BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9443

Length=1880
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009800463.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    868   0.0      Nicotiana sylvestris
gb|AHM22941.1|  3-hydroxy-3-methylglutaryl coenzyme A synthase          867   0.0      Nicotiana tabacum [American tobacco]
ref|XP_009626966.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    867   0.0      Nicotiana tomentosiformis
ref|XP_009803000.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    863   0.0      Nicotiana sylvestris
ref|XP_009614165.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    863   0.0      Nicotiana tomentosiformis
ref|XP_004252572.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    863   0.0      Solanum lycopersicum
ref|XP_006364129.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    862   0.0      Solanum tuberosum [potatoes]
ref|XP_009597456.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    862   0.0      Nicotiana tomentosiformis
gb|ABV02025.1|  HMG-CoA synthase                                        860   0.0      Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_004245661.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase      860   0.0      Solanum lycopersicum
ref|XP_006358385.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    859   0.0      Solanum tuberosum [potatoes]
ref|XP_006358854.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    858   0.0      Solanum tuberosum [potatoes]
gb|AFC34137.1|  3-hydroxy-3-methylglutaryl-CoA synthase                 858   0.0      Camellia sinensis [black tea]
ref|NP_001234846.1|  3-hydroxy-3-methylglutaryl coenzyme A synthase     857   0.0      Solanum lycopersicum
ref|XP_009776168.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    855   0.0      Nicotiana sylvestris
ref|XP_011072067.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    850   0.0      Sesamum indicum [beniseed]
ref|XP_011081049.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    848   0.0      Sesamum indicum [beniseed]
gb|AIK21781.1|  3-hydroxy-3-methylglutaryl coenzyme A synthase          847   0.0      Panax notoginseng [san-qi]
gb|EYU39002.1|  hypothetical protein MIMGU_mgv1a006016mg                845   0.0      Erythranthe guttata [common monkey flower]
emb|CDP09824.1|  unnamed protein product                                844   0.0      Coffea canephora [robusta coffee]
ref|XP_007040101.1|  Hydroxymethylglutaryl-CoA synthase / HMG-CoA...    843   0.0      
ref|XP_002282434.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase      841   0.0      Vitis vinifera
gb|AEM42970.1|  hydroxymethylglutaryl-CoA synthase                      840   0.0      Siraitia grosvenorii [arhat fruit]
ref|XP_008238764.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase      838   0.0      Prunus mume [ume]
ref|XP_007209993.1|  hypothetical protein PRUPE_ppa005266mg             838   0.0      Prunus persica
gb|ADI80347.1|  3-hydroxy-3-methylglutaryl coenzyme A synthase          835   0.0      Panax ginseng [Asiatic ginseng]
gb|KJB20762.1|  hypothetical protein B456_003G163200                    835   0.0      Gossypium raimondii
ref|XP_006440512.1|  hypothetical protein CICLE_v10020042mg             835   0.0      Citrus clementina [clementine]
ref|XP_008381926.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase      834   0.0      
ref|XP_006477363.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    833   0.0      Citrus sinensis [apfelsine]
gb|ACV65039.1|  3-hydroxy-3-methylglutaryl coenzyme A synthase          833   0.0      Salvia miltiorrhiza [Chinese salvia]
gb|AIO11225.2|  hydroxymethylglutaryl coenzyme A synthase isoform       833   0.0      Hevea brasiliensis [jebe]
gb|KDO63604.1|  hypothetical protein CISIN_1g012353mg                   833   0.0      Citrus sinensis [apfelsine]
gb|AEC13715.1|  hydroxymethylglutaryl-CoA synthase                      832   0.0      Catharanthus roseus [chatas]
ref|XP_009377905.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    832   0.0      Pyrus x bretschneideri [bai li]
ref|XP_002509692.1|  hydroxymethylglutaryl-CoA synthase, putative       832   0.0      Ricinus communis
dbj|BAF98279.1|  hydroxymethylglutaryl-CoA synthase                     831   0.0      Hevea brasiliensis [jebe]
gb|KJB20763.1|  hypothetical protein B456_003G163200                    830   0.0      Gossypium raimondii
gb|AAS46245.1|  HMG-CoA synthase 2                                      830   0.0      Hevea brasiliensis [jebe]
gb|ACD87446.1|  3-hydroxy-3-methylglutaryl-CoA synthase                 830   0.0      Camptotheca acuminata
ref|XP_012087024.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase      829   0.0      Jatropha curcas
gb|AGQ04158.1|  hydroxymethylglutaryl-CoA synthase                      827   0.0      Lavandula angustifolia [lavender]
gb|AAL18930.1|AF429389_1  hydroxymethylglutaryl coenzyme A synthase     826   0.0      Hevea brasiliensis [jebe]
gb|KJB52035.1|  hypothetical protein B456_008G243100                    825   0.0      Gossypium raimondii
gb|AGZ15317.1|  3-hydroxy-3-methylglutaryl CoA synthase                 825   0.0      Platycodon grandiflorus [balloon-flower]
ref|XP_009362838.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    825   0.0      Pyrus x bretschneideri [bai li]
ref|XP_011033824.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    825   0.0      Populus euphratica
gb|AJK26754.1|  3-hydroxy-3-methylglutaryl Co-enzyme A synthase         825   0.0      Tripterygium wilfordii
ref|XP_008448952.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase      822   0.0      Cucumis melo [Oriental melon]
ref|XP_003549866.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    822   0.0      Glycine max [soybeans]
ref|XP_004298742.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxymethy...    821   0.0      Fragaria vesca subsp. vesca
gb|AAK73854.1|  hydroxymethylglutaryl coenzyme A synthase               822   0.0      Hevea brasiliensis [jebe]
ref|XP_002304458.2|  hypothetical protein POPTR_0003s12030g             821   0.0      
ref|XP_008374018.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    821   0.0      
dbj|BAF98278.1|  hydroxymethylglutaryl-CoA synthase                     821   0.0      Hevea brasiliensis [jebe]
gb|KHG02248.1|  Hydroxymethylglutaryl-CoA synthase -like protein        820   0.0      Gossypium arboreum [tree cotton]
ref|XP_004147967.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase      820   0.0      Cucumis sativus [cucumbers]
gb|KHN14128.1|  Hydroxymethylglutaryl-CoA synthase                      818   0.0      Glycine soja [wild soybean]
ref|XP_004511613.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    815   0.0      Cicer arietinum [garbanzo]
gb|AHK61014.1|  3-hydroxy-3-methylglutaryl-coenzyme A synthase          812   0.0      Aquilaria sinensis
ref|XP_010272584.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    812   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_011081050.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    811   0.0      
ref|XP_007155571.1|  hypothetical protein PHAVU_003G213200g             811   0.0      Phaseolus vulgaris [French bean]
gb|ABK93824.1|  unknown                                                 811   0.0      Populus trichocarpa [western balsam poplar]
gb|AAF69804.1|AF148847_1  HMG-CoA synthase                              811   0.0      Brassica juncea [brown mustard]
ref|XP_002298076.1|  hypothetical protein POPTR_0001s08600g             811   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010676575.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase      811   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011081051.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    810   0.0      
ref|XP_010053352.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase      811   0.0      Eucalyptus grandis [rose gum]
gb|AID51435.1|  3-hydroxy-3-methylglutaryl coenzyme A synthase          810   0.0      Astragalus membranaceus
ref|XP_010108051.1|  Hydroxymethylglutaryl-CoA synthase                 811   0.0      Morus notabilis
emb|CDY47424.1|  BnaA02g21580D                                          810   0.0      Brassica napus [oilseed rape]
emb|CDX86743.1|  BnaA09g21330D                                          810   0.0      
ref|XP_006287702.1|  hypothetical protein CARUB_v10000910mg             810   0.0      Capsella rubella
emb|CDY13282.1|  BnaC09g23740D                                          809   0.0      Brassica napus [oilseed rape]
emb|CDY64800.1|  BnaCnng45000D                                          808   0.0      Brassica napus [oilseed rape]
ref|XP_002874726.1|  hydroxymethylglutaryl-CoA synthase                 808   0.0      Arabidopsis lyrata subsp. lyrata
ref|XP_007158452.1|  hypothetical protein PHAVU_002G153600g             808   0.0      Phaseolus vulgaris [French bean]
gb|AAG32922.1|AF188639_1  HMG-CoA synthase                              807   0.0      Brassica juncea [brown mustard]
ref|XP_009128649.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    807   0.0      Brassica rapa
ref|XP_011029156.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    807   0.0      Populus euphratica
ref|XP_010434116.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase      807   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_006396844.1|  hypothetical protein EUTSA_v10028643mg             806   0.0      Eutrema salsugineum [saltwater cress]
emb|CAA58763.1|  hydroxymethylglutaryl-CoA synthase                     806   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009102712.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase      806   0.0      Brassica rapa
gb|AAG32923.1|AF188640_1  HMG-CoA synthase                              805   0.0      Brassica juncea [brown mustard]
ref|XP_003538436.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    806   0.0      
gb|KHN34992.1|  Hydroxymethylglutaryl-CoA synthase                      805   0.0      Glycine soja [wild soybean]
ref|XP_003611167.1|  Hydroxymethylglutaryl-CoA synthase                 803   0.0      Medicago truncatula
ref|XP_010255571.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    803   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_007038548.1|  Hydroxymethylglutaryl-CoA synthase / HMG-CoA...    803   0.0      
ref|NP_192919.1|  Hydroxymethylglutaryl-CoA synthase                    803   0.0      Arabidopsis thaliana [mouse-ear cress]
pdb|2F82|A  Chain A, Hmg-Coa Synthase From Brassica Juncea In The...    802   0.0      Brassica juncea [brown mustard]
ref|XP_010422136.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    802   0.0      Camelina sativa [gold-of-pleasure]
gb|KFK31939.1|  hypothetical protein AALP_AA6G179500                    802   0.0      Arabis alpina [alpine rockcress]
ref|XP_003517453.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase      802   0.0      Glycine max [soybeans]
gb|AFP23864.1|  3-hydroxy-3-methylglutaryl coenzyme A synthase          800   0.0      Picrorhiza kurrooa
ref|XP_010455597.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    800   0.0      Camelina sativa [gold-of-pleasure]
pdb|2FA3|A  Chain A, Hmg-Coa Synthase From Brassica Juncea In Com...    799   0.0      Brassica juncea [brown mustard]
gb|AFK46199.1|  unknown                                                 799   0.0      Medicago truncatula
ref|XP_010940907.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    797   0.0      Elaeis guineensis
ref|XP_009415836.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    795   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006421820.1|  hypothetical protein CICLE_v10005099mg             793   0.0      
gb|AHF81872.1|  hydroxymethylglutaryl coenzyme A synthase               793   0.0      Narcissus tazetta
ref|XP_006598724.1|  PREDICTED: uncharacterized protein LOC100777...    790   0.0      
ref|XP_008809783.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    790   0.0      Phoenix dactylifera
ref|XP_010907420.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    791   0.0      Elaeis guineensis
ref|XP_010529525.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    790   0.0      Tarenaya hassleriana [spider flower]
gb|AHF81873.1|  hydroxymethylglutaryl coenzyme A synthase               790   0.0      Narcissus tazetta
gb|ACY74339.1|  putative HMG-CoA synthase 1                             789   0.0      Artemisia annua [sweet Annie]
ref|XP_010540458.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase      788   0.0      Tarenaya hassleriana [spider flower]
ref|XP_007152355.1|  hypothetical protein PHAVU_004G123000g             788   0.0      Phaseolus vulgaris [French bean]
ref|XP_003533236.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    787   0.0      
ref|XP_008777803.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    785   0.0      Phoenix dactylifera
ref|XP_003620731.1|  Hydroxymethylglutaryl-CoA synthase                 783   0.0      Medicago truncatula
gb|AAG32924.1|AF188641_1  HMG-CoA synthase                              781   0.0      Brassica juncea [brown mustard]
ref|XP_011628383.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase      778   0.0      Amborella trichopoda
gb|EAZ09792.1|  hypothetical protein OsI_32080                          775   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010533729.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    773   0.0      Tarenaya hassleriana [spider flower]
ref|XP_004513692.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    770   0.0      Cicer arietinum [garbanzo]
ref|XP_003558959.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    770   0.0      Brachypodium distachyon [annual false brome]
ref|XP_004957395.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    770   0.0      Setaria italica
ref|XP_011081052.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    768   0.0      
ref|NP_001063706.1|  Os09g0521400                                       769   0.0      
ref|XP_008670331.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    769   0.0      
ref|XP_002468628.1|  hypothetical protein SORBIDRAFT_01g049310          767   0.0      
gb|EAZ25374.1|  hypothetical protein OsJ_09191                          767   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006660857.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    767   0.0      Oryza brachyantha
ref|NP_001048774.1|  Os03g0118800                                       766   0.0      
ref|XP_009395343.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    764   0.0      
ref|NP_001140749.1|  uncharacterized protein LOC100272824               764   0.0      Zea mays [maize]
gb|ACG33137.1|  hydroxymethylglutaryl-CoA synthase                      764   0.0      Zea mays [maize]
ref|NP_001170696.1|  uncharacterized protein LOC100384769               763   0.0      Zea mays [maize]
ref|XP_010919197.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    762   0.0      Elaeis guineensis
ref|XP_004985955.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    762   0.0      
ref|XP_003574875.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    760   0.0      Brachypodium distachyon [annual false brome]
ref|XP_002445758.1|  hypothetical protein SORBIDRAFT_07g025240          760   0.0      Sorghum bicolor [broomcorn]
ref|XP_008646617.1|  PREDICTED: uncharacterized protein LOC100384...    759   0.0      
ref|XP_006649284.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    759   0.0      
ref|NP_001062410.1|  Os08g0544900                                       758   0.0      
gb|ACG33328.1|  hydroxymethylglutaryl-CoA synthase                      757   0.0      Zea mays [maize]
gb|EMS57402.1|  Hydroxymethylglutaryl-CoA synthase                      758   0.0      Triticum urartu
gb|ACY74340.1|  putative HMG-CoA synthase 2                             754   0.0      Artemisia annua [sweet Annie]
gb|KDO60144.1|  hypothetical protein CISIN_1g012253mg                   754   0.0      Citrus sinensis [apfelsine]
ref|XP_006659653.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    754   0.0      Oryza brachyantha
ref|NP_001152145.1|  hydroxymethylglutaryl-CoA synthase                 753   0.0      Zea mays [maize]
gb|ABG73437.1|  hydroxymethylglutaryl-CoA synthase                      745   0.0      Oryza brachyantha
gb|ERN19421.1|  hypothetical protein AMTR_s00069p00168650               739   0.0      Amborella trichopoda
emb|CAA65250.1|  3-hydroxy-3-methylglutaryl-CoA-synthase                737   0.0      Pinus sylvestris [Scotch pine]
gb|AAT73206.1|  3-hydroxy-3-methylglutaryl-CoA synthase                 730   0.0      Taxus x media [hybrid yew]
gb|KDO63605.1|  hypothetical protein CISIN_1g012353mg                   729   0.0      Citrus sinensis [apfelsine]
gb|EEC74400.1|  hypothetical protein OsI_09754                          732   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006440513.1|  hypothetical protein CICLE_v10020042mg             727   0.0      
gb|EMT14328.1|  Hydroxymethylglutaryl-CoA synthase                      741   0.0      
ref|NP_001242721.1|  uncharacterized protein LOC100777679               723   0.0      
ref|XP_010940908.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    717   0.0      Elaeis guineensis
ref|XP_007038552.1|  Hydroxymethylglutaryl-CoA synthase / HMG-CoA...    713   0.0      
ref|XP_010907421.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    712   0.0      
ref|XP_003611168.1|  Hydroxymethylglutaryl-CoA synthase                 710   0.0      
ref|NP_849361.1|  Hydroxymethylglutaryl-CoA synthase                    699   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|KHG29301.1|  Hydroxymethylglutaryl-CoA synthase -like protein        697   0.0      Gossypium arboreum [tree cotton]
ref|XP_006421819.1|  hypothetical protein CICLE_v10005099mg             696   0.0      
ref|XP_010919198.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    696   0.0      Elaeis guineensis
ref|XP_010940910.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    694   0.0      
ref|XP_007152356.1|  hypothetical protein PHAVU_004G123000g             686   0.0      Phaseolus vulgaris [French bean]
gb|KJB25737.1|  hypothetical protein B456_004G207000                    669   0.0      Gossypium raimondii
gb|KHN31549.1|  Hydroxymethylglutaryl-CoA synthase                      667   0.0      Glycine soja [wild soybean]
gb|EAZ07863.1|  hypothetical protein OsI_30125                          666   0.0      Oryza sativa Indica Group [Indian rice]
gb|KHG05295.1|  Hydroxymethylglutaryl-CoA synthase -like protein        659   0.0      Gossypium arboreum [tree cotton]
gb|EMS54524.1|  Hydroxymethylglutaryl-CoA synthase                      657   0.0      Triticum urartu
emb|CBI31867.3|  unnamed protein product                                659   0.0      Vitis vinifera
gb|EMT03685.1|  Hydroxymethylglutaryl-CoA synthase                      657   0.0      
gb|KDO63606.1|  hypothetical protein CISIN_1g012353mg                   651   0.0      Citrus sinensis [apfelsine]
ref|XP_007038549.1|  Hydroxymethylglutaryl-CoA synthase / HMG-CoA...    646   0.0      
ref|XP_010919200.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    641   0.0      Elaeis guineensis
gb|KDO60145.1|  hypothetical protein CISIN_1g012253mg                   625   0.0      Citrus sinensis [apfelsine]
gb|ABE73758.1|  3-hydroxy-3-methylglutaryl CoA synthase                 608   0.0      Medicago truncatula
ref|XP_001774681.1|  predicted protein                                  612   0.0      
ref|XP_001772764.1|  predicted protein                                  610   0.0      
ref|XP_002982918.1|  hypothetical protein SELMODRAFT_228892             599   0.0      
ref|XP_002981938.1|  hypothetical protein SELMODRAFT_179152             598   0.0      Selaginella moellendorffii
gb|KDO63607.1|  hypothetical protein CISIN_1g012353mg                   568   0.0      Citrus sinensis [apfelsine]
gb|EYU39003.1|  hypothetical protein MIMGU_mgv1a006016mg                567   0.0      Erythranthe guttata [common monkey flower]
ref|XP_007038550.1|  Hydroxymethylglutaryl-CoA synthase / HMG-CoA...    555   0.0      
ref|XP_007038551.1|  Hydroxymethylglutaryl-CoA synthase / HMG-CoA...    549   0.0      
ref|XP_006421822.1|  hypothetical protein CICLE_v10005099mg             548   0.0      
ref|XP_002984961.1|  hypothetical protein SELMODRAFT_121372             551   0.0      Selaginella moellendorffii
ref|XP_002986147.1|  hypothetical protein SELMODRAFT_123543             549   0.0      Selaginella moellendorffii
gb|ABD57974.2|  hydroxy-methylglutaryl CoA synthase                     535   0.0      Arnebia euchroma
gb|ABO27206.1|  cytosolic 3-hydroxy-3-methylglutaryl-CoA synthase       540   0.0      Chara vulgaris
gb|ABO27205.1|  cytosolic 3-hydroxy-3-methylglutaryl-CoA synthase       539   0.0      Chara vulgaris
gb|KDO63608.1|  hypothetical protein CISIN_1g012353mg                   525   1e-180   Citrus sinensis [apfelsine]
gb|KDO60146.1|  hypothetical protein CISIN_1g012253mg                   512   1e-175   Citrus sinensis [apfelsine]
ref|XP_006421821.1|  hypothetical protein CICLE_v10005099mg             511   6e-175   
gb|EFA74817.1|  hydroxymethylglutaryl-CoA synthase                      488   1e-163   Heterostelium album PN500
ref|XP_003293379.1|  hydroxymethylglutaryl-CoA synthase                 486   2e-162   Dictyostelium purpureum
ref|XP_002304459.2|  hypothetical protein POPTR_0003s12040g             478   4e-162   
ref|XP_004362382.1|  hydroxymethylglutaryl-CoA synthase                 482   5e-161   Cavenderia fasciculata
emb|CEG68468.1|  Putative Hydroxymethylglutaryl-CoA synthase            475   1e-158   Rhizopus microsporus
emb|CEJ04633.1|  Putative Hydroxymethylglutaryl-CoA synthase            474   3e-158   Rhizopus microsporus
dbj|GAM26369.1|  hypothetical protein SAMD00019534_095440               475   4e-158   Acytostelium subglobosum LB1
ref|XP_636713.1|  hydroxymethylglutaryl-CoA synthase                    475   5e-158   Dictyostelium discoideum AX4
ref|XP_005650241.1|  hydroxymethylglutaryl-CoA synthase                 476   6e-158   Coccomyxa subellipsoidea C-169
gb|ELU04623.1|  hypothetical protein CAPTEDRAFT_155025                  471   4e-156   Capitella teleta
ref|XP_007574126.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    471   7e-156   Poecilia formosa
gb|ESA11911.1|  hypothetical protein GLOINDRAFT_347600                  468   7e-156   
ref|NP_001087380.1|  3-hydroxy-3-methylglutaryl-CoA synthase 1 (s...    471   8e-156   Xenopus laevis [clawed frog]
gb|KJE90152.1|  hydroxymethylglutaryl-CoA synthase 1, variant           469   8e-156   Capsaspora owczarzaki ATCC 30864
gb|EPB91550.1|  hydroxymethylglutaryl-CoA synthase                      468   1e-155   Mucor circinelloides f. circinelloides 1006PhL
emb|CDS11516.1|  Putative Hydroxymethylglutaryl-CoA synthase            468   2e-155   Lichtheimia ramosa
ref|XP_004364367.1|  hydroxymethylglutaryl-CoA synthase 1               470   2e-155   Capsaspora owczarzaki ATCC 30864
gb|EIE88360.1|  hydroxymethylglutaryl-CoA synthase                      467   2e-155   Rhizopus delemar RA 99-880
ref|XP_008421310.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    469   3e-155   Poecilia reticulata
ref|XP_011205537.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase 1    467   4e-155   Bactrocera dorsalis [papaya fruit fly]
ref|XP_005816295.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    469   5e-155   
dbj|GAN05349.1|  hydroxymethylglutaryl-CoA synthase 1                   466   6e-155   Mucor ambiguus
ref|XP_008421309.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    470   1e-154   Poecilia reticulata
ref|XP_011181523.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase 1    465   2e-154   Zeugodacus cucurbitae [melon fruit fly]
ref|XP_008101034.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    467   3e-154   Anolis carolinensis [Carolina anole]
ref|XP_008101032.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    468   3e-154   
ref|XP_008101033.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    467   3e-154   Anolis carolinensis [Carolina anole]
ref|XP_973437.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase 1       464   8e-154   Tribolium castaneum [rust-red flour beetle]
gb|ETE73530.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         466   1e-153   Ophiophagus hannah
ref|XP_004564719.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    465   1e-153   Maylandia zebra
ref|XP_003439547.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    464   2e-153   Oreochromis niloticus
ref|XP_002063005.1|  GK21611                                            462   4e-153   Drosophila willistoni
ref|XP_008208687.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase 1    462   4e-153   Nasonia vitripennis
ref|XP_008287032.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    464   4e-153   Stegastes partitus
ref|XP_010747211.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    464   5e-153   Larimichthys crocea [croceine croaker]
ref|XP_005751360.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    464   5e-153   Pundamilia nyererei
ref|XP_004333041.1|  hydroxymethylglutarylCoA synthase                  463   5e-153   Acanthamoeba castellanii str. Neff
ref|XP_010887875.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    463   7e-153   Esox lucius
ref|XP_005174887.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase 1    461   8e-153   Musca domestica
ref|NP_001120172.1|  hydroxymethylglutaryl-CoA synthase, cytoplasmic    463   8e-153   Xenopus tropicalis [western clawed frog]
ref|XP_011874686.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase 1    461   9e-153   Vollenhovia emeryi
ref|XP_004533489.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    461   1e-152   Ceratitis capitata [medfly]
ref|XP_003965130.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    462   1e-152   Takifugu rubripes [tiger puffer]
ref|XP_005112065.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    462   1e-152   
gb|KKA18589.1|  Hydroxymethylglutaryl-CoA synthase                      460   2e-152   Rasamsonia emersonii CBS 393.64
ref|XP_010887874.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    462   2e-152   Esox lucius
ref|XP_007430524.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    462   2e-152   Python bivittatus
ref|XP_002015981.1|  GL10732                                            460   2e-152   Drosophila persimilis
ref|XP_007430523.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    462   3e-152   
ref|XP_011152580.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase 1    459   3e-152   Harpegnathos saltator
ref|XP_005943122.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    461   3e-152   Haplochromis burtoni
ref|XP_006797374.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    461   3e-152   Neolamprologus brichardi [lyretail cichlid]
ref|XP_001360459.1|  GA18098                                            459   4e-152   Drosophila pseudoobscura pseudoobscura
ref|XP_006900395.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    461   4e-152   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|AFK11330.1|  hydroxymethylglutaryl-CoA synthase 1                    463   4e-152   Callorhinchus milii [Australian ghost shark]
gb|ACN31023.1|  unknown                                                 453   5e-152   Zea mays [maize]
ref|XP_001628162.1|  predicted protein                                  459   5e-152   Nematostella vectensis
dbj|GAD98897.1|  hydroxymethylglutaryl-CoA synthase, putative           459   5e-152   Byssochlamys spectabilis No. 5
ref|NP_001080399.1|  hydroxymethylglutaryl-CoA synthase 1               461   7e-152   Xenopus laevis [clawed frog]
ref|XP_007517684.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    461   7e-152   Erinaceus europaeus [common hedgehog]
ref|XP_008576520.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    461   8e-152   Galeopterus variegatus [Malayan flying lemur]
ref|XP_002004415.1|  GI19921                                            458   1e-151   Drosophila mojavensis
ref|XP_011336618.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase 1    458   1e-151   Ooceraea biroi
ref|XP_008322664.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    460   1e-151   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_007430522.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    461   1e-151   Python bivittatus
ref|XP_001960902.1|  GF13593                                            457   2e-151   Drosophila ananassae
ref|XP_002714059.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    459   2e-151   Oryctolagus cuniculus [domestic rabbit]
ref|XP_005112064.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    458   2e-151   Aplysia californica
gb|KFQ32347.1|  hypothetical protein N331_05551                         457   3e-151   Merops nubicus
ref|XP_006026773.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    459   3e-151   
emb|CEP13010.1|  hypothetical protein                                   456   3e-151   Parasitella parasitica
ref|XP_011696926.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase 1    457   3e-151   Wasmannia auropunctata
ref|XP_009887836.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    458   4e-151   Charadrius vociferus
gb|AAH83514.1|  3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 ...    459   4e-151   synthetic construct
ref|XP_004737989.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    458   6e-151   Mustela putorius furo [black ferret]
gb|KGL96896.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         457   6e-151   Charadrius vociferus
ref|XP_005027038.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    458   8e-151   
ref|XP_006191982.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    458   8e-151   Camelus ferus
ref|XP_005657669.1|  PREDICTED: 3-hydroxy-3-methylglutaryl-CoA sy...    458   9e-151   
gb|EOA96071.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         458   1e-150   Anas platyrhynchos [duck]
ref|XP_006207760.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   1e-150   Vicugna pacos
ref|XP_006627102.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   1e-150   
ref|XP_004416448.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   1e-150   Odobenus rosmarus divergens
ref|NP_001127508.1|  hydroxymethylglutaryl-CoA synthase, cytoplasmic    457   1e-150   Pongo abelii [orang utan]
ref|XP_008941355.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   1e-150   Merops nubicus
ref|XP_002738314.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   1e-150   
ref|XP_004075091.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   1e-150   
ref|XP_003925935.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   1e-150   
gb|KFP77314.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         457   2e-150   
ref|XP_004058935.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   2e-150   
gb|KFP97949.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         457   2e-150   
sp|P54961.1|HMCS1_BLAGE  RecName: Full=Hydroxymethylglutaryl-CoA ...    455   2e-150   
ref|XP_003310783.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   2e-150   
ref|NP_001091742.1|  hydroxymethylglutaryl-CoA synthase, cytoplasmic    457   2e-150   
gb|KFQ95017.1|  hypothetical protein Y956_03469                         455   2e-150   
ref|XP_009069912.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   2e-150   
ref|XP_006752179.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   2e-150   
ref|XP_001975365.1|  GG20599                                            455   2e-150   
ref|XP_009563217.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   2e-150   
ref|XP_010964620.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    458   2e-150   
ref|XP_009928510.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   2e-150   
ref|NP_001193507.1|  hydroxymethylglutaryl-CoA synthase, cytoplasmic    457   2e-150   
ref|NP_957379.1|  hydroxymethylglutaryl-CoA synthase, cytoplasmic       456   2e-150   
ref|XP_002113924.1|  hypothetical protein TRIADDRAFT_27878              455   2e-150   
ref|XP_002745054.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   2e-150   
ref|XP_005971002.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   2e-150   
ref|XP_003382956.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   2e-150   
emb|CAC18553.1|  putative 3-hydroxy-3-methylglutaryl coenzyme A s...    454   3e-150   
ref|XP_006079384.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   3e-150   
ref|XP_003277794.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   3e-150   
gb|KFO79141.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         457   3e-150   
ref|XP_006865817.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   3e-150   
ref|XP_009012462.1|  hypothetical protein HELRODRAFT_185341             456   3e-150   
gb|KFU92248.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         457   3e-150   
dbj|BAE00977.1|  unnamed protein product                                456   3e-150   
ref|XP_007959697.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   3e-150   
gb|EFB28023.1|  hypothetical protein PANDA_010663                       455   3e-150   
ref|XP_008690796.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   3e-150   
gb|KFW64761.1|  hypothetical protein AS28_09910                         454   3e-150   
ref|XP_009322751.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   3e-150   
ref|XP_009999463.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   3e-150   
ref|XP_004583741.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   3e-150   
ref|XP_004017060.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   3e-150   
ref|XP_010157167.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   3e-150   
ref|XP_536483.3|  PREDICTED: hydroxymethylglutaryl-CoA synthase, ...    456   4e-150   
ref|NP_001247798.1|  hydroxymethylglutaryl-CoA synthase, cytoplasmic    456   4e-150   
gb|KFP01670.1|  hypothetical protein N300_02713                         454   4e-150   
gb|KFQ29020.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         456   4e-150   
ref|XP_006026772.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   4e-150   
ref|XP_003793010.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   5e-150   
ref|XP_005221599.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    457   5e-150   
ref|XP_005152027.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   5e-150   
gb|KFW11988.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         456   5e-150   
ref|XP_009272815.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   5e-150   
ref|XP_008937829.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   5e-150   
ref|XP_009318886.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   5e-150   
gb|KFO85708.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         456   5e-150   
ref|XP_010143446.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   5e-150   
ref|NP_001239144.1|  3-hydroxy-3-methylglutaryl-CoA synthase 1 (s...    456   6e-150   
ref|XP_002092221.1|  GE11785                                            454   6e-150   
gb|ELR57001.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         457   6e-150   
ref|XP_007255348.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   7e-150   
ref|XP_010182090.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   7e-150   
ref|XP_011809872.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   7e-150   
ref|XP_004678398.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   7e-150   
gb|KFQ19700.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         456   7e-150   
ref|XP_004891111.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   7e-150   
ref|XP_005155548.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   8e-150   
ref|XP_002124753.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase 1    455   8e-150   
ref|XP_003981479.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   8e-150   
ref|XP_005434240.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   8e-150   
ref|XP_007095484.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   8e-150   
ref|XP_008493062.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   9e-150   
ref|XP_009811040.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   9e-150   
gb|KFV54046.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         456   9e-150   
gb|AAH00297.2|  HMGCS1 protein                                          456   9e-150   
ref|XP_011592621.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
gb|KFW61278.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         455   1e-149   
ref|XP_006079383.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    456   1e-149   
ref|XP_010082333.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
gb|AAI02851.1|  HMGCS1 protein                                          457   1e-149   
ref|XP_007255347.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
ref|XP_012027209.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
gb|KFV15798.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         455   1e-149   
ref|XP_008501167.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
ref|XP_004608468.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
ref|XP_006268976.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
ref|XP_005514607.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
ref|XP_009460792.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   1e-149   
gb|KFP51233.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         455   1e-149   
gb|KFP07883.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         455   1e-149   
ref|XP_007052888.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
ref|XP_004327073.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
ref|XP_006095440.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
gb|KFZ62716.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         455   1e-149   
ref|XP_009322737.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
ref|XP_012057122.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase 1    452   1e-149   
ref|XP_009272813.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
ref|XP_009983802.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
ref|XP_005241290.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   1e-149   
ref|XP_011226375.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
gb|EMC76963.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         455   1e-149   
gb|AGZ95703.1|  3-hydroxy-3-methylglutaryl-CoA synthase                 455   1e-149   
ref|XP_005155547.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
ref|XP_009897684.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   1e-149   
pdb|2P8U|A  Chain A, Crystal Structure Of Human 3-Hydroxy-3-Methy...    453   2e-149   
ref|XP_010172590.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   2e-149   
gb|KFZ48431.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         455   2e-149   
gb|KFW87822.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         455   2e-149   
gb|KGL74407.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         455   2e-149   
ref|XP_009578725.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   2e-149   
gb|KFM04354.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         455   2e-149   
ref|XP_009705154.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   2e-149   
ref|XP_010361428.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   2e-149   
ref|XP_001749256.1|  hypothetical protein                               454   2e-149   
gb|KFV17622.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         455   2e-149   
ref|XP_008930318.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   2e-149   
gb|KFQ88566.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         455   2e-149   
gb|KFV66532.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         454   2e-149   
gb|KFP68305.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         454   2e-149   
ref|XP_009941973.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   2e-149   
ref|XP_010579418.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   2e-149   
ref|XP_009632156.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   2e-149   
gb|KFW07256.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         454   2e-149   
ref|XP_010295488.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   2e-149   
gb|KFP11889.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         454   2e-149   
ref|XP_005242021.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   2e-149   
ref|XP_011832297.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   2e-149   
ref|XP_007120341.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   2e-149   
ref|XP_011592622.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    455   2e-149   
ref|XP_011264535.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase 1    452   2e-149   
ref|XP_010226713.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   2e-149   
ref|XP_002059880.1|  GJ15089                                            452   2e-149   
ref|XP_010014913.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   2e-149   
gb|KFQ51484.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         454   2e-149   
ref|XP_002034119.1|  GM21690                                            452   2e-149   
gb|KFO56469.1|  hypothetical protein N302_00536                         452   2e-149   
ref|XP_007195606.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   2e-149   
ref|XP_008628659.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   3e-149   
gb|KFQ70665.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         454   3e-149   
gb|KFR17909.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         454   3e-149   
ref|XP_009097653.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   3e-149   
pdb|2WYA|A  Chain A, Crystal Structure Of Human Mitochondrial 3-H...    452   3e-149   
ref|XP_006989864.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   3e-149   
ref|XP_006167012.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   3e-149   
ref|XP_005060648.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   3e-149   
ref|XP_005282257.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   3e-149   
ref|XP_009472355.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   3e-149   
ref|XP_010584084.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   3e-149   
gb|KFO56791.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         454   3e-149   
ref|XP_003294117.1|  hypothetical protein DICPUDRAFT_159071             452   3e-149   
ref|XP_008149864.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   3e-149   
ref|XP_005060645.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   4e-149   
ref|XP_007487465.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   4e-149   
gb|KFP37392.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         454   4e-149   
ref|XP_005060646.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   4e-149   
ref|XP_005422059.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   4e-149   
ref|XP_005493772.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   4e-149   
ref|XP_010126027.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   4e-149   
ref|XP_006903105.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   4e-149   
ref|XP_001987443.1|  GH19963                                            451   4e-149   
ref|XP_008628850.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   4e-149   
ref|XP_005282256.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   4e-149   
gb|EMP42406.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         454   5e-149   
ref|XP_010393526.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   5e-149   
gb|KFM03501.1|  hypothetical protein AS27_15770                         451   5e-149   
ref|XP_010218230.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    453   5e-149   
ref|XP_007461810.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    453   5e-149   
ref|XP_004266000.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    453   5e-149   
gb|EME41554.1|  hypothetical protein DOTSEDRAFT_73850                   451   5e-149   
ref|XP_009271584.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    453   6e-149   
gb|KFV78473.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         453   6e-149   
ref|XP_004891110.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   6e-149   
gb|EPQ10631.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         454   6e-149   
ref|XP_001114146.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   6e-149   
ref|XP_009667705.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    453   6e-149   
ref|XP_005542199.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   7e-149   
ref|XP_004422841.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    453   7e-149   
ref|XP_011735164.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   7e-149   
ref|XP_005831598.1|  hydroxymethylglutaryl-CoA synthase                 451   7e-149   
ref|XP_005533351.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    453   7e-149   
ref|XP_007061267.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   7e-149   
ref|XP_010407619.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   7e-149   
ref|XP_010584082.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   7e-149   
ref|XP_011498798.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase 1    451   7e-149   
ref|XP_003892546.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   8e-149   
ref|XP_010628221.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    453   9e-149   
ref|XP_003408063.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   9e-149   
ref|XP_005533350.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    453   1e-148   
ref|XP_007975550.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   1e-148   
ref|NP_005509.1|  hydroxymethylglutaryl-CoA synthase, mitochondri...    452   1e-148   
ref|XP_001498396.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   1e-148   
ref|XP_003759958.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    454   1e-148   
ref|XP_011788436.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   1e-148   
gb|KGL80944.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         453   1e-148   
ref|XP_001364426.2|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    453   1e-148   
ref|NP_990742.1|  hydroxymethylglutaryl-CoA synthase, cytoplasmic       452   1e-148   
ref|XP_011629926.1|  PREDICTED: hydroxymethylglutaryl-CoA synthase 1    453   1e-148   
gb|KFO04539.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         452   1e-148   
ref|XP_006139569.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   1e-148   
ref|XP_011591828.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxymethy...    454   1e-148   
gb|KFQ61803.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         452   1e-148   
ref|XP_009482227.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   1e-148   
ref|XP_008614707.1|  hypothetical protein SDRG_10493                    469   1e-148   
gb|ABO27198.1|  cytosolic 3-hydroxy-3-methylglutaryl-CoA synthase       448   1e-148   
ref|XP_006861371.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   2e-148   
ref|XP_004647358.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   2e-148   
ref|XP_010298649.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   2e-148   
ref|XP_005356896.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   2e-148   
ref|XP_009960457.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   2e-148   
ref|XP_005709049.1|  hydroxymethylglutaryl-CoA synthase                 449   2e-148   
ref|XP_006989863.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    453   2e-148   
gb|EDL18336.1|  3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1,...    453   2e-148   
ref|XP_009470661.1|  PREDICTED: LOW QUALITY PROTEIN: hydroxymethy...    452   2e-148   
ref|NP_666054.2|  hydroxymethylglutaryl-CoA synthase, cytoplasmic       452   2e-148   
ref|XP_006139566.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   2e-148   
gb|AAY56656.1|  HMG coenzyme asynthase                                  450   2e-148   
gb|KFP96679.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         452   2e-148   
ref|XP_005392802.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   2e-148   
ref|NP_001271538.1|  uncharacterized protein LOC101926043               452   2e-148   
dbj|BAE22855.1|  unnamed protein product                                451   3e-148   
ref|XP_010208616.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    452   3e-148   
emb|CAA47061.1|  Hydroxymethylglutaryl CoA Synthase                     451   3e-148   
ref|XP_004026495.1|  PREDICTED: hydroxymethylglutaryl-CoA synthas...    451   3e-148   
gb|KFP88740.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         451   3e-148   
gb|KFP28728.1|  Hydroxymethylglutaryl-CoA synthase, cytoplasmic         451   3e-148   



>ref|XP_009800463.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Nicotiana 
sylvestris]
Length=462

 Score =   868 bits (2242),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/462 (88%), Positives = 435/462 (94%), Gaps = 0/462 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MASQ KNVGILA+EIYFPPTCLQQE LEAHDGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MASQPKNVGILAMEIYFPPTCLQQEVLEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAVTSLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNAC
Sbjct  61    LTAVTSLLEKYAIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKHGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAP+VF
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPLVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK+R SHM+H YDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLC+KYEKLEGK FS
Sbjct  181   ESKIRASHMSHAYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCNKYEKLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             +ADA YFVFHSPYNKLVQKSF RLLFNDFLRNAS ++E+ K+ LAPF SLTGDESY +RD
Sbjct  241   MADAAYFVFHSPYNKLVQKSFGRLLFNDFLRNASSVDESAKQILAPFESLTGDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+KPFYD KVQP+TL+PKQVGNMYTAS+YAAF SLIHNKH+TL GQRV+MFSY
Sbjct  301   LEKASQQVAKPFYDEKVQPTTLIPKQVGNMYTASLYAAFASLIHNKHNTLAGQRVIMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TATMFSL+  EGQHPFSLSNIA+V+N+AEKLKSRHEF PEKFVEI+K+MEHRYGAK
Sbjct  361   GSGLTATMFSLKFNEGQHPFSLSNIASVMNVAEKLKSRHEFTPEKFVEIMKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             DFVTSKDCSLLAPGTYYLTEVDSKYRRFYA+K  +  + NGH
Sbjct  421   DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAQKAPEHGLVNGH  462



>gb|AHM22941.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase [Nicotiana tabacum]
Length=462

 Score =   867 bits (2241),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/462 (88%), Positives = 437/462 (95%), Gaps = 0/462 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MA+Q KNVGILA+EIYFPPTCL QEALEAHDGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MAAQPKNVGILAVEIYFPPTCLPQEALEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAVTSLLEKYE+DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC
Sbjct  61    LTAVTSLLEKYEIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEG ARPTGGAAAIAMLVGPDAPIVF
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGAARPTGGAAAIAMLVGPDAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK+R SHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLC KYEKLEGK FS
Sbjct  181   ESKIRASHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCDKYEKLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             +ADA YFVFHSPYNKLVQKS ARL+FNDF+RNAS I+E+ KEKLAPFSSLTGDESY +RD
Sbjct  241   IADAAYFVFHSPYNKLVQKSTARLMFNDFIRNASSIDESTKEKLAPFSSLTGDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK S QV+KPFYD KV+P+TL+PKQVGNMYTAS+YAAF SL+HNKH+TL GQRV++FSY
Sbjct  301   LEKVSWQVAKPFYDEKVKPATLIPKQVGNMYTASLYAAFASLLHNKHNTLAGQRVMLFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSGSTATMFSL++ EGQHPFSLSNIA+ +N+AEKLKSRHE  PEKFVEI+++MEHRYGAK
Sbjct  361   GSGSTATMFSLKLNEGQHPFSLSNIASAMNVAEKLKSRHELVPEKFVEIMQLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK ++  + NGH
Sbjct  421   DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKASENGLVNGH  462



>ref|XP_009626966.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Nicotiana 
tomentosiformis]
Length=463

 Score =   867 bits (2240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/459 (88%), Positives = 436/459 (95%), Gaps = 0/459 (0%)
 Frame = +3

Query  333   QQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTA  512
             QQKNVGILA+EIYFPPTC+QQE LEAHDGASKGKYTIGLGQDCM FC+EVEDVISMSLTA
Sbjct  5     QQKNVGILAMEIYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMSLTA  64

Query  513   VTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGG  692
             VTSLLEKY VDPKQ+GRLEVGSETVIDKSKSIKTFLMQIFEKCGN+DIEGVDSTNACYGG
Sbjct  65    VTSLLEKYAVDPKQVGRLEVGSETVIDKSKSIKTFLMQIFEKCGNSDIEGVDSTNACYGG  124

Query  693   TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESK  872
             TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AML+GPDAPIVFESK
Sbjct  125   TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVAMLIGPDAPIVFESK  184

Query  873   LRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVAD  1052
             +R SHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALD+CYKS+C+KYEKLE K FS+AD
Sbjct  185   IRASHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDACYKSVCNKYEKLESKQFSIAD  244

Query  1053  ADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEK  1232
             A YFVFHSPYNKLVQKSFARLLFNDFLRNA  I+E+ KEKLAPF SL+GDESY +RDLEK
Sbjct  245   AAYFVFHSPYNKLVQKSFARLLFNDFLRNACSIDESAKEKLAPFLSLSGDESYQSRDLEK  304

Query  1233  ASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSG  1412
              SQQV+KPFYD KVQP+TL+PKQVGNMYTAS+YAAF SL+HNKH+TL GQRV++FSYGSG
Sbjct  305   TSQQVAKPFYDEKVQPTTLIPKQVGNMYTASLYAAFASLLHNKHNTLAGQRVMLFSYGSG  364

Query  1413  STATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFV  1592
             STATMFSL++ EGQHPFSLSNIA+ +N+AEKLKSRHE  PEKFVEI+++MEHRYGAKDFV
Sbjct  365   STATMFSLKLNEGQHPFSLSNIASAMNVAEKLKSRHELAPEKFVEIMQLMEHRYGAKDFV  424

Query  1593  TSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             TSKDCSLLAPGTYYLTEVDSKYRRFYAKK T+  +ANGH
Sbjct  425   TSKDCSLLAPGTYYLTEVDSKYRRFYAKKATENGLANGH  463



