp. spizizenii]
 gb|AJW83712.1| sodium transporter [Bacillus subtilis]
Length=321

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFTFPSFFTWI-SSYITIFLGIIMFGMGLTLQADDFKELIRKPWHVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             + QY I PL+ + +S  L L A +A G+ILV CCPG
Sbjct  74   VIVQYTIMPLVAFGLSFGLHLPAEIAVGVILVGCCPG  110



>ref|XP_003543183.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic-like 
[Glycine max]
Length=415

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 64/103 (62%), Gaps = 0/103 (0%)
 Frame = +2

Query  491  ETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNP  670
            E L+T FP+WV + +V+G+ KPS   W+   L  + L  +ML MG+TLT DD R  L  P
Sbjct  113  EVLSTGFPLWVTIASVLGLMKPSYFNWVTPKLSIMGLNIIMLGMGMTLTLDDLRGVLAMP  172

Query  671  WTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
              V  GFL QY + PL G+ IS+ L L +  A G+IL+ CCPG
Sbjct  173  KEVLSGFLIQYSVMPLSGFLISKLLNLPSHSAAGIILLGCCPG  215



>ref|XP_010429683.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Camelina sativa]
Length=422

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 0/107 (0%)
 Frame = +2

Query  479  ERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRC  658
            E + E ++  FPVWV LG ++G+ +P+   W+  +  T+ L   ML MG+TLT DD R  
Sbjct  112  EYLGEAVSIAFPVWVSLGCLLGLLRPTTFNWVTPNWTTVGLTITMLGMGMTLTLDDLRGA  171

Query  659  LRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            L  P  +  GF+ QY + PL GY +S+ L L    A GLILV CCPG
Sbjct  172  LSMPKELFAGFVLQYSVMPLSGYFVSKLLNLPPHYAAGLILVGCCPG  218



>ref|XP_009392828.1| PREDICTED: probable sodium/metabolite cotransporter BASS1, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=418

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 72/131 (55%), Gaps = 3/131 (2%)
 Frame = +2

Query  416  KAATNVSGDIPGDSSSGMSQYERII---ETLTTLFPVWVILGTVIGIYKPSAVTWLETDl  586
            +AA+N   D   D  S  S  E I+   E L+  FP+WV    V+ ++KPS+  W   + 
Sbjct  83   RAASNPLADSGADGESERSLREVIVRAGEVLSLAFPLWVGSACVLALWKPSSFLWAHKNW  142

Query  587  ftlslgflmlsmgltltfDDFRRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLA  766
              L L   ML MG+TLT  D R  L  P  +  GF+ QY + PL G+ +S+ L L +  A
Sbjct  143  QILGLTLTMLGMGMTLTLQDLRGALLMPKELAAGFVLQYTVMPLSGFFVSKLLDLPSHYA  202

Query  767  TGLILVSCCPG  799
             GLILV+CCPG
Sbjct  203  AGLILVACCPG  213



>ref|WP_044445279.1| sodium transporter [Bacillus subtilis]
Length=321

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 61/97 (63%), Gaps = 1/97 (1%)
 Frame = +2

Query  509  FPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCLRNPWTVGVG  688
            F +WVI+  V+G   PS  TW+ +   T+ LG +M  MGLTL  DDF+  +R PW V +G
Sbjct  15   FGIWVIVFAVLGFTFPSFFTWI-SSYITIFLGIIMFGMGLTLQADDFKELIRKPWHVIIG  73

Query  689  FLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
             + QY I PL+ + +S  L L A +A G+ILV CCPG
Sbjct  74   VIVQYTIMPLVAFGLSFGLHLPAEVAVGVILVGCCPG  110



>ref|WP_036247339.1| transporter [Methylobacter sp. BBA5.1]
Length=336

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 65/106 (61%), Gaps = 0/106 (0%)
 Frame = +2

Query  482  RIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCL  661
            R+   L  LFP WV++ + + ++ P+  TW    +    L  +M+ MG+TL+F+DF R  
Sbjct  3    RLFNLLANLFPFWVLIFSGLALFFPAWFTWFSGPMIVWGLAVIMVGMGITLSFEDFHRVT  62

Query  662  RNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R+   V +G  AQ+ + PLLG+AI+ A  L   LA GLILV+CCPG
Sbjct  63   RSARPVLIGIAAQFAVMPLLGWAIASAFALETQLAVGLILVACCPG  108