>ref|XP_009803000.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Nicotiana 
sylvestris]
Length=463

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/459 (87%), Positives = 436/459 (95%), Gaps = 0/459 (0%)
 Frame = +3

Query  333   QQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTA  512
             QQKNVGILA+EIYFPPTC+QQE LEAHDGASKGKYTIGLGQDCM FC+EVEDVISMSLTA
Sbjct  5     QQKNVGILAIEIYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMSLTA  64

Query  513   VTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGG  692
             VTSLLEKY VDPKQ+GRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGG
Sbjct  65    VTSLLEKYAVDPKQVGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGG  124

Query  693   TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESK  872
             TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+APIVFESK
Sbjct  125   TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPIVFESK  184

Query  873   LRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVAD  1052
             +R SHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALD+CYKSLC+KYEKLEGK FS+AD
Sbjct  185   IRASHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDACYKSLCNKYEKLEGKQFSIAD  244

Query  1053  ADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEK  1232
             A YFVFHSPYNKLVQKSFARLLFNDFLRNA  I+++ KEKLAPF SL+GDESY +RDLEK
Sbjct  245   AAYFVFHSPYNKLVQKSFARLLFNDFLRNACSIDKSAKEKLAPFLSLSGDESYQSRDLEK  304

Query  1233  ASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSG  1412
              SQQV+KPFY+ KVQP+TL+PKQVGNMYTAS+YAAF SL+HNKH+TL GQRV++FSYGSG
Sbjct  305   TSQQVAKPFYNEKVQPTTLIPKQVGNMYTASLYAAFASLLHNKHNTLAGQRVMLFSYGSG  364

Query  1413  STATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFV  1592
             STATMFSL++ EGQHPFSLSNIA+ +N+AEKLKSRHE  PEKFVEI+++MEHRYGAKDFV
Sbjct  365   STATMFSLKLNEGQHPFSLSNIASAMNVAEKLKSRHELVPEKFVEIMQLMEHRYGAKDFV  424

Query  1593  TSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             TSKDCSLLAPGTYYLTEVDSKYRRFYAKK ++  + NGH
Sbjct  425   TSKDCSLLAPGTYYLTEVDSKYRRFYAKKASENGLVNGH  463



>ref|XP_009614165.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Nicotiana 
tomentosiformis]
Length=462

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/462 (88%), Positives = 434/462 (94%), Gaps = 0/462 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MA+Q KNVGILA+EIYFPPTCL QEALEAHDGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MAAQPKNVGILAVEIYFPPTCLPQEALEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAVTSLLEKYE+DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC
Sbjct  61    LTAVTSLLEKYEIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEG ARPTGGAAAIAMLVGPDAPIVF
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGAARPTGGAAAIAMLVGPDAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK+R SHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLC KYEKLEGK FS
Sbjct  181   ESKIRASHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCDKYEKLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             +ADA YFVFHSPYNKLVQKS ARL+FNDF+RNAS I+E+ KEKLAPFSSLTGDESY +RD
Sbjct  241   IADAAYFVFHSPYNKLVQKSTARLMFNDFIRNASSIDESTKEKLAPFSSLTGDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK S QV+KPFYD KV+P+TL+PKQVGNMYTAS+YAAF SL+HNKHS+L GQRV++FSY
Sbjct  301   LEKVSWQVAKPFYDEKVKPATLIPKQVGNMYTASLYAAFASLLHNKHSSLAGQRVILFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TATMFSLR+ EGQHPFSLSNIAAV+N+ EKLKSRHEF PEKF+E + IMEHRYG K
Sbjct  361   GSGLTATMFSLRLNEGQHPFSLSNIAAVMNVDEKLKSRHEFTPEKFIETMHIMEHRYGGK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             DFVTSKDCSLLAPGTYYLTEVDSKYRRFYA+K  +  +ANGH
Sbjct  421   DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAQKCAENGLANGH  462



>ref|XP_004252572.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Solanum lycopersicum]
Length=462

 Score =   863 bits (2231),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/462 (87%), Positives = 437/462 (95%), Gaps = 0/462 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MA+Q+KNVGILA+EIYFPPTC+QQE LEAHDGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MAAQRKNVGILAMEIYFPPTCIQQETLEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAVTSL+EKY +DP Q+GRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC
Sbjct  61    LTAVTSLVEKYAIDPNQVGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPIVF
Sbjct  121   YGGTAALFNCVNWVESASWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK+R SHMAHVYDFYKPILDSEYPVVDGKLSQTCYL+ALDSCYK LC+KYEKLEGK FS
Sbjct  181   ESKIRASHMAHVYDFYKPILDSEYPVVDGKLSQTCYLVALDSCYKILCNKYEKLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             +ADA YFVFHSPYNKLVQKSFARL+FNDF RNAS I+E+ KEKLAPFSSL+ DESY +RD
Sbjct  241   IADAAYFVFHSPYNKLVQKSFARLVFNDFTRNASSIDESAKEKLAPFSSLSHDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+KPFYD KVQP+TL+PKQVGNMYTAS+YAAF SL+HNKH TL GQRVV+FSY
Sbjct  301   LEKASQQVAKPFYDEKVQPTTLIPKQVGNMYTASLYAAFASLLHNKHKTLAGQRVVLFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSGSTATMFSL++ EGQHPFSLSNIA+V+N+ EKL+SR+E  PEKFVEI+K+MEHRYGAK
Sbjct  361   GSGSTATMFSLKLNEGQHPFSLSNIASVMNVKEKLESRNELTPEKFVEIMKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  +  +ANGH
Sbjct  421   DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKAAENGLANGH  462



>ref|XP_006364129.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Solanum tuberosum]
Length=462

 Score =   862 bits (2227),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/462 (86%), Positives = 437/462 (95%), Gaps = 0/462 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MA+QQKNVGILA+EIYFPPTC+QQE +EAHDGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MAAQQKNVGILAMEIYFPPTCIQQETMEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAV+SLLEKY +DPK++GRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC
Sbjct  61    LTAVSSLLEKYAIDPKKVGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPIVF
Sbjct  121   YGGTAALFNCVNWVESASWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK+R SHMAHVYDFYKPILDSEYPVVDGKLSQTCYL+ALDSCYK LC+KYEKLEG  FS
Sbjct  181   ESKIRASHMAHVYDFYKPILDSEYPVVDGKLSQTCYLVALDSCYKILCNKYEKLEGNQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             +ADA YFVFHSPYNKLVQKSFARL+FNDF RNAS I+E+ KEKL+PFSSL+ DESY +RD
Sbjct  241   IADAAYFVFHSPYNKLVQKSFARLVFNDFTRNASSIDESAKEKLSPFSSLSHDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK SQQV+KPFYD KVQP+TL+PKQVGNMYTAS+YAAF SL+HNKH+TL GQRVV+FSY
Sbjct  301   LEKVSQQVAKPFYDEKVQPTTLIPKQVGNMYTASLYAAFASLLHNKHNTLAGQRVVLFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSGSTATMFSL++ EGQHPFSLSNIA+V+N+ EKLKSR+E  PEKFVEI+K+MEHRYGAK
Sbjct  361   GSGSTATMFSLKLNEGQHPFSLSNIASVMNVKEKLKSRNELTPEKFVEIMKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  +  +ANGH
Sbjct  421   DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKGAENGLANGH  462



>ref|XP_009597456.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Nicotiana 
tomentosiformis]
Length=462

 Score =   862 bits (2226),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/462 (88%), Positives = 433/462 (94%), Gaps = 0/462 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MASQ KNVGILA+EIYFPPTCLQQE LEAHDGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MASQPKNVGILAMEIYFPPTCLQQEVLEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAVTSLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNAC
Sbjct  61    LTAVTSLLEKYAIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKHGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGP+APIVF
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPNAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK+R SHM+H YDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLC+KYEKLEGK FS
Sbjct  181   ESKIRASHMSHAYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCNKYEKLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             +ADA YFVFHSPYNKLVQKSF RLLFNDFLRNAS ++E+ K+ LAPF SLTGDESY +RD
Sbjct  241   MADAAYFVFHSPYNKLVQKSFGRLLFNDFLRNASSVDESAKQILAPFESLTGDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+KPFYD KVQP+TL+PKQVGNMYTAS+YAAF SLIHNKH+ L GQRV+MFSY
Sbjct  301   LEKASQQVAKPFYDEKVQPTTLIPKQVGNMYTASLYAAFASLIHNKHNILAGQRVIMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TATMFSL+  EGQHPFSLSNIA+V+N+AEKLKSRHEF PEKFV I+K+MEHRYGAK
Sbjct  361   GSGLTATMFSLKFNEGQHPFSLSNIASVMNVAEKLKSRHEFTPEKFVVIMKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             DFVTSKDCSLLAPGTYYLTEVDSKYRRFYA+K  +  + NGH
Sbjct  421   DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAQKAPEHGLVNGH  462



>gb|ABV02025.1| HMG-CoA synthase [Nicotiana langsdorffii x Nicotiana sanderae]
Length=462

 Score =   860 bits (2223),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/462 (87%), Positives = 433/462 (94%), Gaps = 0/462 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MASQ KNVGILA+EIYFPPTCLQQE LEAHDGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MASQPKNVGILAMEIYFPPTCLQQEVLEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAVTSL EKY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNAC
Sbjct  61    LTAVTSLPEKYAIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKHGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK+R SHM+H YDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLC+KYEKLEGK FS
Sbjct  181   ESKIRASHMSHAYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCNKYEKLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             +ADA YFVFHSPYNKLVQKSF RLLFNDFLRNAS ++E+ K+ LAPF SL GDESY +RD
Sbjct  241   MADAAYFVFHSPYNKLVQKSFGRLLFNDFLRNASSVDESAKQILAPFESLAGDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+KPFYD KVQP+TL+PKQVGNMYTAS+YAAF SLIHNKH+TL GQRV++FSY
Sbjct  301   LEKASQQVAKPFYDEKVQPTTLIPKQVGNMYTASLYAAFASLIHNKHNTLAGQRVIVFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TATMFSL+  EGQHPFSLSNIA+V+N++EKLKSRHEF PEKFVEI+K+MEHRYGAK
Sbjct  361   GSGLTATMFSLKFNEGQHPFSLSNIASVMNVSEKLKSRHEFTPEKFVEIMKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             DFVTSKDCSLLAPGTYYLTEVDSKYRRFYA+K  +  + NGH
Sbjct  421   DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAQKAPEHGLVNGH  462



>ref|XP_004245661.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Solanum lycopersicum]
Length=462

 Score =   860 bits (2221),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/462 (87%), Positives = 434/462 (94%), Gaps = 0/462 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MASQ KNVGILA+EIYFPPTCLQQE LEAHDGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MASQPKNVGILAMEIYFPPTCLQQEVLEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAV SLLEKY VDPKQIGRLEVGSETVIDKSKSIKTFLM+IFEK GNTDIEGVDSTNAC
Sbjct  61    LTAVNSLLEKYSVDPKQIGRLEVGSETVIDKSKSIKTFLMEIFEKHGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF
Sbjct  121   YGGTAALFNCVNWVESASWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK+R SHM+HVYDFYKPILDSEYPVVDGKLSQTCYLMALD+CYKSLC+KYEKLEGK FS
Sbjct  181   ESKIRASHMSHVYDFYKPILDSEYPVVDGKLSQTCYLMALDACYKSLCNKYEKLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             ++DA YFVFHSPYNKLVQKSF+RLLFNDFLRNAS I+E+ K+ LAPF SLTGDESY +RD
Sbjct  241   MSDAAYFVFHSPYNKLVQKSFSRLLFNDFLRNASSIDESAKKILAPFESLTGDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQ++KP YD KVQP+TL+PKQVGNMYTAS+YAAF SL+HNKH+TL GQRV+MFSY
Sbjct  301   LEKASQQLAKPLYDEKVQPTTLIPKQVGNMYTASLYAAFASLLHNKHNTLAGQRVIMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TATMFSL+  EGQHPFSLSNIA+V+N+ EKL+SRHEF PEKF+EILK+MEHRYGAK
Sbjct  361   GSGLTATMFSLKFNEGQHPFSLSNIASVMNVTEKLESRHEFTPEKFIEILKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  +  + NGH
Sbjct  421   DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKAQENGLVNGH  462



>ref|XP_006358385.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Solanum tuberosum]
Length=462

 Score =   859 bits (2220),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/462 (87%), Positives = 432/462 (94%), Gaps = 0/462 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MA+Q KNVGILA+EIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MAAQPKNVGILAVEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAVTSLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFE CGNTDIEGVDSTNAC
Sbjct  61    LTAVTSLLEKYAIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFETCGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEG ARPTGGAAAIAMLVGPDAPIVF
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGAARPTGGAAAIAMLVGPDAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK+R SHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLC+KYEKL+GK FS
Sbjct  181   ESKIRASHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCNKYEKLDGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DA YFVFHSPYNKLVQKS ARL+FNDF RNAS I+E+ KEKLAPFSSLTGDESY +RD
Sbjct  241   IDDAAYFVFHSPYNKLVQKSTARLMFNDFTRNASSIDESTKEKLAPFSSLTGDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK S QV+KPFYD KV+P+TLVPKQVGNMYTAS+YAAF SL+HNKHS+L GQRVV+FSY
Sbjct  301   LEKTSWQVAKPFYDKKVKPTTLVPKQVGNMYTASLYAAFASLLHNKHSSLAGQRVVLFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TATMFSL++ EGQHPF+LSNIA V+N+ EKLKSRHEF PE F+E +KIMEHRYG K
Sbjct  361   GSGLTATMFSLKLHEGQHPFNLSNIAVVMNVEEKLKSRHEFTPENFIETMKIMEHRYGGK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK T+  +ANGH
Sbjct  421   DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKCTENGLANGH  462



>ref|XP_006358854.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Solanum tuberosum]
Length=462

 Score =   858 bits (2218),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/462 (87%), Positives = 432/462 (94%), Gaps = 0/462 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MASQ KNVGILA+EIYFPPTCLQQE LEAHDGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MASQPKNVGILAMEIYFPPTCLQQEVLEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAV SLLEKY VDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNAC
Sbjct  61    LTAVNSLLEKYSVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKHGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AMLVGPDAPIVF
Sbjct  121   YGGTAALFNCVNWVESASWDGRYGLVVCTDSAVYAEGPARPTGGAAAVAMLVGPDAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK+R SHM+HVYDFYKPILDSEYPVVDGKLSQTCYLMALD+CYKSLC+KYEKLEGK FS
Sbjct  181   ESKIRASHMSHVYDFYKPILDSEYPVVDGKLSQTCYLMALDACYKSLCNKYEKLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DA YFVFHSPYNKLVQKSF+RLLFNDFLRNAS I+E+ K+ LAPF SLTGDESY +RD
Sbjct  241   MTDAAYFVFHSPYNKLVQKSFSRLLFNDFLRNASSIDESAKKILAPFESLTGDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK SQQ++KP YD KVQP+TL+PKQVGNMYTAS+YAAF SL+HNKH+TL GQRV+MFSY
Sbjct  301   LEKTSQQLAKPLYDEKVQPTTLIPKQVGNMYTASLYAAFASLLHNKHNTLAGQRVIMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TATMFSL+  EGQHPFSLSNIA+V+N+AEKL+SRHEF PEKF+EILK+MEHRYGAK
Sbjct  361   GSGLTATMFSLKFNEGQHPFSLSNIASVMNVAEKLESRHEFTPEKFIEILKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  +    NGH
Sbjct  421   DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKAHENGQVNGH  462



>gb|AFC34137.1| 3-hydroxy-3-methylglutaryl-CoA synthase [Camellia sinensis]
Length=467

 Score =   858 bits (2217),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/461 (87%), Positives = 430/461 (93%), Gaps = 0/461 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MASQQKNVGILA+EIYFPPTC+QQEALEAHDG SKGKYTIGLGQDC+AFC+EVEDVISMS
Sbjct  1     MASQQKNVGILAVEIYFPPTCVQQEALEAHDGVSKGKYTIGLGQDCLAFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAVTSLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFE+ GNTDIEGVDSTNAC
Sbjct  61    LTAVTSLLEKYGIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEETGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAAL NCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI F
Sbjct  121   YGGTAALLNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIAF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK+RGSHM+HVYDFY+P L SEYPVVDGKLSQTCYLMA+DSCY  LC+KYEK EGK FS
Sbjct  181   ESKIRGSHMSHVYDFYRPNLASEYPVVDGKLSQTCYLMAVDSCYNRLCNKYEKFEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             V DADYFVFHSPYNKLVQKSFARLLFNDFLRNAS INEA KEKLAPFS+LTGDESY +RD
Sbjct  241   VNDADYFVFHSPYNKLVQKSFARLLFNDFLRNASSINEAAKEKLAPFSTLTGDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKA+QQV+K  YDAKVQP+TLVPKQVGNMYTAS+YAAF SLIH KHS+L GQR+VMFSY
Sbjct  301   LEKATQQVAKALYDAKVQPTTLVPKQVGNMYTASLYAAFASLIHKKHSSLVGQRIVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TATMFS R+RE QHPFSLSNIAAV+N+ +KLKSRHEFPPEKFVE +K+MEHRYGAK
Sbjct  361   GSGLTATMFSFRVRECQHPFSLSNIAAVMNVDKKLKSRHEFPPEKFVETMKVMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             DFVTSKDCSLLAPGTYYLTEVDS YRRFYAKK +  A  NG
Sbjct  421   DFVTSKDCSLLAPGTYYLTEVDSMYRRFYAKKASTTACENG  461



>ref|NP_001234846.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase [Solanum lycopersicum]
 ref|XP_010324453.1| PREDICTED: 3-hydroxy-3-methylglutaryl coenzyme A synthase isoform 
X1 [Solanum lycopersicum]
 gb|ABX55778.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase [Solanum lycopersicum]
Length=462

 Score =   857 bits (2213),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/462 (87%), Positives = 431/462 (93%), Gaps = 0/462 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MA+Q KNVGILA+EIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MAAQPKNVGILAVEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAVTSLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNAC
Sbjct  61    LTAVTSLLEKYAIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKSGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEG ARPTGGAAAIAMLVGPDAPIVF
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGAARPTGGAAAIAMLVGPDAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK+R SHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLC+KYEKLEGK FS
Sbjct  181   ESKIRASHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCNKYEKLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DA YFVFHSPYNKLVQKS ARL+FNDF RNAS I+E+ KEKLAPFSSLTGDESY +RD
Sbjct  241   IDDAAYFVFHSPYNKLVQKSTARLMFNDFTRNASSIDESTKEKLAPFSSLTGDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK S QV+KPFYD KV+P+TL+PKQVGNMYTAS+YAAF SL+HNKHS+L GQRVV+FSY
Sbjct  301   LEKTSWQVAKPFYDEKVKPATLIPKQVGNMYTASLYAAFASLLHNKHSSLAGQRVVLFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TATMFSL++ EGQHPF+LSNIA V+NI EKLKSRHEF PE F+E +KIMEHRYG K
Sbjct  361   GSGLTATMFSLKLHEGQHPFNLSNIATVMNIEEKLKSRHEFTPENFIETMKIMEHRYGGK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  +  +ANGH
Sbjct  421   DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKCAENGLANGH  462



>ref|XP_009776168.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Nicotiana 
sylvestris]
Length=462

 Score =   855 bits (2210),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 403/462 (87%), Positives = 431/462 (93%), Gaps = 0/462 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MA+Q KNVGILA+EIYFPPTCL QEALEAHDGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MAAQPKNVGILAVEIYFPPTCLPQEALEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAVTSLLEKYE+DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC
Sbjct  61    LTAVTSLLEKYEIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEG ARPTGGAAAIAMLVGPDAPIVF
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGAARPTGGAAAIAMLVGPDAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK+R SHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLC KYEKLEGK FS
Sbjct  181   ESKIRASHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCDKYEKLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DA YFVFHSPYNKLVQKS ARL+FNDF RNAS I+E+ KEKLAPFSSLTGDESY +RD
Sbjct  241   IDDAAYFVFHSPYNKLVQKSTARLMFNDFTRNASSIDESTKEKLAPFSSLTGDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK S QV+KPFYD KV+P+TL+PKQVGNMYTAS+YAAF SL+HNKHS+L GQRV++FSY
Sbjct  301   LEKVSWQVAKPFYDEKVKPATLIPKQVGNMYTASLYAAFASLLHNKHSSLAGQRVILFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TATMFSLR+ EGQ PFSLSNIAAV+N+ EKLKSRHEF PEKF+E + IMEHRYG K
Sbjct  361   GSGLTATMFSLRLNEGQQPFSLSNIAAVMNVDEKLKSRHEFTPEKFIETMHIMEHRYGGK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             DFVT+KDCSLLAPGTYYLTEVDSKYRRFYA+K  +  +ANGH
Sbjct  421   DFVTTKDCSLLAPGTYYLTEVDSKYRRFYAQKCVENGLANGH  462



>ref|XP_011072067.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Sesamum indicum]
Length=464

 Score =   850 bits (2195),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/462 (87%), Positives = 430/462 (93%), Gaps = 1/462 (0%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             +SQ KNVGILA+EIYFPPTC+QQE LEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMS+
Sbjct  3     SSQPKNVGILAMEIYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSM  62

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             TAVTSLLEKY VDPKQIGRLEVGSETV+DKSKSIKTFLM IFEK GNTDIEGVDSTNACY
Sbjct  63    TAVTSLLEKYGVDPKQIGRLEVGSETVLDKSKSIKTFLMPIFEKHGNTDIEGVDSTNACY  122

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AML+GP+API FE
Sbjct  123   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVAMLIGPNAPIAFE  182

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSV  1046
             SKLR SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYKSLC KYEKLEGK FSV
Sbjct  183   SKLRSSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYKSLCHKYEKLEGKQFSV  242

Query  1047  ADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDL  1226
             ADADYFVFHSPYNKLVQKSF+RLLFNDFL  AS I+EA KEKLAPFSSLT DESY +RDL
Sbjct  243   ADADYFVFHSPYNKLVQKSFSRLLFNDFLSGASSIDEAAKEKLAPFSSLTIDESYQSRDL  302

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYG  1406
             EKASQQV+KP YDAKVQPSTL+PKQVGNMYTAS+YAAF SL+HNK+STL GQRV++FSYG
Sbjct  303   EKASQQVAKPLYDAKVQPSTLIPKQVGNMYTASLYAAFASLLHNKNSTLAGQRVILFSYG  362

Query  1407  SGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKD  1586
             SG TATMFSLR+ EGQHPFSLSNIA ++N++EKLKSRHEFPPEKF+E +K+MEHRYG KD
Sbjct  363   SGLTATMFSLRLNEGQHPFSLSNIATIMNVSEKLKSRHEFPPEKFIETMKLMEHRYGGKD  422

Query  1587  FVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK-ETKAAVANGH  1709
             FVTSKDCSLLA GTYYLTEVDSKYRRFYAKK      +ANGH
Sbjct  423   FVTSKDCSLLAAGTYYLTEVDSKYRRFYAKKGNENGTLANGH  464



>ref|XP_011081049.1| PREDICTED: hydroxymethylglutaryl-CoA synthase isoform X1 [Sesamum 
indicum]
Length=460

 Score =   848 bits (2192),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/458 (87%), Positives = 429/458 (94%), Gaps = 1/458 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA+EIYFPPTC+QQE LE HDGASKGKYTIGLGQDCMAFC+EVEDVISMS+TAVT
Sbjct  3     KNVGILAMEIYFPPTCIQQEVLEVHDGASKGKYTIGLGQDCMAFCAEVEDVISMSMTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY VDPKQIGRLEVGSETV+DKSKSIKTFLM IFEKCGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYGVDPKQIGRLEVGSETVLDKSKSIKTFLMPIFEKCGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+APIVFESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYKS C+KYEKLEGK FSVADAD
Sbjct  183   GSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYKSFCAKYEKLEGKQFSVADAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLLFNDF R+AS I+EA KEKLAPFSSL+ +ESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLLFNDFTRSASSIDEAAKEKLAPFSSLSNEESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKVQPSTL+PKQVGNMYTAS+YAAF SL+HNK+ TL GQRV++FSYGSG T
Sbjct  303   QQVAKPLYDAKVQPSTLIPKQVGNMYTASLYAAFASLLHNKNITLAGQRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR  EGQHPFSLSNIA ++N++EKLKSRHEFPPEKFVE +++MEHRYG K FVTS
Sbjct  363   ATMFSLRFNEGQHPFSLSNIATIMNVSEKLKSRHEFPPEKFVETMQLMEHRYGGKGFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETK-AAVANGH  1709
             KDCSLLAPGTYYLTEVDSKYRRFYAKK  +   +ANGH
Sbjct  423   KDCSLLAPGTYYLTEVDSKYRRFYAKKAIENGTLANGH  460



>gb|AIK21781.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase [Panax notoginseng]
Length=469

 Score =   847 bits (2189),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/470 (85%), Positives = 431/470 (92%), Gaps = 9/470 (2%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MASQ KNVGILA+EIYFPPTC+QQE LEAHDGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MASQ-KNVGILAMEIYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMS  59

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT VTSLLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC
Sbjct  60    LTTVTSLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  119

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA IAML+G DAPI F
Sbjct  120   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAATIAMLIGTDAPITF  179

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C KYEKLEGK FS
Sbjct  180   ESKFRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKRYCKKYEKLEGKQFS  239

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DADYFVFHSPYNKLVQKSFARL+FNDFLRNAS ++E+ KEKLAPFS+LTGDESY++RD
Sbjct  240   MDDADYFVFHSPYNKLVQKSFARLMFNDFLRNASSVDESAKEKLAPFSTLTGDESYASRD  299

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKA+QQV+K  YD KVQP+TL+PKQVGNMYTAS+YAAF SLIHNKHSTL G+RV+MFSY
Sbjct  300   LEKATQQVAKSQYDVKVQPTTLIPKQVGNMYTASLYAAFASLIHNKHSTLAGKRVMMFSY  359

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG +ATMFSLR+REGQHPFSLSNIA V+N+AEKLKSR+EFPPEKFVEI+K+MEHRYGAK
Sbjct  360   GSGLSATMFSLRLREGQHPFSLSNIANVMNVAEKLKSRNEFPPEKFVEIMKLMEHRYGAK  419

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKET--------KAAVANGH  1709
             DFVTSKDCSLL+PGTYYLTEVDS YRRFYAKK             +ANGH
Sbjct  420   DFVTSKDCSLLSPGTYYLTEVDSMYRRFYAKKAVDKTTIGTENGTLANGH  469



>gb|EYU39002.1| hypothetical protein MIMGU_mgv1a006016mg [Erythranthe guttata]
Length=461

 Score =   845 bits (2182),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/459 (86%), Positives = 428/459 (93%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA+E+YFPPTC+QQE LEAHDGASKGKYTIGLGQDCMAFC EVEDVISMS+TAVT
Sbjct  3     KNVGILAMEVYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMAFCDEVEDVISMSMTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY VDPKQIGRLEVGSETV+DKSKSIKTFLM IFEKCGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYGVDPKQIGRLEVGSETVLDKSKSIKTFLMPIFEKCGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNC+NWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPI FESKLR
Sbjct  123   ALFNCINWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYKSLC KYEK+EGK FS+ DAD
Sbjct  183   ASHMSHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYKSLCDKYEKMEGKQFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSF+RLLFNDF R AS I+EA KEKL+PFSSL+ DESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFSRLLFNDFTRAASSIDEAAKEKLSPFSSLSNDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KPFYDAKVQPSTL+PKQVGNMYTASIYAAF SL+HNK++TL GQRV++FSYGSG  
Sbjct  303   QQVAKPFYDAKVQPSTLIPKQVGNMYTASIYAAFASLLHNKNTTLAGQRVILFSYGSGLA  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFS+RI EGQHPFSLSNIAA++N+++KLK RHEFPPEKF +I+K+MEHRYG KDFVT+
Sbjct  363   ATMFSVRINEGQHPFSLSNIAAIMNVSDKLKKRHEFPPEKFADIMKLMEHRYGGKDFVTT  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKK--ETKAAVANGH  1709
             KDCSLLAPGTYYLTEVDSKYRRFYA+K  E   A+ NGH
Sbjct  423   KDCSLLAPGTYYLTEVDSKYRRFYARKPVENGTAITNGH  461



>emb|CDP09824.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   844 bits (2181),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/462 (86%), Positives = 427/462 (92%), Gaps = 1/462 (0%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             A   KNVGILA+EIYFPPTC+QQE LEAHDGASKGKYTIGLGQDCM FC+EVEDVISMSL
Sbjct  3     AHNNKNVGILAMEIYFPPTCIQQEILEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMSL  62

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             TAVTSL EKY VDPKQIGRLEVGSETV+DKSKSIKTFLMQIFE CGNTDIEGVDS+NACY
Sbjct  63    TAVTSLFEKYNVDPKQIGRLEVGSETVLDKSKSIKTFLMQIFEGCGNTDIEGVDSSNACY  122

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYA GPARPTGGAAAIAML+GPDAPI FE
Sbjct  123   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAAGPARPTGGAAAIAMLIGPDAPIAFE  182

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSV  1046
             SKLRGSHMAH YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK+ C KYEKLEGK FS+
Sbjct  183   SKLRGSHMAHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKTFCHKYEKLEGKKFSI  242

Query  1047  ADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDL  1226
              DA+YFVFHSPYNKLVQKSF+RLLFND LRNAS I+EA KEKLAPFSSLTGDESY +RDL
Sbjct  243   LDAEYFVFHSPYNKLVQKSFSRLLFNDSLRNASSIDEAAKEKLAPFSSLTGDESYQSRDL  302

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYG  1406
             EKASQQV+KPFYDAKVQP+TL+PKQVGNMYTAS+YAAF SLIHNKH TL GQRV++FSYG
Sbjct  303   EKASQQVAKPFYDAKVQPTTLIPKQVGNMYTASLYAAFASLIHNKHKTLDGQRVILFSYG  362

Query  1407  SGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKD  1586
             SG T+TMFSLR+REGQHPFSLS+IA+V+N+AEKLKSRHEF PEKFVE + +MEHRYGAKD
Sbjct  363   SGLTSTMFSLRLREGQHPFSLSHIASVMNVAEKLKSRHEFSPEKFVETMHLMEHRYGAKD  422

Query  1587  FVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETK-AAVANGH  1709
             FVTSKDCSLLAPGTYYL EVDS YRR YAKK  +  ++ANGH
Sbjct  423   FVTSKDCSLLAPGTYYLLEVDSMYRRSYAKKACENGSLANGH  464



>ref|XP_007040101.1| Hydroxymethylglutaryl-CoA synthase / HMG-CoA synthase / 3-hydroxy-3-methylglutaryl 
coenzyme A synthase [Theobroma cacao]
 gb|EOY24602.1| Hydroxymethylglutaryl-CoA synthase / HMG-CoA synthase / 3-hydroxy-3-methylglutaryl 
coenzyme A synthase [Theobroma cacao]
Length=465

 Score =   843 bits (2178),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/463 (86%), Positives = 430/463 (93%), Gaps = 6/463 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC++QEALEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMSLT VT
Sbjct  3     KNVGILAMDIYFPPTCVRQEALEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPI FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C KYEKL GK FS++DA+
Sbjct  183   GSHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKYFCHKYEKLVGKQFSLSDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSF+RLLFNDFLRNAS +++  KEKL PFS+LTGDESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFSRLLFNDFLRNASSVDDIAKEKLGPFSTLTGDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQVSKP YDAKVQP+TL+PKQVGNMYTAS+YAAF+SLIHNKHS L G+RV++FSYGSG T
Sbjct  303   QQVSKPLYDAKVQPTTLIPKQVGNMYTASLYAAFVSLIHNKHSELAGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ EGQHPFSLSNIA V+N+A KLKSRHEFPPEKFV  +K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLNEGQHPFSLSNIATVMNVAGKLKSRHEFPPEKFVATMKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKE------TKAAVANGH  1709
             KDCSLL+PGTYYLTEVDS YRRFYAKK+         +++NGH
Sbjct  423   KDCSLLSPGTYYLTEVDSMYRRFYAKKDGDFTACENGSLSNGH  465



>ref|XP_002282434.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Vitis vinifera]
 emb|CBI34763.3| unnamed protein product [Vitis vinifera]
Length=464

 Score =   841 bits (2173),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/462 (86%), Positives = 429/462 (93%), Gaps = 5/462 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALE HDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT VT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEVHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFE+CGN DIEGVDS+NACYGGTA
Sbjct  63    SLLEKYGIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEECGNNDIEGVDSSNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPI FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LCSKYEKLEGK FS+ADAD
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKLLCSKYEKLEGKQFSIADAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FND +RNAS ++EA K+KL PFSSL+GDESY NRDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDVVRNASSVDEAGKQKLEPFSSLSGDESYQNRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKVQPSTL+PKQVGNMYTAS+YAAF+S++HNKHS L G+RVVMFSYGSG T
Sbjct  303   QQVAKPLYDAKVQPSTLLPKQVGNMYTASLYAAFVSVLHNKHSELSGKRVVMFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFS ++R+GQHPFSLSNIA V+++A KLK+RHEFPPEKFVEILK+MEHRYGAKDFVTS
Sbjct  363   ATMFSFQLRDGQHPFSLSNIATVMDVAGKLKARHEFPPEKFVEILKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKE-----TKAAVANGH  1709
             KDCSLL PGT+YLTEVDS YRRFY+KK         ++ANGH
Sbjct  423   KDCSLLPPGTHYLTEVDSMYRRFYSKKAGSCTCENGSLANGH  464



>gb|AEM42970.1| hydroxymethylglutaryl-CoA synthase [Siraitia grosvenorii]
Length=465

 Score =   840 bits (2171),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/463 (86%), Positives = 430/463 (93%), Gaps = 6/463 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPT +QQEALEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMSLT VT
Sbjct  3     KNVGILAVDIYFPPTYVQQEALEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYGIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKHGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FES++R
Sbjct  123   ALLNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIAFESRVR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC KYEKLEGK FS++DAD
Sbjct  183   GSHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKQLCHKYEKLEGKQFSISDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLLFNDF RNAS I+E  KEKLAPFS+L+GDESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLFNDFKRNASSIDEVAKEKLAPFSTLSGDESYQSRDLEKIS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++KP YDAKVQPSTL+PKQVGNMYTAS+YAAFISL+HNKH+TL G RV++FSYGSGST
Sbjct  303   QQLAKPLYDAKVQPSTLIPKQVGNMYTASLYAAFISLLHNKHNTLSGNRVILFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++ EGQHPFSLSNIAA+LN+ +KLKSRHE  PEKF+EI+K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLKLNEGQHPFSLSNIAAILNVDKKLKSRHELVPEKFIEIMKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAA------VANGH  1709
             KDCSLL+PGTYYLTEVDS YRRFYAK + K+A      VANGH
Sbjct  423   KDCSLLSPGTYYLTEVDSLYRRFYAKNDGKSARFENGVVANGH  465



>ref|XP_008238764.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Prunus mume]
Length=469

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/467 (85%), Positives = 426/467 (91%), Gaps = 10/467 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA +IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT VT
Sbjct  3     KNVGILAADIYFPPTCIQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLM IFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYGIDPKQIGRLEVGSETVIDKSKSIKTFLMTIFEKHGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIA+L+GPDAPI FESK+R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIALLIGPDAPIAFESKIR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYL ALDSCYK LC KYEKLEGK FS+ADA+
Sbjct  183   GSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLKALDSCYKELCKKYEKLEGKQFSLADAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FND +RNAS I+EA KEKLAPF+SL GDESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDSVRNASSIDEAAKEKLAPFASLPGDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKVQP+TLVPKQVGNMYTAS+YAAF+SL+HNKHS+L G+RV++FSYGSGST
Sbjct  303   QQVAKPLYDAKVQPTTLVPKQVGNMYTASLYAAFVSLLHNKHSSLDGKRVILFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+  GQHPFSL NIAAVLN+ EKLKSRHEFPPEKFVE++KIMEHRYG KDFVT+
Sbjct  363   ATMFSLRLNAGQHPFSLGNIAAVLNVGEKLKSRHEFPPEKFVEVMKIMEHRYGGKDFVTN  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKE----------TKAAVANGH  1709
             +D SLL PGTYYLTEVDSKYRRFYAKKE              VANGH
Sbjct  423   QDISLLLPGTYYLTEVDSKYRRFYAKKEGGSTAAVTSNENGVVANGH  469



>ref|XP_007209993.1| hypothetical protein PRUPE_ppa005266mg [Prunus persica]
 gb|EMJ11192.1| hypothetical protein PRUPE_ppa005266mg [Prunus persica]
Length=469

 Score =   838 bits (2164),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/467 (85%), Positives = 426/467 (91%), Gaps = 10/467 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA +IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT VT
Sbjct  3     KNVGILAADIYFPPTCIQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLM +FEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYGIDPKQIGRLEVGSETVIDKSKSIKTFLMTVFEKHGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIA+L+GPDAPI FESK+R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIALLIGPDAPIAFESKIR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYL ALDSCYK LC KYEKLEGK FS+ADA+
Sbjct  183   GSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLKALDSCYKELCKKYEKLEGKQFSLADAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FND +RNAS I+EA KEKLAPF+SL GDESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDSVRNASSIDEAAKEKLAPFASLPGDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKVQP+TLVPKQVGNMYTAS+YAAF+SL+HNKHS+L G+RV++FSYGSGST
Sbjct  303   QQVAKPLYDAKVQPTTLVPKQVGNMYTASLYAAFVSLLHNKHSSLDGKRVILFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+  GQHPFSL NIAAVLN+ EKLKSRHEFPPEKFVE++KIMEHRYG KDFVT+
Sbjct  363   ATMFSLRLNAGQHPFSLENIAAVLNVGEKLKSRHEFPPEKFVEVMKIMEHRYGGKDFVTN  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKE----------TKAAVANGH  1709
             +D SLL PGTYYLTEVDSKYRRFYAKKE              VANGH
Sbjct  423   QDISLLLPGTYYLTEVDSKYRRFYAKKEGGSTAAVTSNENGVVANGH  469



>gb|ADI80347.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase [Panax ginseng]
Length=468

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/469 (84%), Positives = 427/469 (91%), Gaps = 8/469 (2%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MASQ KNVGILA+EIYFPPTC+QQE LE HDGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MASQ-KNVGILAMEIYFPPTCIQQEVLEVHDGASKGKYTIGLGQDCMGFCTEVEDVISMS  59

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT VTSLLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC
Sbjct  60    LTTVTSLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  119

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA IAML+G DAPI F
Sbjct  120   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAATIAMLIGTDAPITF  179

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C KYEKLEGK FS
Sbjct  180   ESKFRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKRYCHKYEKLEGKQFS  239

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             +A ADYFVFHSPYNKLVQKSFARL FNDFLRNAS ++E+ KEKLAPFS+LTGDESY++RD
Sbjct  240   MAGADYFVFHSPYNKLVQKSFARLTFNDFLRNASSVDESAKEKLAPFSTLTGDESYASRD  299

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKA+QQV+KP YDAKV P+TL+PKQVGNMYTAS+YAA+ SLIHNKHS+L G+RV+MFSY
Sbjct  300   LEKATQQVAKPQYDAKVLPTTLIPKQVGNMYTASLYAAYASLIHNKHSSLEGKRVIMFSY  359

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TATMFS  +REGQH FSLSNIA V+N+AEKLKSRHEFPPEKFVEI+K+MEHRYGAK
Sbjct  360   GSGLTATMFSFHLREGQHSFSLSNIANVMNVAEKLKSRHEFPPEKFVEIMKLMEHRYGAK  419

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETK-------AAVANGH  1709
             DF TSKDCSLL+PGTYYLT VDS YRRFYAKK  +        ++ANGH
Sbjct  420   DFDTSKDCSLLSPGTYYLTAVDSMYRRFYAKKAVEKTTSTENGSLANGH  468



>gb|KJB20762.1| hypothetical protein B456_003G163200 [Gossypium raimondii]
Length=465

 Score =   835 bits (2158),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/463 (85%), Positives = 426/463 (92%), Gaps = 6/463 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMSLTAVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL KY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLAKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKSGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK  C KYEKLEGK FS++DA 
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKYFCHKYEKLEGKQFSLSDAA  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSF+RLLFNDFLRNAS ++E  KEKLAPFS+LTGDESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFSRLLFNDFLRNASSVDEITKEKLAPFSTLTGDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ SK  YDAKVQP+TL+PKQVGNMYTAS+YAAF SLIHNK+S L G+RV++FSYGSG T
Sbjct  303   QQASKCLYDAKVQPTTLIPKQVGNMYTASLYAAFASLIHNKNSELAGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR  EGQHPFSLSNI +V+N+A KLKSRHEFPPEKFVE +K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRFHEGQHPFSLSNIVSVMNVAGKLKSRHEFPPEKFVETMKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKE------TKAAVANGH  1709
             KDCSLL+PGTYYLTEVDS YRRFYAKK+         +VANGH
Sbjct  423   KDCSLLSPGTYYLTEVDSMYRRFYAKKDGDFAACDNGSVANGH  465



>ref|XP_006440512.1| hypothetical protein CICLE_v10020042mg [Citrus clementina]
 gb|ESR53752.1| hypothetical protein CICLE_v10020042mg [Citrus clementina]
Length=465

 Score =   835 bits (2156),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/463 (85%), Positives = 429/463 (93%), Gaps = 6/463 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQ+CMAFCSEVEDVISMSLTAVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +LLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    NLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+ MLVGPDAP+ FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK LCSKYEKLEGK FS+++AD
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YF+FHSPYNKLVQKSFARLLFNDF+RNAS ++EA KEKL PFS+L+GDESY +RDLEK S
Sbjct  243   YFMFHSPYNKLVQKSFARLLFNDFMRNASSVDEAAKEKLGPFSTLSGDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++KP YDAKVQPSTL+PKQVGNMYTAS+YAA  SLIHNKHS L G+RVV+FSYGSG T
Sbjct  303   QQLAKPLYDAKVQPSTLIPKQVGNMYTASLYAALASLIHNKHSELDGKRVVLFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++ EG HPFSLSNI +V+N+A KLKSRHEFPPEKFVE++K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLKLSEGHHPFSLSNILSVMNVAGKLKSRHEFPPEKFVEVMKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKA------AVANGH  1709
             KD SLLAPGTYYLTEVDS YRRFYAKK   A      ++ANGH
Sbjct  423   KDSSLLAPGTYYLTEVDSMYRRFYAKKPADATTCENGSLANGH  465



>ref|XP_008381926.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Malus domestica]
Length=465

 Score =   834 bits (2154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/463 (85%), Positives = 427/463 (92%), Gaps = 6/463 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT VT
Sbjct  3     KNVGILAVDIYFPPTCIQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLM IFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYXIDPKQIGRLEVGSETVIDKSKSIKTFLMTIFEKHGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAP+ FESK+R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPLAFESKIR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYL ALDSCYK LC KYEKLEGK FS+ADA+
Sbjct  183   GSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLKALDSCYKELCKKYEKLEGKQFSIADAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FND +RNAS I+EA KEKLAPF+ L GD+SY++RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDSVRNASSIDEAGKEKLAPFADLPGDDSYNSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKV P+TLVPKQVGNMYTAS+YAAF+SL+HNKHS+L G+RV++FSYGSGST
Sbjct  303   QQVAKPLYDAKVVPTTLVPKQVGNMYTASLYAAFVSLLHNKHSSLDGKRVILFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+  GQ PFSL NIAAV+N+ EKLK+RHEFPPEKFVE++KIMEHRYG KDFVT+
Sbjct  363   ATMFSLRLNAGQQPFSLENIAAVMNVGEKLKARHEFPPEKFVEVMKIMEHRYGGKDFVTN  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKA------AVANGH  1709
             +D SLL PGTYYLTEVDSKYRRFYAKK+  A       VANGH
Sbjct  423   QDISLLLPGTYYLTEVDSKYRRFYAKKDAAATTNANGVVANGH  465



>ref|XP_006477363.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Citrus sinensis]
Length=465

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/463 (84%), Positives = 428/463 (92%), Gaps = 6/463 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQ+CMAFCSEVEDVISMSLTAVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +LLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    NLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+ MLVGPDAP+ FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK LCSKYEKLEGK FS+++AD
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLLFNDF+RNAS ++EA KEKL PFS+L+GDESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLFNDFMRNASSVDEATKEKLGPFSTLSGDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++KP YDAKVQPSTL+PKQVGNMYTAS+YAA  SLIHNKHS L G+RVV+FSYGSG T
Sbjct  303   QQLAKPLYDAKVQPSTLIPKQVGNMYTASLYAALASLIHNKHSELDGKRVVLFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++ EG+HPFSLSNI +V+N+A KLKSRHEFPPE FVE++K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLKLSEGRHPFSLSNILSVMNVAGKLKSRHEFPPENFVEVMKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKET------KAAVANGH  1709
             KD SLLAPGTYYLTEVDS YRRFYAKK          ++ANGH
Sbjct  423   KDSSLLAPGTYYLTEVDSMYRRFYAKKPADVTNCENGSLANGH  465



>gb|ACV65039.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase [Salvia miltiorrhiza]
Length=460

 Score =   833 bits (2152),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/458 (85%), Positives = 423/458 (92%), Gaps = 1/458 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA+EIYFPPTC+QQE LEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS+TAVT
Sbjct  3     KNVGILAMEIYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSMTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL KY VDPKQIGRLEVGSETV+DKSKSIKTFLM IFEKCGN DIEGVDS+NACYGGTA
Sbjct  63    SLLGKYNVDPKQIGRLEVGSETVLDKSKSIKTFLMPIFEKCGNIDIEGVDSSNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPIAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              +HMAHVYDFYKP L SEYPVVDGKLSQTCYLMALD+CYK  C K+EK EGK FS+ DAD
Sbjct  183   ANHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDACYKGFCQKFEKQEGKQFSILDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSF+RLLFNDF RNAS I+EA KEKLAPFSSL+ +ESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFSRLLFNDFSRNASSIDEAAKEKLAPFSSLSNEESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KPF+D KVQPSTLVPKQVGNMYTAS+YAAF SLIHNK STL GQRV++FSYGSG +
Sbjct  303   QQVAKPFFDTKVQPSTLVPKQVGNMYTASLYAAFASLIHNKSSTLAGQRVILFSYGSGLS  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             A MFSLR  EG+HPFSLSNIA+V+N++EKLKSRHEFPPEKFVE++++MEHRYG KDF+TS
Sbjct  363   AIMFSLRFTEGEHPFSLSNIASVMNVSEKLKSRHEFPPEKFVELMQLMEHRYGGKDFITS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKE-TKAAVANGH  1709
             KDCSLLAPGTYYLTEVDSKYRRFYAKK      VANGH
Sbjct  423   KDCSLLAPGTYYLTEVDSKYRRFYAKKAIANGTVANGH  460



>gb|AIO11225.2| hydroxymethylglutaryl coenzyme A synthase isoform [Hevea brasiliensis]
Length=465

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/456 (85%), Positives = 424/456 (93%), Gaps = 0/456 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPT +QQEALEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMSLTAVT
Sbjct  3     KNVGILAVDIYFPPTFVQQEALEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL+KY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLDKYNIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIA+LVGPDAPI FESK R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAILVGPDAPIAFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+KYEKLEGK FS++DA+
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHFCAKYEKLEGKQFSISDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FNDF+RNAS I++A KEKLAPFS+L+GDESY NRDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDFVRNASSIDDAAKEKLAPFSTLSGDESYQNRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKVQP+TL+PKQVGNMYTAS+YAAF SL+HNKH+ L G+RV++FSYGSG T
Sbjct  303   QQVAKPLYDAKVQPTTLIPKQVGNMYTASLYAAFTSLLHNKHTELAGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ EGQHPFSLSNIA V+N+A KLK+RHE PPEKFV+I+K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLHEGQHPFSLSNIATVMNVAGKLKARHELPPEKFVDIMKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             KDCSLLA GTYYLTEVDS YRRFYA+K     V NG
Sbjct  423   KDCSLLASGTYYLTEVDSLYRRFYAQKAVGNTVENG  458



>gb|KDO63604.1| hypothetical protein CISIN_1g012353mg [Citrus sinensis]
Length=465

 Score =   833 bits (2151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/463 (84%), Positives = 427/463 (92%), Gaps = 6/463 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQ+CMAFCSEVEDVISMSLTAVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +LLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    NLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+ MLVGPDAP+ FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK LCSKYEKLEGK FS+++AD
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLLFNDF+RNAS ++EA KEKL PFS+L+GDESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLFNDFMRNASSVDEAAKEKLGPFSTLSGDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++KP YDAKVQPSTL+PKQVGNMYTAS+YAA  SLIHNKHS L G+RVV+FSYGSG T
Sbjct  303   QQLAKPLYDAKVQPSTLIPKQVGNMYTASLYAALASLIHNKHSELDGKRVVLFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++ EG HPFSLSNI +V+N+A KLKSRHEFPPE FVE++K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLKLSEGHHPFSLSNILSVMNVAGKLKSRHEFPPENFVEVMKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKET------KAAVANGH  1709
             KD SLLAPGTYYLTEVDS YRRFYAKK          ++ANGH
Sbjct  423   KDSSLLAPGTYYLTEVDSMYRRFYAKKPADVTNCENGSLANGH  465



>gb|AEC13715.1| hydroxymethylglutaryl-CoA synthase [Catharanthus roseus]
Length=463

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/463 (84%), Positives = 426/463 (92%), Gaps = 1/463 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MA+QQKNVGILA+EIYFPPTC++QE LEA+DGASKGKYTIGLGQDCM FC+EVEDVISMS
Sbjct  1     MAAQQKNVGILAMEIYFPPTCIKQEILEAYDGASKGKYTIGLGQDCMGFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             +TAVTSLL+KY +DPKQIGRLEVGSETV+DKSKSIKTFLMQ+FE+ GNTDIEGVDS+NAC
Sbjct  61    MTAVTSLLQKYNIDPKQIGRLEVGSETVLDKSKSIKTFLMQVFEESGNTDIEGVDSSNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAAL NCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI F
Sbjct  121   YGGTAALLNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIAF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESKLRGSHMAH YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK+ C KYEK EGK FS
Sbjct  181   ESKLRGSHMAHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKTFCRKYEKFEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DA YFVFHSPYNKLVQKSFARL F DFLRNAS I+EA KEKLAPFSSLTGDESY +RD
Sbjct  241   ITDASYFVFHSPYNKLVQKSFARLCFIDFLRNASSIDEAAKEKLAPFSSLTGDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+KP YD KVQP+TL+PKQVGNMYTAS+YAAF SLIHNKHSTL GQRV++FSY
Sbjct  301   LEKASQQVAKPLYDEKVQPTTLIPKQVGNMYTASLYAAFASLIHNKHSTLAGQRVILFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TATMFSLR+RE + PFSLSNIA+V+N+AEKLKSRHEFPPEKFVE + +ME +YG K
Sbjct  361   GSGLTATMFSLRLRECRTPFSLSNIASVVNVAEKLKSRHEFPPEKFVETMHLMEQKYGGK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETK-AAVANGH  1709
             DFVTSKDCSLLAPGTYYLTEVDS YRRFYAKK  +  ++A GH
Sbjct  421   DFVTSKDCSLLAPGTYYLTEVDSMYRRFYAKKAMENGSLAIGH  463



>ref|XP_009377905.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Pyrus x bretschneideri]
Length=465

 Score =   832 bits (2149),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/463 (85%), Positives = 426/463 (92%), Gaps = 6/463 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT VT
Sbjct  3     KNVGILAVDIYFPPTCIQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLM IFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYGIDPKQIGRLEVGSETVIDKSKSIKTFLMTIFEKHGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAP+ FESK+R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPVAFESKIR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYL ALDSCYK LC KYEKLEGK FS+ADA+
Sbjct  183   GSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLKALDSCYKELCKKYEKLEGKQFSIADAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FND +RNAS I+EA KEKLAPF+ L GD+SY++RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDSVRNASSIDEAGKEKLAPFADLPGDDSYNSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YD KV P+TLVPKQVGNMYTAS+YAAF+SL+HNKHS+L G+RV++FSYGSGST
Sbjct  303   QQVAKPLYDTKVVPTTLVPKQVGNMYTASLYAAFVSLLHNKHSSLDGKRVILFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+  GQ PFSL NIAAV+N+ EKLK+RHEFPPEKFVE++KIMEHRYG KDFVT+
Sbjct  363   ATMFSLRLNAGQQPFSLENIAAVMNVGEKLKARHEFPPEKFVEVMKIMEHRYGGKDFVTN  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKA------AVANGH  1709
             +D SLL PGTYYLTEVDSKYRRFYAKK+  A       VANGH
Sbjct  423   QDISLLLPGTYYLTEVDSKYRRFYAKKDAAAISNANGVVANGH  465



>ref|XP_002509692.1| hydroxymethylglutaryl-CoA synthase, putative [Ricinus communis]
 gb|EEF51079.1| hydroxymethylglutaryl-CoA synthase, putative [Ricinus communis]
Length=464

 Score =   832 bits (2148),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/456 (85%), Positives = 421/456 (92%), Gaps = 0/456 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILAL+IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCM FC+EVEDVISMSLTAVT
Sbjct  3     KNVGILALDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL+ Y +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDS+NACYGGTA
Sbjct  63    SLLDNYNIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKHGNTDIEGVDSSNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESK R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIAFESKYR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+KYEK EGK FS++DA+
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHFCAKYEKFEGKQFSISDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FNDF+RNAS I+EA KEKLAPFS+LTGDESY NRDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDFVRNASSIDEAAKEKLAPFSTLTGDESYQNRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKVQP+TL+PKQVGNMYTAS+YAAF SL+HNK+S L G+RV++FSYGSG T
Sbjct  303   QQVAKPLYDAKVQPTTLIPKQVGNMYTASLYAAFASLLHNKNSKLAGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ EGQHPFSLSNIA V+N+ +KLKSRHEF PEKFVE +K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLHEGQHPFSLSNIATVMNVTDKLKSRHEFSPEKFVETMKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             +DCSLLAPGTYYLTEVD+ YRRFYAKK       NG
Sbjct  423   QDCSLLAPGTYYLTEVDTMYRRFYAKKLVDNTCENG  458



>dbj|BAF98279.1| hydroxymethylglutaryl-CoA synthase [Hevea brasiliensis]
Length=464

 Score =   831 bits (2147),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/456 (85%), Positives = 423/456 (93%), Gaps = 0/456 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPT +QQEALEAHDGASKGKYTIGLGQDCM FC+EVEDVISMSLTAVT
Sbjct  3     KNVGILAMDIYFPPTYVQQEALEAHDGASKGKYTIGLGQDCMPFCTEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL+KY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLDKYNIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPEAPIAFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+KYEKLEGK FS++DA+
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHFCAKYEKLEGKQFSISDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FNDF+RNAS I++A KEKLAPFS+L+GDESY NRDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDFVRNASSIDDAAKEKLAPFSTLSGDESYQNRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKVQP+TL+PKQVGNMYTAS+YAAF SL+HNKH+ L G+RV++FSYGSG T
Sbjct  303   QQVAKPLYDAKVQPTTLIPKQVGNMYTASLYAAFASLLHNKHTELAGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ EGQHPFSLSNIA V+N+A KLK+RHEFPPEKF  I+K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLHEGQHPFSLSNIATVMNVAGKLKTRHEFPPEKFAVIMKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             KDCS+LAPGTYYLTEVD+ YRRFYA+K     V NG
Sbjct  423   KDCSILAPGTYYLTEVDTMYRRFYAQKAVGDTVENG  458



>gb|KJB20763.1| hypothetical protein B456_003G163200 [Gossypium raimondii]
Length=466

 Score =   830 bits (2145),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/464 (85%), Positives = 426/464 (92%), Gaps = 7/464 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMSLTAVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFE-KCGNTDIEGVDSTNACYGGT  695
             SLL KY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFE K GNTDIEGVDSTNACYGGT
Sbjct  63    SLLAKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEQKSGNTDIEGVDSTNACYGGT  122

Query  696   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKL  875
             AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESKL
Sbjct  123   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIAFESKL  182

Query  876   RGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADA  1055
             RGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK  C KYEKLEGK FS++DA
Sbjct  183   RGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKYFCHKYEKLEGKQFSLSDA  242

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
              YFVFHSPYNKLVQKSF+RLLFNDFLRNAS ++E  KEKLAPFS+LTGDESY +RDLEKA
Sbjct  243   AYFVFHSPYNKLVQKSFSRLLFNDFLRNASSVDEITKEKLAPFSTLTGDESYQSRDLEKA  302

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGS  1415
             SQQ SK  YDAKVQP+TL+PKQVGNMYTAS+YAAF SLIHNK+S L G+RV++FSYGSG 
Sbjct  303   SQQASKCLYDAKVQPTTLIPKQVGNMYTASLYAAFASLIHNKNSELAGKRVILFSYGSGL  362

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             TATMFSLR  EGQHPFSLSNI +V+N+A KLKSRHEFPPEKFVE +K+MEHRYGAKDFVT
Sbjct  363   TATMFSLRFHEGQHPFSLSNIVSVMNVAGKLKSRHEFPPEKFVETMKLMEHRYGAKDFVT  422

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKKE------TKAAVANGH  1709
             SKDCSLL+PGTYYLTEVDS YRRFYAKK+         +VANGH
Sbjct  423   SKDCSLLSPGTYYLTEVDSMYRRFYAKKDGDFAACDNGSVANGH  466



>gb|AAS46245.1| HMG-CoA synthase 2 [Hevea brasiliensis]
Length=464

 Score =   830 bits (2144),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/456 (84%), Positives = 422/456 (93%), Gaps = 0/456 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPT +QQEALEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMSLTAVT
Sbjct  3     KNVGILAMDIYFPPTYVQQEALEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DP QIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDS NACYGGTA
Sbjct  63    SLLEKYNIDPNQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSANACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK R
Sbjct  123   ALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPEAPIAFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+KYEKLEGK FS++DA+
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHFCAKYEKLEGKQFSISDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FNDF+RNAS I++A KEKLAPFS+L+GDESY NRDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDFVRNASSIDDAAKEKLAPFSTLSGDESYQNRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKVQP+TL+PKQVGNMYTAS+YAAF SL+HNKH+ L G+RV++FSYGSG T
Sbjct  303   QQVAKPLYDAKVQPTTLIPKQVGNMYTASLYAAFASLLHNKHTELAGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ EGQHPFSLSNIA V+N+A KLK+RHEFPPEKF  I+K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLHEGQHPFSLSNIATVMNVAGKLKTRHEFPPEKFAVIMKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             KDCS+LAPGTYYLTEVD+ YRRFYA+K     V NG
Sbjct  423   KDCSILAPGTYYLTEVDTMYRRFYAQKAVGDTVENG  458



>gb|ACD87446.1| 3-hydroxy-3-methylglutaryl-CoA synthase [Camptotheca acuminata]
Length=471

 Score =   830 bits (2143),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/471 (83%), Positives = 423/471 (90%), Gaps = 9/471 (2%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MAS+QKNVGILA+EIYFP   +QQEA+E HDGASKGKYTIGLGQDCMAFC+EVEDVISM 
Sbjct  1     MASEQKNVGILAMEIYFPSLFVQQEAMEVHDGASKGKYTIGLGQDCMAFCTEVEDVISMG  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAVTSLL KY +DPKQIGRLEVGSETVIDKSKS KTFLMQIFE+CGNTDIEGVDSTNAC
Sbjct  61    LTAVTSLLTKYGIDPKQIGRLEVGSETVIDKSKSTKTFLMQIFEECGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AMLVGPDAPI F
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVAMLVGPDAPIAF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C KYE+LEGK FS
Sbjct  181   ESKFRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKRYCHKYERLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             +ADADYFVFHSPYNKLVQKSF RLLF+DFLRN S I+EA KEKL PFS+LT DESY +RD
Sbjct  241   IADADYFVFHSPYNKLVQKSFGRLLFSDFLRNVSSIDEATKEKLGPFSTLTVDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKA+QQ++KP YDAKVQP+TL+PKQVGNMYTAS+YAAF SLIHNKHSTL GQRVVMFSY
Sbjct  301   LEKATQQLAKPLYDAKVQPATLIPKQVGNMYTASLYAAFASLIHNKHSTLVGQRVVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TATMFS RIR+ +HPFSL NIA V+N+A+KLKSRHEFPPE FVE +K+MEHRYGAK
Sbjct  361   GSGLTATMFSFRIRDCEHPFSLKNIATVMNVADKLKSRHEFPPENFVETMKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE---------TKAAVANGH  1709
             DFVTSKDCSLL+PGTYYLTEVDS YRRFYAKK             +++NGH
Sbjct  421   DFVTSKDCSLLSPGTYYLTEVDSMYRRFYAKKAGDNITGKTCENGSLSNGH  471



>ref|XP_012087024.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Jatropha curcas]
 ref|XP_012087025.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Jatropha curcas]
 gb|KDP25525.1| hypothetical protein JCGZ_20681 [Jatropha curcas]
Length=465

 Score =   829 bits (2142),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/456 (84%), Positives = 424/456 (93%), Gaps = 0/456 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYT+GLGQDCMAFCSEVEDVISMSLTAV+
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTVGLGQDCMAFCSEVEDVISMSLTAVS  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTD+EGVDSTNACYGGTA
Sbjct  63    SLLEKYNIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIA+L+GPDAPI FESK R
Sbjct  123   ALLNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAILIGPDAPIAFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK+ C+KYEK +GK FS++DA+
Sbjct  183   GSHMSHTYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKNFCAKYEKFKGKQFSISDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FNDFLRNAS I+EA KEKLAPF++L+GDESY NRDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDFLRNASSIDEAGKEKLAPFATLSGDESYQNRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKVQP+TL+PKQVGNMYTAS+YAAF SL+HNKH+ L G RV++FSYGSG T
Sbjct  303   QQVAKPLYDAKVQPTTLIPKQVGNMYTASLYAAFASLLHNKHTELAGNRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++ EG++PFSLSNIA V+N+A KLK+RHEFPPEKFVE LK+MEHRYG KD+VTS
Sbjct  363   ATMFSLQLNEGKYPFSLSNIANVMNVAGKLKARHEFPPEKFVETLKLMEHRYGGKDYVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             KDC LLAPGTYYLTEVD+ YRRFYAKK T  AV NG
Sbjct  423   KDCGLLAPGTYYLTEVDNMYRRFYAKKATDIAVENG  458



>gb|AGQ04158.1| hydroxymethylglutaryl-CoA synthase [Lavandula angustifolia]
Length=460

 Score =   827 bits (2137),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/458 (85%), Positives = 421/458 (92%), Gaps = 1/458 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA+EIYFPPTC+QQE LEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS+TAV 
Sbjct  3     KNVGILAMEIYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSMTAVV  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY VDPKQIGRLEVGSETV+DKSKSIKTFLM +FEKCGN+DIEGVDS+NACYGGTA
Sbjct  63    SLLEKYGVDPKQIGRLEVGSETVLDKSKSIKTFLMPVFEKCGNSDIEGVDSSNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPIAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHMAH YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK  C KYEK E K FSV+DAD
Sbjct  183   ASHMAHAYDFYKPDLASEYPVVDGKLSQTCYLMALDACYKGFCQKYEKQERKQFSVSDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             Y VFHSPYNKLVQKSFARL+FNDF+RNASYI+EA KEKL+PFSSLT DESY +RDLEKAS
Sbjct  243   YVVFHSPYNKLVQKSFARLIFNDFVRNASYIDEAAKEKLSPFSSLTNDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KPFYDAKVQPSTL+PKQVGNMYTAS+YAAF SLIHNK +TL GQRV++FSYGSG T
Sbjct  303   QQVAKPFYDAKVQPSTLIPKQVGNMYTASLYAAFASLIHNKGNTLAGQRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             +TMFSLR  EG+HPFSLSNI  V+N+AEKLKSRHE  PEKFV+++++MEHRYG KDFVT+
Sbjct  363   STMFSLRFTEGEHPFSLSNIVTVMNVAEKLKSRHELAPEKFVDLMQLMEHRYGGKDFVTN  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKE-TKAAVANGH  1709
             KD SLLAPGTYYLTEVDSKYRRFYAKK      +ANGH
Sbjct  423   KDISLLAPGTYYLTEVDSKYRRFYAKKAIANGTLANGH  460



>gb|AAL18930.1|AF429389_1 hydroxymethylglutaryl coenzyme A synthase [Hevea brasiliensis]
Length=464

 Score =   826 bits (2133),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/456 (85%), Positives = 422/456 (93%), Gaps = 0/456 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPT +QQEALEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMSLTAVT
Sbjct  3     KNVGILAVDIYFPPTFVQQEALEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL+KY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLDKYNIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIA+LVGPDAPI FESK R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAILVGPDAPIAFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+KYEK EGK FS++DA+
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHFCAKYEKFEGKQFSISDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FNDF+RNAS I+E  KEKLAPFS+L+GDESY NRDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDFVRNASSIDETAKEKLAPFSNLSGDESYQNRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKV+P+TL+PKQVGNMYTAS+YAAF SL+H+KH+ L G+RV +FSYGSG T
Sbjct  303   QQVAKPLYDAKVKPTTLIPKQVGNMYTASLYAAFASLLHSKHTELAGKRVTLFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ EGQHPFSLSNIA+V+N+A KLK+RHE PPEKFV+I+K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLHEGQHPFSLSNIASVMNVAGKLKARHELPPEKFVDIMKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             KDCSLLA GTYYLTEVDS YRRFYA+K     V NG
Sbjct  423   KDCSLLASGTYYLTEVDSLYRRFYAQKAVGNTVENG  458



>gb|KJB52035.1| hypothetical protein B456_008G243100 [Gossypium raimondii]
Length=465

 Score =   825 bits (2132),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/463 (84%), Positives = 424/463 (92%), Gaps = 6/463 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPT +QQE LEAHDG SKGKYTIGLGQDC+AFC+EVEDVISMSLT VT
Sbjct  3     KNVGILAMDIYFPPTFVQQETLEAHDGVSKGKYTIGLGQDCLAFCTEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYG+VVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESK R
Sbjct  123   ALFNCVNWVESSSWDGRYGIVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIAFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK  C KYEK EGK FS++DAD
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKYFCHKYEKQEGKQFSLSDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FNDF+RNAS +++  KEKLAPFS+LTGDESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDFVRNASSVDDIAKEKLAPFSTLTGDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQVSKP YDAKVQP+TL+PKQVGNMYTAS+YAAF SL+H+K+S L G+RV++FSYGSG T
Sbjct  303   QQVSKPLYDAKVQPTTLIPKQVGNMYTASLYAAFASLLHSKNSELAGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ EGQHPFSLSNIA V+NIA KLKSRHEF PEKFVE + +MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLHEGQHPFSLSNIATVMNIAGKLKSRHEFAPEKFVETMHLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKE------TKAAVANGH  1709
             KDCSLL+PGTYYLTEVDSKYRRFYAKK+         +V NGH
Sbjct  423   KDCSLLSPGTYYLTEVDSKYRRFYAKKDGNCTGNENGSVVNGH  465



>gb|AGZ15317.1| 3-hydroxy-3-methylglutaryl CoA synthase [Platycodon grandiflorus]
Length=466

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/466 (84%), Positives = 419/466 (90%), Gaps = 4/466 (1%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MAS  KNVGILA+EIYFPPTC+QQE LEAHDG S GKYTIGLGQDCMAFCSEVEDVISMS
Sbjct  1     MASNPKNVGILAMEIYFPPTCIQQETLEAHDGVSTGKYTIGLGQDCMAFCSEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAVTSLLEKY +DP QIGRLEVGSETVIDKSKSIKTFLMQIFE+ GNTDIEGVDSTNAC
Sbjct  61    LTAVTSLLEKYGIDPTQIGRLEVGSETVIDKSKSIKTFLMQIFEESGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+G DAPI F
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGTDAPIAF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK R SHMAH YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C KYEKLEGK FS
Sbjct  181   ESKFRASHMAHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKRFCHKYEKLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             +ADADYFVFHSPYNKLVQKSFARL+FND +RNAS ++E  KEKLAPF+SLTGDESY +RD
Sbjct  241   IADADYFVFHSPYNKLVQKSFARLVFNDVVRNASSVDEVAKEKLAPFTSLTGDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+K  YD KVQP+TL+PKQVGNMYTAS+YAAF SL+HNK+S+L  QRV+MFSY
Sbjct  301   LEKASQQVAKSLYDEKVQPTTLIPKQVGNMYTASLYAAFASLLHNKNSSLADQRVIMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG +ATMFS  +REGQHPFSLSNIA V+N+ EKLKSRHE PP KFVEI+++MEHRYGAK
Sbjct  361   GSGLSATMFSFHLREGQHPFSLSNIAKVMNVGEKLKSRHELPPGKFVEIMQLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETK----AAVANGH  1709
             DFVTSKD +LL PGTYYLTE DSKYRRFYAKK  +    A VANGH
Sbjct  421   DFVTSKDATLLPPGTYYLTECDSKYRRFYAKKTGESTESAPVANGH  466



>ref|XP_009362838.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Pyrus x bretschneideri]
Length=465

 Score =   825 bits (2131),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/451 (86%), Positives = 419/451 (93%), Gaps = 0/451 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT VT
Sbjct  3     KNVGILAVDIYFPPTCIQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLM IFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYGIDPKQIGRLEVGSETVIDKSKSIKTFLMPIFEKHGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESK+R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPISFESKIR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYL ALDSCYK LC KYEKLEGK FS+ADA+
Sbjct  183   GSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLKALDSCYKELCKKYEKLEGKQFSIADAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FND +RNAS I+EA KEKLAPF+ L GD+SY++RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDSIRNASSIDEAGKEKLAPFADLPGDDSYNSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKV P+TLVPKQVGNMYTASIYAAF+SL+HNKHS+L G+RV++FSYGSGS 
Sbjct  303   QQVAKPLYDAKVVPTTLVPKQVGNMYTASIYAAFVSLLHNKHSSLDGKRVILFSYGSGSA  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+  GQ PFSL NIAAV+N+ EKLK+RHEFPPEKFVE++KIMEHRYG KDF T 
Sbjct  363   ATMFSLRLNAGQQPFSLENIAAVMNVGEKLKARHEFPPEKFVEVMKIMEHRYGGKDFATK  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKA  1691
             +D SLL PGTYYLTEVDSKYRRFYAKK+  A
Sbjct  423   QDISLLLPGTYYLTEVDSKYRRFYAKKDAAA  453



>ref|XP_011033824.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Populus euphratica]
Length=464

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/456 (85%), Positives = 417/456 (91%), Gaps = 0/456 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILAL+IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCM FC+E+EDVISMSLTAV+
Sbjct  3     KNVGILALDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCMGFCTELEDVISMSLTAVS  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY VDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYNVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESK R
Sbjct  123   ALFNCVNWVESCSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPITFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+KYEK  GK FS++DA 
Sbjct  183   GSHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKQFCAKYEKSTGKQFSISDAA  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+F D +RNAS I+EA KEKLAPFS+L+GDESY NRDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVFTDSVRNASSIDEAAKEKLAPFSTLSGDESYQNRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKVQP+TL+PKQVGNMYTAS+YAAF+SL+HNK S L G+RV++FSYGSGST
Sbjct  303   QQVAKPLYDAKVQPTTLIPKQVGNMYTASLYAAFVSLLHNKSSELAGKRVILFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++ EGQ PFSLSNIA V+N++ KLKSRHEF P KFVE + +MEHRYG KDFVTS
Sbjct  363   ATMFSLKLHEGQKPFSLSNIATVMNVSTKLKSRHEFSPVKFVETINLMEHRYGGKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             KDCSLLAPGTYYLTEVDS YRRFYAKK    A  NG
Sbjct  423   KDCSLLAPGTYYLTEVDSMYRRFYAKKPVDGACENG  458



>gb|AJK26754.1| 3-hydroxy-3-methylglutaryl Co-enzyme A synthase [Tripterygium 
wilfordii]
Length=465

 Score =   825 bits (2130),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/463 (83%), Positives = 424/463 (92%), Gaps = 6/463 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+ QE LEAHDGASKGKYTIGLGQDCM FC+EVEDVISMSLT V+
Sbjct  3     KNVGILAMDIYFPPTCIPQEVLEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMSLTVVS  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL KY VDPKQIGRLEVGSETV+DKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLNKYNVDPKQIGRLEVGSETVLDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNW+ESSSWDGRYGLVVCTDSAVYAEGPARPTGGA A+AMLVGPDAPI FESKLR
Sbjct  123   ALFNCVNWIESSSWDGRYGLVVCTDSAVYAEGPARPTGGAGAVAMLVGPDAPIAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAH YDFYKP L SEYPVVDGKLSQTCYL+ALDSCYK LC KYEKL+GK FS++DA+
Sbjct  183   GSHMAHAYDFYKPNLASEYPVVDGKLSQTCYLIALDSCYKQLCHKYEKLDGKQFSLSDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS ++E+ KEKLAPFS+L+GDESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSVDESAKEKLAPFSALSGDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K  YDAKVQP+TL+PKQVGNMYTAS+YAA  S+IHNKH++L GQRV++FSYGSGST
Sbjct  303   QQLAKSLYDAKVQPTTLIPKQVGNMYTASLYAALASVIHNKHTSLAGQRVILFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL+ +EGQHPFSLSNIA V+N+A K+KSRHE  PEKFVE++K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLQFQEGQHPFSLSNIANVMNVAGKMKSRHELIPEKFVELMKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKE------TKAAVANGH  1709
             KD SLLAPGTYYLTEVDS YRRFYAKK+         AVANGH
Sbjct  423   KDTSLLAPGTYYLTEVDSMYRRFYAKKDGDSTACENGAVANGH  465



>ref|XP_008448952.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Cucumis melo]
Length=465

 Score =   822 bits (2124),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/462 (84%), Positives = 425/462 (92%), Gaps = 6/462 (1%)
 Frame = +3

Query  342   NVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVTS  521
             NVGILA++IYFPPT +QQEALEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMSLT V S
Sbjct  4     NVGILAIDIYFPPTYVQQEALEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTVVNS  63

Query  522   LLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTAA  701
             LLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTAA
Sbjct  64    LLEKYGIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKHGNTDIEGVDSTNACYGGTAA  123

Query  702   LFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRG  881
             LFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESKLRG
Sbjct  124   LFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIAFESKLRG  183

Query  882   SHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADADY  1061
             SHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC KYEKLEGK FS+++ADY
Sbjct  184   SHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKQLCHKYEKLEGKQFSISNADY  243

Query  1062  FVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKASQ  1241
             FVFHSPYNKLVQKSFARLLFNDF RNAS I+ A KEKLAPFS+L+ DESY +RDLEK +Q
Sbjct  244   FVFHSPYNKLVQKSFARLLFNDFKRNASSIDVAAKEKLAPFSALSNDESYQSRDLEKITQ  303

Query  1242  QVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGSTA  1421
             Q++KP YDAKVQPSTL+PKQVGNMYTAS+YAAFISL+HNK+++L G RVV+FSYGSGSTA
Sbjct  304   QLAKPLYDAKVQPSTLIPKQVGNMYTASLYAAFISLLHNKNNSLVGNRVVLFSYGSGSTA  363

Query  1422  TMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTSK  1601
             TMFSL++ EGQ+PFSLSNI+A+LN+ +KLKSRHE  PEKFVEI+++MEHRYGAKDFVTSK
Sbjct  364   TMFSLKLNEGQNPFSLSNISAILNVDKKLKSRHELVPEKFVEIMQLMEHRYGAKDFVTSK  423

Query  1602  DCSLLAPGTYYLTEVDSKYRRFYAKKE------TKAAVANGH  1709
             DCSLL+ GTYYLTEVDS YRRFYAKKE          VANGH
Sbjct  424   DCSLLSTGTYYLTEVDSLYRRFYAKKEGGSEKIENGVVANGH  465



>ref|XP_003549866.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Glycine max]
Length=460

 Score =   822 bits (2123),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/458 (84%), Positives = 425/458 (93%), Gaps = 1/458 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQE LEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMSLT V+
Sbjct  3     KNVGILAIDIYFPPTCIQQELLEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTVVS  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPKQIGRLEVGSETVIDKSKSIKTF+MQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYAIDPKQIGRLEVGSETVIDKSKSIKTFIMQIFEKYGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AML+GPDAPI FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVAMLIGPDAPISFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAH YDFYKP L SEYPVVDGKLSQTCYLMALDSCY  L  KYEK EGK FS++DA+
Sbjct  183   GSHMAHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYNHLSHKYEKQEGKQFSISDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FNDFL+NAS+++EA KEKL PF++L+GDESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDFLKNASFVDEAAKEKLEPFATLSGDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKVQP+TL+PKQVGNMYTAS+YAAFISLIHNKHSTL G+RV++FSYGSG T
Sbjct  303   QQVAKPQYDAKVQPTTLIPKQVGNMYTASLYAAFISLIHNKHSTLDGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             +TMFSL +REGQHPFSLSNI  ++++A KLKSRHEFPPEKFVE +K+MEHRYG K+FVTS
Sbjct  363   STMFSLLLREGQHPFSLSNIDKMMDVAGKLKSRHEFPPEKFVETMKLMEHRYGGKEFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETK-AAVANGH  1709
             KD SLL+PGT+YLTEVDS YRRFYAKK ++   V NGH
Sbjct  423   KDTSLLSPGTFYLTEVDSMYRRFYAKKTSENGLVTNGH  460



>ref|XP_004298742.1| PREDICTED: LOW QUALITY PROTEIN: hydroxymethylglutaryl-CoA synthase 
[Fragaria vesca subsp. vesca]
Length=461

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/459 (84%), Positives = 423/459 (92%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IY PP+C+QQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT VT
Sbjct  3     KNVGILAVDIYXPPSCIQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +LLEKY VDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    NLLEKYGVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKHGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESK+R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIAFESKIR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC KYEK+EGK FS++DA+
Sbjct  183   GSHMSHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYKQLCKKYEKIEGKQFSISDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+F D LRNA  I+EA KEK APF+SL+ DESY++RDLEK +
Sbjct  243   YFVFHSPYNKLVQKSFARLVFQDSLRNACSIDEAAKEKFAPFASLSSDESYASRDLEKVA  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKVQP+TLVPKQVGNMYTAS+YAAF SL+HNKH +L G+RV++FSYGSGST
Sbjct  303   QQVAKPLYDAKVQPTTLVPKQVGNMYTASLYAAFASLLHNKHDSLDGKRVILFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++R GQHPFSL NIAAV+N+ EKL+SRHEF PEKF EI+KIMEHRYG KDFVT+
Sbjct  363   ATMFSLQLRAGQHPFSLKNIAAVMNVGEKLESRHEFAPEKFCEIMKIMEHRYGGKDFVTN  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKET--KAAVANGH  1709
             KD SLL PGT+YLTEVDSKYRRFYA+K+      VANGH
Sbjct  423   KDISLLLPGTFYLTEVDSKYRRFYAQKDCAENGVVANGH  461



>gb|AAK73854.1| hydroxymethylglutaryl coenzyme A synthase [Hevea brasiliensis]
Length=464

 Score =   822 bits (2122),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/456 (84%), Positives = 419/456 (92%), Gaps = 0/456 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPT +QQEALEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMSLTAVT
Sbjct  3     KNVGILAVDIYFPPTFVQQEALEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL+KY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLDKYNIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIA+LVGPDAPI FESK R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAILVGPDAPIAFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+KYEK EGK FS++DA+
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHFCAKYEKFEGKQFSISDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FNDF+RNA  I+E  KEKLAPFS+L+GDESY NRDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDFVRNARSIDETAKEKLAPFSNLSGDESYQNRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKV+P+TL+PKQVGNMYTAS+YAAF SL+H+KH+ L G+RV +FSYGSG T
Sbjct  303   QQVAKPLYDAKVKPTTLIPKQVGNMYTASLYAAFASLLHSKHTELAGKRVTLFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ EGQHPFSLSNIA+V+N+A KLK+RHE PPEKFV I+K+MEHRYGAKDFV S
Sbjct  363   ATMFSLRLHEGQHPFSLSNIASVMNVAGKLKARHELPPEKFVNIMKLMEHRYGAKDFVRS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             KDCSLLA GTYYLTEVDS YRRFYA+K     V NG
Sbjct  423   KDCSLLASGTYYLTEVDSLYRRFYAQKAVGNTVENG  458



>ref|XP_002304458.2| hypothetical protein POPTR_0003s12030g [Populus trichocarpa]
 gb|EEE79437.2| hypothetical protein POPTR_0003s12030g [Populus trichocarpa]
Length=464

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/456 (85%), Positives = 416/456 (91%), Gaps = 0/456 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCM FC+EVEDVISMSLT V+
Sbjct  3     KNVGILAVDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCMGFCTEVEDVISMSLTVVS  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY VDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYNVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPI FESK R
Sbjct  123   ALFNCVNWVESCSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPITFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+KYEK  GK FS++DA 
Sbjct  183   GSHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKQFCAKYEKSTGKQFSISDAA  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+F+D +RNAS I+EA KEKLAPFS+L+GDESY NRDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVFDDSVRNASSIDEAAKEKLAPFSTLSGDESYQNRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKVQP+TL+PKQVGNMYTAS+YAAFISL+HNK S L G+RV++FSYGSGST
Sbjct  303   QQVAKPLYDAKVQPTTLIPKQVGNMYTASLYAAFISLLHNKSSELAGKRVILFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++ EGQ PFSLSNIA V+N++ KLKSRHEF   KFVE + +MEHRYG KDFVTS
Sbjct  363   ATMFSLKLHEGQKPFSLSNIATVMNVSTKLKSRHEFSAVKFVETINLMEHRYGGKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             KDCSLLAPGTYYLTEVDS YRRFYAKK    A  NG
Sbjct  423   KDCSLLAPGTYYLTEVDSMYRRFYAKKPVDGACENG  458



>ref|XP_008374018.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Malus domestica]
Length=465

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/463 (84%), Positives = 423/463 (91%), Gaps = 6/463 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT VT
Sbjct  3     KNVGILAVDIYFPPTCIQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLM IFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYGIDPKQIGRLEVGSETVIDKSKSIKTFLMPIFEKHGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESK+R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPISFESKIR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYL ALDSCYK LC KYEKLEGK FS+ADA+
Sbjct  183   GSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLKALDSCYKELCKKYEKLEGKQFSIADAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FND +RNAS I+EA KEKLAPF+ L GD+SY++RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDSVRNASSIDEAGKEKLAPFADLPGDDSYNSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKV P+TLVPKQVGNMYTASIYAAF+SL+HNKHS+L G+RV++FSYGSGS 
Sbjct  303   QQVAKPLYDAKVVPTTLVPKQVGNMYTASIYAAFVSLLHNKHSSLDGKRVILFSYGSGSA  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL +  GQ PFSL NIAAV+N+ EKLK+RHEFPPEKFVE++KIMEHRYG KDFVT+
Sbjct  363   ATMFSLCLNAGQQPFSLENIAAVMNVGEKLKARHEFPPEKFVEVMKIMEHRYGGKDFVTN  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKA------AVANGH  1709
             +D SLL PGTYYLTEVDSKYRRFY KK+  A       VAN H
Sbjct  423   QDISLLLPGTYYLTEVDSKYRRFYGKKDAAATSDDNXVVANCH  465



>dbj|BAF98278.1| hydroxymethylglutaryl-CoA synthase [Hevea brasiliensis]
Length=465

 Score =   821 bits (2121),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/456 (84%), Positives = 421/456 (92%), Gaps = 0/456 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPT +QQEALEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMSLTAVT
Sbjct  3     KNVGILAVDIYFPPTFVQQEALEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL+KY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLDKYNIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIA+LVGPDAPI FESK R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAILVGPDAPIAFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+KYEK EGK FS++DA+
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHFCAKYEKFEGKQFSISDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFA L+FNDF+RNAS I+E  KEKLAPFS+L+GDESY NRDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFACLVFNDFVRNASSIDETAKEKLAPFSNLSGDESYQNRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKV+P+TL+PKQVGNMYTAS+YAAF SL+H+KH+ L G+RV +FSYGSG T
Sbjct  303   QQVAKPLYDAKVKPTTLIPKQVGNMYTASLYAAFASLLHSKHTELAGKRVTLFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ EGQHPFSLSNIA+V+N+A KLK+RHE PPEKFV+I+K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLHEGQHPFSLSNIASVMNVAGKLKARHELPPEKFVDIMKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             KDCSLLA GTYYLTEVDS YRRFYA+K     V NG
Sbjct  423   KDCSLLASGTYYLTEVDSLYRRFYAQKAVGNTVENG  458



>gb|KHG02248.1| Hydroxymethylglutaryl-CoA synthase -like protein [Gossypium arboreum]
Length=465

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/463 (83%), Positives = 420/463 (91%), Gaps = 6/463 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVG+LA+EIYFPPTC+QQEALE HDGASKGKYTIGLGQDCMAFC+EVEDVISM LTAVT
Sbjct  3     KNVGVLAMEIYFPPTCVQQEALETHDGASKGKYTIGLGQDCMAFCTEVEDVISMGLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPKQIGR EVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYTIDPKQIGRFEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESK R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK  C KYEKLEGK FS++DAD
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKYFCYKYEKLEGKQFSISDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             Y VFHSPYNKLVQKSFARLLFNDF+RNAS +++  K KL+ FS+LTGDE+Y +RDLEK S
Sbjct  243   YIVFHSPYNKLVQKSFARLLFNDFIRNASSVDDIAKGKLSLFSNLTGDETYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQVSK  YDAKVQP+TL+PKQVGNMYTAS+YAAF SLIHNKHS L G+RV++FSYGSG T
Sbjct  303   QQVSKSLYDAKVQPTTLIPKQVGNMYTASLYAAFASLIHNKHSELAGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             +TMFSLR+ EGQHPF LSN+A V+N+A KLK RHEFPPEKFV+ +K+MEHRYGAKDFVTS
Sbjct  363   STMFSLRLHEGQHPFCLSNLATVMNVAGKLKWRHEFPPEKFVQTMKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKE------TKAAVANGH  1709
             KDC LL+PGTYYLTEVDS YRRFY+KK+         ++ANGH
Sbjct  423   KDCGLLSPGTYYLTEVDSMYRRFYSKKDGDYTVCETGSLANGH  465



>ref|XP_004147967.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Cucumis sativus]
 ref|XP_011650437.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Cucumis sativus]
 gb|KGN55947.1| hypothetical protein Csa_3G038200 [Cucumis sativus]
Length=466

 Score =   820 bits (2117),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/463 (84%), Positives = 425/463 (92%), Gaps = 7/463 (2%)
 Frame = +3

Query  342   NVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVTS  521
             NVGILA++IYFPPT +QQEALEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMSLT V S
Sbjct  4     NVGILAIDIYFPPTYVQQEALEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTVVNS  63

Query  522   LLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTAA  701
             LLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTAA
Sbjct  64    LLEKYGIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKHGNTDIEGVDSTNACYGGTAA  123

Query  702   LFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRG  881
             LFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESKLRG
Sbjct  124   LFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIAFESKLRG  183

Query  882   SHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLE-GKSFSVADAD  1058
             SHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC KYEKLE GK FS+++AD
Sbjct  184   SHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKQLCHKYEKLEGGKQFSLSNAD  243

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLLFNDF RNAS I+EA KEKLAPFS+L+ DESY +RDLEK +
Sbjct  244   YFVFHSPYNKLVQKSFARLLFNDFKRNASSIDEAAKEKLAPFSTLSNDESYQSRDLEKIT  303

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++KP YDAKVQPSTL+PKQVGNMYTAS+YAAFISL+HNK+ +L G RVV+FSYGSGST
Sbjct  304   QQLAKPLYDAKVQPSTLIPKQVGNMYTASLYAAFISLLHNKNKSLVGNRVVLFSYGSGST  363

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++ EGQ+PFSLSNI+A+LN+ +KLKSRHE  PEKFVEI+++MEHRYGAKDFVTS
Sbjct  364   ATMFSLKLNEGQNPFSLSNISAILNVDKKLKSRHELVPEKFVEIMQLMEHRYGAKDFVTS  423

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKE------TKAAVANGH  1709
             KDCSLL+ GTYYLTEVDS YRRFYAKKE          VANGH
Sbjct  424   KDCSLLSSGTYYLTEVDSLYRRFYAKKEGGSEKIENGVVANGH  466



>gb|KHN14128.1| Hydroxymethylglutaryl-CoA synthase [Glycine soja]
Length=460

 Score =   818 bits (2113),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/458 (83%), Positives = 424/458 (93%), Gaps = 1/458 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQE LEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMSLT V+
Sbjct  3     KNVGILAIDIYFPPTCIQQELLEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTVVS  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPKQIGRLEVGSETVIDKSKSIKTF+MQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYAIDPKQIGRLEVGSETVIDKSKSIKTFIMQIFEKYGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AML+GPDAPI FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVAMLIGPDAPISFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAH YDFYKP L SEYPV DG+LSQTCYLMALDSCY  L  KYEK EGK FS++DA+
Sbjct  183   GSHMAHAYDFYKPNLASEYPVGDGQLSQTCYLMALDSCYNHLSHKYEKQEGKQFSISDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FNDFL+NAS+++EA KEKL PF++L+GDESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDFLKNASFVDEAAKEKLEPFATLSGDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YDAKVQP+TL+PKQVGNMYTAS+YAAFISLIHNKHSTL G+RV++FSYGSG T
Sbjct  303   QQVAKPQYDAKVQPTTLIPKQVGNMYTASLYAAFISLIHNKHSTLDGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             +TMFSL +REGQHPFSLSNI  ++++A KLKSRHEFPPEKFVE +K+MEHRYG K+FVTS
Sbjct  363   STMFSLLLREGQHPFSLSNIDKMMDVAGKLKSRHEFPPEKFVETMKLMEHRYGGKEFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETK-AAVANGH  1709
             KD SLL+PGT+YLTEVDS YRRFYAKK ++   V NGH
Sbjct  423   KDTSLLSPGTFYLTEVDSMYRRFYAKKTSENGLVTNGH  460