>ref|WP_017365455.1| transporter [Methylococcus capsulatus]
Length=334

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 64/105 (61%), Gaps = 0/105 (0%)
 Frame = +2

Query  482  RIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDFRRCL  661
            RI  +L  LFPVWV+L + + +Y P+  TW    +    L  +ML MG+TLTFDDF R  
Sbjct  3    RICNSLANLFPVWVLLCSGLALYFPAWFTWFTGPMIVWGLSIIMLGMGITLTFDDFHRVA  62

Query  662  RNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCP  796
            R P  +  G +A + I P LG++I+  L L   LA GLILV+CCP
Sbjct  63   RMPRIIIAGTVAHFGIMPFLGWSIAHGLALEPELAVGLILVACCP  107



>ref|WP_016753439.1| transporter, partial [Leptospira kirschneri]
Length=299

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 64/110 (58%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV +G+++  + P   TW      T  LGF ML MG TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVSIGSILSFFFPEWFTWFTGPAITYGLGFTMLGMGSTLLPKDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G + QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPIPVFIGVVLQYTVMPVSGWGIGILLDLPMPLATGLVVVSCCPG  112



>ref|WP_004756245.1| transporter [Leptospira kirschneri]
 gb|EJO67839.1| sodium Bile acid symporter family protein [Leptospira kirschneri 
serovar Grippotyphosa str. RM52]
Length=316

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV +G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVSIGSILSFFFPEWFTWFTGPAITYGLGFTMLGMGITLLPKDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G + QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPIPVFIGVVLQYTVMPVSGWGIGVLLDLPMPLATGLVVVSCCPG  112



>ref|WP_002101302.1| sodium Bile acid symporter family protein [Leptospira interrogans]
 gb|EKR29189.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Bataviae str. L1111]
 gb|KGE21166.1| transporter [Leptospira interrogans serovar Lai]
Length=316

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSILSFFFPQWFTWFTGPAITYGLGFTMLGMGITLLPRDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPIPVFIGVALQYTVMPVSGWGIGVLLDLPIPLATGLVVVSCCPG  112



>ref|WP_000448522.1| transporter [Leptospira interrogans]
 gb|AAS72229.1| bile acid Na+ symporter [Leptospira interrogans serovar Copenhageni 
str. Fiocruz L1-130]
 gb|EKP21855.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Icterohaemorrhagiae str. Verdun LP]
 gb|EKP75155.1| sodium Bile acid symporter family protein [Leptospira interrogans 
str. HAI1594]
 gb|EKR16790.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Pyrogenes str. 2006006960]
 gb|EMG20721.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Copenhageni str. LT2050]
 gb|EMM94217.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Zanoni str. LT2156]
 gb|EMO05459.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Icterohaemorrhagiae str. Verdun HP]
 gb|EMO17746.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Copenhageni str. HAI0188]
 gb|EMO36115.1| sodium Bile acid symporter family protein [Leptospira interrogans 
str. MMD3731]
 gb|EMY51690.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Copenhageni str. M20]
Length=316

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSILSFFFPQWFTWFTGPAITYGLGFTMLGMGITLLPRDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPIPVFIGVALQYTVMPVSGWGIGVLLDLPIPLATGLVVVSCCPG  112