>ref|XP_004511613.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like isoform X1 
[Cicer arietinum]
 ref|XP_004511614.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like isoform X2 
[Cicer arietinum]
Length=466

 Score =   815 bits (2105),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/464 (83%), Positives = 422/464 (91%), Gaps = 7/464 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA +IYFPP C+QQEALEAHDGASKGKYTIGLGQDCM+FCSE+EDVISMSLT V 
Sbjct  3     KNVGILAFDIYFPPNCVQQEALEAHDGASKGKYTIGLGQDCMSFCSEIEDVISMSLTVVN  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKYE+DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYEIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKSGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESKLR
Sbjct  123   ALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPISFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAH YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C KYEK EGK FS++DAD
Sbjct  183   GSHMAHAYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYKRFCDKYEKHEGKPFSLSDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+F+DFLRN S  +   KEKL PF++L+ DESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLVFSDFLRNPSGADGVAKEKLGPFATLSDDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YD KVQP+TL+PKQVGNMYTAS+YAAF SLIHNKHSTL G+RV++FSYGSG T
Sbjct  303   QQVAKPLYDEKVQPATLIPKQVGNMYTASLYAAFASLIHNKHSTLEGRRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++RE +HPFSLSNIA V+++AEKLKSRHEFPPEKF+E LK+MEHRYGAKD+VTS
Sbjct  363   ATMFSLQMRESKHPFSLSNIARVMDVAEKLKSRHEFPPEKFIETLKLMEHRYGAKDYVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAA-------VANGH  1709
             KD SLL+PGT+YLTEVD+KYRRFYA K +++        +ANGH
Sbjct  423   KDSSLLSPGTFYLTEVDTKYRRFYATKPSESGLTAVNGVIANGH  466



>gb|AHK61014.1| 3-hydroxy-3-methylglutaryl-coenzyme A synthase [Aquilaria sinensis]
Length=465

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/463 (83%), Positives = 422/463 (91%), Gaps = 6/463 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPT ++QEALEAHDG SKGKYTIGLGQDC+ FC+E+EDV+SMSL  VT
Sbjct  3     KNVGILAVDIYFPPTFVKQEALEAHDGVSKGKYTIGLGQDCLGFCTELEDVVSMSLNVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL+KY+VDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLDKYKVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIA+L+GPDAPI FESK+R
Sbjct  123   ALCNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIALLIGPDAPITFESKIR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAH YDFYKP L SEYPVVDGKLSQTCYLMALD CYK L  KYEKLEGK FSV+D D
Sbjct  183   GSHMAHAYDFYKPNLASEYPVVDGKLSQTCYLMALDLCYKHLSEKYEKLEGKKFSVSDVD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLLFNDFLRNASYI+EA KEKLA FS+LT DESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLLFNDFLRNASYIDEAAKEKLAAFSNLTSDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KPFYDAKVQP+TL+PK VGNMYTAS+YAAF SL+HNKHS L G+RV++FSYGSG T
Sbjct  303   QQVAKPFYDAKVQPTTLIPKLVGNMYTASLYAAFASLLHNKHSELSGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             +TMFSL++ EGQHPFSLSNIA V+N++ KLKSRHEFPPEKFVE +K+MEHRYGAKDF+TS
Sbjct  363   STMFSLQLHEGQHPFSLSNIATVMNVSGKLKSRHEFPPEKFVETMKLMEHRYGAKDFLTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETK------AAVANGH  1709
             KD SLLAPGT++LTEVDS YRRFYAKK  +       AVANGH
Sbjct  423   KDTSLLAPGTHFLTEVDSMYRRFYAKKGEENTACDNGAVANGH  465



>ref|XP_010272584.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Nelumbo nucifera]
Length=475

 Score =   812 bits (2098),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/452 (85%), Positives = 413/452 (91%), Gaps = 0/452 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MA QQKNVGILA+EIYFPPTC+QQEALEAHDGASKGKYTIGLGQDCMAFC+E EDVISMS
Sbjct  1     MALQQKNVGILAMEIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCMAFCTESEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAVTSL EKY +DP QIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNAC
Sbjct  61    LTAVTSLFEKYGIDPTQIGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API F
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPIAF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALD+CYK   ++YEKLEGK FS
Sbjct  181   ESKYRGSHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDACYKHFSNRYEKLEGKPFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             ++DADYFVFHSPYNKLVQKSFARL FNDFLRNAS + E  KEKLAPFSSL+ DESY +RD
Sbjct  241   MSDADYFVFHSPYNKLVQKSFARLYFNDFLRNASSVEEVAKEKLAPFSSLSCDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+K  YDAKVQP+TL+PKQVGNMYTAS+YAAF SL+HNKHSTL G RVVMFSY
Sbjct  301   LEKASQQVAKNLYDAKVQPTTLLPKQVGNMYTASLYAAFASLVHNKHSTLDGNRVVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG T+TMFS R+  G+HPFSLSNIAAV+NI  KLKSRHEF PEKFVE LK+MEHRYG K
Sbjct  361   GSGLTSTMFSFRLHSGEHPFSLSNIAAVMNIPAKLKSRHEFSPEKFVETLKLMEHRYGGK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             DFVT+KD SLL+PGTYYL EVD  YRRFYAKK
Sbjct  421   DFVTAKDRSLLSPGTYYLIEVDKLYRRFYAKK  452



>ref|XP_011081050.1| PREDICTED: hydroxymethylglutaryl-CoA synthase isoform X2 [Sesamum 
indicum]
Length=455

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/440 (87%), Positives = 411/440 (93%), Gaps = 1/440 (0%)
 Frame = +3

Query  393   QEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVTSLLEKYEVDPKQIGRLEV  572
             +E LE HDGASKGKYTIGLGQDCMAFC+EVEDVISMS+TAVTSLLEKY VDPKQIGRLEV
Sbjct  16    EEVLEVHDGASKGKYTIGLGQDCMAFCAEVEDVISMSMTAVTSLLEKYGVDPKQIGRLEV  75

Query  573   GSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRY  752
             GSETV+DKSKSIKTFLM IFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRY
Sbjct  76    GSETVLDKSKSIKTFLMPIFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRY  135

Query  753   GLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSE  932
             GLVVCTDSAVYAEGPARPTGGAAAIAML+GP+APIVFESKLRGSHMAHVYDFYKP L SE
Sbjct  136   GLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPIVFESKLRGSHMAHVYDFYKPDLASE  195

Query  933   YPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADADYFVFHSPYNKLVQKSFAR  1112
             YPVVDGKLSQTCYLMALDSCYKS C+KYEKLEGK FSVADADYFVFHSPYNKLVQKSFAR
Sbjct  196   YPVVDGKLSQTCYLMALDSCYKSFCAKYEKLEGKQFSVADADYFVFHSPYNKLVQKSFAR  255

Query  1113  LLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLV  1292
             LLFNDF R+AS I+EA KEKLAPFSSL+ +ESY +RDLEKASQQV+KP YDAKVQPSTL+
Sbjct  256   LLFNDFTRSASSIDEAAKEKLAPFSSLSNEESYQSRDLEKASQQVAKPLYDAKVQPSTLI  315

Query  1293  PKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPFSLS  1472
             PKQVGNMYTAS+YAAF SL+HNK+ TL GQRV++FSYGSG TATMFSLR  EGQHPFSLS
Sbjct  316   PKQVGNMYTASLYAAFASLLHNKNITLAGQRVILFSYGSGLTATMFSLRFNEGQHPFSLS  375

Query  1473  NIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDS  1652
             NIA ++N++EKLKSRHEFPPEKFVE +++MEHRYG K FVTSKDCSLLAPGTYYLTEVDS
Sbjct  376   NIATIMNVSEKLKSRHEFPPEKFVETMQLMEHRYGGKGFVTSKDCSLLAPGTYYLTEVDS  435

Query  1653  KYRRFYAKKETK-AAVANGH  1709
             KYRRFYAKK  +   +ANGH
Sbjct  436   KYRRFYAKKAIENGTLANGH  455



>ref|XP_007155571.1| hypothetical protein PHAVU_003G213200g [Phaseolus vulgaris]
 gb|ESW27565.1| hypothetical protein PHAVU_003G213200g [Phaseolus vulgaris]
Length=460

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/458 (83%), Positives = 421/458 (92%), Gaps = 1/458 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQE LEAHDGASKGKYTIGLGQDCMAFC+EVEDV+SMSLT V+
Sbjct  3     KNVGILAIDIYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMAFCTEVEDVVSMSLTVVS  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYGIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLV+CTDSAVYAEGPARPTGGAA++AML+GPDAPI FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVICTDSAVYAEGPARPTGGAASVAMLIGPDAPIAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAH YDFYKP L SEYPVVDGKLSQTCYLMALDSCY  L  KYEKLEGK FS++DA+
Sbjct  183   GSHMAHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYNHLSHKYEKLEGKQFSISDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FNDFL+N S ++E  KEKL PF++L+GDESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDFLKNPSSVDEIAKEKLEPFATLSGDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP +D KVQP+TL+PKQVGNMYTAS+YAAFISLIHNKHSTL  +RV++FSYGSG T
Sbjct  303   QQVAKPQFDVKVQPTTLIPKQVGNMYTASLYAAFISLIHNKHSTLDSKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             +TMFSL++REGQ PFSLSNI  V+++A KLKSRHEFPPEKFVE + +MEHRYGAK+FVTS
Sbjct  363   STMFSLQLREGQSPFSLSNIVKVMDVAGKLKSRHEFPPEKFVETMNLMEHRYGAKEFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKA-AVANGH  1709
             KD SLL+PGT+YLTEVDS YRRFYAKK ++   V NGH
Sbjct  423   KDTSLLSPGTFYLTEVDSMYRRFYAKKSSENDLVTNGH  460



>gb|ABK93824.1| unknown [Populus trichocarpa]
Length=464

 Score =   811 bits (2096),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/462 (83%), Positives = 418/462 (90%), Gaps = 5/462 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALE HDGASKGKYTIGLGQDC+ FC+EVEDVISMSLT V+
Sbjct  3     KNVGILAIDIYFPPTCVQQEALETHDGASKGKYTIGLGQDCLGFCTEVEDVISMSLTVVS  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY VDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYNVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESK R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK+ C+KYEK  GK FS++DA 
Sbjct  183   GSHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKTFCAKYEKSTGKQFSLSDAA  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FND +R AS I+E  KEKLAPFS+L+GDESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDSVRKASSIDEGAKEKLAPFSTLSGDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP ++AKVQP+TL+PKQVGNMYTAS+YAAF SL+HNK+S L G+RV++FSYGSG T
Sbjct  303   QQVAKPLFEAKVQPTTLIPKQVGNMYTASLYAAFASLLHNKNSELSGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++ EGQ PFSLSNIA V+N+  KLKSRHEF PEKFVE + +MEHRYGAKDFVTS
Sbjct  363   ATMFSLQLHEGQQPFSLSNIATVMNVPTKLKSRHEFSPEKFVETMHLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAA-----VANGH  1709
             KDCSLLAPGTYYLTEVD  YRRFYAKK    A     + NGH
Sbjct  423   KDCSLLAPGTYYLTEVDYMYRRFYAKKPIDGASENCSLTNGH  464



>gb|AAF69804.1|AF148847_1 HMG-CoA synthase [Brassica juncea]
Length=461

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/459 (83%), Positives = 421/459 (92%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EKLEGK FS+ DAD
Sbjct  183   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKLEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K +YDAKVQP+TLVPKQVGNMYTAS+YAAF SL+HNKHS L G+RVVMFSYGSGST
Sbjct  303   QQLAKTYYDAKVQPTTLVPKQVGNMYTASLYAAFASLVHNKHSDLAGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E Q PFSLSNIA+V+++  KLK+RHE+ PEKFVE +K+MEHRYGAK+FVTS
Sbjct  363   ATMFSLRLCENQSPFSLSNIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKEFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    ++ NGH
Sbjct  423   KEGILDLLAPGTYYLKEVDSLYRRFYGKKGDDGSITNGH  461



>ref|XP_002298076.1| hypothetical protein POPTR_0001s08600g [Populus trichocarpa]
 gb|EEE82881.1| hypothetical protein POPTR_0001s08600g [Populus trichocarpa]
Length=464

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/462 (83%), Positives = 418/462 (90%), Gaps = 5/462 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALE HDGASKGKYTIGLGQDC+ FC+EVEDVISMSLT V+
Sbjct  3     KNVGILAIDIYFPPTCVQQEALETHDGASKGKYTIGLGQDCLGFCTEVEDVISMSLTVVS  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY VDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYNVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESK R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK+ C+KYEK  GK FS++DA 
Sbjct  183   GSHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKTFCAKYEKSTGKQFSLSDAA  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FND +R AS I+E  KEKLAPFS+L+GDESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDSVRKASSIDEGAKEKLAPFSTLSGDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP ++AKVQP+TL+PKQVGNMYTAS+YAAF SL+HNK+S L G+RV++FSYGSG T
Sbjct  303   QQVAKPLFEAKVQPTTLIPKQVGNMYTASLYAAFASLLHNKNSELAGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++ EGQ PFSLSNIA V+N+  KLKSRHEF PEKFVE + +MEHRYGAKDFVTS
Sbjct  363   ATMFSLQLHEGQQPFSLSNIATVMNVPTKLKSRHEFSPEKFVETMHLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAA-----VANGH  1709
             KDCSLLAPGTYYLTEVD  YRRFYAKK    A     + NGH
Sbjct  423   KDCSLLAPGTYYLTEVDYMYRRFYAKKPIDGASENCSLTNGH  464



>ref|XP_010676575.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Beta vulgaris 
subsp. vulgaris]
Length=477

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/464 (83%), Positives = 419/464 (90%), Gaps = 3/464 (1%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MAS  KNVGILA+EIYFPPTC+QQEALE HDGASKGKYTIGLGQDCMAFC++VED+ISMS
Sbjct  1     MASTLKNVGILAMEIYFPPTCVQQEALEVHDGASKGKYTIGLGQDCMAFCTDVEDIISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAV +LLEKY +D KQIGRLEVGSETV+DKSKSIKTFLMQIFE+ GNTDIEGVDSTNAC
Sbjct  61    LTAVNNLLEKYHIDRKQIGRLEVGSETVLDKSKSIKTFLMQIFEEHGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEG ARPTGGAA IAMLVGPDAPI F
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGAARPTGGAATIAMLVGPDAPISF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESKLRGSHMAH YDFYKP L SEYPVVDGKLSQTCYL+A+DSCY  LC KYEK EGK FS
Sbjct  181   ESKLRGSHMAHAYDFYKPNLASEYPVVDGKLSQTCYLVAVDSCYNLLCKKYEKFEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DA+Y VFHSPYNKLVQKSFARL++NDFLRNAS I+E DKEKL+PFS+L+ DESY +RD
Sbjct  241   INDAEYVVFHSPYNKLVQKSFARLMYNDFLRNASSISEDDKEKLSPFSNLSIDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK +QQV+KP YD KVQP+TLVPKQ+GN YTAS+Y+A  SLIHNKHS L G+RV+MFSY
Sbjct  301   LEKVAQQVAKPLYDKKVQPTTLVPKQIGNTYTASLYSALASLIHNKHSELAGKRVLMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TATMFS R+ EGQ PFSLSNIAAV+N+A+KLKSRHEF PEKFVE LK+MEHRYGAK
Sbjct  361   GSGLTATMFSFRLNEGQQPFSLSNIAAVMNVADKLKSRHEFEPEKFVETLKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK---ETKAAVANG  1706
             +FVTSKD SLLAPGTYYLTEVDS YRRFYAKK   ++K A ANG
Sbjct  421   EFVTSKDTSLLAPGTYYLTEVDSMYRRFYAKKPANDSKVATANG  464



>ref|XP_011081051.1| PREDICTED: hydroxymethylglutaryl-CoA synthase isoform X3 [Sesamum 
indicum]
Length=449

 Score =   810 bits (2092),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/439 (87%), Positives = 410/439 (93%), Gaps = 1/439 (0%)
 Frame = +3

Query  396   EALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVTSLLEKYEVDPKQIGRLEVG  575
             E LE HDGASKGKYTIGLGQDCMAFC+EVEDVISMS+TAVTSLLEKY VDPKQIGRLEVG
Sbjct  11    EVLEVHDGASKGKYTIGLGQDCMAFCAEVEDVISMSMTAVTSLLEKYGVDPKQIGRLEVG  70

Query  576   SETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYG  755
             SETV+DKSKSIKTFLM IFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYG
Sbjct  71    SETVLDKSKSIKTFLMPIFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYG  130

Query  756   LVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSEY  935
             LVVCTDSAVYAEGPARPTGGAAAIAML+GP+APIVFESKLRGSHMAHVYDFYKP L SEY
Sbjct  131   LVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPIVFESKLRGSHMAHVYDFYKPDLASEY  190

Query  936   PVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADADYFVFHSPYNKLVQKSFARL  1115
             PVVDGKLSQTCYLMALDSCYKS C+KYEKLEGK FSVADADYFVFHSPYNKLVQKSFARL
Sbjct  191   PVVDGKLSQTCYLMALDSCYKSFCAKYEKLEGKQFSVADADYFVFHSPYNKLVQKSFARL  250

Query  1116  LFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVP  1295
             LFNDF R+AS I+EA KEKLAPFSSL+ +ESY +RDLEKASQQV+KP YDAKVQPSTL+P
Sbjct  251   LFNDFTRSASSIDEAAKEKLAPFSSLSNEESYQSRDLEKASQQVAKPLYDAKVQPSTLIP  310

Query  1296  KQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPFSLSN  1475
             KQVGNMYTAS+YAAF SL+HNK+ TL GQRV++FSYGSG TATMFSLR  EGQHPFSLSN
Sbjct  311   KQVGNMYTASLYAAFASLLHNKNITLAGQRVILFSYGSGLTATMFSLRFNEGQHPFSLSN  370

Query  1476  IAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSK  1655
             IA ++N++EKLKSRHEFPPEKFVE +++MEHRYG K FVTSKDCSLLAPGTYYLTEVDSK
Sbjct  371   IATIMNVSEKLKSRHEFPPEKFVETMQLMEHRYGGKGFVTSKDCSLLAPGTYYLTEVDSK  430

Query  1656  YRRFYAKKETK-AAVANGH  1709
             YRRFYAKK  +   +ANGH
Sbjct  431   YRRFYAKKAIENGTLANGH  449



>ref|XP_010053352.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Eucalyptus grandis]
 gb|KCW77621.1| hypothetical protein EUGRSUZ_D01931 [Eucalyptus grandis]
Length=464

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/462 (83%), Positives = 417/462 (90%), Gaps = 5/462 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEA+E HDGASKGKYTIGLGQDCMAFC+EVEDVISMSLT V+
Sbjct  3     KNVGILAMDIYFPPTCVQQEAMEVHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTVVS  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +D KQIGRLEVGSETVIDKSKSIKTFLM +FE CGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYGIDAKQIGRLEVGSETVIDKSKSIKTFLMPLFEACGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIA+L+GPDAP+VFESK R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIALLIGPDAPMVFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C KYEK EGK FS++DAD
Sbjct  183   GSHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKQFCHKYEKFEGKQFSLSDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             Y VFHSPYNKLVQKSF+RL FND LRNAS ++E  KEKLAPFSSL+GDESY +RDLEKAS
Sbjct  243   YVVFHSPYNKLVQKSFSRLFFNDCLRNASSVDEVAKEKLAPFSSLSGDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YD KVQP+TL+PKQVGNMYTAS+YAAF SLI+NKHS+L G RV++FSYGSG +
Sbjct  303   QQVAKPMYDVKVQPTTLIPKQVGNMYTASLYAAFASLINNKHSSLDGNRVILFSYGSGLS  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL+   G+HPFSLSNIAA++N+ +KLKSRHE  PEKFVE LK+MEHRYGAKDFVTS
Sbjct  363   ATMFSLKFNGGKHPFSLSNIAAIMNVDKKLKSRHEIAPEKFVETLKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKET-----KAAVANGH  1709
             KDCSLLAPGTYYLTEVDS YRRFYAKK          VANGH
Sbjct  423   KDCSLLAPGTYYLTEVDSMYRRFYAKKAKDSPCENGPVANGH  464



>gb|AID51435.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase [Astragalus membranaceus]
Length=460

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/458 (83%), Positives = 423/458 (92%), Gaps = 1/458 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFP TC+QQEALEAHDGASKGKYTIGLGQDC+AFC+EVEDVISMSLT VT
Sbjct  3     KNVGILAIDIYFPSTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +LLEKYE+DPK+IGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    NLLEKYEIDPKKIGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              S+M+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CY  L  KYEKLEGK FS+ADA+
Sbjct  183   ASYMSHAYDFYKPDLASEYPVVDGKLSQTCYLMALDNCYNRLSQKYEKLEGKKFSIADAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+F+DFL N+S ++E  KEKL PF++L+GDESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLVFDDFLNNSSSVDEVAKEKLGPFATLSGDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP +DAKVQP+TLVPKQVGNMYTAS+YAAFISLIHNKHS+L G+RV++FSYGSG T
Sbjct  303   QQVAKPLFDAKVQPTTLVPKQVGNMYTASLYAAFISLIHNKHSSLAGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             +TMFSL++ EGQHPFSLSNIA VL++A KLKSRHEFPPEKF EI+K+MEHRYG K+FVTS
Sbjct  363   STMFSLQLSEGQHPFSLSNIAKVLDVAGKLKSRHEFPPEKFEEIMKVMEHRYGGKEFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAV-ANGH  1709
             KD SLL  GT+YLTEVDSKYRRFY KK ++  + ANGH
Sbjct  423   KDTSLLPHGTFYLTEVDSKYRRFYEKKTSENGLTANGH  460



>ref|XP_010108051.1| Hydroxymethylglutaryl-CoA synthase [Morus notabilis]
 gb|EXC17783.1| Hydroxymethylglutaryl-CoA synthase [Morus notabilis]
Length=467

 Score =   811 bits (2094),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/465 (82%), Positives = 421/465 (91%), Gaps = 8/465 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGI+A++IYFPP+C++QEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT VT
Sbjct  3     KNVGIVAMDIYFPPSCVKQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFE+ GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEEHGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIA+L+GPDAPI FESK R
Sbjct  123   ALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIALLIGPDAPIAFESKYR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC KYEK EGK FS++DA+
Sbjct  183   ASHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKQLCKKYEKFEGKQFSISDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL++ND +RNAS I++A KEKLAPFS+L+GDESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVYNDSVRNASSIDKASKEKLAPFSTLSGDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ +KP YDAKVQP+TL+PKQVGNMYTAS+YAA  SLIHNK S L G+RVV+FSYGSG T
Sbjct  303   QQAAKPLYDAKVQPTTLMPKQVGNMYTASLYAALASLIHNKSSELAGKRVVLFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++REG+HPFSL+NIA V+N+AEKLKSRHE  PEKF+E LK+MEHRYGAKDFVTS
Sbjct  363   ATMFSLQLREGEHPFSLANIARVMNVAEKLKSRHEVVPEKFIETLKLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETK--------AAVANGH  1709
             KD  LL PGTYYLTEVDS YRRFY+KK  +          VANGH
Sbjct  423   KDSGLLPPGTYYLTEVDSLYRRFYSKKAVEGTGGASENGTVANGH  467



>emb|CDY47424.1| BnaA02g21580D [Brassica napus]
Length=461

 Score =   810 bits (2093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/459 (83%), Positives = 421/459 (92%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EKLEGK FS+ DAD
Sbjct  183   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKLEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K +YDAKVQP+TLVPKQVGNMYTAS+YAAF SL+HNKHS L G+RVVMFSYGSGST
Sbjct  303   QQLAKTYYDAKVQPTTLVPKQVGNMYTASLYAAFASLVHNKHSDLAGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E Q PFSLSNIA+V+++  KLK+RHE+ PEKFVE +K+MEHRYGAK+FVT+
Sbjct  363   ATMFSLRLCENQTPFSLSNIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKEFVTT  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    ++ NGH
Sbjct  423   KEGILDLLAPGTYYLKEVDSLYRRFYGKKGDDGSITNGH  461



>emb|CDX86743.1| BnaA09g21330D [Brassica napus]
Length=461

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/459 (83%), Positives = 421/459 (92%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL+KY++DPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLLDKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GP+APIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPNAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK +C+K+EKLEGK FS+ DAD
Sbjct  183   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHMCNKFEKLEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+K FYD KVQP+TLVPK+VGNMYTAS+YAAF SLIHNKHS L G+RVVMFSYGSGST
Sbjct  303   QQVAKTFYDTKVQPTTLVPKEVGNMYTASLYAAFASLIHNKHSDLAGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E Q PFSLSNIA+V++I  KLK+RHE+ PEKFVE +K+MEHRYGAK+FVTS
Sbjct  363   ATMFSLRLCENQSPFSLSNIASVMDIGGKLKARHEYAPEKFVETMKLMEHRYGAKEFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    ++ANGH
Sbjct  423   KEGIIDLLAPGTYYLKEVDSLYRRFYGKKGDDGSIANGH  461



>ref|XP_006287702.1| hypothetical protein CARUB_v10000910mg [Capsella rubella]
 gb|EOA20600.1| hypothetical protein CARUB_v10000910mg [Capsella rubella]
Length=461

 Score =   810 bits (2091),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/459 (82%), Positives = 421/459 (92%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SL +KY++DPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLFDKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EK+EGK FS+ DAD
Sbjct  183   ASHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKIEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K FYDAKVQP+TL+PK++GNMYTAS+YAAF SLIHNKH+ LPG+RVVMFSYGSGST
Sbjct  303   QQLAKSFYDAKVQPTTLIPKEIGNMYTASLYAAFASLIHNKHNDLPGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ + Q PFS+SNIAAV+++  KLK+RHE+ PEKFVE +K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLCDNQSPFSVSNIAAVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKDFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             KD    LLAPGTYYL EVDS YRRFY KK    ++ANGH
Sbjct  423   KDGIIDLLAPGTYYLKEVDSLYRRFYGKKGEDGSIANGH  461



>emb|CDY13282.1| BnaC09g23740D [Brassica napus]
Length=461

 Score =   809 bits (2089),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/459 (83%), Positives = 421/459 (92%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL+KY++DPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLLDKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GP+APIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPNAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK +C+K+EKLEGK FS+ DAD
Sbjct  183   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHMCNKFEKLEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL  DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLPLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+K FYDAKVQP+TLVPK+VGNMYTAS+YAAF SLIHNKHS L G+RVVMFSYGSGST
Sbjct  303   QQVAKTFYDAKVQPTTLVPKEVGNMYTASLYAAFASLIHNKHSDLAGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E Q PFSLSNIA+V++I  KLK+RHE+ PEKFVE +K+MEHRYGAK+FVTS
Sbjct  363   ATMFSLRLCENQSPFSLSNIASVMDIGGKLKARHEYEPEKFVETMKLMEHRYGAKEFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    ++ANGH
Sbjct  423   KEGIIDLLAPGTYYLKEVDSLYRRFYGKKGDDGSIANGH  461



>emb|CDY64800.1| BnaCnng45000D [Brassica napus]
Length=461

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/459 (82%), Positives = 421/459 (92%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAVDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EKLEG+ FS+ DAD
Sbjct  183   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKLEGEEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQK+FARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKTFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K +YDAKVQP+TLVPKQVGNMYTAS+YAAF SL+HNKHS L G+RVVMFSYGSGST
Sbjct  303   QQLAKTYYDAKVQPTTLVPKQVGNMYTASLYAAFASLVHNKHSDLAGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E Q PFSLSNIA+V+++  KLK+RHE+ PEKFVE +K+MEHRYGAK+FVTS
Sbjct  363   ATMFSLRLCENQSPFSLSNIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKEFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    ++ NGH
Sbjct  423   KEGILDLLAPGTYYLKEVDSLYRRFYGKKGDDGSITNGH  461



>ref|XP_002874726.1| hydroxymethylglutaryl-CoA synthase [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50985.1| hydroxymethylglutaryl-CoA synthase [Arabidopsis lyrata subsp. 
lyrata]
Length=461

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/459 (82%), Positives = 421/459 (92%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SL EKY++DP QIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLFEKYKIDPNQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K++K+EGK FS+ DAD
Sbjct  183   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFKKIEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++KPFYDAKVQP+TL+PK+VGNMYTAS+YAAF SLIHNKH+ L G+RVVMFSYGSGST
Sbjct  303   QQIAKPFYDAKVQPTTLIPKEVGNMYTASLYAAFASLIHNKHNDLAGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ + Q PFS+SNIA+V+++  KLK+RHE+ PEKFVE +K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLNDNQPPFSVSNIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKDFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    ++ANGH
Sbjct  423   KEGIIDLLAPGTYYLKEVDSLYRRFYGKKGDDGSIANGH  461



>ref|XP_007158452.1| hypothetical protein PHAVU_002G153600g [Phaseolus vulgaris]
 gb|ESW30446.1| hypothetical protein PHAVU_002G153600g [Phaseolus vulgaris]
Length=472

 Score =   808 bits (2087),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/470 (81%), Positives = 423/470 (90%), Gaps = 13/470 (3%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPP C+QQEALE HDGASKGKYTIGLGQDCM+FC+EVEDVISMSLT V 
Sbjct  3     KNVGILAIDIYFPPACVQQEALETHDGASKGKYTIGLGQDCMSFCTEVEDVISMSLTVVN  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKYE+D KQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDS+NACYGGTA
Sbjct  63    SLLEKYEIDAKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSSNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESK R
Sbjct  123   ALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPISFESKYR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYKS C KYEK EGK FS++DA 
Sbjct  183   GSHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKSFCHKYEKFEGKQFSLSDAA  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL FNDFLRNAS ++E  KEKL PF++L+GDESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLYFNDFLRNASSVDEIAKEKLGPFATLSGDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YD KVQP+TL+PKQVGNMYTAS+YAAF SLIHNKHSTL G+RVV+FSYGSG T
Sbjct  303   QQVAKPLYDEKVQPTTLIPKQVGNMYTASLYAAFASLIHNKHSTLAGERVVLFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             +T+FSL++R+ QHPFSLSNIA V++I  KLKSRHEFPPE+FVE LK+MEHRYGAK+FVTS
Sbjct  363   STIFSLQLRDIQHPFSLSNIARVMDIDGKLKSRHEFPPEEFVETLKLMEHRYGAKEFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAA-------------VANGH  1709
             KD SLL+PGT+YLTEVDS YRRFY++K  +++             ++NGH
Sbjct  423   KDSSLLSPGTFYLTEVDSMYRRFYSEKTKESSSIPAVNGVAVNGVISNGH  472



>gb|AAG32922.1|AF188639_1 HMG-CoA synthase [Brassica juncea]
Length=461

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/459 (83%), Positives = 421/459 (92%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL+KY++DPKQIGRLEVGSETVIDKSKSIKTFLMQ+ EKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLLDKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLLEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GP+APIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPNAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK +C+K+EKLEGK FS+ DAD
Sbjct  183   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHMCNKFEKLEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+K FYDAKVQP+TLVPK+VGNMYTAS+YAAF SLIHN+HS L G+RVVMFSYGSGST
Sbjct  303   QQVAKTFYDAKVQPTTLVPKEVGNMYTASLYAAFASLIHNEHSDLAGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E Q PFSLSNIA+V++I  KLK+RHE+ PEKFVE +K+MEHRYGAK+FVTS
Sbjct  363   ATMFSLRLCENQSPFSLSNIASVMDIGGKLKARHEYAPEKFVETMKLMEHRYGAKEFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    ++ANGH
Sbjct  423   KEGILELLAPGTYYLKEVDSLYRRFYGKKGDDGSIANGH  461



>ref|XP_009128649.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Brassica 
rapa]
Length=461

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/459 (82%), Positives = 419/459 (91%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EKLEGK FS+ DAD
Sbjct  183   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKLEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K +YDAKVQP+TLVPKQVGNMYTAS+YAAF SL+HNKHS L G+RVVM SYG GST
Sbjct  303   QQLAKTYYDAKVQPTTLVPKQVGNMYTASLYAAFASLVHNKHSDLAGKRVVMLSYGRGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E Q PFSLSNIA+V+++  KLK+RHE+ PEKFVE +K+MEHRYGAK+FVTS
Sbjct  363   ATMFSLRLCENQSPFSLSNIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKEFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    ++ NGH
Sbjct  423   KEGILDLLAPGTYYLKEVDSLYRRFYGKKGDDGSITNGH  461



>ref|XP_011029156.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Populus euphratica]
Length=464

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/455 (83%), Positives = 413/455 (91%), Gaps = 0/455 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALE HDGASKGKYTIGLGQDC+ FC+EVEDVISMSLT V+
Sbjct  3     KNVGILAIDIYFPPTCVQQEALETHDGASKGKYTIGLGQDCLGFCTEVEDVISMSLTVVS  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY VDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYNVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESK R
Sbjct  123   ALFNCVNWVESCSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPITFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK+ C+KYEK  GK FS++DA 
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKTFCAKYEKSTGKQFSLSDAA  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FND +R AS I+E  KEKLAPFS+L+GDESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDSVRKASSIDEGAKEKLAPFSTLSGDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP ++AKVQP+TL+PKQVGNMYTAS+YAAF SL+HNK+S L G+RV++FSYGSG T
Sbjct  303   QQVAKPLFEAKVQPTTLIPKQVGNMYTASLYAAFASLLHNKNSELAGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++ EGQ PFSLSNIA V+N+  KLKSRHEF PEKFVE + +MEHRYGAKDFVTS
Sbjct  363   ATMFSLQLHEGQQPFSLSNIATVMNVPTKLKSRHEFSPEKFVETMHLMEHRYGAKDFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVAN  1703
             KDCSLLAPGTYYLTEVD  YRRFYAKK    A+ N
Sbjct  423   KDCSLLAPGTYYLTEVDYMYRRFYAKKPIDGAIEN  457



>ref|XP_010434116.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Camelina sativa]
Length=461

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/459 (82%), Positives = 421/459 (92%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SL +KYE+DPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGN+D+EGVDSTNACYGGTA
Sbjct  63    SLFDKYEIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNSDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EK+EGK FS+ DAD
Sbjct  183   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKIEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K FYDAKVQP+TL+PK+VGNMYTAS+YAAF SLIHNKH+ L G+RVVMFSYGSGST
Sbjct  303   QQLAKSFYDAKVQPTTLIPKEVGNMYTASLYAAFASLIHNKHNDLVGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E Q PFS+SNIA+V+++  KLK+RHE+ PEKFVE +K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLCENQSPFSVSNIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKDFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    ++ANGH
Sbjct  423   KEGIIDLLAPGTYYLKEVDSLYRRFYGKKGDDGSIANGH  461



>ref|XP_006396844.1| hypothetical protein EUTSA_v10028643mg [Eutrema salsugineum]
 gb|ESQ38297.1| hypothetical protein EUTSA_v10028643mg [Eutrema salsugineum]
Length=461

 Score =   806 bits (2083),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/459 (82%), Positives = 422/459 (92%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL+KY++DPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLLDKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GP+APIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPNAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EKLEGK FS+ DAD
Sbjct  183   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKLEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKIS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++KP YD+KVQP+TLVPK+VGNMYTAS+YAAF SLIHNKHS L G+RVVMFSYGSGST
Sbjct  303   QQLAKPLYDSKVQPTTLVPKEVGNMYTASLYAAFASLIHNKHSDLAGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E + PFSLS+IA+V+++  KLK+RHE+ PEKFVE +K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLCENESPFSLSSIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKDFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    ++ANGH
Sbjct  423   KEGIIDLLAPGTYYLKEVDSLYRRFYGKKGDDGSIANGH  461



>emb|CAA58763.1| hydroxymethylglutaryl-CoA synthase [Arabidopsis thaliana]
 prf||2204245A hydroxy methylglutaryl CoA synthase
Length=461

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/459 (82%), Positives = 419/459 (91%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SL EKY++DP QIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLFEKYKIDPNQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EK+EGK FS+ DAD
Sbjct  183   ASHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKIEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             Y VFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSLT DESY +RDLEK S
Sbjct  243   YIVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLTLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ+SKPFYDAKVQP+TL+PK+VGNMYTAS+YAAF SLIHNKH+ L G+RVVMFSYGSGST
Sbjct  303   QQISKPFYDAKVQPTTLIPKEVGNMYTASLYAAFASLIHNKHNDLAGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ + + PFS+SNIA+V+++  KLK+RHE+ PEKFVE +K+MEHRYGAKDFVT+
Sbjct  363   ATMFSLRLNDNKPPFSISNIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKDFVTT  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    +VANGH
Sbjct  423   KEGIIDLLAPGTYYLKEVDSLYRRFYGKKGEDGSVANGH  461



>ref|XP_009102712.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Brassica rapa]
Length=461

 Score =   806 bits (2082),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/459 (83%), Positives = 420/459 (92%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL+KY++DP QIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLLDKYKIDPTQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GP+APIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPNAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK +C+K+EKLEGK FS+ DAD
Sbjct  183   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHMCNKFEKLEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+K FYDAKVQP+TLVPK+VGNMYTAS+YAAF SLIHNKHS L  +RVVMFSYGSGST
Sbjct  303   QQVAKTFYDAKVQPTTLVPKEVGNMYTASLYAAFASLIHNKHSDLAEKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E Q PFSLSNIA+V++I  KLK+RHE+ PEKFVE +K+MEHRYGAK+FVTS
Sbjct  363   ATMFSLRLCENQSPFSLSNIASVMDIGGKLKARHEYAPEKFVETMKLMEHRYGAKEFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    ++ANGH
Sbjct  423   KEGIIDLLAPGTYYLKEVDSLYRRFYGKKGDDGSIANGH  461



>gb|AAG32923.1|AF188640_1 HMG-CoA synthase [Brassica juncea]
Length=461

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/459 (83%), Positives = 420/459 (92%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             +NVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     ENVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL+KY++DP QIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLLDKYKIDPMQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GP+APIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPNAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EKLEGK FS+ DAD
Sbjct  183   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKLEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFIPYSSLSLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+K FYD KVQP+TLVPK+VGNMYTAS+YAAF SLIHNKHS L G+RVVMFSYGSGST
Sbjct  303   QQVAKTFYDGKVQPTTLVPKEVGNMYTASLYAAFASLIHNKHSDLAGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E + PFSLSNIA+V++I  KLK+RHE+ PEKFVE +K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLCENKSPFSLSNIASVMDIGGKLKARHEYAPEKFVETMKLMEHRYGAKDFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    ++ANGH
Sbjct  423   KEGILELLAPGTYYLKEVDSLYRRFYGKKGDDGSIANGH  461



>ref|XP_003538436.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Glycine max]
Length=475

 Score =   806 bits (2081),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/453 (82%), Positives = 420/453 (93%), Gaps = 0/453 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPP C+QQEALE HDGASKGKYTIGLGQDCM+FC+EVEDVISMSLT VT
Sbjct  3     KNVGILAIDIYFPPACVQQEALETHDGASKGKYTIGLGQDCMSFCTEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKYE+DPK +GRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYEIDPKLVGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESKLR
Sbjct  123   ALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPISFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+HVYDFYKP L SEYPVVDGKLSQTCYLMA+DSCYK+ C KYEK EGK FS++DA+
Sbjct  183   GSHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMAVDSCYKNFCHKYEKFEGKQFSLSDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FNDFL N+S ++E  KEKL PF++L+GDESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDFLMNSSSVDEVAKEKLGPFATLSGDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YD KVQP+TL+PKQVGNMYTAS+YAAF SLIHNK+STL G+RV++FSYGSG T
Sbjct  303   QQVAKPLYDQKVQPTTLIPKQVGNMYTASLYAAFASLIHNKNSTLAGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++R+ QHPFSLSNIA V+++  KLKSRHEFPPE+FVE LK+MEHRYG K+FVTS
Sbjct  363   ATMFSLQLRDSQHPFSLSNIARVMDVDGKLKSRHEFPPEEFVENLKLMEHRYGGKEFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAV  1697
             KD SLL+PGT+YLTEVDS YRRFY+KK  ++++
Sbjct  423   KDTSLLSPGTFYLTEVDSMYRRFYSKKTKESSL  455



>gb|KHN34992.1| Hydroxymethylglutaryl-CoA synthase [Glycine soja]
Length=475

 Score =   805 bits (2080),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/453 (82%), Positives = 420/453 (93%), Gaps = 0/453 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPP C+QQEALE HDGASKGKYTIGLGQDCM+FC+EVEDVISMSLT VT
Sbjct  3     KNVGILAIDIYFPPACVQQEALETHDGASKGKYTIGLGQDCMSFCTEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKYE+DPK +GRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYEIDPKLVGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESKLR
Sbjct  123   ALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPISFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+HVYDFYKP L SEYPVVDGKLSQTCYLMA+DSCYK+ C KYEK EGK FS++DA+
Sbjct  183   GSHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMAVDSCYKNFCHKYEKFEGKQFSLSDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FNDFL N+S ++E  KEKL PF++L+GDESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLVFNDFLMNSSSVDEVAKEKLGPFATLSGDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YD KVQP+TL+PKQVGNMYTAS+YAAF SLIHNK+STL G+RV++FSYGSG T
Sbjct  303   QQVAKPLYDQKVQPTTLIPKQVGNMYTASLYAAFASLIHNKNSTLAGKRVILFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++R+ QHPFSLSNIA V+++  KLKSRHEFPPE+FVE LK+MEHRYG K+FVTS
Sbjct  363   ATMFSLQLRDSQHPFSLSNIARVMDVDGKLKSRHEFPPEEFVENLKLMEHRYGGKEFVTS  422

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAV  1697
             KD SLL+PGT+YLTEVDS YRRFY+KK  ++++
Sbjct  423   KDTSLLSPGTFYLTEVDSMYRRFYSKKTKESSL  455



>ref|XP_003611167.1| Hydroxymethylglutaryl-CoA synthase [Medicago truncatula]
 gb|AES94125.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase [Medicago truncatula]
Length=471

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/464 (81%), Positives = 422/464 (91%), Gaps = 8/464 (2%)
 Frame = +3

Query  342   NVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVTS  521
             NVGILAL+IYFPP C+QQEALEAHDGASKGKYTIGLGQDCM+FCS+VEDVISMSLT V++
Sbjct  8     NVGILALDIYFPPNCVQQEALEAHDGASKGKYTIGLGQDCMSFCSDVEDVISMSLTVVST  67

Query  522   LLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTAA  701
             LL+KYE+DPKQIGRLEVGSETVIDKSKSIK+FLMQIFEK GNTDIEGVDSTNACYGGTAA
Sbjct  68    LLQKYEIDPKQIGRLEVGSETVIDKSKSIKSFLMQIFEKYGNTDIEGVDSTNACYGGTAA  127

Query  702   LFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRG  881
             LFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESKLRG
Sbjct  128   LFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPISFESKLRG  187

Query  882   SHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADADY  1061
             SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALD+C+K+ C KYEK EGK FS++DADY
Sbjct  188   SHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDTCFKNFCQKYEKHEGKQFSLSDADY  247

Query  1062  FVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKASQ  1241
             FVFHSPYNKLVQKSFARL+F+DFLRN S  +E   EKL PF++L+ DESY +RDLEKASQ
Sbjct  248   FVFHSPYNKLVQKSFARLVFSDFLRNPSSKDEVTNEKLGPFTTLSDDESYQSRDLEKASQ  307

Query  1242  QVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGSTA  1421
             QV+KP YD KVQPSTL+PKQVGNMYTASIYAAF SL+HNK+S+L G+RV++FSYGSG TA
Sbjct  308   QVAKPLYDEKVQPSTLIPKQVGNMYTASIYAAFASLLHNKNSSLEGKRVILFSYGSGLTA  367

Query  1422  TMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTSK  1601
             TMFSL++RE +HPFSLSNIA V+++AEKLKSRHEFPP+KF+E LK+MEHRYGAKD+VTSK
Sbjct  368   TMFSLQLRETKHPFSLSNIARVMDVAEKLKSRHEFPPQKFIETLKLMEHRYGAKDYVTSK  427

Query  1602  DCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVA--------NGH  1709
             D SLLAPGT+YLTEVD+ YRRFY  K +++ +         NGH
Sbjct  428   DSSLLAPGTFYLTEVDTMYRRFYTTKSSESNLTPAVNGLSVNGH  471



>ref|XP_010255571.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Nelumbo nucifera]
Length=475

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/452 (83%), Positives = 413/452 (91%), Gaps = 0/452 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MASQ+K+VGILA++IYFPPTC+QQEALEAHDGA+KGKYTIGLGQDCMAFC+E EDVISMS
Sbjct  1     MASQKKDVGILAMDIYFPPTCVQQEALEAHDGANKGKYTIGLGQDCMAFCTESEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT VTSLLEKY +DP QIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNAC
Sbjct  61    LTVVTSLLEKYGIDPTQIGRLEVGSETVIDKSKSIKTFLMQIFEKHGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES SWDGRYGLVVCTDSAVYAEG ARPTGGAAAIAML+GP+API F
Sbjct  121   YGGTAALFNCVNWVESCSWDGRYGLVVCTDSAVYAEGSARPTGGAAAIAMLIGPNAPIAF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ES+ RGSHM+HVYDFYKP L SEYPVV+GKLSQTCYLMALD+CYK  C+K+EKLEGK FS
Sbjct  181   ESRYRGSHMSHVYDFYKPDLASEYPVVNGKLSQTCYLMALDACYKHFCNKFEKLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             ++DADYFVFHSPYNKLVQKSFARL FNDFLRNAS + E  KEKLAPFSSL+ DESY NRD
Sbjct  241   ISDADYFVFHSPYNKLVQKSFARLYFNDFLRNASSVGEVAKEKLAPFSSLSSDESYQNRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+K  YD KVQP+TL+PKQVGNMYTAS+YAAF SLIHNKHS+L G+R++MFSY
Sbjct  301   LEKASQQVAKNLYDVKVQPTTLLPKQVGNMYTASLYAAFASLIHNKHSSLEGKRIIMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG T+TMFS +++ GQHPFSLSNIA V+NI+EKLKSRHE  PE FVE LK+MEHRYG K
Sbjct  361   GSGLTSTMFSFQLQSGQHPFSLSNIATVMNISEKLKSRHEISPENFVETLKLMEHRYGGK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             DFVTSKD  LL+PGT+YL EVD+ YRRFYAKK
Sbjct  421   DFVTSKDRRLLSPGTFYLIEVDNLYRRFYAKK  452



>ref|XP_007038548.1| Hydroxymethylglutaryl-CoA synthase / HMG-CoA synthase / 3-hydroxy-3-methylglutaryl 
coenzyme A synthase isoform 1 [Theobroma 
cacao]
 gb|EOY23049.1| Hydroxymethylglutaryl-CoA synthase / HMG-CoA synthase / 3-hydroxy-3-methylglutaryl 
coenzyme A synthase isoform 1 [Theobroma 
cacao]
Length=464

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/457 (82%), Positives = 417/457 (91%), Gaps = 0/457 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MAS  +NVGILA++IYFPPTC+QQE LEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMS
Sbjct  1     MASHPENVGILAIDIYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT VTSLLEKYE+DP +IGRLEVGSETVIDKSKSIKTFLMQIFE+CGNTDIEGVDSTNAC
Sbjct  61    LTVVTSLLEKYEIDPTKIGRLEVGSETVIDKSKSIKTFLMQIFEECGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGP+API F
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPNAPIAF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD CYK    K+EKL+G+ FS
Sbjct  181   ESKFRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDLCYKHFYEKFEKLQGRPFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             ++DADYFVFHSPYNKLVQKSFARL FNDFLRNASYI+E  KEKL PFS L+ DESY +RD
Sbjct  241   ISDADYFVFHSPYNKLVQKSFARLFFNDFLRNASYIDEGAKEKLTPFSGLSNDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+KP YD+ VQPSTL+PKQVGNMYTAS+YAAF SL+HNKH++L G+RVVMFSY
Sbjct  301   LEKASQQVAKPLYDSMVQPSTLLPKQVGNMYTASLYAAFASLLHNKHTSLAGKRVVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG TAT+FSL++++G+HPF+L NIA ++N++EKLK RHEFPPEKFV+ +K+ME RYGAK
Sbjct  361   GSGLTATIFSLKLQDGRHPFNLLNIAKLMNVSEKLKLRHEFPPEKFVDTMKLMEQRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAA  1694
             DFVTSK+ SLL P TYYLT+VDS YRRFY++K   AA
Sbjct  421   DFVTSKESSLLLPDTYYLTKVDSMYRRFYSRKANAAA  457



>ref|NP_192919.1| Hydroxymethylglutaryl-CoA synthase [Arabidopsis thaliana]
 sp|P54873.2|HMCS_ARATH RecName: Full=Hydroxymethylglutaryl-CoA synthase; Short=HMG-CoA 
synthase; AltName: Full=3-hydroxy-3-methylglutaryl coenzyme 
A synthase; AltName: Full=Protein EMBRYO DEFECTIVE 2778; 
AltName: Full=Protein FLAKY POLLEN 1 [Arabidopsis thaliana]
 gb|AAD00297.1| HMG-CoA synthase [Arabidopsis thaliana]
 gb|AAD00298.1| HMG-CoA synthase [Arabidopsis thaliana]
 emb|CAB44320.1| hydroxymethylglutaryl-CoA synthase [Arabidopsis thaliana]
 emb|CAB78225.1| hydroxymethylglutaryl-CoA synthase [Arabidopsis thaliana]
 gb|AEE83053.1| Hydroxymethylglutaryl-CoA synthase [Arabidopsis thaliana]
Length=461

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/459 (81%), Positives = 418/459 (91%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SL EKY++DP QIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLFEKYKIDPNQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EK+EGK FS+ DAD
Sbjct  183   ASHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKIEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             Y VFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSLT DESY +RDLEK S
Sbjct  243   YIVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLTLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++KPFYDAKVQP+TL+PK+VGNMYTAS+YAAF SLIH KH+ L G+RVVMFSYGSGST
Sbjct  303   QQIAKPFYDAKVQPTTLIPKEVGNMYTASLYAAFASLIHKKHNDLAGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ + + PFS+SNIA+V+++  KLK+RHE+ PEKFVE +K+MEHRYGAKDFVT+
Sbjct  363   ATMFSLRLNDNKPPFSISNIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKDFVTT  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    +VANGH
Sbjct  423   KEGIIDLLAPGTYYLKEVDSLYRRFYGKKGEDGSVANGH  461



>pdb|2F82|A Chain A, Hmg-Coa Synthase From Brassica Juncea In The Apo-Form
 pdb|2F9A|A Chain A, Hmg-Coa Synthase From Brassica Juncea In Complex With 
F-244
 pdb|2FA0|A Chain A, Hmg-coa Synthase From Brassica Juncea In Complex With 
Hmg-coa And Covalently Bound To Hmg-coa
Length=450

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/449 (84%), Positives = 416/449 (93%), Gaps = 2/449 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  2     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  61

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  62    SLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  121

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  122   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  181

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EKLEGK FS+ DAD
Sbjct  182   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKLEGKEFSINDAD  241

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  242   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVS  301

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K +YDAKVQP+TLVPKQVGNMYTAS+YAAF SL+HNKHS L G+RVVMFSYGSGST
Sbjct  302   QQLAKTYYDAKVQPTTLVPKQVGNMYTASLYAAFASLVHNKHSDLAGKRVVMFSYGSGST  361

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E Q PFSLSNIA+V+++  KLK+RHE+ PEKFVE +K+MEHRYGAK+FVTS
Sbjct  362   ATMFSLRLCENQSPFSLSNIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKEFVTS  421

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKK  1679
             K+    LLAPGTYYL EVDS YRRFY KK
Sbjct  422   KEGILDLLAPGTYYLKEVDSLYRRFYGKK  450



>ref|XP_010422136.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Camelina 
sativa]
Length=461

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/459 (82%), Positives = 420/459 (92%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SL +KY++DPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGN+D+EGVDSTNACYGGTA
Sbjct  63    SLFDKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNSDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EK+EGK FS+ DAD
Sbjct  183   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKIEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K FYDAKVQP+TL+PK+VGNMYTAS+YAAF SLIHNKH+ L G+RVVMFSYGSGST
Sbjct  303   QQLAKSFYDAKVQPTTLIPKEVGNMYTASLYAAFASLIHNKHNDLVGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E   PFS+SNIA+V+++  KLK+RHE+ PEKFVE +K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLCENLSPFSISNIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKDFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    ++ANGH
Sbjct  423   KEGIIELLAPGTYYLKEVDSLYRRFYGKKGDDGSIANGH  461



>gb|KFK31939.1| hypothetical protein AALP_AA6G179500 [Arabis alpina]
Length=461

 Score =   802 bits (2071),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/459 (82%), Positives = 418/459 (91%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALE HDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEVHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY+VDPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLLEKYKVDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GP+APIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPNAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K++KLEGK FS+ DAD
Sbjct  183   ASHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFKKLEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             Y VFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  PFSSL+ DESY +RDLEK S
Sbjct  243   YIVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPFSSLSLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K FYDAKVQP+TLVPK+VGNMYTAS+YAAF SLIHN H+ L G+RVVMFSYGSGST
Sbjct  303   QQLAKSFYDAKVQPTTLVPKEVGNMYTASLYAAFASLIHNTHNDLAGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E Q PFSLS+IA+V+++  KLK+RHE+ PEKFVE +K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLCENQSPFSLSSIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKDFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    ++ANGH
Sbjct  423   KEGILDLLAPGTYYLKEVDSLYRRFYGKKGEDGSIANGH  461



>ref|XP_003517453.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Glycine max]
 gb|KHN25735.1| Hydroxymethylglutaryl-CoA synthase [Glycine soja]
Length=471

 Score =   802 bits (2072),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/470 (80%), Positives = 422/470 (90%), Gaps = 12/470 (3%)
 Frame = +3

Query  336   QKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAV  515
             +KNVGILA++IYFPP C+QQEALE HDGASKGKYTIGLGQDCM+FC+EVEDVISMSLT V
Sbjct  2     EKNVGILAIDIYFPPACVQQEALETHDGASKGKYTIGLGQDCMSFCTEVEDVISMSLTVV  61

Query  516   TSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGT  695
             TSLLEKY +DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGT
Sbjct  62    TSLLEKYGIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDIEGVDSTNACYGGT  121

Query  696   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKL  875
             AALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESKL
Sbjct  122   AALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPISFESKL  181

Query  876   RGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADA  1055
             RGSHM+HVYDFYKP L SEYPVVDGKLSQTCYLMA+DSCYK+ C K++K +GK FS+ DA
Sbjct  182   RGSHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMAVDSCYKNFCHKFQKFQGKQFSLFDA  241

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
             +YFVFHSPYNKLVQKSFARL FNDFL N+S  +E  KEKL PF++L+GDESY +RDLEKA
Sbjct  242   EYFVFHSPYNKLVQKSFARLFFNDFLMNSSSADEVAKEKLGPFATLSGDESYQSRDLEKA  301

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGS  1415
             SQ ++KP YD KVQP+TL+PKQVGNMYTAS+YAAF SLIHNKHSTL G+RV++FSYGSG 
Sbjct  302   SQLLAKPLYDQKVQPTTLIPKQVGNMYTASLYAAFASLIHNKHSTLAGKRVILFSYGSGL  361

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             TATMFSL++R+ QHPFSLSN+A V+N+  KLKSRHEFPPE+FVE LK+MEHRYGAK+FVT
Sbjct  362   TATMFSLQLRDSQHPFSLSNMARVMNVDGKLKSRHEFPPEEFVENLKLMEHRYGAKEFVT  421

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAA------------VANGH  1709
             SKD SLL+PGT+YLTEVDS YRRFY+KK  +++            VANGH
Sbjct  422   SKDSSLLSPGTFYLTEVDSMYRRFYSKKTKESSLTHAENGVIANGVANGH  471



>gb|AFP23864.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase, partial [Picrorhiza 
kurrooa]
Length=436

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/434 (87%), Positives = 406/434 (94%), Gaps = 0/434 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA+EIYFPPTC+QQE LEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS+TAVT
Sbjct  3     KNVGILAMEIYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSMTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY VDPKQIGRLEVGSETV+DKSKSIKTFLM IFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYGVDPKQIGRLEVGSETVLDKSKSIKTFLMPIFEKYGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+APIVFESKLR
Sbjct  123   ALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHMAH YDFYKP L SEYPVVDGKLSQTCYLMALDSCYKSLC KYEK+EGK FSV DAD
Sbjct  183   ASHMAHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKSLCEKYEKIEGKQFSVTDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDF R+AS I+EA +EKLAPFSSLT DESY +RDLEKAS
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFSRSASSIDEAAQEKLAPFSSLTNDESYQSRDLEKAS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KPFYD KVQPSTL+PKQVGNMYTAS+YAAF SL+H+K +TLPGQRV+MFSYGSG +
Sbjct  303   QQVAKPFYDEKVQPSTLIPKQVGNMYTASLYAAFASLLHDKSTTLPGQRVIMFSYGSGLS  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR  EGQ+PFSLSNIA V+N++EKLKSRH+  PEKFVEI+K+MEHRYG KDFVTS
Sbjct  363   ATMFSLRFNEGQNPFSLSNIATVMNVSEKLKSRHDVAPEKFVEIMKVMEHRYGGKDFVTS  422

Query  1599  KDCSLLAPGTYYLT  1640
             KD SLLA GT+YLT
Sbjct  423   KDTSLLASGTFYLT  436



>ref|XP_010455597.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Camelina 
sativa]
Length=460

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/459 (82%), Positives = 423/459 (92%), Gaps = 3/459 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMSL AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSLNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SL +KY++DPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGN+D+EGVDSTNACYGGTA
Sbjct  63    SLFDKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNSDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EK+EGK FS+ DAD
Sbjct  183   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKIEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK +
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVA  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K FYDAKVQP+TL+PK+VGNMYTAS+YAAF SLIHNKH+ L G+RVVMFSYGSGST
Sbjct  303   QQLAKSFYDAKVQPTTLIPKEVGNMYTASLYAAFASLIHNKHNDLVGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E Q PFS+SNIA+V+++  KLK+RH++ PEKFVE +K+MEHRYGAKDFVTS
Sbjct  363   ATMFSLRLCENQSPFSVSNIASVMDVGGKLKARHKYAPEKFVETMKLMEHRYGAKDFVTS  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK  + ++ANGH
Sbjct  423   KEGIIDLLAPGTYYLKEVDSLYRRFYGKKGDE-SIANGH  460



>pdb|2FA3|A Chain A, Hmg-Coa Synthase From Brassica Juncea In Complex With 
Acetyl-Coa And Acetyl-Cys117.
Length=450

 Score =   799 bits (2063),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/449 (84%), Positives = 415/449 (92%), Gaps = 2/449 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  2     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  61

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTNA YGGTA
Sbjct  62    SLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTNAXYGGTA  121

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  122   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  181

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EKLEGK FS+ DAD
Sbjct  182   GSHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKLEGKEFSINDAD  241

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  242   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVS  301

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K +YDAKVQP+TLVPKQVGNMYTAS+YAAF SL+HNKHS L G+RVVMFSYGSGST
Sbjct  302   QQLAKTYYDAKVQPTTLVPKQVGNMYTASLYAAFASLVHNKHSDLAGKRVVMFSYGSGST  361

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E Q PFSLSNIA+V+++  KLK+RHE+ PEKFVE +K+MEHRYGAK+FVTS
Sbjct  362   ATMFSLRLCENQSPFSLSNIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYGAKEFVTS  421

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKK  1679
             K+    LLAPGTYYL EVDS YRRFY KK
Sbjct  422   KEGILDLLAPGTYYLKEVDSLYRRFYGKK  450



>gb|AFK46199.1| unknown [Medicago truncatula]
Length=471

 Score =   799 bits (2064),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/464 (81%), Positives = 420/464 (91%), Gaps = 8/464 (2%)
 Frame = +3

Query  342   NVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVTS  521
             NVGILAL+IYFPP C+QQEALEAHDGASKGKYTIGLGQDCM+FCS+VEDVISMSLT V +
Sbjct  8     NVGILALDIYFPPNCVQQEALEAHDGASKGKYTIGLGQDCMSFCSDVEDVISMSLTVVFT  67

Query  522   LLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTAA  701
             LL+KYE+DPKQIGRLEVGSETVIDKSKSIK+FLMQIFEK GNTDIEGVDSTNACYGGTAA
Sbjct  68    LLQKYEIDPKQIGRLEVGSETVIDKSKSIKSFLMQIFEKYGNTDIEGVDSTNACYGGTAA  127

Query  702   LFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRG  881
             LFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESKLRG
Sbjct  128   LFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPISFESKLRG  187

Query  882   SHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADADY  1061
             SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALD+C+K+ C KYEK EGK FS++DADY
Sbjct  188   SHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDTCFKNFCQKYEKHEGKQFSLSDADY  247

Query  1062  FVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKASQ  1241
             FVFHSPYNKLVQKSFARL+F+DFLRN S  +E   EKL PF++L+ DESY +RDLEKASQ
Sbjct  248   FVFHSPYNKLVQKSFARLVFSDFLRNPSSKDEVTNEKLGPFTTLSDDESYQSRDLEKASQ  307

Query  1242  QVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGSTA  1421
             QV+KP YD KVQPSTL+PKQVGNMYTASIYAAF SL+HNK+S+L G+RV++FSYGSG TA
Sbjct  308   QVAKPLYDEKVQPSTLIPKQVGNMYTASIYAAFASLLHNKNSSLEGKRVILFSYGSGLTA  367

Query  1422  TMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTSK  1601
             TMFSL++RE +HPFSL NIA V+++AEKLKSRHEFPP+KF+E LK+MEHRYGAKD+VTSK
Sbjct  368   TMFSLQLRETKHPFSLPNIARVMDVAEKLKSRHEFPPQKFIETLKLMEHRYGAKDYVTSK  427

Query  1602  DCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVA--------NGH  1709
             D SLLAPGT+YLTEVD+ YRRFY  K +++ +         NGH
Sbjct  428   DSSLLAPGTFYLTEVDTMYRRFYTTKSSESNLTPAVNGLSVNGH  471



>ref|XP_010940907.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like isoform X1 
[Elaeis guineensis]
Length=473

 Score =   797 bits (2059),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/457 (81%), Positives = 415/457 (91%), Gaps = 1/457 (0%)
 Frame = +3

Query  336   QKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAV  515
             +K+VGILA++IYFPPT +QQE LEA+DGASKGKYTIGLGQDCMAFC+E+EDVISMSLT +
Sbjct  4     RKDVGILAMDIYFPPTSVQQEELEAYDGASKGKYTIGLGQDCMAFCTELEDVISMSLTVI  63

Query  516   TSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGT  695
             TSLLEKY++DPKQIGRLEVGSETVIDKSKSIKT+LMQIFE+CGNTD+EGVDSTNACYGGT
Sbjct  64    TSLLEKYQIDPKQIGRLEVGSETVIDKSKSIKTWLMQIFEECGNTDVEGVDSTNACYGGT  123

Query  696   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKL  875
             AALFNCVNWVESSSWDGRYG+VVCTDSAVYAEGPARPTGGA AIAML+GP+API FESK 
Sbjct  124   AALFNCVNWVESSSWDGRYGVVVCTDSAVYAEGPARPTGGAGAIAMLIGPNAPISFESKY  183

Query  876   RGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADA  1055
             RG+HM HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  CSKYEK EGK FS++DA
Sbjct  184   RGTHMTHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHFCSKYEKFEGKQFSISDA  243

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
             DYFVFHSPYNKLVQKSFARL FNDFLR+AS + +  +EKL PFS+LTGDESY NR+LEK 
Sbjct  244   DYFVFHSPYNKLVQKSFARLYFNDFLRSASSVEKDGREKLEPFSTLTGDESYQNRELEKT  303

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGS  1415
             SQQV+K  YD KVQPSTL+PKQ+GNMYTASIYAAF SL+HNKHSTL  QRVVMFSYGSG 
Sbjct  304   SQQVAKHLYDEKVQPSTLLPKQIGNMYTASIYAAFASLLHNKHSTLVNQRVVMFSYGSGL  363

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             ++TMFS +++EGQHPFSLSNIAAVLN++EKLK+RH F PEKFVE LK+MEHRYGAKDFVT
Sbjct  364   SSTMFSFKLQEGQHPFSLSNIAAVLNVSEKLKARHVFTPEKFVETLKLMEHRYGAKDFVT  423

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             SKD SLL+PGT+YLT VD  YRR+Y KK  +  + NG
Sbjct  424   SKDTSLLSPGTFYLTNVDHMYRRYYVKKSAE-GMTNG  459



>ref|XP_009415836.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Musa acuminata 
subsp. malaccensis]
Length=475

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/469 (79%), Positives = 418/469 (89%), Gaps = 12/469 (3%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGILA++IYFP TC+QQEALEAHDGASKGKYTIGLGQ+CMAFC+EVEDVISMSLT VT
Sbjct  7     KDVGILAMDIYFPSTCVQQEALEAHDGASKGKYTIGLGQECMAFCTEVEDVISMSLTVVT  66

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY+VDPKQIGRLEVGSETVIDKSKSIKT++MQIFE+ GNTD+EGVDSTNACYGGTA
Sbjct  67    SLLEKYQVDPKQIGRLEVGSETVIDKSKSIKTWIMQIFEESGNTDVEGVDSTNACYGGTA  126

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK R
Sbjct  127   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFESKFR  186

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             G+HM HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  CSK+EK EGK FS++DAD
Sbjct  187   GTHMTHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKRFCSKFEKFEGKQFSISDAD  246

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL FND+LRN+S + +  +EKL  FS+LTGDESY +R+LEK S
Sbjct  247   YFVFHSPYNKLVQKSFARLYFNDYLRNSSVVEKDAREKLEQFSNLTGDESYQSRELEKVS  306

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQVSKP YDAK+QPSTL+PKQ+GNMYTASIYAAF S+IHNK+STL GQR+VMFSYGSG +
Sbjct  307   QQVSKPLYDAKIQPSTLLPKQIGNMYTASIYAAFASVIHNKYSTLMGQRIVMFSYGSGLS  366

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             +TMFS ++++GQHPF++SNIA VLN++EKL+ RH  PPE FVE LK+MEHRYGAKDF TS
Sbjct  367   STMFSFKLQDGQHPFNISNIATVLNVSEKLEKRHVIPPENFVETLKLMEHRYGAKDFETS  426

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAA------------VANGH  1709
             KD SLL+PGT+YL  VDS YRR+YAKK T+ A            +ANGH
Sbjct  427   KDTSLLSPGTFYLVNVDSMYRRYYAKKGTEEATSAKSFSVKNGSLANGH  475



>ref|XP_006421820.1| hypothetical protein CICLE_v10005099mg [Citrus clementina]
 ref|XP_006421823.1| hypothetical protein CICLE_v10005099mg [Citrus clementina]
 ref|XP_006490295.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Citrus sinensis]
 gb|ESR35060.1| hypothetical protein CICLE_v10005099mg [Citrus clementina]
 gb|ESR35063.1| hypothetical protein CICLE_v10005099mg [Citrus clementina]
 gb|KDO60142.1| hypothetical protein CISIN_1g012253mg [Citrus sinensis]
 gb|KDO60143.1| hypothetical protein CISIN_1g012253mg [Citrus sinensis]
Length=467

 Score =   793 bits (2049),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/455 (82%), Positives = 410/455 (90%), Gaps = 0/455 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILAL+IYFPPTC+ QEALE HDG SKGKYT+GLGQDCMAFCSEVEDVISMSLT VT
Sbjct  7     KNVGILALDIYFPPTCVLQEALEVHDGVSKGKYTVGLGQDCMAFCSEVEDVISMSLTVVT  66

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DP QIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  67    SLLEKYKIDPTQIGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDIEGVDSTNACYGGTA  126

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AML+GPDAPI FESKLR
Sbjct  127   ALFNCVNWVESASWDGRYGLVVCTDSAVYAEGPARPTGGAAAVAMLIGPDAPIAFESKLR  186

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C K+EKLEG+ FS+ D D
Sbjct  187   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKYFCQKFEKLEGRQFSMLDVD  246

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL FNDFLRNAS ++E  KEKLAP+S+L+  ESY +RDLEKAS
Sbjct  247   YFVFHSPYNKLVQKSFARLFFNDFLRNASSVDEIAKEKLAPYSTLSDVESYQSRDLEKAS  306

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+K  YD KVQPSTL+PKQVGNMYTAS+YAAF SL+H KHS+L G+RV+MFSYGSG T
Sbjct  307   QQVAKQLYDLKVQPSTLIPKQVGNMYTASLYAAFASLLHEKHSSLEGKRVIMFSYGSGLT  366

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL+++EG  PFSLSNI  V+++  KLK RHEFPPEKFV+I+K+MEHRYGAKDFVTS
Sbjct  367   ATMFSLQLQEGHRPFSLSNIVKVMDVPGKLKLRHEFPPEKFVDIMKLMEHRYGAKDFVTS  426

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVAN  1703
             KD SLL+PGT YLTEVDS +RRFYAKKE  +  A 
Sbjct  427   KDSSLLSPGTCYLTEVDSMFRRFYAKKENTSNAAT  461



>gb|AHF81872.1| hydroxymethylglutaryl coenzyme A synthase [Narcissus tazetta]
Length=470

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/464 (79%), Positives = 423/464 (91%), Gaps = 3/464 (1%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             M ++ K+VGILA++IYFPPTC+QQ  LEA+DGASKGKYTIGLGQDC+AFC+E+EDVISMS
Sbjct  1     METKAKDVGILAVDIYFPPTCVQQAELEAYDGASKGKYTIGLGQDCLAFCTELEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT VTSLLEKY++DPK IGRLEVG+ETVIDKSKSIKT+LMQIFE+ GNTDIEGVDSTNAC
Sbjct  61    LTVVTSLLEKYQIDPKMIGRLEVGTETVIDKSKSIKTWLMQIFEEHGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP API F
Sbjct  121   YGGTAALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPHAPIAF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RG+HM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+KYEK EGK FS
Sbjct  181   ESKYRGTHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKRFCAKYEKFEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             ++DADYFVFHSPYNKLVQKSFARL FNDF+RN+S +++  +EKL PFSSL+G+ESY +RD
Sbjct  241   ISDADYFVFHSPYNKLVQKSFARLYFNDFMRNSSSVDKEAREKLEPFSSLSGNESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK SQQV+K  YD KVQP+TLVPKQVGNMYTAS+YAAF S++H+KHSTL GQR+VMFSY
Sbjct  301   LEKVSQQVAKNLYDEKVQPATLVPKQVGNMYTASLYAAFASVLHDKHSTLAGQRIVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG +++MFSLRI++GQHPFSLSNI  V+N++ KL++RH FPPEKFVE +K+MEHRYGAK
Sbjct  361   GSGLSSSMFSLRIQDGQHPFSLSNIDNVMNVSGKLEARHVFPPEKFVETMKVMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK---ETKAAVANG  1706
             DFVT+KD SLL+PGT+YLT+VDS YRRFY++K   E  +AVANG
Sbjct  421   DFVTAKDTSLLSPGTFYLTQVDSMYRRFYSRKGLNEKSSAVANG  464



>ref|XP_006598724.1| PREDICTED: uncharacterized protein LOC100777679 isoform X1 [Glycine 
max]
Length=454

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/452 (81%), Positives = 409/452 (90%), Gaps = 0/452 (0%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             +S+  NVGILA++IYFPPTC+ Q+ALE HDG SKGKYTIGLGQDCMAFCSEVEDVISMSL
Sbjct  3     SSRPANVGILAMDIYFPPTCVTQDALEGHDGVSKGKYTIGLGQDCMAFCSEVEDVISMSL  62

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             T VTSLLEK+ VDPKQIG L VGSETVIDKSKSIKTFLMQ+FE  GNTDIEGVDSTNACY
Sbjct  63    TVVTSLLEKFNVDPKQIGHLAVGSETVIDKSKSIKTFLMQVFEASGNTDIEGVDSTNACY  122

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFNCVNWVESSSWDGRYGLVVCTD+AVYAEGPARPTGGAAAIAMLVGPDAPI FE
Sbjct  123   GGTAALFNCVNWVESSSWDGRYGLVVCTDTAVYAEGPARPTGGAAAIAMLVGPDAPIAFE  182

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSV  1046
             SKLRGSHM+H YDFYKP L SEYP+VDGKLSQTCYLMALDSCY+  C K+EKLEG+ FS+
Sbjct  183   SKLRGSHMSHAYDFYKPNLASEYPIVDGKLSQTCYLMALDSCYRLYCEKFEKLEGRPFSM  242

Query  1047  ADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDL  1226
             +D+DYFVFHSPYNKLVQKSF RL FNDFLRNAS+++E  +E LAP++SL+GDESY +RDL
Sbjct  243   SDSDYFVFHSPYNKLVQKSFGRLYFNDFLRNASFVDEVARETLAPYASLSGDESYQSRDL  302

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYG  1406
             EKA+QQ +K  YDAKVQPSTL+PKQVGNMYTAS+YAAF SL+HNK+S+L G+RVVMFSYG
Sbjct  303   EKANQQAAKHLYDAKVQPSTLIPKQVGNMYTASLYAAFASLLHNKNSSLVGKRVVMFSYG  362

Query  1407  SGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKD  1586
             SG TATMFS +++EGQHPF+LSNI  V+N+++KLK R E PPEKFVE LKIMEHRYG KD
Sbjct  363   SGLTATMFSFQLQEGQHPFNLSNIVTVMNVSDKLKQRVEIPPEKFVETLKIMEHRYGGKD  422

Query  1587  FVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE  1682
             FVTSKDCS L PGT+YLT VDS YRRFYAKK+
Sbjct  423   FVTSKDCSYLTPGTFYLTNVDSMYRRFYAKKD  454



>ref|XP_008809783.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Phoenix dactylifera]
Length=460

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/456 (81%), Positives = 414/456 (91%), Gaps = 0/456 (0%)
 Frame = +3

Query  336   QKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAV  515
             +K+VGILA++IYFPPT +QQEALEA+DGASKGKYTIGLGQDCMAFC+E+EDVISMSLT V
Sbjct  4     RKDVGILAMDIYFPPTFVQQEALEAYDGASKGKYTIGLGQDCMAFCTELEDVISMSLTVV  63

Query  516   TSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGT  695
             TSLLEKY++DPKQIGRLEVGSE+VIDKSKS+KT+LMQIFE+ GNTD+EGVDSTNACYGGT
Sbjct  64    TSLLEKYQIDPKQIGRLEVGSESVIDKSKSVKTWLMQIFEEFGNTDVEGVDSTNACYGGT  123

Query  696   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKL  875
             AALFNCVNWVESSSWDGRYGLVVCTDSAVYA+GPARPTGGA AIAML+GP+API FESK 
Sbjct  124   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAKGPARPTGGAGAIAMLIGPNAPIPFESKY  183

Query  876   RGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADA  1055
             RG+HM HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  CSKYEK EGK FS++DA
Sbjct  184   RGTHMIHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKRFCSKYEKFEGKQFSISDA  243

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
             DYFVFHSPYNKLVQKSFARL FNDFLR+ S + +  +EKL PFS+LTGDESY +R+LEK 
Sbjct  244   DYFVFHSPYNKLVQKSFARLYFNDFLRSPSSVEKGAREKLEPFSTLTGDESYQSRELEKT  303

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGS  1415
             SQQV+K  YD KVQPSTL+PKQ+GNMYTASIYAAF SL+HNKHSTL  QRVVMFSYGSG 
Sbjct  304   SQQVAKHLYDEKVQPSTLLPKQIGNMYTASIYAAFASLLHNKHSTLGNQRVVMFSYGSGL  363

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             ++TMFSL+++EGQHPFSLSNI AVLN++EKLK+RHEF PEKFVE LK+MEHRYGAKDFVT
Sbjct  364   SSTMFSLKLQEGQHPFSLSNINAVLNVSEKLKARHEFTPEKFVETLKLMEHRYGAKDFVT  423

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVAN  1703
             SKD SLL+PGT+YLT VD  YRR+Y KK  +  + N
Sbjct  424   SKDTSLLSPGTFYLTNVDYMYRRYYTKKGAEGLLNN  459



>ref|XP_010907420.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like isoform X1 
[Elaeis guineensis]
Length=474

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/471 (79%), Positives = 422/471 (90%), Gaps = 12/471 (3%)
 Frame = +3

Query  333   QQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTA  512
             ++K+VGILA++IYFPPTC++QEALEA+DGASKGKYTIGLGQDCMAFC+E+EDVISMSLT 
Sbjct  3     ERKDVGILAMDIYFPPTCVEQEALEAYDGASKGKYTIGLGQDCMAFCTELEDVISMSLTV  62

Query  513   VTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGG  692
             VTSLLEKY++DPKQIGRLEVGSETVIDKSKSIKT+LMQIFE+ GNTD+EGVDSTNACYGG
Sbjct  63    VTSLLEKYQIDPKQIGRLEVGSETVIDKSKSIKTWLMQIFEEYGNTDVEGVDSTNACYGG  122

Query  693   TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESK  872
             TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AML+GP+API FESK
Sbjct  123   TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAMAMLIGPNAPISFESK  182

Query  873   LRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVAD  1052
              RG+HM HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  CSKYEK EGK FS+ D
Sbjct  183   FRGTHMTHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHFCSKYEKFEGKKFSIFD  242

Query  1053  ADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEK  1232
             ADYFVFHSPYNKLVQKSFARL +NDFL N S + +  +EKL PFS+LTGDESY +R+LEK
Sbjct  243   ADYFVFHSPYNKLVQKSFARLYYNDFLHNPSSVEKDSREKLEPFSTLTGDESYQSRELEK  302

Query  1233  ASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSG  1412
              SQQV+K  YD KVQPSTL+PKQ+GNMYTASIYAAF S++HNKHSTL GQR+VMFSYGSG
Sbjct  303   TSQQVAKCLYDKKVQPSTLLPKQIGNMYTASIYAAFASVLHNKHSTLGGQRIVMFSYGSG  362

Query  1413  STATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFV  1592
              ++TMFSL++R+GQHPFSLSNIA +LN++EKL++RH F PEKFVE LK+MEHRYGAKDFV
Sbjct  363   LSSTMFSLKLRDGQHPFSLSNIATMLNVSEKLEARHVFLPEKFVETLKLMEHRYGAKDFV  422

Query  1593  TSKDCSLLAPGTYYLTEVDSKYRRFYAKK------ETKAA------VANGH  1709
             T K+ SLL+PGT+YLT+VDS YRR+YAKK        KAA      +ANGH
Sbjct  423   TGKETSLLSPGTFYLTKVDSMYRRYYAKKVAEGITNGKAAECNNKPLANGH  473



>ref|XP_010529525.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Tarenaya 
hassleriana]
Length=465

 Score =   790 bits (2041),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/463 (81%), Positives = 416/463 (90%), Gaps = 6/463 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCMAFC+E+EDVISMS   VT
Sbjct  3     KSVGILAMDIYFPPTCIQQEALEAHDGASKGKYTIGLGQDCMAFCTELEDVISMSFNVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DP QIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLLEKYKIDPSQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  123   ALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAH YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+KY+KLEGK FS+ D D
Sbjct  183   GSHMAHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHYCNKYQKLEGKEFSILDGD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             +FVFHSPYNKLVQKSFARLL+NDFLRNAS + EA KEK +P+SSL+ DESY NRDLEK S
Sbjct  243   FFVFHSPYNKLVQKSFARLLYNDFLRNASSVEEAVKEKFSPYSSLSLDESYQNRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             Q ++KP YDAKVQP+TL+PKQVGNMYTAS+YAAF SLIHNKH  L G+RV+MFSYGSG T
Sbjct  303   QLLAKPLYDAKVQPTTLIPKQVGNMYTASLYAAFASLIHNKHKELAGKRVMMFSYGSGLT  362

Query  1419  ATMFSLRIREGQH-PFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             +TMFSLR+ +  H PFSLS+IA+V+++AEKLKSRHEF PE+FVE +K+MEHRYG KDFVT
Sbjct  363   STMFSLRMCDSSHPPFSLSDIASVMDVAEKLKSRHEFTPERFVETMKVMEHRYGGKDFVT  422

Query  1596  SKD--CSLLAPGTYYLTEVDSKYRRFYAKKETK---AAVANGH  1709
             +K     LLAPGTYYL EVDS YRRFY KK+      ++ANGH
Sbjct  423   NKGGVIDLLAPGTYYLKEVDSLYRRFYGKKDADCNGGSLANGH  465



>gb|AHF81873.1| hydroxymethylglutaryl coenzyme A synthase [Narcissus tazetta]
Length=470

 Score =   790 bits (2039),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/464 (79%), Positives = 422/464 (91%), Gaps = 3/464 (1%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             M ++ K+VGILA++IYFPPTC+QQ  LEA+DGASKGKY IGLGQDC+AFC+E+EDVISMS
Sbjct  1     METKAKDVGILAVDIYFPPTCVQQAELEAYDGASKGKYAIGLGQDCLAFCTELEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT VTSLLEKY++DPK IGRLEVG+ETVIDKSKSIKT+LMQIFE+ GNTDIEGVDSTNAC
Sbjct  61    LTVVTSLLEKYQIDPKMIGRLEVGTETVIDKSKSIKTWLMQIFEEHGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP API F
Sbjct  121   YGGTAALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPHAPIAF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RG+HM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+KYEK EGK FS
Sbjct  181   ESKYRGTHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKRFCAKYEKFEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             ++DADYFVFHSPYNKLVQKSFARL FNDF+RN+S +++  +EKL PFSSL+G+ESY +RD
Sbjct  241   ISDADYFVFHSPYNKLVQKSFARLYFNDFMRNSSSVDKEAREKLEPFSSLSGNESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK SQQV+K  YD KVQP+TLVPKQVGNMYTAS+YAAF S++H+KHSTL GQR+VMFSY
Sbjct  301   LEKVSQQVAKNLYDEKVQPATLVPKQVGNMYTASLYAAFASVLHDKHSTLVGQRIVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG +++MFSLRI++GQHPFSLSNI  V+N++ KL++RH FPPEKFVE +K+MEHRYGAK
Sbjct  361   GSGLSSSMFSLRIQDGQHPFSLSNIDNVMNVSGKLEARHVFPPEKFVETMKVMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK---ETKAAVANG  1706
             DFVT+KD SLL+PGT+YLT+VDS YRRFY++K   E  +AVANG
Sbjct  421   DFVTAKDTSLLSPGTFYLTQVDSMYRRFYSRKGLNEKSSAVANG  464



>gb|ACY74339.1| putative HMG-CoA synthase 1 [Artemisia annua]
Length=458

 Score =   789 bits (2037),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/457 (82%), Positives = 410/457 (90%), Gaps = 2/457 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             +NVGILA+EIYFPPTC+QQ+ LE  DG SKGKYTIGLGQDCMAFCSEVEDVISM LTAVT
Sbjct  4     QNVGILAMEIYFPPTCIQQDTLEDFDGVSKGKYTIGLGQDCMAFCSEVEDVISMGLTAVT  63

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY VDPKQIGRLEVGSETVIDKSKSIKTFLM IFE CGNTDIEGVDSTNACYGGTA
Sbjct  64    SLLEKYGVDPKQIGRLEVGSETVIDKSKSIKTFLMTIFEDCGNTDIEGVDSTNACYGGTA  123

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESK R
Sbjct  124   ALLNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIAFESKFR  183

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHM+HVYDFYKP L SEYPVVDGKLSQTCYLMAL+SCYK  C KYEKL+GK FS+ADAD
Sbjct  184   ASHMSHVYDFYKPDLASEYPVVDGKLSQTCYLMALESCYKGYCQKYEKLQGKQFSIADAD  243

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+F+D  R+AS ++E+ KEKL  F+SLTGDESY+NRDLEKAS
Sbjct  244   YFVFHSPYNKLVQKSFARLVFSDVARSASSVDESAKEKLGQFTSLTGDESYNNRDLEKAS  303

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+KP YD KVQP TL+ KQVGNMYTASIYAAF SLIHNK+S+L G RV+MFSYGSG +
Sbjct  304   QQVAKPHYDVKVQPGTLICKQVGNMYTASIYAAFASLIHNKNSSLDGNRVMMFSYGSGLS  363

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ EG+ PFSLSNIA V+N+ EKLK R E  PEKFVE++K+MEHRYG KDFVTS
Sbjct  364   ATMFSLRLSEGKAPFSLSNIAKVMNVDEKLKRRTELSPEKFVELMKVMEHRYGGKDFVTS  423

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             KD +LLAP TYYLTEVDSKYRR+YAKK ++  +ANG 
Sbjct  424   KDTTLLAPDTYYLTEVDSKYRRYYAKKTSE--LANGQ  458



>ref|XP_010540458.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Tarenaya hassleriana]
Length=460

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/458 (81%), Positives = 413/458 (90%), Gaps = 3/458 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGI+A++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCM FC+E+EDVISMS   VT
Sbjct  3     KNVGIVAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCMGFCTELEDVISMSFNVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLE Y++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLLENYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNW+ES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  123   ALFNCVNWMESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAH YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  CSKYEKLEGK FS+ DA+
Sbjct  183   GSHMAHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHYCSKYEKLEGKQFSILDAE  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLR+AS +  A  EK  PFSSL+ DESY NRDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRSASSVEGAVSEKFVPFSSLSLDESYQNRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++KP YDAKVQP+TL+PKQVGNMYTAS+YAAF SLIHNKH+ L G+RV+MFSYGSG T
Sbjct  303   QQLAKPLYDAKVQPTTLIPKQVGNMYTASLYAAFASLIHNKHTELAGKRVMMFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             +TMFSL + +   PFSLSNIA+V+++A KLK+RHEF PE+F+E +K+MEHRYGAKDFVT+
Sbjct  363   STMFSLHLVDTNPPFSLSNIASVMDVAGKLKARHEFTPERFIETMKLMEHRYGAKDFVTT  422

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             KD    LLAPGTYYL EVDS YRRFY KK+  + +ANG
Sbjct  423   KDGVIDLLAPGTYYLKEVDSLYRRFYGKKD-GSCLANG  459



>ref|XP_007152355.1| hypothetical protein PHAVU_004G123000g [Phaseolus vulgaris]
 gb|ESW24349.1| hypothetical protein PHAVU_004G123000g [Phaseolus vulgaris]
Length=458

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/452 (81%), Positives = 408/452 (90%), Gaps = 0/452 (0%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             +S   NVGILA++IYFPP+C+ QEALE HDG SKGKYTIGLGQDCMAFCSEVEDVISMSL
Sbjct  3     SSHPTNVGILAMDIYFPPSCVTQEALEGHDGVSKGKYTIGLGQDCMAFCSEVEDVISMSL  62

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             T V SLLEK+ VDPKQIGRLEVGSETVIDKSKSIKTFLMQ+FE  GNTDIEGVDSTNACY
Sbjct  63    TVVASLLEKFNVDPKQIGRLEVGSETVIDKSKSIKTFLMQVFEASGNTDIEGVDSTNACY  122

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPI FE
Sbjct  123   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIAFE  182

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSV  1046
             SKLRGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C K+EKLEG+ FS+
Sbjct  183   SKLRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYRIFCEKFEKLEGRPFSI  242

Query  1047  ADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDL  1226
             +D+DYFVFHSPYNKLVQKSF RL FNDF+RN S+++EA +E LAP++SL+ DESY +RDL
Sbjct  243   SDSDYFVFHSPYNKLVQKSFGRLYFNDFMRNLSFVDEAARETLAPYASLSSDESYQSRDL  302

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYG  1406
             EKA+QQ +K  YDAKVQPSTL+PKQVGNMYTAS+YAAF SL+HNK+++L G+RVVMFSYG
Sbjct  303   EKANQQAAKHVYDAKVQPSTLIPKQVGNMYTASLYAAFASLLHNKNTSLVGKRVVMFSYG  362

Query  1407  SGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKD  1586
             SG TATMFS+ ++EGQHPF+LSNI  V+N+++KLK R E PPEKFVE LKIMEHRYG KD
Sbjct  363   SGLTATMFSVHLQEGQHPFNLSNIVTVMNVSDKLKQRLEIPPEKFVETLKIMEHRYGGKD  422

Query  1587  FVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE  1682
             FVTSKDCS L PGT+YLT VDS YRR+YAKK+
Sbjct  423   FVTSKDCSYLPPGTFYLTNVDSMYRRYYAKKD  454



>ref|XP_003533236.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Glycine max]
 gb|KHN23062.1| Hydroxymethylglutaryl-CoA synthase [Glycine soja]
Length=457

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/455 (81%), Positives = 409/455 (90%), Gaps = 1/455 (0%)
 Frame = +3

Query  324   MAS-QQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISM  500
             MAS +  NVGILA++IYFPPTC+ QEALE HDG SKGKYTIGLGQDCMAFCSEVEDVISM
Sbjct  1     MASLRPANVGILAMDIYFPPTCVTQEALEGHDGVSKGKYTIGLGQDCMAFCSEVEDVISM  60

Query  501   SLTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNA  680
             SLT VTSLLEK+ VDPKQIGRLEVGSETVIDKSKSIKTFLMQ+FE  GN DIEGVDSTNA
Sbjct  61    SLTVVTSLLEKFNVDPKQIGRLEVGSETVIDKSKSIKTFLMQVFEASGNIDIEGVDSTNA  120

Query  681   CYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIV  860
             CYGGTAALFNCVNWVESSSWDGRYGLVVCTD+AVYAEGPARPTGGAAAIAMLVGPDAPI 
Sbjct  121   CYGGTAALFNCVNWVESSSWDGRYGLVVCTDTAVYAEGPARPTGGAAAIAMLVGPDAPIA  180