>ref|WP_000448523.1| transporter [Leptospira interrogans]
 gb|EJP15914.1| sodium Bile acid symporter family protein [Leptospira interrogans 
str. FPW2026]
 gb|EKO25051.1| sodium Bile acid symporter family protein [Leptospira interrogans 
str. UI 12621]
 gb|EKO70274.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Canicola str. Fiocruz LV133]
 gb|EKR37925.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Hebdomadis str. R499]
 gb|EKR46162.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Grippotyphosa str. UI 08368]
 gb|EKR53813.1| sodium Bile acid symporter family protein [Leptospira interrogans 
str. UI 12758]
 gb|EMF40913.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Lora str. TE 1992]
 gb|EMF74252.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Canicola str. LT1962]
 gb|EMG08906.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Grippotyphosa str. LT2186]
 gb|EMJ50177.1| sodium Bile acid symporter family protein [Leptospira interrogans 
str. UT126]
 gb|EMK20482.1| sodium Bile acid symporter family protein [Leptospira interrogans 
str. Kito]
 gb|EMM79104.1| sodium Bile acid symporter family protein [Leptospira interrogans 
str. 2006001854]
 gb|EMM89514.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Djasiman str. LT1649]
 gb|EMN11056.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Muenchen str. Brem 129]
 gb|EMN52719.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Autumnalis str. LP101]
 gb|EMN68841.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Grippotyphosa str. UI 08434]
 gb|EMN73800.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Bataviae str. UI 08561]
 gb|EMN74882.1| sodium Bile acid symporter family protein [Leptospira interrogans 
str. UI 09600]
 gb|EMN82999.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Grippotyphosa str. UI 12764]
 gb|EMN84447.1| sodium Bile acid symporter family protein [Leptospira interrogans 
serovar Grippotyphosa str. UI 12769]
 gb|EMO94581.1| sodium Bile acid symporter family protein [Leptospira interrogans 
str. UI 13372]
Length=316

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSILSFFFPQWFTWFTGPAITYGLGFTMLGMGITLLPRDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPIPVFIGVALQYTVMPVSGWGIGVLLDLPIPLATGLVVVSCCPG  112



>ref|WP_016560727.1| sodium Bile acid symporter family protein [Leptospira kirschneri]
 gb|EPG50019.1| sodium Bile acid symporter family protein [Leptospira kirschneri 
serovar Cynopteri str. 3522 CT]
Length=314

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV +G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVSIGSILSFFFPEWFTWFTGPAITYGLGFTMLGMGITLLPKDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G + QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPIPVFIGVVLQYTVMPVSGWGIGVLLDLPMPLATGLVVVSCCPG  112



>ref|WP_017853737.1| transporter [Leptospira interrogans]
Length=316

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSILSFFFPQWFTWFTGPAITYGLGFTMLGMGITLLPRDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPIPVFIGVALQYTVMPVSGWGIGVLLDLPIPLATGLVVVSCCPG  112



>ref|WP_000448524.1| transporter [Leptospira interrogans]
 ref|NP_714810.1| hypothetical protein LB_266 [Leptospira interrogans serovar Lai 
str. 56601]
 gb|AAN51825.1| bile acid Na+ symporter [Leptospira interrogans serovar Lai str. 
56601]
 gb|AER04453.1| bile acid Na+ symporter [Leptospira interrogans serovar Lai str. 
IPAV]
Length=316

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSILSFFFPQWFTWFTGPAITYGLGFTMLGMGITLLPRDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G   QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPIPVFIGVALQYTVMPVSGWGIGVLLDLPIPLATGLVVVSCCPG  112



>ref|WP_020762608.1| sodium Bile acid symporter family protein [Leptospira kirschneri]
 gb|EMK25844.1| sodium Bile acid symporter family protein [Leptospira kirschneri 
serovar Bulgarica str. Nikolaevo]
Length=316

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV +G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVSIGSILSFFFPEWFTWFTGPAITYGLGFTMLGMGITLLPKDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P  V +G + QY + P+ G+ I   L L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPIPVFIGVVLQYTVMPVSGWGIGVLLDLPTPLATGLVVVSCCPG  112



>ref|WP_045193578.1| transporter [Leptospira interrogans]
 gb|AJR16419.1| hypothetical protein LIL_20217 [Leptospira interrogans serovar 
Linhai str. 56609]
Length=316

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 65/110 (59%), Gaps = 0/110 (0%)
 Frame = +2

Query  470  SQYERIIETLTTLFPVWVILGTVIGIYKPSAVTWLETDlftlslgflmlsmgltltfDDF  649
            ++ ++I E  T LFP WV++G+++  + P   TW      T  LGF ML MG+TL   DF
Sbjct  3    TKLQKIGEVGTLLFPAWVLIGSILSFFFPQWFTWFTGPAITYGLGFTMLGMGITLLPRDF  62

Query  650  RRCLRNPWTVGVGFLAQYLIKPLLGYAISRALKLSAPLATGLILVSCCPG  799
            R   + P +V +G   QY + P+ G+ I     L  PLATGL++VSCCPG
Sbjct  63   RNIFKTPISVFIGVALQYTVMPVSGWGIGVLFDLPIPLATGLVVVSCCPG  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1655620752480