Query  861   FESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSF  1040
             FESKLRGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C K+EKLEG+ F
Sbjct  181   FESKLRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYQLYCKKFEKLEGRPF  240

Query  1041  SVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNR  1220
             S++D+DYFVFHSPYNKLVQKSF RL FNDFLRN S+++E  ++ LAP++SL+GD+SY +R
Sbjct  241   SMSDSDYFVFHSPYNKLVQKSFGRLYFNDFLRNPSFVDEVARDTLAPYASLSGDDSYQSR  300

Query  1221  DLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFS  1400
             DLEKA+QQ +K  YDAKVQPSTL+PKQVGNMYTAS+YAAF SL+HNK+S+L G+RVVMFS
Sbjct  301   DLEKANQQAAKHLYDAKVQPSTLIPKQVGNMYTASLYAAFASLLHNKNSSLVGKRVVMFS  360

Query  1401  YGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGA  1580
             YGSG TATMFS  ++EGQHPF+LSNI  V+N+++KLK R E PPEKFVE LKIMEHRYG 
Sbjct  361   YGSGLTATMFSFHLQEGQHPFNLSNIVTVMNVSDKLKQRVEIPPEKFVETLKIMEHRYGG  420

Query  1581  KDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKET  1685
             KDFVTSKDCS L PGT+YLT VDS YRRFYAKKE 
Sbjct  421   KDFVTSKDCSYLPPGTFYLTNVDSMYRRFYAKKEV  455



>ref|XP_008777803.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Phoenix dactylifera]
Length=473

 Score =   785 bits (2027),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/466 (79%), Positives = 418/466 (90%), Gaps = 4/466 (1%)
 Frame = +3

Query  333   QQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTA  512
             ++K+VGILA++ YFPPTC+QQEALEA+DGASKGKYTIGLGQDCMAFC+E+EDVISMSLT 
Sbjct  3     ERKDVGILAMDFYFPPTCVQQEALEAYDGASKGKYTIGLGQDCMAFCTELEDVISMSLTV  62

Query  513   VTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGG  692
             VTSLLEKY++DPKQIGRLEVGSETVIDKSKSIKT+LMQIFE+ GNTD+EGVDSTNACYGG
Sbjct  63    VTSLLEKYQIDPKQIGRLEVGSETVIDKSKSIKTWLMQIFEEYGNTDVEGVDSTNACYGG  122

Query  693   TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESK  872
             TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK
Sbjct  123   TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFESK  182

Query  873   LRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVAD  1052
              RG+HM HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  CSKYEK EGK FS+ D
Sbjct  183   YRGTHMTHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKRFCSKYEKFEGKQFSIFD  242

Query  1053  ADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEK  1232
             AD FVFHSPYNKLVQKSFARL +NDFLRN S + +  +EKL PFS+LTGDESY +R+LEK
Sbjct  243   ADSFVFHSPYNKLVQKSFARLYYNDFLRNPSSVEKDAREKLEPFSTLTGDESYQSRELEK  302

Query  1233  ASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSG  1412
              SQQV+K  YD KVQPSTL+PKQ+GNMYTASIYAAF S++HNKHSTL GQR+VMFSYGSG
Sbjct  303   TSQQVAKHLYDEKVQPSTLLPKQLGNMYTASIYAAFASVLHNKHSTLGGQRIVMFSYGSG  362

Query  1413  STATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFV  1592
              ++TMFSL++ +GQHPFSLSNIA VLN++EKL++RH   PEKFVE LK+MEHRYGAKDFV
Sbjct  363   LSSTMFSLKLHDGQHPFSLSNIATVLNVSEKLEARHVVLPEKFVETLKLMEHRYGAKDFV  422

Query  1593  TSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH*PESIKC  1730
             T K+ SLL+PGT+YLT+VDS YRR YAKK     + NG+   ++KC
Sbjct  423   TGKETSLLSPGTFYLTKVDSMYRRHYAKK-VAEGITNGN---AVKC  464



>ref|XP_003620731.1| Hydroxymethylglutaryl-CoA synthase [Medicago truncatula]
 gb|AES76949.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase [Medicago truncatula]
Length=459

 Score =   783 bits (2022),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/452 (80%), Positives = 406/452 (90%), Gaps = 0/452 (0%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             +S   NVGILA++IYFPPTC+QQEALEAHDG SKGKYTIGLGQDCMAFC+EVED+ISMS+
Sbjct  3     SSHPNNVGILAIDIYFPPTCVQQEALEAHDGVSKGKYTIGLGQDCMAFCTEVEDIISMSM  62

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             T V+SLLEKY +DPK+IGRLEVGSET+IDKSKSIKTFLMQIFE  GNTDIEGVDSTNACY
Sbjct  63    TVVSSLLEKYNIDPKKIGRLEVGSETMIDKSKSIKTFLMQIFEDSGNTDIEGVDSTNACY  122

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPI FE
Sbjct  123   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIAFE  182

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSV  1046
             SKLRGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C K+EK EGK FS+
Sbjct  183   SKLRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYRVFCEKFEKSEGKHFSM  242

Query  1047  ADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDL  1226
             AD+DYFVFHSPYNKLVQKSF RL FNDFLRN S+++E  ++ LAP++SLTGDESY +RDL
Sbjct  243   ADSDYFVFHSPYNKLVQKSFGRLYFNDFLRNPSFVDEVSRQALAPYASLTGDESYQSRDL  302

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYG  1406
             EKA+QQ +K  YDAKVQPSTL+PKQVGNMYTAS+YAAF SL+HNKH +L G+RVVMFSYG
Sbjct  303   EKANQQAAKKIYDAKVQPSTLIPKQVGNMYTASLYAAFASLLHNKHDSLVGKRVVMFSYG  362

Query  1407  SGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKD  1586
             SG T+TMFS R++EGQHPF+LSNI  V+N++ KLK R E PPEKFVE  KIMEH YG K+
Sbjct  363   SGLTSTMFSFRLQEGQHPFNLSNIVTVMNVSGKLKQRIELPPEKFVENTKIMEHHYGGKE  422

Query  1587  FVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE  1682
             FVT +DC+ L PGT++LT+VDS YRRFYAKK+
Sbjct  423   FVTGQDCNYLLPGTFFLTKVDSMYRRFYAKKD  454



>gb|AAG32924.1|AF188641_1 HMG-CoA synthase [Brassica juncea]
Length=453

 Score =   781 bits (2018),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/459 (81%), Positives = 411/459 (90%), Gaps = 10/459 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDC+AFC+E+EDVISMS  AVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCLAFCTELEDVISMSFNAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DP QIGRLEVGSETVIDKSKSIKTF+MQ+FEKCGNTD+EGVDSTNACYGGTA
Sbjct  63    SLLEKYKIDPNQIGRLEVGSETVIDKSKSIKTFVMQLFEKCGNTDVEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPIVFESKLR
Sbjct  123   ALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPIVFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSH+ HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EKLEGK FS+ DAD
Sbjct  183   GSHIPHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKLEGKEFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSL+ DESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLSLDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K FYDAKVQP+TLVPKQVGNMYTAS+YAAF SLIHNKH+ L G+RVVMFSYGSGST
Sbjct  303   QQLAKTFYDAKVQPTTLVPKQVGNMYTASLYAAFASLIHNKHNDLVGKRVVMFSYGSGST  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ E Q PFSLSNIA+V+++           PEKFVE +K+MEHRYGAK+FVTS
Sbjct  363   ATMFSLRLCENQSPFSLSNIASVMDVG--------VSPEKFVETMKLMEHRYGAKEFVTS  414

Query  1599  KD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             K+    LLAPGTYYL EVDS YRRFY KK    +VANG 
Sbjct  415   KEGILDLLAPGTYYLKEVDSLYRRFYGKKGDDGSVANGQ  453



>ref|XP_011628383.1| PREDICTED: hydroxymethylglutaryl-CoA synthase [Amborella trichopoda]
Length=467

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/461 (79%), Positives = 409/461 (89%), Gaps = 0/461 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             M SQQKNVGILA++IYFP  C+QQE+LEAHDGASKGKYTIGLGQDCMAFC+E+EDVISMS
Sbjct  1     MGSQQKNVGILAMDIYFPRACVQQESLEAHDGASKGKYTIGLGQDCMAFCTELEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             +T V+SLLEKY++D KQIGRLEVGSETVIDKSKSIKT+LM +FE CGNTDIEGVDSTNAC
Sbjct  61    MTVVSSLLEKYQIDRKQIGRLEVGSETVIDKSKSIKTWLMDLFEDCGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAAL NCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AML+GP+API F
Sbjct  121   YGGTAALLNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVAMLIGPNAPIAF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  CSK+E LEGK FS
Sbjct  181   ESKYRGSHMSHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKRYCSKFEDLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DADY  FHSPYNKLVQKSFARL FNDFLRN S IN+   EKL PFS+L+ +ESY +RD
Sbjct  241   ILDADYVAFHSPYNKLVQKSFARLYFNDFLRNGSSINKDVYEKLGPFSTLSSEESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK +QQV+KP YD KVQPSTL+PKQVGNMYTAS+YAAF S++HNKH +L GQRV+MFSY
Sbjct  301   LEKVTQQVAKPQYDVKVQPSTLLPKQVGNMYTASLYAAFASIVHNKHESLVGQRVLMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG ++TMFS R+REGQHPFS+SNIA+VLN++ KL+SR  F PEKFVEI+ +MEHRYGAK
Sbjct  361   GSGLSSTMFSFRMREGQHPFSISNIASVLNVSGKLESRQVFSPEKFVEIMNLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
              FVTS+D SLL+P TYYL EVD+ YRR+YAKK      +NG
Sbjct  421   GFVTSEDRSLLSPETYYLKEVDALYRRYYAKKVGDDGASNG  461



>gb|EAZ09792.1| hypothetical protein OsI_32080 [Oryza sativa Indica Group]
Length=476

 Score =   775 bits (2001),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/464 (79%), Positives = 410/464 (88%), Gaps = 6/464 (1%)
 Frame = +3

Query  336   QKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAV  515
             +K+VGILA++IYFPPTC+ QE+LEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS+T V
Sbjct  4     RKDVGILAMDIYFPPTCVLQESLEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSMTVV  63

Query  516   TSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGT  695
             TSLL+KY+VDPK IGRLEVGSETVIDKSKSIKT+LMQIFE+CGNTDIEGVDS+NACYGGT
Sbjct  64    TSLLKKYKVDPKLIGRLEVGSETVIDKSKSIKTWLMQIFEECGNTDIEGVDSSNACYGGT  123

Query  696   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKL  875
             AAL NCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK 
Sbjct  124   AALLNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPIAFESKY  183

Query  876   RGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADA  1055
             + SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C KYEKL GK FS++DA
Sbjct  184   KASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQFCKKYEKLAGKQFSISDA  243

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
             DYFVFHSPYNKLVQKSFARL +NDF R+ S ++   KEKL PFS+LTG+ESY +RDLEKA
Sbjct  244   DYFVFHSPYNKLVQKSFARLYYNDFTRDCSSVDNDAKEKLQPFSNLTGEESYQSRDLEKA  303

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGS  1415
             SQQV+KP YD KVQPSTL+PKQ+GNMYTAS+YAA  S+++NKH++L GQR+VMFSYGSG 
Sbjct  304   SQQVAKPLYDIKVQPSTLLPKQIGNMYTASLYAALASVLYNKHASLDGQRIVMFSYGSGL  363

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             T+TMFSL++  GQ PFSLSNIA+VLN  EKL+SRH   PEKFVE LK+MEHRYGAKDF T
Sbjct  364   TSTMFSLKLNNGQDPFSLSNIASVLNATEKLESRHMTLPEKFVETLKLMEHRYGAKDFET  423

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKK------ETKAAVANGH  1709
             SKD SLL PGT+YLT VDS YRRFY +K        KA  +NGH
Sbjct  424   SKDTSLLPPGTFYLTRVDSMYRRFYERKADEEIAAAKAKYSNGH  467



>ref|XP_010533729.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Tarenaya 
hassleriana]
Length=461

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/459 (79%), Positives = 411/459 (90%), Gaps = 2/459 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEA DGASKGKYTIGLGQDCMAFC+E+EDVISMSLT VT
Sbjct  3     KNVGILAVDIYFPPTCVQQEALEAFDGASKGKYTIGLGQDCMAFCTELEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DP +IGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYKIDPTKIGRLEVGSETVIDKSKSIKTFLMQIFEKHGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AML+GP+APIVFESK R
Sbjct  123   ALLNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVAMLIGPEAPIVFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHMAH YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK+LC+KYEKLEGK FS+ +AD
Sbjct  183   GSHMAHAYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYKTLCNKYEKLEGKQFSLDEAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             +FVFHSPYNKLVQKSFARLL+N+F+RN S ++EA KE    F+SL+ DESY +RDLEK S
Sbjct  243   FFVFHSPYNKLVQKSFARLLYNEFMRNTSSVDEAAKEMFKQFASLSIDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++KP YD+KV+P+TL+ KQ GNMYTAS+YAAF+SLIH KHS LPG+RVVMFSYGSG T
Sbjct  303   QQLAKPLYDSKVKPTTLISKQGGNMYTASLYAAFVSLIHGKHSELPGKRVVMFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL++RE   PF LS+IA  +++A KLK+RHEF PEKFVE +K+MEHRYGAKDFVT+
Sbjct  363   ATMFSLKLRENAAPFGLSDIATAMDVAGKLKNRHEFSPEKFVETMKLMEHRYGAKDFVTN  422

Query  1599  KD-CSLLAPGTYYLTEVDSKYRRFY-AKKETKAAVANGH  1709
             K+   LL+PGTYYL EVDSKYRRFY A      +V NGH
Sbjct  423   KEQIGLLSPGTYYLVEVDSKYRRFYSAISPENGSVENGH  461



>ref|XP_004513692.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Cicer arietinum]
Length=459

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/455 (78%), Positives = 403/455 (89%), Gaps = 0/455 (0%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             +S   NVGILA++IYFPPTC+QQEALEAHDG  KGKYTIGLGQDCM FC+EVEDVISMS+
Sbjct  3     SSHPNNVGILAMDIYFPPTCVQQEALEAHDGVGKGKYTIGLGQDCMTFCTEVEDVISMSM  62

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             T V+SLLEKY VDPK+IGRLEVGSETVIDKSKSIKTFLMQ+FE  GN+DIEGVDSTNACY
Sbjct  63    TVVSSLLEKYNVDPKKIGRLEVGSETVIDKSKSIKTFLMQVFEDSGNSDIEGVDSTNACY  122

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAP+ FE
Sbjct  123   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPVAFE  182

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSV  1046
             SKLRGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C K++KLE + FS+
Sbjct  183   SKLRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYRVFCEKFKKLERRDFSI  242

Query  1047  ADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDL  1226
             +D+DYFVFHSPYNKLVQKSF RL FNDF+RN S+++E  +  LAP++S + +ESY +RDL
Sbjct  243   SDSDYFVFHSPYNKLVQKSFGRLYFNDFMRNPSFVDEVSRPTLAPYASFSDEESYQSRDL  302

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYG  1406
             EKA+Q  ++  YDAKVQPSTL+PKQ+GNMYTAS+YAAF SL+HNKH +L G+RVVMFSYG
Sbjct  303   EKANQLAARDTYDAKVQPSTLIPKQIGNMYTASLYAAFASLLHNKHDSLVGKRVVMFSYG  362

Query  1407  SGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKD  1586
             SG TATMFS RIRE QHPF+LSNI +V+N+++KLK R EFPPEKFVE  KIMEH YGAKD
Sbjct  363   SGLTATMFSFRIRESQHPFTLSNIVSVMNVSDKLKQRVEFPPEKFVENTKIMEHHYGAKD  422

Query  1587  FVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKA  1691
             FVT +DC  L PGT+YLT+VDS YRRFY+KK+  A
Sbjct  423   FVTGEDCKYLLPGTFYLTKVDSLYRRFYSKKDAAA  457



>ref|XP_003558959.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Brachypodium 
distachyon]
Length=463

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/461 (78%), Positives = 404/461 (88%), Gaps = 0/461 (0%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             A + K+VGILA++IYFPP C+ QE LE HDG SKGKYTIGLGQD MAFC+EVEDVISMSL
Sbjct  3     AERIKDVGILAMDIYFPPNCVLQEELETHDGVSKGKYTIGLGQDSMAFCTEVEDVISMSL  62

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             TAV SLLE Y++DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+CGNTDIEGVDS+NACY
Sbjct  63    TAVKSLLENYKIDPKTIGRLEVGSETVIDKSKSIKTWLMQIFEECGNTDIEGVDSSNACY  122

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAAL NCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FE
Sbjct  123   GGTAALLNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFE  182

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSV  1046
             SK RGSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY + C KYEKLEGK FS+
Sbjct  183   SKYRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYNTFCKKYEKLEGKQFSI  242

Query  1047  ADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDL  1226
              DAD FVFHSPYNKLVQKSFARL +NDFLRN S +++  +EKL P+S L+ +ESY +RDL
Sbjct  243   VDADSFVFHSPYNKLVQKSFARLYYNDFLRNCSIVDKDSREKLEPYSGLSSEESYQSRDL  302

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYG  1406
             EK  QQV+K  YD KVQP+TL+PKQ+GNMYTAS+YAAF S++HNKH TL GQR+VMFSYG
Sbjct  303   EKVCQQVAKHLYDTKVQPTTLIPKQLGNMYTASLYAAFASVLHNKHDTLAGQRIVMFSYG  362

Query  1407  SGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKD  1586
             SG T+TMFS +I +GQHPFSLSNI+ VL+I+ KL+SRH  PP+KFVE LK+MEHRYGAKD
Sbjct  363   SGLTSTMFSFKINKGQHPFSLSNISNVLDISNKLESRHVVPPKKFVEALKLMEHRYGAKD  422

Query  1587  FVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             FVTS+D SLL PGTYYLT VDS YRR+YA K     V+NGH
Sbjct  423   FVTSQDISLLVPGTYYLTHVDSMYRRYYAVKGDAVPVSNGH  463



>ref|XP_004957395.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Setaria italica]
Length=470

 Score =   770 bits (1989),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/468 (78%), Positives = 411/468 (88%), Gaps = 10/468 (2%)
 Frame = +3

Query  336   QKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAV  515
             +K+VGILA++IYFPP+C+QQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT V
Sbjct  3     RKDVGILAMDIYFPPSCVQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVV  62

Query  516   TSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGT  695
              SLL+KY+VDPK IGRLEVGSETVIDKSKSIKT+LMQIFE+ GNTDIEGVDS+NACYGGT
Sbjct  63    NSLLKKYKVDPKLIGRLEVGSETVIDKSKSIKTWLMQIFEESGNTDIEGVDSSNACYGGT  122

Query  696   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKL  875
             AAL NCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK 
Sbjct  123   AALLNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFESKY  182

Query  876   RGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADA  1055
             R SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C+KYEK+ GK FS++DA
Sbjct  183   RASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQFCNKYEKIVGKQFSISDA  242

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
             +YFVFHSPYNKLVQKSFARL +NDF+RN S I++  KEKL PFS+LTG+ESY +RDLEKA
Sbjct  243   EYFVFHSPYNKLVQKSFARLCYNDFMRNCSSIDDDAKEKLQPFSNLTGEESYQSRDLEKA  302

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGS  1415
             SQQV+K  YD KVQPSTL+PKQ+GNMYTAS+YAA  S+++NKH +L GQR+VMFSYGSG 
Sbjct  303   SQQVAKHLYDIKVQPSTLLPKQIGNMYTASLYAALASVLYNKHDSLDGQRIVMFSYGSGL  362

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             T+TMFSLR+  GQHPFSLSNIA+VL + EKL+SRHE  PEKF+E LK+MEHRYGAKDF T
Sbjct  363   TSTMFSLRLNNGQHPFSLSNIASVLGVTEKLQSRHETLPEKFIETLKLMEHRYGAKDFET  422

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAV----------ANGH  1709
             +KD SLL PGT+YLT VDS YRRFY +K  +             ANGH
Sbjct  423   NKDTSLLPPGTFYLTHVDSMYRRFYDQKPVEETAGGKAKCCNGFANGH  470



>ref|XP_011081052.1| PREDICTED: hydroxymethylglutaryl-CoA synthase isoform X4 [Sesamum 
indicum]
 ref|XP_011081053.1| PREDICTED: hydroxymethylglutaryl-CoA synthase isoform X4 [Sesamum 
indicum]
 ref|XP_011081054.1| PREDICTED: hydroxymethylglutaryl-CoA synthase isoform X4 [Sesamum 
indicum]
Length=417

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/417 (87%), Positives = 390/417 (94%), Gaps = 1/417 (0%)
 Frame = +3

Query  462   MAFCSEVEDVISMSLTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKC  641
             MAFC+EVEDVISMS+TAVTSLLEKY VDPKQIGRLEVGSETV+DKSKSIKTFLM IFEKC
Sbjct  1     MAFCAEVEDVISMSMTAVTSLLEKYGVDPKQIGRLEVGSETVLDKSKSIKTFLMPIFEKC  60

Query  642   GNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA  821
             GNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA
Sbjct  61    GNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA  120

Query  822   AIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKS  1001
             AIAML+GP+APIVFESKLRGSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYKS
Sbjct  121   AIAMLIGPNAPIVFESKLRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYKS  180

Query  1002  LCSKYEKLEGKSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAP  1181
              C+KYEKLEGK FSVADADYFVFHSPYNKLVQKSFARLLFNDF R+AS I+EA KEKLAP
Sbjct  181   FCAKYEKLEGKQFSVADADYFVFHSPYNKLVQKSFARLLFNDFTRSASSIDEAAKEKLAP  240

Query  1182  FSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNK  1361
             FSSL+ +ESY +RDLEKASQQV+KP YDAKVQPSTL+PKQVGNMYTAS+YAAF SL+HNK
Sbjct  241   FSSLSNEESYQSRDLEKASQQVAKPLYDAKVQPSTLIPKQVGNMYTASLYAAFASLLHNK  300

Query  1362  HSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKF  1541
             + TL GQRV++FSYGSG TATMFSLR  EGQHPFSLSNIA ++N++EKLKSRHEFPPEKF
Sbjct  301   NITLAGQRVILFSYGSGLTATMFSLRFNEGQHPFSLSNIATIMNVSEKLKSRHEFPPEKF  360

Query  1542  VEILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETK-AAVANGH  1709
             VE +++MEHRYG K FVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  +   +ANGH
Sbjct  361   VETMQLMEHRYGGKGFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKAIENGTLANGH  417



>ref|NP_001063706.1| Os09g0521400 [Oryza sativa Japonica Group]
 dbj|BAD46696.1| putative hydroxymethylglutaryl coenzyme A synthase [Oryza sativa 
Japonica Group]
 dbj|BAF25620.1| Os09g0521400 [Oryza sativa Japonica Group]
 gb|EEE62622.1| hypothetical protein OsJ_17425 [Oryza sativa Japonica Group]
Length=476

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/464 (78%), Positives = 408/464 (88%), Gaps = 6/464 (1%)
 Frame = +3

Query  336   QKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAV  515
             +K+VGILA++IYFPPTC+ QE+LEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS+T V
Sbjct  4     RKDVGILAMDIYFPPTCVLQESLEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSMTVV  63

Query  516   TSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGT  695
             TSLL+KY+VDPK IGRLEVGSETVIDKSKSIKT+LMQIFE+CGNTDIEGVDS+NACYGGT
Sbjct  64    TSLLKKYKVDPKLIGRLEVGSETVIDKSKSIKTWLMQIFEECGNTDIEGVDSSNACYGGT  123

Query  696   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKL  875
             AAL NCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK 
Sbjct  124   AALLNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPIAFESKY  183

Query  876   RGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADA  1055
             + SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C KYEKL GK FS++DA
Sbjct  184   KASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQFCKKYEKLAGKQFSISDA  243

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
             DYFVFHSPYNKLVQKSFARL +NDF R+ S ++   KEKL PFS+LTG+ESY +RDLEKA
Sbjct  244   DYFVFHSPYNKLVQKSFARLYYNDFTRDCSSVDNDAKEKLQPFSNLTGEESYQSRDLEKA  303

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGS  1415
             SQQV+KP YD KVQPSTL+PKQ+GNMYTAS+YAA  S+++NKH++L  QR+VMFSYGSG 
Sbjct  304   SQQVAKPLYDIKVQPSTLLPKQIGNMYTASLYAALASVLYNKHASLDDQRIVMFSYGSGL  363

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             T+TMFSL++  GQ PFSLSNIA+VLN  EKL+SRH   PEKFVE LK+MEHRYGAKDF T
Sbjct  364   TSTMFSLKLNNGQDPFSLSNIASVLNATEKLESRHMTLPEKFVETLKLMEHRYGAKDFET  423

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKK------ETKAAVANGH  1709
              KD SLL PGT+YLT VDS YRRFY +K        KA  +NGH
Sbjct  424   CKDTSLLPPGTFYLTRVDSMYRRFYERKADEEIAAAKAKYSNGH  467



>ref|XP_008670331.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Zea mays]
 tpg|DAA40580.1| TPA: putative hydroxymethylglutaryl-CoA synthase family protein 
[Zea mays]
Length=470

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/468 (78%), Positives = 415/468 (89%), Gaps = 10/468 (2%)
 Frame = +3

Query  336   QKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAV  515
             +K+VGILA++IYFPP+C+QQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT V
Sbjct  3     RKDVGILAMDIYFPPSCVQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVV  62

Query  516   TSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGT  695
              SLL+KY++DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+ GN+DIEGVDS+NACYGGT
Sbjct  63    NSLLKKYKIDPKLIGRLEVGSETVIDKSKSIKTWLMQIFEESGNSDIEGVDSSNACYGGT  122

Query  696   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKL  875
             AAL NCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK 
Sbjct  123   AALLNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFESKY  182

Query  876   RGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADA  1055
             R SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C+KYEK+ GK FS+ DA
Sbjct  183   RASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQFCNKYEKIAGKQFSICDA  242

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
             +YFVFHSPYNKLVQKSFARL +NDFLRN S +++  KEKL  FS+LTG+ESY +RDLEKA
Sbjct  243   EYFVFHSPYNKLVQKSFARLYYNDFLRNCSSVDDDAKEKLQSFSNLTGEESYQSRDLEKA  302

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGS  1415
             SQQV+K  +D KVQPSTL+PKQ+GNMYTAS+YAA  S+++NKH +L GQR+VMFSYGSG 
Sbjct  303   SQQVAKHLHDIKVQPSTLLPKQIGNMYTASLYAALASVLYNKHDSLNGQRIVMFSYGSGL  362

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             T+TMFSLR+  GQHPFSLSNIA+VL++ EKL+SRHE  PEKFVE LK+MEHRYGAKDF T
Sbjct  363   TSTMFSLRLNNGQHPFSLSNIASVLDVTEKLQSRHETLPEKFVETLKLMEHRYGAKDFET  422

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKK--------ETKA--AVANGH  1709
             S+D SLL PGT+YLT+VDS YRRFY++K        +TK    +ANGH
Sbjct  423   SRDTSLLQPGTFYLTKVDSMYRRFYSQKLSEETGGGKTKCCNGLANGH  470



>ref|XP_002468628.1| hypothetical protein SORBIDRAFT_01g049310 [Sorghum bicolor]
 gb|EER95626.1| hypothetical protein SORBIDRAFT_01g049310 [Sorghum bicolor]
Length=464

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/464 (77%), Positives = 405/464 (87%), Gaps = 2/464 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MAS+ KNVGILA++IYFPP C+ QE LE HDG SKGKYTIGLGQ+ MAFC+EVEDVISMS
Sbjct  1     MASEAKNVGILAMDIYFPPNCVLQEELETHDGVSKGKYTIGLGQESMAFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V SLL+ Y +DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+ GNTDIEGVDS+NAC
Sbjct  61    LTVVKSLLKNYNIDPKCIGRLEVGSETVIDKSKSIKTWLMQIFEESGNTDIEGVDSSNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API F
Sbjct  121   YGGTAALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY   C KYEK EGK FS
Sbjct  181   ESKYRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYNVFCKKYEKNEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DADY VFHSPYNKLVQKSFARL +NDFLRN S ++E  +EKLAP++ L+ +ESY +RD
Sbjct  241   IFDADYVVFHSPYNKLVQKSFARLYYNDFLRNCSTVDEESREKLAPYAGLSSEESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+K  YD+KVQP+TL+PKQVGNMYTAS+YAA  S+IHN+H TL GQR+VMFSY
Sbjct  301   LEKASQQVAKNLYDSKVQPTTLIPKQVGNMYTASLYAALASIIHNRHETLAGQRIVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG T+TMFS +I EGQHPFSL NIA ++++++KLK+RH  PP+KFVE LK+MEHRYGAK
Sbjct  361   GSGLTSTMFSFKINEGQHPFSLLNIANIMDVSKKLKARHVVPPKKFVETLKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK--ETKAAVANGH  1709
             DFVTS+D SLL+ GTYYLT VDS YRRFY  K      A++NGH
Sbjct  421   DFVTSQDTSLLSAGTYYLTHVDSMYRRFYDVKGDSVTTAISNGH  464



>gb|EAZ25374.1| hypothetical protein OsJ_09191 [Oryza sativa Japonica Group]
Length=463

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/463 (77%), Positives = 407/463 (88%), Gaps = 1/463 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MA+++K+VGILA++IYFPPTC+ Q+ LE HDG SKGKYTIGLGQD MAFC+EVEDVISMS
Sbjct  1     MAAERKDVGILAMDIYFPPTCVLQDELENHDGVSKGKYTIGLGQDSMAFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V SLLE Y++DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+CGNTDIEGVDS+NAC
Sbjct  61    LTVVKSLLENYKIDPKCIGRLEVGSETVIDKSKSIKTWLMQIFEECGNTDIEGVDSSNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+AP+ F
Sbjct  121   YGGTAALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPVSF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY   C KYEKLEGK FS
Sbjct  181   ESKYRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYNVFCKKYEKLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DADYFVFHSPYNKLVQKSFARL +NDFLR  S + +  +EKL P+S L+ +ESY +R+
Sbjct  241   IHDADYFVFHSPYNKLVQKSFARLYYNDFLRKCSTVEDGSREKLEPYSGLSSEESYQSRE  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+K  YD+KVQP+TL+PKQVGNMYTAS+YAA  S++HNK+ TL GQR+VMFSY
Sbjct  301   LEKASQQVAKHLYDSKVQPTTLIPKQVGNMYTASLYAALASVMHNKNETLAGQRIVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG T+TMFS +I EGQHPF LSNIA +L++++KL+SRH   PEKFV  LK+MEHRYGAK
Sbjct  361   GSGLTSTMFSFKINEGQHPFILSNIAGILDVSKKLESRHVVAPEKFVAALKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYA-KKETKAAVANGH  1709
             DF TS+D SLLAPGTYYLT VDS YRRFYA K +    V+NGH
Sbjct  421   DFTTSQDTSLLAPGTYYLTHVDSMYRRFYAVKGQAVTEVSNGH  463



>ref|XP_006660857.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Oryza brachyantha]
Length=475

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/464 (78%), Positives = 409/464 (88%), Gaps = 6/464 (1%)
 Frame = +3

Query  336   QKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAV  515
             + NVGILA++IYFPPTC+ QEALEAHDGAS+GKYTIGLGQDCMAFCSEVEDVISMS+T V
Sbjct  4     RDNVGILAMDIYFPPTCVLQEALEAHDGASRGKYTIGLGQDCMAFCSEVEDVISMSMTVV  63

Query  516   TSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGT  695
             TSLL+KY+VDPK IGRLEVGSETVIDKSKSIKT+LMQIFE+CGNTDIEGVDS+NACYGGT
Sbjct  64    TSLLKKYKVDPKLIGRLEVGSETVIDKSKSIKTWLMQIFEECGNTDIEGVDSSNACYGGT  123

Query  696   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKL  875
             AAL NCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+AP+ FESK 
Sbjct  124   AALLNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPLSFESKY  183

Query  876   RGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADA  1055
             + SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C KYEKL GK FS++DA
Sbjct  184   KASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQFCKKYEKLAGKQFSISDA  243

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
             DYFVFHSPYNKLVQKSFARL +NDF+R+ S ++   KEKL PFS+LTG+ESY +RDLEKA
Sbjct  244   DYFVFHSPYNKLVQKSFARLYYNDFMRDCSSVDNDAKEKLQPFSNLTGEESYQSRDLEKA  303

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGS  1415
             SQQV+K  YD KVQPSTL+PKQ+GNMYTAS+YAA  S++++KH +L GQR+VMFSYGSG 
Sbjct  304   SQQVAKHLYDIKVQPSTLLPKQIGNMYTASLYAALASVVYDKHGSLDGQRIVMFSYGSGL  363

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             T+TMFSL++  G+ PFSLSNIA+VLN+ EKL+SRH   PEKFVE LK+MEHRYGAKDF T
Sbjct  364   TSTMFSLKLNNGESPFSLSNIASVLNVTEKLESRHVTLPEKFVETLKLMEHRYGAKDFET  423

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKKET------KAAVANGH  1709
             +KD SLL PGT+YLT VDS YRRFY KK        KA  +NGH
Sbjct  424   NKDTSLLPPGTFYLTRVDSMYRRFYDKKAEEEIAAGKAKYSNGH  467



>ref|NP_001048774.1| Os03g0118800 [Oryza sativa Japonica Group]
 gb|AAO15287.1| Putative hydroxymethylglutaryl coenzyme A synthase [Oryza sativa 
Japonica Group]
 gb|ABF93673.1| Hydroxymethylglutaryl-CoA synthase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10688.1| Os03g0118800 [Oryza sativa Japonica Group]
Length=463

 Score =   766 bits (1977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/463 (77%), Positives = 406/463 (88%), Gaps = 1/463 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MA+++K+VGILA++IYFPPTC+ Q+ LE HDG SKGKYTIGLGQD MAFC+EVEDVISMS
Sbjct  1     MAAERKDVGILAMDIYFPPTCVLQDELENHDGVSKGKYTIGLGQDSMAFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V SLLE Y++DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+CGNTDIEGVDS+NAC
Sbjct  61    LTVVKSLLENYKIDPKCIGRLEVGSETVIDKSKSIKTWLMQIFEECGNTDIEGVDSSNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+AP+ F
Sbjct  121   YGGTAALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPVSF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY   C KYEKLEGK FS
Sbjct  181   ESKYRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYNVFCKKYEKLEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DADYFVFHSPYNKLVQKSFARL +NDFLR  S + +  +EKL P+S L+ +ESY +R+
Sbjct  241   IHDADYFVFHSPYNKLVQKSFARLYYNDFLRKCSTVEDGSREKLEPYSGLSSEESYQSRE  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+K  YD+KVQP TL+PKQVGNMYTAS+YAA  S++HNK+ TL GQR+VMFSY
Sbjct  301   LEKASQQVAKHLYDSKVQPITLIPKQVGNMYTASLYAALASVMHNKNETLAGQRIVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG T+TMFS +I EGQHPF LSNIA +L++++KL+SRH   PEKFV  LK+MEHRYGAK
Sbjct  361   GSGLTSTMFSFKINEGQHPFILSNIAGILDVSKKLESRHVVAPEKFVAALKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYA-KKETKAAVANGH  1709
             DF TS+D SLLAPGTYYLT VDS YRRFYA K +    V+NGH
Sbjct  421   DFTTSQDTSLLAPGTYYLTHVDSMYRRFYAVKGQAVTEVSNGH  463



>ref|XP_009395343.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Musa acuminata 
subsp. malaccensis]
Length=474

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/457 (77%), Positives = 410/457 (90%), Gaps = 0/457 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             M   + +VGILA++IYFPPTC+QQEALE +DGASKGKYTIGLGQDCMAFC+++EDVISMS
Sbjct  1     MEPGRMDVGILAMDIYFPPTCVQQEALEDYDGASKGKYTIGLGQDCMAFCTDLEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V SLLEKY++DP+QIGRLEVGSETVIDKSKSIKT+LMQ+FE+  NTD+EGVDSTNAC
Sbjct  61    LTVVLSLLEKYQIDPRQIGRLEVGSETVIDKSKSIKTWLMQVFEEYDNTDVEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API F
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RG+HMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C K+EK+EGK FS
Sbjct  181   ESKFRGTHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKRFCGKFEKIEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             ++DA+YFVFHSPYNKLVQKSFARL+FNDFL   S + + ++E L PFS++ G+ESY +R+
Sbjct  241   ISDANYFVFHSPYNKLVQKSFARLVFNDFLHCPSNLQKEERENLEPFSNMNGEESYQSRE  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK SQQV+KPFY+ KVQPSTL+PKQ+GN YTAS+YAA  S+++NKH TL GQR+VMFSY
Sbjct  301   LEKVSQQVAKPFYNVKVQPSTLLPKQIGNTYTASLYAALASVVYNKHDTLMGQRIVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG T+TMFS ++ +GQHPFSLSNIA++LN++EKLKSRH F PEKF E LK+MEHRYGAK
Sbjct  361   GSGLTSTMFSFKLHDGQHPFSLSNIASILNLSEKLKSRHVFSPEKFAETLKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAA  1694
             DF TSKD SLL+PGT+YLT+VDS YRR YAKK ++ A
Sbjct  421   DFETSKDTSLLSPGTFYLTKVDSMYRRCYAKKGSEDA  457



>ref|NP_001140749.1| uncharacterized protein LOC100272824 [Zea mays]
 gb|ACF79046.1| unknown [Zea mays]
 gb|ACF84536.1| unknown [Zea mays]
Length=470

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/468 (77%), Positives = 411/468 (88%), Gaps = 10/468 (2%)
 Frame = +3

Query  336   QKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAV  515
             +K+VGILA++IYFPP+C+QQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT V
Sbjct  3     RKDVGILAMDIYFPPSCVQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVV  62

Query  516   TSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGT  695
              SLL+KY++DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+  NTDIEGVDS+NACYGGT
Sbjct  63    NSLLKKYKIDPKLIGRLEVGSETVIDKSKSIKTWLMQIFEESDNTDIEGVDSSNACYGGT  122

Query  696   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKL  875
             AAL NCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK 
Sbjct  123   AALLNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFESKY  182

Query  876   RGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADA  1055
             R SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C+KYEK+ GK FS++DA
Sbjct  183   RASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQFCNKYEKIAGKQFSISDA  242

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
             +YFVFHSPYNKLVQKSFARL +NDF+RN SY+++  KEKL  FS+LTG+ESY +RDLEKA
Sbjct  243   EYFVFHSPYNKLVQKSFARLYYNDFMRNCSYVDDDAKEKLQSFSNLTGEESYQSRDLEKA  302

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGS  1415
             SQQV+K  Y  KVQP+TL+PKQ+GNMYTAS+YAA  S+++NKH +L GQR+VMFSYGSG 
Sbjct  303   SQQVAKHLYGIKVQPTTLLPKQIGNMYTASLYAALASVLYNKHDSLNGQRIVMFSYGSGL  362

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             T+TMFSLR+  GQHPFSLSNI +VL + EKL+SRHE  PEKFVE LK+MEHRYGAKDF T
Sbjct  363   TSTMFSLRLNNGQHPFSLSNIGSVLGVTEKLQSRHETLPEKFVETLKLMEHRYGAKDFET  422

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKK--------ETKA--AVANGH  1709
             S D SLL PGT+YLT+VDS YRRFY++K        +TK     ANGH
Sbjct  423   SSDTSLLQPGTFYLTKVDSMYRRFYSQKPAEEIGGGKTKCCNGFANGH  470



>gb|ACG33137.1| hydroxymethylglutaryl-CoA synthase [Zea mays]
Length=470

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/468 (77%), Positives = 411/468 (88%), Gaps = 10/468 (2%)
 Frame = +3

Query  336   QKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAV  515
             +K+VGILA++IYFPP+C+QQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT V
Sbjct  3     RKDVGILAMDIYFPPSCVQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVV  62

Query  516   TSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGT  695
              SLL+KY++DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+  NTDIEGVDS+NACYGGT
Sbjct  63    NSLLKKYKIDPKLIGRLEVGSETVIDKSKSIKTWLMQIFEESDNTDIEGVDSSNACYGGT  122

Query  696   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKL  875
             AAL NCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK 
Sbjct  123   AALLNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFESKY  182

Query  876   RGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADA  1055
             R SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C+KYEK+ GK FS++DA
Sbjct  183   RASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQFCNKYEKIAGKQFSISDA  242

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
             +YFVFHSPYNKLVQKSFARL +NDF+RN SY+++  KEKL  FS+LTG+ESY +RDLEKA
Sbjct  243   EYFVFHSPYNKLVQKSFARLYYNDFMRNCSYVDDDAKEKLQSFSNLTGEESYQSRDLEKA  302

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGS  1415
             SQQV+K  Y  KVQP+TL+PKQ+GNMYTAS+YAA  S+++NKH +L GQR+VMFSYGSG 
Sbjct  303   SQQVAKHLYGIKVQPTTLLPKQIGNMYTASLYAALASVLYNKHDSLNGQRIVMFSYGSGL  362

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             T+TMFSLR+  GQHPFSLSNI +VL + EKL+SRHE  PEKFVE LK+MEHRYGAKDF T
Sbjct  363   TSTMFSLRLNNGQHPFSLSNIGSVLGVTEKLQSRHETLPEKFVETLKLMEHRYGAKDFET  422

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKK--------ETKA--AVANGH  1709
             S D SLL PGT+YLT+VDS YRRFY++K        +TK     ANGH
Sbjct  423   SSDTSLLQPGTFYLTKVDSMYRRFYSQKPAEETGGGKTKCCNGFANGH  470



>ref|NP_001170696.1| uncharacterized protein LOC100384769 [Zea mays]
 gb|ACR34540.1| unknown [Zea mays]
 tpg|DAA42966.1| TPA: putative hydroxymethylglutaryl-CoA synthase family protein 
[Zea mays]
Length=465

 Score =   763 bits (1970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/465 (77%), Positives = 408/465 (88%), Gaps = 3/465 (1%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MAS+ K+VGILA++IYFPP+C+ QE LE HDG SKGKYTIGLGQ+ MAFC+EVEDVISMS
Sbjct  1     MASEAKDVGILAMDIYFPPSCVLQEELETHDGVSKGKYTIGLGQENMAFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V SLL+ Y +DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+ GNTDIEGVDS+NAC
Sbjct  61    LTVVKSLLKNYNIDPKCIGRLEVGSETVIDKSKSIKTWLMQIFEESGNTDIEGVDSSNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API F
Sbjct  121   YGGTAALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY   C KYEK EGK FS
Sbjct  181   ESKYRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYNVFCKKYEKHEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DADY VFHSPYNKLVQKSFARL +NDFLRN S ++E  +EKLAP++ L+ +ESY +RD
Sbjct  241   IFDADYVVFHSPYNKLVQKSFARLYYNDFLRNCSTVDEESREKLAPYAGLSSEESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+K  Y++KVQP+TL+PKQVGNMYTAS+YAA  S+IHN+H TL GQR+VMFSY
Sbjct  301   LEKASQQVAKNLYESKVQPTTLIPKQVGNMYTASLYAALASVIHNRHETLAGQRIVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG T+TMFS +I EG HPFSL NIA ++++++KLK+RH  PP+KF+E+LK+MEHRYGAK
Sbjct  361   GSGLTSTMFSFKINEGHHPFSLLNIANIMDVSKKLKARHVVPPKKFIEVLKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE---TKAAVANGH  1709
             DFVTS+D SLL+ GTYYLT VDSKYRRFY  K    T  A++NGH
Sbjct  421   DFVTSQDTSLLSVGTYYLTHVDSKYRRFYDVKGDGVTTTAMSNGH  465



>ref|XP_010919197.1| PREDICTED: hydroxymethylglutaryl-CoA synthase isoform X1 [Elaeis 
guineensis]
Length=470

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/470 (76%), Positives = 408/470 (87%), Gaps = 8/470 (2%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             M  ++K+ GILA++IYFP TC+QQE LE + G S+GKYTIGLGQDCMAFC+E+EDV+SMS
Sbjct  1     MDGEKKSAGILAMDIYFPSTCVQQEELEVYYGVSRGKYTIGLGQDCMAFCTELEDVVSMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V SLLEKY++DP+QIGRLEVG+ET+IDKSKSIKT+LMQIFE+ GN+DIEGVDSTNAC
Sbjct  61    LTVVKSLLEKYQIDPRQIGRLEVGTETIIDKSKSIKTWLMQIFEEYGNSDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API F
Sbjct  121   YGGTAALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RG+HM+H YDFYKP L SEYPVVDGKLSQ CYLMALDSCYK  C+K E  EGK FS
Sbjct  181   ESKFRGTHMSHAYDFYKPNLASEYPVVDGKLSQICYLMALDSCYKHFCNKNENFEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DADYFVFHSPYNKLVQKSFARL FNDFLRN+S I EA +EKL PF +L+GDESY +R+
Sbjct  241   IFDADYFVFHSPYNKLVQKSFARLYFNDFLRNSSCIEEAAREKLEPFLNLSGDESYQSRE  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+K  YDAKVQPSTL+PKQVGNMYTAS+YA+F SL+HNKHSTL GQRVVMFSY
Sbjct  301   LEKASQQVAKHLYDAKVQPSTLIPKQVGNMYTASLYASFASLLHNKHSTLGGQRVVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG ++TMFS +I++GQHPFSLSNI  V+NI++KL+ RH FP EKF E +K+ME RYGAK
Sbjct  361   GSGLSSTMFSFKIQDGQHPFSLSNIVNVMNISQKLELRHVFPTEKFAETMKLMERRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK--------ETKAAVANGH  1709
             DFVTSKD SLL PGT+YLT+VDS YRR+YAKK            +  NGH
Sbjct  421   DFVTSKDTSLLYPGTFYLTQVDSLYRRYYAKKGADDTTVIHANRSFVNGH  470



>ref|XP_004985955.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like isoform X1 
[Setaria italica]
 ref|XP_004985956.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like isoform X2 
[Setaria italica]
Length=464

 Score =   762 bits (1967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/464 (77%), Positives = 407/464 (88%), Gaps = 2/464 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MAS+ K+VGILA++IYFPPTC+ QE LE HDG SKGKYTIGLGQD MAFC++VEDVISMS
Sbjct  1     MASEAKDVGILAMDIYFPPTCVLQEELETHDGVSKGKYTIGLGQDSMAFCTDVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V SLL+ Y +DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+ GNTDIEGVDS+NAC
Sbjct  61    LTVVKSLLKNYNIDPKCIGRLEVGSETVIDKSKSIKTWLMQIFEEYGNTDIEGVDSSNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API F
Sbjct  121   YGGTAALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHMAH YDFYKP L SEYPVVDGKLSQTCYLMALDSCY   C KYEK EGK FS
Sbjct  181   ESKYRGSHMAHAYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYNVFCKKYEKHEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DADY VFHSPYNKLVQKSFARL +NDFLRN S ++E  +EKLAP++ L+ +ESY +RD
Sbjct  241   IFDADYVVFHSPYNKLVQKSFARLCYNDFLRNCSTVDEESREKLAPYAGLSSEESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+K  Y++KVQP+TL+PKQVGNMYTAS+YAAF S+I+N+H TL GQR+VMFSY
Sbjct  301   LEKASQQVAKNLYESKVQPTTLIPKQVGNMYTASLYAAFASVIYNRHETLAGQRIVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG T+TMFS +I EG+HPFSL NIA VL++++KL++RH  PP+KFVE LK+MEHRYGAK
Sbjct  361   GSGLTSTMFSFKINEGEHPFSLLNIANVLDVSKKLEARHVVPPKKFVEALKLMEHRYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE--TKAAVANGH  1709
             DFVTS+D SLL  GTYYLT VDS YRRFYA K+     AV+NGH
Sbjct  421   DFVTSQDTSLLPAGTYYLTHVDSMYRRFYAAKDDGVTTAVSNGH  464



>ref|XP_003574875.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Brachypodium 
distachyon]
Length=467

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/464 (77%), Positives = 407/464 (88%), Gaps = 7/464 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT V 
Sbjct  4     KDVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVVK  63

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+ GNTDIEGVDS+NACYGGTA
Sbjct  64    SLLEKYHIDPKLIGRLEVGSETVIDKSKSIKTWLMQIFEESGNTDIEGVDSSNACYGGTA  123

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES  WDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK R
Sbjct  124   ALLNCVNWVESKCWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFESKYR  183

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C+KYEKL G+ FS++DAD
Sbjct  184   ASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQYCAKYEKLVGEQFSLSDAD  243

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             Y VFHSPYNKLVQKSFARL FNDF+RN S ++   KEKL PF++LT +ESY NRDLEK S
Sbjct  244   YCVFHSPYNKLVQKSFARLYFNDFMRNCSSVDNDAKEKLQPFANLTSEESYQNRDLEKGS  303

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K  YD KVQPSTL+PKQ+GNMYTAS+YAA  S+++NKH++L GQR+VMFSYGSG T
Sbjct  304   QQLAKHLYDIKVQPSTLLPKQIGNMYTASLYAALASVLYNKHASLSGQRIVMFSYGSGLT  363

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             +TMFS R+ EGQHPFSL+NIA+VL++  KL+SRH   PEKF+  LK+MEHRYGAKDF T+
Sbjct  364   STMFSFRLNEGQHPFSLTNIASVLDVTAKLESRHVTSPEKFIATLKLMEHRYGAKDFETN  423

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKK-----ETKAA--VANGH  1709
             KD +LL PGT+YLT+VDS YRRFY KK     +TK +  +ANGH
Sbjct  424   KDTALLPPGTFYLTKVDSMYRRFYEKKAAADDKTKCSNGIANGH  467



>ref|XP_002445758.1| hypothetical protein SORBIDRAFT_07g025240 [Sorghum bicolor]
 gb|EES15253.1| hypothetical protein SORBIDRAFT_07g025240 [Sorghum bicolor]
Length=471

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/453 (78%), Positives = 401/453 (89%), Gaps = 0/453 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDV+SMSLT V 
Sbjct  5     KDVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVVSMSLTVVA  64

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLL+KY +DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+ GNTDIEGVDS+NACYGGTA
Sbjct  65    SLLQKYNIDPKLIGRLEVGSETVIDKSKSIKTWLMQIFEESGNTDIEGVDSSNACYGGTA  124

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FE K +
Sbjct  125   ALLNCVNWVESKSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFERKYK  184

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHMAH YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+KYEKL G+ FS++DAD
Sbjct  185   ASHMAHAYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYKQFCTKYEKLVGEQFSISDAD  244

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             Y VFHSPYNKLVQKSFARL FNDF+RN S ++   KEKL PF++L  +ESY +RDLEKAS
Sbjct  245   YCVFHSPYNKLVQKSFARLFFNDFMRNCSSVDNDAKEKLLPFANLNSEESYQSRDLEKAS  304

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+K  YD KVQPSTL+PKQ+GNMYTAS+YAA  S+++NKH++L GQR++MFSYGSG T
Sbjct  305   QQVAKHLYDIKVQPSTLLPKQIGNMYTASLYAALASVVYNKHNSLAGQRIIMFSYGSGLT  364

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             +T+FSLR+ EGQHPFSL+NIA++L++  KL SRH  PPEKFVE LK+MEHRYGAKDF TS
Sbjct  365   STLFSLRLHEGQHPFSLANIASMLDVTAKLNSRHVTPPEKFVETLKLMEHRYGAKDFETS  424

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAV  1697
             +D SLL PGT+YLT+VDS YRRFY KK +   V
Sbjct  425   QDTSLLPPGTFYLTKVDSMYRRFYDKKASDDIV  457



>ref|XP_008646617.1| PREDICTED: uncharacterized protein LOC100384769 isoform X1 [Zea 
mays]
Length=466

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/466 (76%), Positives = 409/466 (88%), Gaps = 4/466 (1%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MAS+ K+VGILA++IYFPP+C+ QE LE HDG SKGKYTIGLGQ+ MAFC+EVEDVISMS
Sbjct  1     MASEAKDVGILAMDIYFPPSCVLQEELETHDGVSKGKYTIGLGQENMAFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V SLL+ Y +DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+ GNTDIEGVDS+NAC
Sbjct  61    LTVVKSLLKNYNIDPKCIGRLEVGSETVIDKSKSIKTWLMQIFEESGNTDIEGVDSSNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API F
Sbjct  121   YGGTAALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY   C KYEK EGK FS
Sbjct  181   ESKYRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYNVFCKKYEKHEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRN-ASYINEADKEKLAPFSSLTGDESYSNR  1220
             + DADY VFHSPYNKLVQKSFARL +NDFLRN +S ++E  +EKLAP++ L+ +ESY +R
Sbjct  241   IFDADYVVFHSPYNKLVQKSFARLYYNDFLRNCSSTVDEESREKLAPYAGLSSEESYQSR  300

Query  1221  DLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFS  1400
             DLEKASQQV+K  Y++KVQP+TL+PKQVGNMYTAS+YAA  S+IHN+H TL GQR+VMFS
Sbjct  301   DLEKASQQVAKNLYESKVQPTTLIPKQVGNMYTASLYAALASVIHNRHETLAGQRIVMFS  360

Query  1401  YGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGA  1580
             YGSG T+TMFS +I EG HPFSL NIA ++++++KLK+RH  PP+KF+E+LK+MEHRYGA
Sbjct  361   YGSGLTSTMFSFKINEGHHPFSLLNIANIMDVSKKLKARHVVPPKKFIEVLKLMEHRYGA  420

Query  1581  KDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE---TKAAVANGH  1709
             KDFVTS+D SLL+ GTYYLT VDSKYRRFY  K    T  A++NGH
Sbjct  421   KDFVTSQDTSLLSVGTYYLTHVDSKYRRFYDVKGDGVTTTAMSNGH  466



>ref|XP_006649284.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Oryza brachyantha]
Length=463

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/460 (77%), Positives = 405/460 (88%), Gaps = 1/460 (0%)
 Frame = +3

Query  330   SQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT  509
             +++K+VGILA++IYFPPTC+ Q+ LE HDG SKGKYTIGLGQD MAFC+EVEDVISMSLT
Sbjct  5     TERKDVGILAMDIYFPPTCVLQDELETHDGVSKGKYTIGLGQDSMAFCTEVEDVISMSLT  64

Query  510   AVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYG  689
              V SLLE Y++DP  IGRLEVGSETVIDKSKSIKT+LMQIFE+CGNTDIEGVDS+NACYG
Sbjct  65    VVKSLLENYKIDPTCIGRLEVGSETVIDKSKSIKTWLMQIFEECGNTDIEGVDSSNACYG  124

Query  690   GTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFES  869
             GTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FES
Sbjct  125   GTAALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPICFES  184

Query  870   KLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVA  1049
             K RGSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY   C KYEK EGK FSV 
Sbjct  185   KYRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYNVFCKKYEKFEGKQFSVH  244

Query  1050  DADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLE  1229
             DA+YFVFHSPYNKLVQKSFARL +NDFLR  S ++E+ +EKL  +S L+ +ESY +R+LE
Sbjct  245   DAEYFVFHSPYNKLVQKSFARLYYNDFLRKCSTVDESSREKLETYSGLSSEESYQSRELE  304

Query  1230  KASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGS  1409
             KASQQV+K  YD+KVQP+TL+PKQ+GNMYTAS+YAA  S+IHNK+ TL GQR+VMFSYGS
Sbjct  305   KASQQVAKKLYDSKVQPTTLIPKQLGNMYTASLYAALASVIHNKNETLAGQRIVMFSYGS  364

Query  1410  GSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDF  1589
             G T+TMFS +I EGQHPFSL+NI ++L++++KL+SRH   PEKFV  LK+MEHRYGAKDF
Sbjct  365   GLTSTMFSFKINEGQHPFSLANIVSILDVSKKLESRHVVAPEKFVAALKLMEHRYGAKDF  424

Query  1590  VTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
              TS+D SLLAPGTYYLT VD+ YRRFYA K    A++NGH
Sbjct  425   TTSQDTSLLAPGTYYLTHVDAMYRRFYAVKGA-TALSNGH  463



>ref|NP_001062410.1| Os08g0544900 [Oryza sativa Japonica Group]
 dbj|BAD09733.1| putative hydroxymethylglutaryl coenzyme A synthase [Oryza sativa 
Japonica Group]
 dbj|BAF24324.1| Os08g0544900 [Oryza sativa Japonica Group]
 dbj|BAG95783.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69095.1| hypothetical protein OsJ_28159 [Oryza sativa Japonica Group]
Length=467

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/465 (77%), Positives = 404/465 (87%), Gaps = 6/465 (1%)
 Frame = +3

Query  333   QQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTA  512
             Q  +VGILA++IYFPP C+ QEALEAHDGASKGKYTIGLGQDCMA+CSEVEDVISMSLT 
Sbjct  3     QPNDVGILAMDIYFPPACVHQEALEAHDGASKGKYTIGLGQDCMAYCSEVEDVISMSLTV  62

Query  513   VTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGG  692
             V SLL+KY +DPKQIGRLEVGSETVIDKSKSIKT+LM IFE+ GNTDIEGVDS+NACYGG
Sbjct  63    VASLLKKYNIDPKQIGRLEVGSETVIDKSKSIKTWLMHIFEESGNTDIEGVDSSNACYGG  122

Query  693   TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESK  872
             TAAL NCVNWVES SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK
Sbjct  123   TAALLNCVNWVESKSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFESK  182

Query  873   LRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVAD  1052
              R SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C+KYEK+ G+ FS++D
Sbjct  183   YRASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQYCTKYEKIVGEQFSISD  242

Query  1053  ADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEK  1232
             A+Y VFHSPYNKLVQKSFARL FNDF+RN S ++   KEKL PF++LT +ESY +RDLEK
Sbjct  243   AEYCVFHSPYNKLVQKSFARLYFNDFMRNCSTVDNDAKEKLQPFANLTSEESYQSRDLEK  302

Query  1233  ASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSG  1412
             ASQQV+K  YD KVQPSTL+PKQ+GNMYTAS+YAA  S+I+NKH +L GQR++MFSYGSG
Sbjct  303   ASQQVAKHLYDIKVQPSTLLPKQIGNMYTASLYAALASVIYNKHDSLDGQRILMFSYGSG  362

Query  1413  STATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFV  1592
              T+TMFSLR+ +GQHPFSL NIA+VL++  KL+SRH   PEKF+E LK+MEHRYGAKDF 
Sbjct  363   LTSTMFSLRLHDGQHPFSLMNIASVLDVTTKLESRHVTSPEKFIETLKLMEHRYGAKDFE  422

Query  1593  TSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKA------AVANGH  1709
             TSKD SLL PGT+YLT+VDS YRRFY KK  +        +ANGH
Sbjct  423   TSKDTSLLPPGTFYLTKVDSMYRRFYDKKAAEGKIKGCNGIANGH  467



>gb|ACG33328.1| hydroxymethylglutaryl-CoA synthase [Zea mays]
Length=464

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/464 (77%), Positives = 402/464 (87%), Gaps = 2/464 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MAS+ K+VGILA++IYFPP C+ QE LE HDG SKGKYTIGLGQ+ MAFC+EVEDVISMS
Sbjct  1     MASEAKDVGILAMDIYFPPNCVLQEELETHDGVSKGKYTIGLGQESMAFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAV SLL+ Y +DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+ GNTDIEGVDS+NAC
Sbjct  61    LTAVKSLLKNYNIDPKCIGRLEVGSETVIDKSKSIKTWLMQIFEESGNTDIEGVDSSNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API F
Sbjct  121   YGGTAALFNCVNWVESKSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPICF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY   C KYEK EGK FS
Sbjct  181   ESKYRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYNLFCKKYEKHEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             ++DADY VFHSPYNKLVQKSFARL +NDFLRN S ++   +EKLAP++ L+ +ESY +RD
Sbjct  241   ISDADYVVFHSPYNKLVQKSFARLYYNDFLRNCSTVDGESREKLAPYAGLSSEESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+K  Y++KVQP+TL+PKQVGNMYTAS+YAA  S++H++H TL GQR+VMFSY
Sbjct  301   LEKASQQVAKNLYESKVQPTTLIPKQVGNMYTASLYAALASVVHSRHETLAGQRIVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG T+TMFS  I EG HPFSL NIA +L+I++KLK+RH  PPEKFVE LK+MEHRYGA+
Sbjct  361   GSGLTSTMFSFMINEGHHPFSLLNIANILDISKKLKARHVVPPEKFVEALKLMEHRYGAR  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVA--NGH  1709
             DFVTS+D SLL  GTYYLT VDSKYRRFY  K    A A  NGH
Sbjct  421   DFVTSQDTSLLPAGTYYLTHVDSKYRRFYDVKGDGVATAMSNGH  464



>gb|EMS57402.1| Hydroxymethylglutaryl-CoA synthase [Triticum urartu]
Length=519

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/456 (77%), Positives = 398/456 (87%), Gaps = 0/456 (0%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             A + K+VGILA++IYFPP C+ QE LE HDG SKGKYTIGLGQD MAFC+EVEDVISMSL
Sbjct  3     AERVKDVGILAMDIYFPPNCVLQEELETHDGVSKGKYTIGLGQDSMAFCTEVEDVISMSL  62

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             T V +LL+ Y +DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+CGNTDIEGVDS+NACY
Sbjct  63    TVVKTLLKNYNIDPKCIGRLEVGSETVIDKSKSIKTWLMQIFEECGNTDIEGVDSSNACY  122

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFNCVNW ES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API  E
Sbjct  123   GGTAALFNCVNWAESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISLE  182

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSV  1046
             SK RGSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK+ C +YEK+EGK FS+
Sbjct  183   SKFRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYKTFCKRYEKIEGKPFSI  242

Query  1047  ADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDL  1226
              DAD FVFHSPYNKLVQKSFARL +NDFLRN S +++  +EKL P+  L+ +ESY +RDL
Sbjct  243   VDADSFVFHSPYNKLVQKSFARLYYNDFLRNCSIVDKDSREKLEPYLGLSSEESYQSRDL  302

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYG  1406
             EK  QQV+KP YD KVQP+TL+PKQ+GNMYTAS+YAAF S++HNKH  L GQR+VMFSYG
Sbjct  303   EKVCQQVAKPLYDTKVQPTTLIPKQLGNMYTASLYAAFASVVHNKHDALVGQRIVMFSYG  362

Query  1407  SGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKD  1586
             SG T+TMFS +I EGQHPFSL+NIA++L+I+ KL+SRH  PP+KFVE LK+MEHRYGAKD
Sbjct  363   SGMTSTMFSFKINEGQHPFSLTNIASILDISNKLESRHVVPPKKFVEALKLMEHRYGAKD  422

Query  1587  FVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAA  1694
             FVTS+D  LL PGTYYLT VDS YRRFYA K   AA
Sbjct  423   FVTSQDTRLLVPGTYYLTHVDSMYRRFYAVKGDTAA  458



>gb|ACY74340.1| putative HMG-CoA synthase 2 [Artemisia annua]
Length=438

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/440 (82%), Positives = 391/440 (89%), Gaps = 2/440 (0%)
 Frame = +3

Query  390   QQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVTSLLEKYEVDPKQIGRLE  569
             QQ+ LE  DG SKGKYTIGLGQDCMAFCSEVEDVISM LTAVTSLLEKYE+DPKQIGRLE
Sbjct  1     QQDTLENFDGVSKGKYTIGLGQDCMAFCSEVEDVISMGLTAVTSLLEKYEIDPKQIGRLE  60

Query  570   VGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGR  749
             VGSETVIDKSKSIKTFLM IFE  GNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGR
Sbjct  61    VGSETVIDKSKSIKTFLMDIFENAGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGR  120

Query  750   YGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDS  929
             YGLVV TDSAVYA+GPARPTGGA A+AML+GPDAPI FESK R SHM+HVYDFYKP L S
Sbjct  121   YGLVVSTDSAVYADGPARPTGGAGAVAMLIGPDAPIAFESKFRASHMSHVYDFYKPDLAS  180

Query  930   EYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADADYFVFHSPYNKLVQKSFA  1109
             EYPVVDGKLSQTCYLMALDSCYK  C KYEKL+GK FS+ADADYFVFHSPYNKLVQKSFA
Sbjct  181   EYPVVDGKLSQTCYLMALDSCYKGYCQKYEKLQGKQFSMADADYFVFHSPYNKLVQKSFA  240

Query  1110  RLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTL  1289
             RL+F D  R+AS ++E+ KEKL  F+SL GDESY +RDLEKASQQV+KP YD KVQP+TL
Sbjct  241   RLVFADVARDASSVDESAKEKLGQFTSLKGDESYQSRDLEKASQQVAKPDYDKKVQPATL  300

Query  1290  VPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPFSL  1469
             VPKQ+GNMYTAS+YAAF SLIHNK S+L G RV+MFSYGSG +ATM+SLR+ EG+ PFSL
Sbjct  301   VPKQLGNMYTASLYAAFASLIHNKSSSLDGNRVMMFSYGSGLSATMWSLRLTEGKAPFSL  360

Query  1470  SNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVD  1649
             SNIA V+NI  KLK+R EF PEKFVE++ +MEHRYG KDFVTSKD S LAPGTYYLTEVD
Sbjct  361   SNIAKVMNIEHKLKTRTEFAPEKFVELMHLMEHRYGGKDFVTSKDTSHLAPGTYYLTEVD  420

Query  1650  SKYRRFYAKKETKAAVANGH  1709
             SKYRRFYAKK T+  VANGH
Sbjct  421   SKYRRFYAKKTTE--VANGH  438



>gb|KDO60144.1| hypothetical protein CISIN_1g012253mg [Citrus sinensis]
Length=453

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/455 (79%), Positives = 396/455 (87%), Gaps = 14/455 (3%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILAL+IYFPPTC+ QEALE HDG SKGKYT+GLGQDCMAFCSEVEDVISMSLT VT
Sbjct  7     KNVGILALDIYFPPTCVLQEALEVHDGVSKGKYTVGLGQDCMAFCSEVEDVISMSLTVVT  66

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DP QIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  67    SLLEKYKIDPTQIGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDIEGVDSTNACYGGTA  126

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTD+A              A+AML+GPDAPI FESKLR
Sbjct  127   ALFNCVNWVESASWDGRYGLVVCTDTA--------------AVAMLIGPDAPIAFESKLR  172

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C K+EKLEG+ FS+ D D
Sbjct  173   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKYFCQKFEKLEGRQFSMLDVD  232

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL FNDFLRNAS ++E  KEKLAP+S+L+  ESY +RDLEKAS
Sbjct  233   YFVFHSPYNKLVQKSFARLFFNDFLRNASSVDEIAKEKLAPYSTLSDVESYQSRDLEKAS  292

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+K  YD KVQPSTL+PKQVGNMYTAS+YAAF SL+H KHS+L G+RV+MFSYGSG T
Sbjct  293   QQVAKQLYDLKVQPSTLIPKQVGNMYTASLYAAFASLLHEKHSSLEGKRVIMFSYGSGLT  352

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSL+++EG  PFSLSNI  V+++  KLK RHEFPPEKFV+I+K+MEHRYGAKDFVTS
Sbjct  353   ATMFSLQLQEGHRPFSLSNIVKVMDVPGKLKLRHEFPPEKFVDIMKLMEHRYGAKDFVTS  412

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVAN  1703
             KD SLL+PGT YLTEVDS +RRFYAKKE  +  A 
Sbjct  413   KDSSLLSPGTCYLTEVDSMFRRFYAKKENTSNAAT  447



>ref|XP_006659653.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like [Oryza brachyantha]
Length=467

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/464 (77%), Positives = 404/464 (87%), Gaps = 6/464 (1%)
 Frame = +3

Query  336   QKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAV  515
             +K+VGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQDCMA+CSEVEDVISMSLT V
Sbjct  4     RKDVGILAIDIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCMAYCSEVEDVISMSLTVV  63

Query  516   TSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGT  695
              SLL+ Y +D K IGRLEVGSETVIDKSKSIKT+LMQIFE+ GNTD+EGVDS+NACYGGT
Sbjct  64    ASLLKNYNIDAKSIGRLEVGSETVIDKSKSIKTWLMQIFEESGNTDLEGVDSSNACYGGT  123

Query  696   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKL  875
             AAL NCVNWVES SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK 
Sbjct  124   AALLNCVNWVESKSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFESKY  183

Query  876   RGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADA  1055
             R SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C+KYEKL G+ FS++DA
Sbjct  184   RASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRKYCTKYEKLVGEQFSISDA  243

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
             DY VFHSPYNKLVQKSFARL FNDF+RN S ++   KEKL PF++LT +ESY +RDLEKA
Sbjct  244   DYCVFHSPYNKLVQKSFARLYFNDFMRNCSSVDNDAKEKLQPFANLTSEESYQSRDLEKA  303

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGS  1415
             SQQV+K  YD KVQPSTL+PKQ+GNMYTAS+YAA  S+I+NKH +L GQR++MFSYGSG 
Sbjct  304   SQQVAKHLYDIKVQPSTLLPKQIGNMYTASLYAALASVIYNKHDSLGGQRILMFSYGSGL  363

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             T+TMFSLR+ +GQHPFSL +IA+VL++  KL+SRH   PEKF+E LK+MEHRYGAKDF T
Sbjct  364   TSTMFSLRLHDGQHPFSLKSIASVLDVTTKLESRHATSPEKFIESLKLMEHRYGAKDFDT  423

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKKETKA------AVANGH  1709
             SKD SLL  GT+YLT+VDS YRRFY KK  +        +ANGH
Sbjct  424   SKDTSLLPLGTFYLTKVDSMYRRFYEKKAVEGKIKGCNGIANGH  467



>ref|NP_001152145.1| hydroxymethylglutaryl-CoA synthase [Zea mays]
 ref|XP_008658728.1| PREDICTED: hydroxymethylglutaryl-CoA synthase isoform X1 [Zea 
mays]
 ref|XP_008658730.1| PREDICTED: hydroxymethylglutaryl-CoA synthase isoform X1 [Zea 
mays]
 gb|ACG46057.1| hydroxymethylglutaryl-CoA synthase [Zea mays]
 gb|AFW89786.1| putative hydroxymethylglutaryl-CoA synthase family protein isoform 
1 [Zea mays]
 gb|AFW89787.1| putative hydroxymethylglutaryl-CoA synthase family protein isoform 
2 [Zea mays]
 gb|AFW89788.1| putative hydroxymethylglutaryl-CoA synthase family protein isoform 
3 [Zea mays]
Length=464

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/464 (76%), Positives = 400/464 (86%), Gaps = 2/464 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MAS+ K+VGILA++IYFPP C+ QE LE HDG SKGKYTIGLGQ+ MAFC+EVEDVISMS
Sbjct  1     MASEAKDVGILAMDIYFPPNCVLQEELETHDGVSKGKYTIGLGQESMAFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V SLL+ Y +DP  IGRLEVGSETVIDKSKSIKT+LMQIFE+ GNTDIEGVDS+NAC
Sbjct  61    LTVVKSLLKNYNIDPMCIGRLEVGSETVIDKSKSIKTWLMQIFEESGNTDIEGVDSSNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVES SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API F
Sbjct  121   YGGTAALFNCVNWVESKSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPICF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY   C KYEK EGK FS
Sbjct  181   ESKYRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYNVFCKKYEKHEGKQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             ++DADY VFHSPYNKLVQKSFARL +NDFLRN S ++   +EKLAP++ L+ +ESY +RD
Sbjct  241   ISDADYVVFHSPYNKLVQKSFARLYYNDFLRNCSTVDGESREKLAPYAGLSSEESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+K  Y+ KVQP+TL+PKQVGNMYTAS+YAA  S++H++H TL GQR+VMFSY
Sbjct  301   LEKASQQVAKNLYETKVQPTTLIPKQVGNMYTASLYAALASVVHSRHETLAGQRIVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG T+TMFS  I EG HPFSL NIA +L+I++KLK+RH  PPEKFVE LK+MEHRYGA+
Sbjct  361   GSGLTSTMFSFMINEGHHPFSLLNIANILDISKKLKARHVVPPEKFVEALKLMEHRYGAR  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVA--NGH  1709
             DFVT++D SLL+ GTYYLT VDSKYRRFY  K    A A  NGH
Sbjct  421   DFVTNQDTSLLSAGTYYLTHVDSKYRRFYDVKGDGVATAMSNGH  464



>gb|ABG73437.1| hydroxymethylglutaryl-CoA synthase [Oryza brachyantha]
Length=522

 Score =   745 bits (1924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/511 (71%), Positives = 409/511 (80%), Gaps = 53/511 (10%)
 Frame = +3

Query  336   QKNVGILALEIYFPPTCLQQ----------------------------------------  395
             + NVGILA++IYFPPTC+ Q                                        
Sbjct  4     RDNVGILAMDIYFPPTCVLQVNPPSLLPLSLPAPSPWTILGGETPQIVGFLHRMDEATIA  63

Query  396   -------EALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVTSLLEKYEVDPKQ  554
                    EALEAHDGAS+GKYTIGLGQDCMAFCSEVEDVISMS+T VTSLL+KY+VDPK 
Sbjct  64    RMPVQRVEALEAHDGASRGKYTIGLGQDCMAFCSEVEDVISMSMTVVTSLLKKYKVDPKL  123

Query  555   IGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESS  734
             IGRLEVGSETVIDKSKSIKT+LMQIFE+CGNTDIEGVDS+NACYGGTAAL NCVNWVES+
Sbjct  124   IGRLEVGSETVIDKSKSIKTWLMQIFEECGNTDIEGVDSSNACYGGTAALLNCVNWVESN  183

Query  735   SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRGSHMAHVYDFYK  914
             SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+AP+ FESK + SHMAHVYDFYK
Sbjct  184   SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPLSFESKYKASHMAHVYDFYK  243

Query  915   PILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADADYFVFHSPYNKLV  1094
             P L SEYPVVDGKLSQTCYLMALDSCY+  C KYEKL GK FS++DADYFVFHSPYNKLV
Sbjct  244   PDLASEYPVVDGKLSQTCYLMALDSCYRQFCKKYEKLAGKQFSISDADYFVFHSPYNKLV  303

Query  1095  QKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKASQQVSKPFYDAKV  1274
             QKSFARL +NDF+R+ S ++   KEKL PFS+LTG+ESY +RDLEKASQQV+K  YD KV
Sbjct  304   QKSFARLYYNDFMRDCSSVDNDAKEKLQPFSNLTGEESYQSRDLEKASQQVAKHLYDIKV  363

Query  1275  QPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGSTATMFSLRIREGQ  1454
             QPSTL+PKQ+GNMYTAS+YAA  S++++KH +L GQR+VMFSYGSG T+TMFSL++  G+
Sbjct  364   QPSTLLPKQIGNMYTASLYAALASVVYDKHGSLDGQRIVMFSYGSGLTSTMFSLKLNNGE  423

Query  1455  HPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTSKDCSLLAPGTYY  1634
              PFSLSNIA+VLN+ EKL+SRH   PEKFVE LK+MEHRYGAKDF T+KD SLL PGT+Y
Sbjct  424   SPFSLSNIASVLNVTEKLESRHVTLPEKFVETLKLMEHRYGAKDFETNKDTSLLPPGTFY  483

Query  1635  LTEVDSKYRRFYAKKET------KAAVANGH  1709
             LT VDS YRRFY KK        KA  +NGH
Sbjct  484   LTRVDSMYRRFYDKKAEEEIAAGKAKYSNGH  514



>gb|ERN19421.1| hypothetical protein AMTR_s00069p00168650 [Amborella trichopoda]
Length=446

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/440 (78%), Positives = 390/440 (89%), Gaps = 0/440 (0%)
 Frame = +3

Query  387   LQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVTSLLEKYEVDPKQIGRL  566
             + +E+LEAHDGASKGKYTIGLGQDCMAFC+E+EDVISMS+T V+SLLEKY++D KQIGRL
Sbjct  1     MAEESLEAHDGASKGKYTIGLGQDCMAFCTELEDVISMSMTVVSSLLEKYQIDRKQIGRL  60

Query  567   EVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDG  746
             EVGSETVIDKSKSIKT+LM +FE CGNTDIEGVDSTNACYGGTAAL NCVNWVES+SWDG
Sbjct  61    EVGSETVIDKSKSIKTWLMDLFEDCGNTDIEGVDSTNACYGGTAALLNCVNWVESNSWDG  120

Query  747   RYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILD  926
             RYGLVVCTDSAVYAEGPARPTGGAAA+AML+GP+API FESK RGSHM+HVYDFYKP L 
Sbjct  121   RYGLVVCTDSAVYAEGPARPTGGAAAVAMLIGPNAPIAFESKYRGSHMSHVYDFYKPNLA  180

Query  927   SEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADADYFVFHSPYNKLVQKSF  1106
             SEYPVVDGKLSQTCYLMALDSCYK  CSK+E LEGK FS+ DADY  FHSPYNKLVQKSF
Sbjct  181   SEYPVVDGKLSQTCYLMALDSCYKRYCSKFEDLEGKQFSILDADYVAFHSPYNKLVQKSF  240

Query  1107  ARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPST  1286
             ARL FNDFLRN S IN+   EKL PFS+L+ +ESY +RDLEK +QQV+KP YD KVQPST
Sbjct  241   ARLYFNDFLRNGSSINKDVYEKLGPFSTLSSEESYQSRDLEKVTQQVAKPQYDVKVQPST  300

Query  1287  LVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPFS  1466
             L+PKQVGNMYTAS+YAAF S++HNKH +L GQRV+MFSYGSG ++TMFS R+REGQHPFS
Sbjct  301   LLPKQVGNMYTASLYAAFASIVHNKHESLVGQRVLMFSYGSGLSSTMFSFRMREGQHPFS  360

Query  1467  LSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEV  1646
             +SNIA+VLN++ KL+SR  F PEKFVEI+ +MEHRYGAK FVTS+D SLL+P TYYL EV
Sbjct  361   ISNIASVLNVSGKLESRQVFSPEKFVEIMNLMEHRYGAKGFVTSEDRSLLSPETYYLKEV  420

Query  1647  DSKYRRFYAKKETKAAVANG  1706
             D+ YRR+YAKK      +NG
Sbjct  421   DALYRRYYAKKVGDDGASNG  440



>emb|CAA65250.1| 3-hydroxy-3-methylglutaryl-CoA-synthase [Pinus sylvestris]
Length=474

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/468 (74%), Positives = 398/468 (85%), Gaps = 7/468 (1%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MAS+ +NVGILA+EIYFP TC+QQE LE  DG SKGKYTIGLGQDCM FC+++EDVISMS
Sbjct  1     MASRPENVGILAMEIYFPTTCVQQEDLETFDGVSKGKYTIGLGQDCMTFCTDLEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAVTSLLEKYE+DPKQIGRLEVGSETVIDKSKSIKT+LM IFEKCGNT+IEGVDSTNAC
Sbjct  61    LTAVTSLLEKYEIDPKQIGRLEVGSETVIDKSKSIKTWLMHIFEKCGNTEIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNC+NW+ESSSWDGRYGLVV TDSAVYAEG ARPTGGAAA+AML+GP+API  
Sbjct  121   YGGTAALFNCINWIESSSWDGRYGLVVATDSAVYAEGAARPTGGAAAVAMLIGPNAPIAT  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RG+HMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+K+EK EG+ FS
Sbjct  181   ESKYRGTHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKRFCNKFEKEEGRQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + D DY  FHSPYNKLVQKSF RLLFNDF R+A  + +  +EKL PF+ L+  +SY++RD
Sbjct  241   LLDTDYIAFHSPYNKLVQKSFGRLLFNDFSRHARSVGKDAQEKLEPFAGLSEQDSYNSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK SQQ++KP YDAK+QPSTL+PKQVGNMYTAS+YAA  S+IHNKH+TL GQRV+MFSY
Sbjct  301   LEKVSQQLAKPLYDAKIQPSTLLPKQVGNMYTASLYAALASIIHNKHTTLDGQRVMMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  +T+FS +IREGQ PF+LSNI  V+++  KL SRHEF PE FVE LK ME  YGAK
Sbjct  361   GSGLASTLFSFKIREGQFPFTLSNITEVMDVQNKLDSRHEFLPEDFVENLKRMETLYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKET-------KAAVANG  1706
             DFV++   SLL PG +YLT+VDS YRRFY++K         K+ +ANG
Sbjct  421   DFVSTSQLSLLRPGAFYLTKVDSMYRRFYSRKVISAGDNFEKSKLANG  468



>gb|AAT73206.1| 3-hydroxy-3-methylglutaryl-CoA synthase [Taxus x media]
Length=476

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/452 (76%), Positives = 393/452 (87%), Gaps = 0/452 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MAS Q+NVGILA+E+YFP TC+QQ+ALE  DG SKGKYTIGLGQDCM FC+++EDVISMS
Sbjct  1     MASPQENVGILAMEVYFPTTCVQQDALETFDGVSKGKYTIGLGQDCMTFCTDLEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT VTSLLEKY +DPKQIGRLEVGSETVIDKSKSIKT+LM IFEKCGNT+IEGVDSTNAC
Sbjct  61    LTVVTSLLEKYAIDPKQIGRLEVGSETVIDKSKSIKTWLMCIFEKCGNTEIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWV+SSSWDGRYGLVV TDSAVYAEGPARPTGGAAAIAML+GP+API F
Sbjct  121   YGGTAALFNCVNWVQSSSWDGRYGLVVATDSAVYAEGPARPTGGAAAIAMLIGPNAPIAF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             E++ RG+HMAH YDFYKP L SEYPVVDGKLSQTCYL ALDSCYK  C+K+EK EG  FS
Sbjct  181   ENRYRGTHMAHAYDFYKPNLASEYPVVDGKLSQTCYLKALDSCYKRFCNKFEKGEGHQFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DADY  FHSPYNKLVQKSFARLLFNDF R+AS   +  +EKL P++ L+ +ESYS+RD
Sbjct  241   LLDADYVAFHSPYNKLVQKSFARLLFNDFSRHASSAGKDAQEKLEPYAGLSEEESYSSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK SQQ +KP YD KVQPSTL+PK+ GNMYTAS+YAA  S+IHNK+STL GQRV+MFSY
Sbjct  301   LEKVSQQAAKPLYDEKVQPSTLLPKKEGNMYTASLYAALASIIHNKYSTLEGQRVLMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  +TMFSL+IREGQHPF LSNIA  +++  KL+S+HEF PE FV+ L++ME  YGAK
Sbjct  361   GSGLASTMFSLKIREGQHPFILSNIAEAMDLQSKLESQHEFSPEDFVDNLRLMETLYGAK  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             DFV+    +LL PGT+YLTEVDS YRRFY++K
Sbjct  421   DFVSCAQHNLLRPGTFYLTEVDSMYRRFYSQK  452



>gb|KDO63605.1| hypothetical protein CISIN_1g012353mg [Citrus sinensis]
Length=446

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/395 (86%), Positives = 372/395 (94%), Gaps = 0/395 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQ+CMAFCSEVEDVISMSLTAVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +LLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    NLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+ MLVGPDAP+ FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK LCSKYEKLEGK FS+++AD
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLLFNDF+RNAS ++EA KEKL PFS+L+GDESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLFNDFMRNASSVDEAAKEKLGPFSTLSGDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++KP YDAKVQPSTL+PKQVGNMYTAS+YAA  SLIHNKHS L G+RVV+FSYGSG T
Sbjct  303   QQLAKPLYDAKVQPSTLIPKQVGNMYTASLYAALASLIHNKHSELDGKRVVLFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHE  1523
             ATMFSL++ EG HPFSLSNI +V+N+A KLKSRHE
Sbjct  363   ATMFSLKLSEGHHPFSLSNILSVMNVAGKLKSRHE  397



>gb|EEC74400.1| hypothetical protein OsI_09754 [Oryza sativa Indica Group]
Length=532

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/440 (78%), Positives = 385/440 (88%), Gaps = 1/440 (0%)
 Frame = +3

Query  393   QEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVTSLLEKYEVDPKQIGRLEV  572
             Q+ LE HDG SKGKYTIGLGQD MAFC+EVEDVISMSLT V SLLE Y++DPK IGRLEV
Sbjct  93    QDELENHDGVSKGKYTIGLGQDSMAFCTEVEDVISMSLTVVKSLLENYKIDPKCIGRLEV  152

Query  573   GSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRY  752
             GSETVIDKSKSIKT+LMQIFE+CGNTDIEGVDS+NACYGGTAALFNCVNWVES+SWDGRY
Sbjct  153   GSETVIDKSKSIKTWLMQIFEECGNTDIEGVDSSNACYGGTAALFNCVNWVESNSWDGRY  212

Query  753   GLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSE  932
             GLVVCTDSAVYAEGPARPTGGAAAIAML+GP+AP+ FESK RGSHMAHVYDFYKP L SE
Sbjct  213   GLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPVSFESKYRGSHMAHVYDFYKPDLASE  272

Query  933   YPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADADYFVFHSPYNKLVQKSFAR  1112
             YPVVDGKLSQTCYLMALDSCY   C KYEKLEGK FS+ DADYFVFHSPYNKLVQKSFAR
Sbjct  273   YPVVDGKLSQTCYLMALDSCYNVFCKKYEKLEGKQFSIHDADYFVFHSPYNKLVQKSFAR  332

Query  1113  LLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLV  1292
             L +NDFLR  S + +  +EKL P+S L+ +ESY +R+LEKASQQV+K  YD+KVQP+TL+
Sbjct  333   LYYNDFLRKCSTVEDGSREKLEPYSGLSSEESYQSRELEKASQQVAKHLYDSKVQPTTLI  392

Query  1293  PKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPFSLS  1472
             PKQVGNMYTAS+YAA  S++HNK+ TL GQR+VMFSYGSG T+TMFS +I EGQHPF LS
Sbjct  393   PKQVGNMYTASLYAALASVMHNKNETLAGQRIVMFSYGSGLTSTMFSFKINEGQHPFILS  452

Query  1473  NIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDS  1652
             NIA +L++++KL+SRH   PEKFV  LK+MEHRYGAKDF TS+D SLLAPGTYYLT VDS
Sbjct  453   NIAGILDVSKKLESRHVVAPEKFVAALKLMEHRYGAKDFTTSQDTSLLAPGTYYLTHVDS  512

Query  1653  KYRRFYA-KKETKAAVANGH  1709
              YRRFYA K +    V+NGH
Sbjct  513   MYRRFYAVKGQAVTEVSNGH  532


 Score =   107 bits (267),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +3

Query  324  MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
            MA+++K+VGILA++IYFPPTC+ Q+ LE HDG SKGKYTIGLGQD MAFC+EVEDVISMS
Sbjct  1    MAAERKDVGILAMDIYFPPTCVLQDELENHDGVSKGKYTIGLGQDSMAFCTEVEDVISMS  60

Query  504  LTA  512
            + A
Sbjct  61   IAA  63



>ref|XP_006440513.1| hypothetical protein CICLE_v10020042mg [Citrus clementina]
 gb|ESR53753.1| hypothetical protein CICLE_v10020042mg [Citrus clementina]
Length=446

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/395 (86%), Positives = 372/395 (94%), Gaps = 0/395 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQ+CMAFCSEVEDVISMSLTAVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +LLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    NLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+ MLVGPDAP+ FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK LCSKYEKLEGK FS+++AD
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YF+FHSPYNKLVQKSFARLLFNDF+RNAS ++EA KEKL PFS+L+GDESY +RDLEK S
Sbjct  243   YFMFHSPYNKLVQKSFARLLFNDFMRNASSVDEAAKEKLGPFSTLSGDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++KP YDAKVQPSTL+PKQVGNMYTAS+YAA  SLIHNKHS L G+RVV+FSYGSG T
Sbjct  303   QQLAKPLYDAKVQPSTLIPKQVGNMYTASLYAALASLIHNKHSELDGKRVVLFSYGSGLT  362

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHE  1523
             ATMFSL++ EG HPFSLSNI +V+N+A KLKSRHE
Sbjct  363   ATMFSLKLSEGHHPFSLSNILSVMNVAGKLKSRHE  397



>gb|EMT14328.1| Hydroxymethylglutaryl-CoA synthase [Aegilops tauschii]
Length=860

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/479 (74%), Positives = 399/479 (83%), Gaps = 23/479 (5%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTC-LQ----------------------QEALEAHDGASKGKY  437
             A + K+VGILA++IYFPP C LQ                      QE LEAHDG SKGKY
Sbjct  3     AERVKDVGILAMDIYFPPNCVLQCKRILVAVYGWHVARVKAMDDYQEELEAHDGVSKGKY  62

Query  438   TIGLGQDCMAFCSEVEDVISMSLTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTF  617
             TIGLGQD MAFC+EVEDVISMSLT V +LL+ Y +DPK IGRLEVGSETVIDKSKSIKT+
Sbjct  63    TIGLGQDSMAFCTEVEDVISMSLTVVKTLLKNYNIDPKCIGRLEVGSETVIDKSKSIKTW  122

Query  618   LMQIFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGP  797
             LMQIFE+CGNTDIEGVDS+NACYGGTA+LFNCVNWVES+SWDGRYGLVVCTDSAVYAEGP
Sbjct  123   LMQIFEECGNTDIEGVDSSNACYGGTASLFNCVNWVESNSWDGRYGLVVCTDSAVYAEGP  182

Query  798   ARPTGGAAAIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLM  977
             ARPTGGAAAIAML+GP+API  ESK RGSHMAHVYDFYKP L SEYPVVDGKLSQTCYLM
Sbjct  183   ARPTGGAAAIAMLIGPNAPISLESKFRGSHMAHVYDFYKPDLASEYPVVDGKLSQTCYLM  242

Query  978   ALDSCYKSLCSKYEKLEGKSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINE  1157
             ALDSCYK+ C +YEK+EGK FS+ DAD FVFHSPYNKLVQKSFARL +NDFLR+ S +++
Sbjct  243   ALDSCYKTFCKRYEKIEGKPFSIVDADSFVFHSPYNKLVQKSFARLYYNDFLRSCSIVDK  302

Query  1158  ADKEKLAPFSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAA  1337
               +EKL P+S L+ +ESY +RDLEK  QQV+KP YD KVQP+TL+PKQ+GNMYTAS+YAA
Sbjct  303   DSREKLEPYSGLSSEESYQSRDLEKVCQQVAKPLYDTKVQPTTLIPKQLGNMYTASLYAA  362

Query  1338  FISLIHNKHSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSR  1517
             F S++HNK   L GQR+VMFSYGSG T+TMFS +I E QHPFSLSNIA +L+I+ KL+SR
Sbjct  363   FASVVHNKRDALVGQRIVMFSYGSGMTSTMFSFKINEFQHPFSLSNIANILDISNKLESR  422

Query  1518  HEFPPEKFVEILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAA  1694
             H  PP+KFVE LK+MEHRYGAKDFVTS+D  LL PGTYYLT VDS YRRFYA K   AA
Sbjct  423   HVVPPKKFVEALKLMEHRYGAKDFVTSQDTRLLVPGTYYLTHVDSMYRRFYAVKGDTAA  481



>ref|NP_001242721.1| uncharacterized protein LOC100777679 [Glycine max]
 gb|ACU18181.1| unknown [Glycine max]
Length=427

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/426 (79%), Positives = 380/426 (89%), Gaps = 1/426 (0%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             +S+  +VGILA++IYFPPTC+ Q+ALE HDG SKGKYTIGLGQDCMAFCSEVEDVISMSL
Sbjct  3     SSRPADVGILAMDIYFPPTCVTQDALEGHDGVSKGKYTIGLGQDCMAFCSEVEDVISMSL  62

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             T VTSLLEK+ VDPKQIG L VGSETVIDKSKSIKTFLMQ+FE  GNTDIEGVDSTNACY
Sbjct  63    TVVTSLLEKFNVDPKQIGHLAVGSETVIDKSKSIKTFLMQVFEASGNTDIEGVDSTNACY  122

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAAL NCVNWVESSSWDGRYGLVVCTD+AVYAEGPARPTGGAAAIAMLVGPDAPI FE
Sbjct  123   GGTAALSNCVNWVESSSWDGRYGLVVCTDTAVYAEGPARPTGGAAAIAMLVGPDAPIAFE  182

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSV  1046
             SKLRGSHM+H YDFYKP L SEYP+VDGKLSQTCYLMALDSCY+  C K+EKLEG+ FS+
Sbjct  183   SKLRGSHMSHAYDFYKPNLASEYPIVDGKLSQTCYLMALDSCYRLYCEKFEKLEGRPFSM  242

Query  1047  ADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDL  1226
             +D+DYFVFHSPYNKLVQKSF RL FNDFLRNAS+++E  +E LAP++SL+GDESY +RDL
Sbjct  243   SDSDYFVFHSPYNKLVQKSFGRLYFNDFLRNASFVDEVARETLAPYASLSGDESYQSRDL  302

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYG  1406
             EKA+QQ +K  YDAKVQPSTL+PKQVGNMYTAS+YAAF SL+HNK+S+L G+RVVMFSYG
Sbjct  303   EKANQQAAKHLYDAKVQPSTLIPKQVGNMYTASLYAAFASLLHNKNSSLVGKRVVMFSYG  362

Query  1407  SGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKD  1586
             SG TATMFS +++EGQHPF+ SNI  V+N+ +KLK R E PPEKFVE LKIMEHRYG + 
Sbjct  363   SGLTATMFSFQLQEGQHPFNSSNIVTVMNVPDKLKQRVEIPPEKFVETLKIMEHRYGGR-  421

Query  1587  FVTSKD  1604
             F   KD
Sbjct  422   FYAKKD  427



>ref|XP_010940908.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like isoform X2 
[Elaeis guineensis]
Length=439

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/457 (75%), Positives = 383/457 (84%), Gaps = 35/457 (8%)
 Frame = +3

Query  336   QKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAV  515
             +K+VGILA++IYFPPT +QQE LEA+DGASKGKYTIGLGQDCMAFC+E+EDVISMSLT +
Sbjct  4     RKDVGILAMDIYFPPTSVQQEELEAYDGASKGKYTIGLGQDCMAFCTELEDVISMSLTVI  63

Query  516   TSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGT  695
             TSLLEKY++DPKQIGRLEVGSETVIDKSKSIKT+LMQIFE+CGNTD+EGVDSTNACYGGT
Sbjct  64    TSLLEKYQIDPKQIGRLEVGSETVIDKSKSIKTWLMQIFEECGNTDVEGVDSTNACYGGT  123

Query  696   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKL  875
             AALFNCVNWVESSSWDGRYG+VVCTDSAVYAEGPARPTGGA AIAML+GP+API FESK 
Sbjct  124   AALFNCVNWVESSSWDGRYGVVVCTDSAVYAEGPARPTGGAGAIAMLIGPNAPISFESKY  183

Query  876   RGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADA  1055
             RG+HM HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  CSKYEK EGK FS++DA
Sbjct  184   RGTHMTHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHFCSKYEKFEGKQFSISDA  243

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
             DYFVFHSPYNKLVQKSFARL FNDFLR+AS + +  +EKL PFS+LTGDESY NR+LEK 
Sbjct  244   DYFVFHSPYNKLVQKSFARLYFNDFLRSASSVEKDGREKLEPFSTLTGDESYQNRELEKT  303

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGS  1415
             SQQV+K  YD KV                                   QRVVMFSYGSG 
Sbjct  304   SQQVAKHLYDEKVN----------------------------------QRVVMFSYGSGL  329

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             ++TMFS +++EGQHPFSLSNIAAVLN++EKLK+RH F PEKFVE LK+MEHRYGAKDFVT
Sbjct  330   SSTMFSFKLQEGQHPFSLSNIAAVLNVSEKLKARHVFTPEKFVETLKLMEHRYGAKDFVT  389

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             SKD SLL+PGT+YLT VD  YRR+Y KK  +  + NG
Sbjct  390   SKDTSLLSPGTFYLTNVDHMYRRYYVKKSAE-GMTNG  425



>ref|XP_007038552.1| Hydroxymethylglutaryl-CoA synthase / HMG-CoA synthase / 3-hydroxy-3-methylglutaryl 
coenzyme A synthase isoform 5 [Theobroma 
cacao]
 gb|EOY23053.1| Hydroxymethylglutaryl-CoA synthase / HMG-CoA synthase / 3-hydroxy-3-methylglutaryl 
coenzyme A synthase isoform 5 [Theobroma 
cacao]
Length=405

 Score =   713 bits (1841),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/400 (83%), Positives = 369/400 (92%), Gaps = 0/400 (0%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MAS  +NVGILA++IYFPPTC+QQE LEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMS
Sbjct  1     MASHPENVGILAIDIYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT VTSLLEKYE+DP +IGRLEVGSETVIDKSKSIKTFLMQIFE+CGNTDIEGVDSTNAC
Sbjct  61    LTVVTSLLEKYEIDPTKIGRLEVGSETVIDKSKSIKTFLMQIFEECGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGP+API F
Sbjct  121   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPNAPIAF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD CYK    K+EKL+G+ FS
Sbjct  181   ESKFRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDLCYKHFYEKFEKLQGRPFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             ++DADYFVFHSPYNKLVQKSFARL FNDFLRNASYI+E  KEKL PFS L+ DESY +RD
Sbjct  241   ISDADYFVFHSPYNKLVQKSFARLFFNDFLRNASYIDEGAKEKLTPFSGLSNDESYQSRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+KP YD+ VQPSTL+PKQVGNMYTAS+YAAF SL+HNKH++L G+RVVMFSY
Sbjct  301   LEKASQQVAKPLYDSMVQPSTLLPKQVGNMYTASLYAAFASLLHNKHTSLAGKRVVMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHE  1523
             GSG TAT+FSL++++G+HPF+L NIA ++N++EKLK RH+
Sbjct  361   GSGLTATIFSLKLQDGRHPFNLLNIAKLMNVSEKLKLRHQ  400



>ref|XP_010907421.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like isoform X2 
[Elaeis guineensis]
Length=429

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/428 (79%), Positives = 379/428 (89%), Gaps = 12/428 (3%)
 Frame = +3

Query  462   MAFCSEVEDVISMSLTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKC  641
             MAFC+E+EDVISMSLT VTSLLEKY++DPKQIGRLEVGSETVIDKSKSIKT+LMQIFE+ 
Sbjct  1     MAFCTELEDVISMSLTVVTSLLEKYQIDPKQIGRLEVGSETVIDKSKSIKTWLMQIFEEY  60

Query  642   GNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA  821
             GNTD+EGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA
Sbjct  61    GNTDVEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA  120

Query  822   AIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKS  1001
             A+AML+GP+API FESK RG+HM HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK 
Sbjct  121   AMAMLIGPNAPISFESKFRGTHMTHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKH  180

Query  1002  LCSKYEKLEGKSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAP  1181
              CSKYEK EGK FS+ DADYFVFHSPYNKLVQKSFARL +NDFL N S + +  +EKL P
Sbjct  181   FCSKYEKFEGKKFSIFDADYFVFHSPYNKLVQKSFARLYYNDFLHNPSSVEKDSREKLEP  240

Query  1182  FSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNK  1361
             FS+LTGDESY +R+LEK SQQV+K  YD KVQPSTL+PKQ+GNMYTASIYAAF S++HNK
Sbjct  241   FSTLTGDESYQSRELEKTSQQVAKCLYDKKVQPSTLLPKQIGNMYTASIYAAFASVLHNK  300

Query  1362  HSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKF  1541
             HSTL GQR+VMFSYGSG ++TMFSL++R+GQHPFSLSNIA +LN++EKL++RH F PEKF
Sbjct  301   HSTLGGQRIVMFSYGSGLSSTMFSLKLRDGQHPFSLSNIATMLNVSEKLEARHVFLPEKF  360

Query  1542  VEILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK------ETKAA---  1694
             VE LK+MEHRYGAKDFVT K+ SLL+PGT+YLT+VDS YRR+YAKK        KAA   
Sbjct  361   VETLKLMEHRYGAKDFVTGKETSLLSPGTFYLTKVDSMYRRYYAKKVAEGITNGKAAECN  420

Query  1695  ---VANGH  1709
                +ANGH
Sbjct  421   NKPLANGH  428



>ref|XP_003611168.1| Hydroxymethylglutaryl-CoA synthase [Medicago truncatula]
 gb|AES94126.1| 3-hydroxy-3-methylglutaryl coenzyme A synthase [Medicago truncatula]
Length=427

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/394 (84%), Positives = 368/394 (93%), Gaps = 0/394 (0%)
 Frame = +3

Query  342   NVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVTS  521
             NVGILAL+IYFPP C+QQEALEAHDGASKGKYTIGLGQDCM+FCS+VEDVISMSLT V++
Sbjct  8     NVGILALDIYFPPNCVQQEALEAHDGASKGKYTIGLGQDCMSFCSDVEDVISMSLTVVST  67

Query  522   LLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTAA  701
             LL+KYE+DPKQIGRLEVGSETVIDKSKSIK+FLMQIFEK GNTDIEGVDSTNACYGGTAA
Sbjct  68    LLQKYEIDPKQIGRLEVGSETVIDKSKSIKSFLMQIFEKYGNTDIEGVDSTNACYGGTAA  127

Query  702   LFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRG  881
             LFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESKLRG
Sbjct  128   LFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPISFESKLRG  187

Query  882   SHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADADY  1061
             SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALD+C+K+ C KYEK EGK FS++DADY
Sbjct  188   SHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDTCFKNFCQKYEKHEGKQFSLSDADY  247

Query  1062  FVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKASQ  1241
             FVFHSPYNKLVQKSFARL+F+DFLRN S  +E   EKL PF++L+ DESY +RDLEKASQ
Sbjct  248   FVFHSPYNKLVQKSFARLVFSDFLRNPSSKDEVTNEKLGPFTTLSDDESYQSRDLEKASQ  307

Query  1242  QVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGSTA  1421
             QV+KP YD KVQPSTL+PKQVGNMYTASIYAAF SL+HNK+S+L G+RV++FSYGSG TA
Sbjct  308   QVAKPLYDEKVQPSTLIPKQVGNMYTASIYAAFASLLHNKNSSLEGKRVILFSYGSGLTA  367

Query  1422  TMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHE  1523
             TMFSL++RE +HPFSLSNIA V+++AEKLKSRHE
Sbjct  368   TMFSLQLRETKHPFSLSNIARVMDVAEKLKSRHE  401



>ref|NP_849361.1| Hydroxymethylglutaryl-CoA synthase [Arabidopsis thaliana]
 gb|AAM98150.1| hydroxymethylglutaryl-CoA synthase [Arabidopsis thaliana]
 gb|AAP37851.1| At4g11820 [Arabidopsis thaliana]
 gb|AEE83052.1| Hydroxymethylglutaryl-CoA synthase [Arabidopsis thaliana]
Length=406

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/406 (81%), Positives = 365/406 (90%), Gaps = 2/406 (0%)
 Frame = +3

Query  498   MSLTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTN  677
             MS  AVTSL EKY++DP QIGRLEVGSETVIDKSKSIKTFLMQ+FEKCGNTD+EGVDSTN
Sbjct  1     MSFNAVTSLFEKYKIDPNQIGRLEVGSETVIDKSKSIKTFLMQLFEKCGNTDVEGVDSTN  60

Query  678   ACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPI  857
             ACYGGTAAL NCVNWVES+SWDGRYGLV+CTDSAVYAEGPARPTGGAAAIAML+GPDAPI
Sbjct  61    ACYGGTAALLNCVNWVESNSWDGRYGLVICTDSAVYAEGPARPTGGAAAIAMLIGPDAPI  120

Query  858   VFESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKS  1037
             VFESKLR SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK LC+K+EK+EGK 
Sbjct  121   VFESKLRASHMAHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHLCNKFEKIEGKE  180

Query  1038  FSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSN  1217
             FS+ DADY VFHSPYNKLVQKSFARLL+NDFLRNAS I+EA KEK  P+SSLT DESY +
Sbjct  181   FSINDADYIVFHSPYNKLVQKSFARLLYNDFLRNASSIDEAAKEKFTPYSSLTLDESYQS  240

Query  1218  RDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMF  1397
             RDLEK SQQ++KPFYDAKVQP+TL+PK+VGNMYTAS+YAAF SLIH KH+ L G+RVVMF
Sbjct  241   RDLEKVSQQIAKPFYDAKVQPTTLIPKEVGNMYTASLYAAFASLIHKKHNDLAGKRVVMF  300

Query  1398  SYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYG  1577
             SYGSGSTATMFSLR+ + + PFS+SNIA+V+++  KLK+RHE+ PEKFVE +K+MEHRYG
Sbjct  301   SYGSGSTATMFSLRLNDNKPPFSISNIASVMDVGGKLKARHEYAPEKFVETMKLMEHRYG  360

Query  1578  AKDFVTSKD--CSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             AKDFVT+K+    LLAPGTYYL EVDS YRRFY KK    +VANGH
Sbjct  361   AKDFVTTKEGIIDLLAPGTYYLKEVDSLYRRFYGKKGEDGSVANGH  406



>gb|KHG29301.1| Hydroxymethylglutaryl-CoA synthase -like protein [Gossypium arboreum]
Length=417

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/463 (73%), Positives = 376/463 (81%), Gaps = 54/463 (12%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGI+A++IYFPPT +QQEALEAHDG SKGKYTIGLGQDC+AFC+EVEDVISMSLT VT
Sbjct  3     KNVGIIAMDIYFPPTFVQQEALEAHDGVSKGKYTIGLGQDCLAFCTEVEDVISMSLTVVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFE                     
Sbjct  63    SLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFE---------------------  101

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
                                        VYAEGPARPTGGAAAIAML+GPDAPI FESK R
Sbjct  102   ---------------------------VYAEGPARPTGGAAAIAMLIGPDAPIAFESKFR  134

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK  C KYEKLE K FS++DAD
Sbjct  135   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKYFCHKYEKLESKQFSLSDAD  194

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL+FNDF+RNAS +++  KEKLAPFS+LTGDESY +RDLEKAS
Sbjct  195   YFVFHSPYNKLVQKSFARLVFNDFVRNASSVDDIAKEKLAPFSTLTGDESYQSRDLEKAS  254

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQVSKP YDAKVQP+TL+PKQVGNMYTAS+YAAF SL+HNK+S L G+RV++FSYGSG T
Sbjct  255   QQVSKPLYDAKVQPTTLIPKQVGNMYTASLYAAFASLLHNKNSELAGKRVILFSYGSGLT  314

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
             ATMFSLR+ EGQHPFSLSNIA V+N+A KLK+RHEF PEKFVE + +MEHRYGAKDFVTS
Sbjct  315   ATMFSLRLHEGQHPFSLSNIATVMNVAGKLKARHEFAPEKFVETMHLMEHRYGAKDFVTS  374

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKKE------TKAAVANGH  1709
             KD SLL+PGTYYLTEVDSKYRRFYAKK+         +V NGH
Sbjct  375   KDSSLLSPGTYYLTEVDSKYRRFYAKKDGNCTGNENGSVVNGH  417



>ref|XP_006421819.1| hypothetical protein CICLE_v10005099mg [Citrus clementina]
 gb|ESR35059.1| hypothetical protein CICLE_v10005099mg [Citrus clementina]
Length=401

 Score =   696 bits (1797),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/395 (83%), Positives = 358/395 (91%), Gaps = 0/395 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILAL+IYFPPTC+ QEALE HDG SKGKYT+GLGQDCMAFCSEVEDVISMSLT VT
Sbjct  7     KNVGILALDIYFPPTCVLQEALEVHDGVSKGKYTVGLGQDCMAFCSEVEDVISMSLTVVT  66

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DP QIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  67    SLLEKYKIDPTQIGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDIEGVDSTNACYGGTA  126

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AML+GPDAPI FESKLR
Sbjct  127   ALFNCVNWVESASWDGRYGLVVCTDSAVYAEGPARPTGGAAAVAMLIGPDAPIAFESKLR  186

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C K+EKLEG+ FS+ D D
Sbjct  187   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKYFCQKFEKLEGRQFSMLDVD  246

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL FNDFLRNAS ++E  KEKLAP+S+L+  ESY +RDLEKAS
Sbjct  247   YFVFHSPYNKLVQKSFARLFFNDFLRNASSVDEIAKEKLAPYSTLSDVESYQSRDLEKAS  306

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQV+K  YD KVQPSTL+PKQVGNMYTAS+YAAF SL+H KHS+L G+RV+MFSYGSG T
Sbjct  307   QQVAKQLYDLKVQPSTLIPKQVGNMYTASLYAAFASLLHEKHSSLEGKRVIMFSYGSGLT  366

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHE  1523
             ATMFSL+++EG  PFSLSNI  V+++  KLK RHE
Sbjct  367   ATMFSLQLQEGHRPFSLSNIVKVMDVPGKLKLRHE  401



>ref|XP_010919198.1| PREDICTED: hydroxymethylglutaryl-CoA synthase isoform X2 [Elaeis 
guineensis]
Length=424

 Score =   696 bits (1795),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/424 (77%), Positives = 370/424 (87%), Gaps = 8/424 (2%)
 Frame = +3

Query  462   MAFCSEVEDVISMSLTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKC  641
             MAFC+E+EDV+SMSLT V SLLEKY++DP+QIGRLEVG+ET+IDKSKSIKT+LMQIFE+ 
Sbjct  1     MAFCTELEDVVSMSLTVVKSLLEKYQIDPRQIGRLEVGTETIIDKSKSIKTWLMQIFEEY  60

Query  642   GNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA  821
             GN+DIEGVDSTNACYGGTAALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAA
Sbjct  61    GNSDIEGVDSTNACYGGTAALFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAA  120

Query  822   AIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKS  1001
             AIAML+GP+API FESK RG+HM+H YDFYKP L SEYPVVDGKLSQ CYLMALDSCYK 
Sbjct  121   AIAMLIGPNAPISFESKFRGTHMSHAYDFYKPNLASEYPVVDGKLSQICYLMALDSCYKH  180

Query  1002  LCSKYEKLEGKSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAP  1181
              C+K E  EGK FS+ DADYFVFHSPYNKLVQKSFARL FNDFLRN+S I EA +EKL P
Sbjct  181   FCNKNENFEGKQFSIFDADYFVFHSPYNKLVQKSFARLYFNDFLRNSSCIEEAAREKLEP  240

Query  1182  FSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNK  1361
             F +L+GDESY +R+LEKASQQV+K  YDAKVQPSTL+PKQVGNMYTAS+YA+F SL+HNK
Sbjct  241   FLNLSGDESYQSRELEKASQQVAKHLYDAKVQPSTLIPKQVGNMYTASLYASFASLLHNK  300

Query  1362  HSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKF  1541
             HSTL GQRVVMFSYGSG ++TMFS +I++GQHPFSLSNI  V+NI++KL+ RH FP EKF
Sbjct  301   HSTLGGQRVVMFSYGSGLSSTMFSFKIQDGQHPFSLSNIVNVMNISQKLELRHVFPTEKF  360

Query  1542  VEILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK--------ETKAAV  1697
              E +K+ME RYGAKDFVTSKD SLL PGT+YLT+VDS YRR+YAKK            + 
Sbjct  361   AETMKLMERRYGAKDFVTSKDTSLLYPGTFYLTQVDSLYRRYYAKKGADDTTVIHANRSF  420

Query  1698  ANGH  1709
              NGH
Sbjct  421   VNGH  424



>ref|XP_010940910.1| PREDICTED: hydroxymethylglutaryl-CoA synthase-like isoform X3 
[Elaeis guineensis]
Length=426

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/457 (73%), Positives = 374/457 (82%), Gaps = 48/457 (11%)
 Frame = +3

Query  336   QKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAV  515
             +K+VGILA++IYFPPT +QQE LEA+DGASKGKYTIGLGQDCMAFC+E+EDVISMSLT +
Sbjct  4     RKDVGILAMDIYFPPTSVQQEELEAYDGASKGKYTIGLGQDCMAFCTELEDVISMSLTVI  63

Query  516   TSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGT  695
             TSLLEKY++DPKQIGRLEVGSETVIDKSKSIKT+LMQIFE+CGNTD+EGVDSTNACYGGT
Sbjct  64    TSLLEKYQIDPKQIGRLEVGSETVIDKSKSIKTWLMQIFEECGNTDVEGVDSTNACYGGT  123

Query  696   AALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKL  875
             AALFNCVNWVESSSWDGRYG+VVCTDSAVYAEGPARPTGGA AIAML+GP+API FESK 
Sbjct  124   AALFNCVNWVESSSWDGRYGVVVCTDSAVYAEGPARPTGGAGAIAMLIGPNAPISFESKY  183

Query  876   RGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADA  1055
             RG+HM HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  CSKYEK EGK FS++DA
Sbjct  184   RGTHMTHVYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKHFCSKYEKFEGKQFSISDA  243

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
             DYFVFHSPYNKLVQKSFARL FNDFLR+AS + +  +EKL PFS+LTGDESY NR+LEK 
Sbjct  244   DYFVFHSPYNKLVQKSFARLYFNDFLRSASSVEKDGREKLEPFSTLTGDESYQNRELEKV  303

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGS  1415
             +Q                                               RVVMFSYGSG 
Sbjct  304   NQ-----------------------------------------------RVVMFSYGSGL  316

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
             ++TMFS +++EGQHPFSLSNIAAVLN++EKLK+RH F PEKFVE LK+MEHRYGAKDFVT
Sbjct  317   SSTMFSFKLQEGQHPFSLSNIAAVLNVSEKLKARHVFTPEKFVETLKLMEHRYGAKDFVT  376

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
             SKD SLL+PGT+YLT VD  YRR+Y KK  +  + NG
Sbjct  377   SKDTSLLSPGTFYLTNVDHMYRRYYVKKSAE-GMTNG  412



>ref|XP_007152356.1| hypothetical protein PHAVU_004G123000g [Phaseolus vulgaris]
 gb|ESW24350.1| hypothetical protein PHAVU_004G123000g [Phaseolus vulgaris]
Length=400

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/395 (80%), Positives = 357/395 (90%), Gaps = 0/395 (0%)
 Frame = +3

Query  498   MSLTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTN  677
             ++LT V SLLEK+ VDPKQIGRLEVGSETVIDKSKSIKTFLMQ+FE  GNTDIEGVDSTN
Sbjct  2     LNLTVVASLLEKFNVDPKQIGRLEVGSETVIDKSKSIKTFLMQVFEASGNTDIEGVDSTN  61

Query  678   ACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPI  857
             ACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPI
Sbjct  62    ACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPI  121

Query  858   VFESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKS  1037
              FESKLRGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C K+EKLEG+ 
Sbjct  122   AFESKLRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYRIFCEKFEKLEGRP  181

Query  1038  FSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSN  1217
             FS++D+DYFVFHSPYNKLVQKSF RL FNDF+RN S+++EA +E LAP++SL+ DESY +
Sbjct  182   FSISDSDYFVFHSPYNKLVQKSFGRLYFNDFMRNLSFVDEAARETLAPYASLSSDESYQS  241

Query  1218  RDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMF  1397
             RDLEKA+QQ +K  YDAKVQPSTL+PKQVGNMYTAS+YAAF SL+HNK+++L G+RVVMF
Sbjct  242   RDLEKANQQAAKHVYDAKVQPSTLIPKQVGNMYTASLYAAFASLLHNKNTSLVGKRVVMF  301

Query  1398  SYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYG  1577
             SYGSG TATMFS+ ++EGQHPF+LSNI  V+N+++KLK R E PPEKFVE LKIMEHRYG
Sbjct  302   SYGSGLTATMFSVHLQEGQHPFNLSNIVTVMNVSDKLKQRLEIPPEKFVETLKIMEHRYG  361

Query  1578  AKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE  1682
              KDFVTSKDCS L PGT+YLT VDS YRR+YAKK+
Sbjct  362   GKDFVTSKDCSYLPPGTFYLTNVDSMYRRYYAKKD  396



>gb|KJB25737.1| hypothetical protein B456_004G207000 [Gossypium raimondii]
Length=371

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/358 (87%), Positives = 336/358 (94%), Gaps = 0/358 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVG+LA+EIYFPPTC+QQEALEAHDGASKGKYTIGLGQDCMAFC+EVEDVISMSLTAVT
Sbjct  3     KNVGVLAMEIYFPPTCVQQEALEAHDGASKGKYTIGLGQDCMAFCTEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPKQIGR EVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYTIDPKQIGRFEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESK R
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK  C KYEKLEGK FS++DAD
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKYFCYKYEKLEGKQFSISDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             Y VFHSPYNKLVQKSFA LLFNDF+RNAS +++  KEKL+PFS+LTGDESY +RDLEK S
Sbjct  243   YIVFHSPYNKLVQKSFACLLFNDFMRNASSVDDIAKEKLSPFSNLTGDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSG  1412
             QQ+SK  YDAKVQP+TL+PKQVGNMYTAS+YAAF SLIHNKHS L G+RV++FSYGSG
Sbjct  303   QQISKSLYDAKVQPTTLIPKQVGNMYTASLYAAFASLIHNKHSELAGKRVILFSYGSG  360



>gb|KHN31549.1| Hydroxymethylglutaryl-CoA synthase [Glycine soja]
Length=406

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/452 (71%), Positives = 363/452 (80%), Gaps = 48/452 (11%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             +S+  NVGILA++IYFPPTC+ Q+ALE HDG SKGKYTIGLGQDCMAFCSEVEDVISMSL
Sbjct  3     SSRPANVGILAMDIYFPPTCVTQDALEGHDGVSKGKYTIGLGQDCMAFCSEVEDVISMSL  62

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             T VTSLLEK+ VDPKQIG L VGSETVIDKSKSIKTFLMQ+FE                 
Sbjct  63    TVVTSLLEKFNVDPKQIGHLAVGSETVIDKSKSIKTFLMQVFE-----------------  105

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
                                            VYAEGPARPTGGAAAIAMLVGPDAPI FE
Sbjct  106   -------------------------------VYAEGPARPTGGAAAIAMLVGPDAPIAFE  134

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSV  1046
             SKLRGSHM+H YDFYKP L SEYP+VDGKLSQTCYLMALDSCY+  C K+EKLEG+ FS+
Sbjct  135   SKLRGSHMSHAYDFYKPNLASEYPIVDGKLSQTCYLMALDSCYRLYCEKFEKLEGRPFSM  194

Query  1047  ADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDL  1226
             +D+DYFVFHSPYNKLVQKSF RL FNDFLRNAS+++E  +E LAP++SL+GDESY +RDL
Sbjct  195   SDSDYFVFHSPYNKLVQKSFGRLYFNDFLRNASFVDEVARETLAPYASLSGDESYQSRDL  254

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYG  1406
             EKA+QQ +K  YDAKVQPSTL+PKQVGNMYTAS+YAAF SL+HNK+S+L G+RVVMFSYG
Sbjct  255   EKANQQAAKHLYDAKVQPSTLIPKQVGNMYTASLYAAFASLLHNKNSSLVGKRVVMFSYG  314

Query  1407  SGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKD  1586
             SG TATMFS +++EGQHPF+LSNI  V+N+++KLK R E PPEKFVE LKIMEHRYG KD
Sbjct  315   SGLTATMFSFQLQEGQHPFNLSNIVTVMNVSDKLKQRVEIPPEKFVETLKIMEHRYGGKD  374

Query  1587  FVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE  1682
             FVTSKDCS L PGT+YLT VDS YRRFYAKK+
Sbjct  375   FVTSKDCSYLTPGTFYLTNVDSMYRRFYAKKD  406



>gb|EAZ07863.1| hypothetical protein OsI_30125 [Oryza sativa Indica Group]
Length=419

 Score =   666 bits (1719),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/465 (69%), Positives = 364/465 (78%), Gaps = 54/465 (12%)
 Frame = +3

Query  333   QQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTA  512
             Q  +VGILA++IYFPP C+ QEALEAHDGASKGKYTIGLGQDCMA+CSEVEDVISMSLT 
Sbjct  3     QPNDVGILAMDIYFPPACVHQEALEAHDGASKGKYTIGLGQDCMAYCSEVEDVISMSLTV  62

Query  513   VTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGG  692
             V SLL+KY +DPKQIGRLEVGSETVIDKSKSIKT+LM IFE+ GNTDIEGVDS+NACYGG
Sbjct  63    VASLLKKYNIDPKQIGRLEVGSETVIDKSKSIKTWLMHIFEESGNTDIEGVDSSNACYGG  122

Query  693   TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESK  872
             TAAL NCVNWVES SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK
Sbjct  123   TAALLNCVNWVESKSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFESK  182

Query  873   LRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVAD  1052
              R SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C+KYEK+ G+ FS++D
Sbjct  183   YRASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQYCTKYEKIVGEQFSISD  242

Query  1053  ADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEK  1232
             A+Y VFHSPYNK                                                
Sbjct  243   AEYCVFHSPYNK------------------------------------------------  254

Query  1233  ASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSG  1412
             ASQQV+K  YD KVQPSTL+PKQ+GNMYTAS+YAA  S+I+NKH +L GQR++MFSYGSG
Sbjct  255   ASQQVAKHLYDIKVQPSTLLPKQIGNMYTASLYAALASVIYNKHDSLDGQRILMFSYGSG  314

Query  1413  STATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFV  1592
              T+TMFSLR+ +GQHPFSL NIA+ L++  KL+SRH   PEKF+E LK+MEHRYGAKDF 
Sbjct  315   LTSTMFSLRLHDGQHPFSLMNIASALDVTTKLESRHVTSPEKFIETLKLMEHRYGAKDFE  374

Query  1593  TSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKA------AVANGH  1709
             TSKD SLL PGT+YLT+VDS YRRFY KK  +        +ANGH
Sbjct  375   TSKDTSLLPPGTFYLTKVDSMYRRFYDKKAAEGKIKGCNGIANGH  419



>gb|KHG05295.1| Hydroxymethylglutaryl-CoA synthase -like protein [Gossypium arboreum]
Length=369

 Score =   659 bits (1701),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/369 (84%), Positives = 333/369 (90%), Gaps = 6/369 (2%)
 Frame = +3

Query  621   MQIFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPA  800
             MQIFEK GNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPA
Sbjct  1     MQIFEKSGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPA  60

Query  801   RPTGGAAAIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMA  980
             RPTGGAAAIAML+GPDAPI FESKLRGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMA
Sbjct  61    RPTGGAAAIAMLIGPDAPIAFESKLRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMA  120

Query  981   LDSCYKSLCSKYEKLEGKSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEA  1160
             LD+CYK  C KYEKLEGK FS++DA YFVFHSPYNKLVQKSF+RLLFNDFLRNAS ++E 
Sbjct  121   LDTCYKYFCHKYEKLEGKQFSLSDAAYFVFHSPYNKLVQKSFSRLLFNDFLRNASSVDEI  180

Query  1161  DKEKLAPFSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAF  1340
              KEKLAPFS+LTGDESY NRDLEKASQQ SK  YDAKVQP+TL+PKQVGNMYTAS+YAAF
Sbjct  181   TKEKLAPFSTLTGDESYQNRDLEKASQQASKSLYDAKVQPTTLIPKQVGNMYTASLYAAF  240

Query  1341  ISLIHNKHSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRH  1520
              SLIHNKHS L G+RV++FSYGSG TATMFSLR  EGQHPFSLSNIA+V+N+  KLKSRH
Sbjct  241   ASLIHNKHSELAGKRVILFSYGSGLTATMFSLRFHEGQHPFSLSNIASVMNVGGKLKSRH  300

Query  1521  EFPPEKFVEILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE------  1682
             EFPPEKFVE +K+MEHRYGAKDFVTSKDCSLL+PGTYYLTEVDS YRRFYAKK+      
Sbjct  301   EFPPEKFVETMKLMEHRYGAKDFVTSKDCSLLSPGTYYLTEVDSMYRRFYAKKDGDFAAC  360

Query  1683  TKAAVANGH  1709
                ++ANGH
Sbjct  361   DNGSIANGH  369



>gb|EMS54524.1| Hydroxymethylglutaryl-CoA synthase [Triticum urartu]
Length=419

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/466 (69%), Positives = 361/466 (77%), Gaps = 59/466 (13%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGILA+++YFPPTC+QQEALE HDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT V 
Sbjct  4     KDVGILAMDMYFPPTCVQQEALEVHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVVK  63

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+ GNTDIEGVDS+NACYGGTA
Sbjct  64    SLLEKYHIDPKLIGRLEVGSETVIDKSKSIKTWLMQIFEESGNTDIEGVDSSNACYGGTA  123

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES  WDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK R
Sbjct  124   ALLNCVNWVESRCWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFESKYR  183

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C+KYEKL G+ FS++DAD
Sbjct  184   ASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQYCAKYEKLVGEKFSISDAD  243

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             Y VFHSPYNKLVQKSFARL FNDF+RN S ++   KEKL PF++LT +ESY +RDLEK S
Sbjct  244   YCVFHSPYNKLVQKSFARLYFNDFMRNCSSVDNDAKEKLQPFANLTSEESYQSRDLEKGS  303

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K  YD KVQPSTL+PKQ+GNMYTAS+YAA  S+I+NKH++L               
Sbjct  304   QQLAKHLYDIKVQPSTLLPKQIGNMYTASLYAALASVIYNKHASLTS-------------  350

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
                                                  PEKF++ LK+MEHRYGAKDF TS
Sbjct  351   -------------------------------------PEKFIDTLKLMEHRYGAKDFETS  373

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKK---------ETKAAVANGH  1709
             KD SLL PGT+YLT+VDS YRRFY KK         +    +ANGH
Sbjct  374   KDISLLPPGTFYLTKVDSMYRRFYEKKTDSIVDGKIKCSNGIANGH  419



>emb|CBI31867.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   659 bits (1699),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/464 (70%), Positives = 371/464 (80%), Gaps = 28/464 (6%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MAS  KNVGILA+EIYFP TC+QQEALEAHDGASKGKYTIGLGQDC AFC+EVEDVISMS
Sbjct  1     MASSPKNVGILAMEIYFPRTCVQQEALEAHDGASKGKYTIGLGQDCTAFCTEVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LTAV SLLEKYE+DPKQIGRLEVGSETVIDKSKSIKTFLMQIFE+ GNTDIEGVDSTNAC
Sbjct  61    LTAVASLLEKYEIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEESGNTDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFNC+NWVESSSWDGR+GLVVCTD+AVYAEGPARPTGGAAAIAMLVGP API F
Sbjct  121   YGGTAALFNCINWVESSSWDGRHGLVVCTDNAVYAEGPARPTGGAAAIAMLVGPGAPIAF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK +GSHM+H YDFYKP L SEYPV+         L+ +  C K+L      +  +  S
Sbjct  181   ESKFKGSHMSHAYDFYKPNLASEYPVM---------LLHIFFCVKTLWCYIYVISCREIS  231

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNA------------SYINEADKEKLAPFS  1187
                      H+  N   Q      +F +F+               S ++EA +EKLAPFS
Sbjct  232   -------KLHNMRNLETQLLLCVFVFVEFIWCTLVRFTVYCFCLISLVDEAAREKLAPFS  284

Query  1188  SLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHS  1367
             +L+ DESY +RDLE A+QQ +K  YDAKVQP+TL+PKQVGNMYTAS+YAAF SL+HNK+ 
Sbjct  285   ALSKDESYQSRDLETATQQEAKHLYDAKVQPTTLLPKQVGNMYTASLYAAFASLLHNKND  344

Query  1368  TLPGQRVVMFSYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVE  1547
             +L G+RV+MFSYGSG TATMFS +++ GQHPFSL NIA V+N++EKLKSR EFPPEKFV+
Sbjct  345   SLAGKRVIMFSYGSGLTATMFSFQLQNGQHPFSLLNIAMVMNVSEKLKSRLEFPPEKFVK  404

Query  1548  ILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
              LK+MEHRYGAK FV SKDCSLLA GTYYLTEVDS YRRFYAKK
Sbjct  405   TLKLMEHRYGAKAFVMSKDCSLLASGTYYLTEVDSMYRRFYAKK  448



>gb|EMT03685.1| Hydroxymethylglutaryl-CoA synthase [Aegilops tauschii]
Length=419

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/466 (69%), Positives = 361/466 (77%), Gaps = 59/466 (13%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGILA+++YFPPTC+QQEALE HDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT V 
Sbjct  4     KDVGILAMDMYFPPTCVQQEALEVHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTVVK  63

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY +DPK IGRLEVGSETVIDKSKSIKT+LMQIFE+ GNTDIEGVDS+NACYGGTA
Sbjct  64    SLLEKYHIDPKLIGRLEVGSETVIDKSKSIKTWLMQIFEESGNTDIEGVDSSNACYGGTA  123

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             AL NCVNWVES  WDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GP+API FESK R
Sbjct  124   ALLNCVNWVESRCWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPNAPISFESKYR  183

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C+KYEKL G+ FS++DAD
Sbjct  184   ASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQYCAKYEKLVGEQFSISDAD  243

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             Y VFHSPYNKLVQKSFARL FNDF+RN S ++   KEKL PF++LT +ESY +RDLEK S
Sbjct  244   YCVFHSPYNKLVQKSFARLYFNDFMRNCSSVDNDAKEKLQPFANLTSEESYQSRDLEKGS  303

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGST  1418
             QQ++K  YD KVQPSTL+PKQ+GNMYTAS+YAA  S+I+NKH++L               
Sbjct  304   QQLAKHLYDIKVQPSTLLPKQIGNMYTASLYAALASVIYNKHASLTS-------------  350

Query  1419  ATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTS  1598
                                                  PEKF++ LK+MEHRYGAKDF TS
Sbjct  351   -------------------------------------PEKFIDTLKLMEHRYGAKDFETS  373

Query  1599  KDCSLLAPGTYYLTEVDSKYRRFYAKK---------ETKAAVANGH  1709
             KD SLL PGT+YLT+VDS YRRFY KK         +    +ANGH
Sbjct  374   KDISLLPPGTFYLTKVDSMYRRFYEKKTDGIVDGKIKCSNGIANGH  419



>gb|KDO63606.1| hypothetical protein CISIN_1g012353mg [Citrus sinensis]
Length=354

 Score =   651 bits (1680),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/345 (88%), Positives = 328/345 (95%), Gaps = 0/345 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQ+CMAFCSEVEDVISMSLTAVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +LLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    NLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+ MLVGPDAP+ FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK LCSKYEKLEGK FS+++AD
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARLLFNDF+RNAS ++EA KEKL PFS+L+GDESY +RDLEK S
Sbjct  243   YFVFHSPYNKLVQKSFARLLFNDFMRNASSVDEAAKEKLGPFSTLSGDESYQSRDLEKVS  302

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTL  1373
             QQ++KP YDAKVQPSTL+PKQVGNMYTAS+YAA  SLIHNKHS L
Sbjct  303   QQLAKPLYDAKVQPSTLIPKQVGNMYTASLYAALASLIHNKHSEL  347



>ref|XP_007038549.1| Hydroxymethylglutaryl-CoA synthase / HMG-CoA synthase / 3-hydroxy-3-methylglutaryl 
coenzyme A synthase isoform 2, partial 
[Theobroma cacao]
 gb|EOY23050.1| Hydroxymethylglutaryl-CoA synthase / HMG-CoA synthase / 3-hydroxy-3-methylglutaryl 
coenzyme A synthase isoform 2, partial 
[Theobroma cacao]
Length=363

 Score =   646 bits (1666),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/362 (83%), Positives = 334/362 (92%), Gaps = 0/362 (0%)
 Frame = +3

Query  462   MAFCSEVEDVISMSLTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKC  641
             MAFC+EVEDVISMSLT VTSLLEKYE+DP +IGRLEVGSETVIDKSKSIKTFLMQIFE+C
Sbjct  1     MAFCTEVEDVISMSLTVVTSLLEKYEIDPTKIGRLEVGSETVIDKSKSIKTFLMQIFEEC  60

Query  642   GNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA  821
             GNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA
Sbjct  61    GNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA  120

Query  822   AIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKS  1001
             AIAMLVGP+API FESK RGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD CYK 
Sbjct  121   AIAMLVGPNAPIAFESKFRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDLCYKH  180

Query  1002  LCSKYEKLEGKSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAP  1181
                K+EKL+G+ FS++DADYFVFHSPYNKLVQKSFARL FNDFLRNASYI+E  KEKL P
Sbjct  181   FYEKFEKLQGRPFSISDADYFVFHSPYNKLVQKSFARLFFNDFLRNASYIDEGAKEKLTP  240

Query  1182  FSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNK  1361
             FS L+ DESY +RDLEKASQQV+KP YD+ VQPSTL+PKQVGNMYTAS+YAAF SL+HNK
Sbjct  241   FSGLSNDESYQSRDLEKASQQVAKPLYDSMVQPSTLLPKQVGNMYTASLYAAFASLLHNK  300

Query  1362  HSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKF  1541
             H++L G+RVVMFSYGSG TAT+FSL++++G+HPF+L NIA ++N++EKLK RHEFPPEKF
Sbjct  301   HTSLAGKRVVMFSYGSGLTATIFSLKLQDGRHPFNLLNIAKLMNVSEKLKLRHEFPPEKF  360

Query  1542  VE  1547
             V+
Sbjct  361   VD  362



>ref|XP_010919200.1| PREDICTED: hydroxymethylglutaryl-CoA synthase isoform X3 [Elaeis 
guineensis]
Length=422

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/470 (66%), Positives = 361/470 (77%), Gaps = 56/470 (12%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             M  ++K+ GILA++IYFP TC+QQE LE + G S+GKYTIGLGQDCMAFC+E+EDV+SMS
Sbjct  1     MDGEKKSAGILAMDIYFPSTCVQQEELEVYYGVSRGKYTIGLGQDCMAFCTELEDVVSMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V SLLEKY++DP+QIGRLEVG+ET+IDKSKSIKT+LMQIFE                
Sbjct  61    LTVVKSLLEKYQIDPRQIGRLEVGTETIIDKSKSIKTWLMQIFE----------------  104

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
                                             VYAEGPARPTGGAAAIAML+GP+API F
Sbjct  105   --------------------------------VYAEGPARPTGGAAAIAMLIGPNAPISF  132

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             ESK RG+HM+H YDFYKP L SEYPVVDGKLSQ CYLMALDSCYK  C+K E  EGK FS
Sbjct  133   ESKFRGTHMSHAYDFYKPNLASEYPVVDGKLSQICYLMALDSCYKHFCNKNENFEGKQFS  192

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + DADYFVFHSPYNKLVQKSFARL FNDFLRN+S I EA +EKL PF +L+GDESY +R+
Sbjct  193   IFDADYFVFHSPYNKLVQKSFARLYFNDFLRNSSCIEEAAREKLEPFLNLSGDESYQSRE  252

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKASQQV+K  YDAKVQPSTL+PKQVGNMYTAS+YA+F SL+HNKHSTL GQRVVMFSY
Sbjct  253   LEKASQQVAKHLYDAKVQPSTLIPKQVGNMYTASLYASFASLLHNKHSTLGGQRVVMFSY  312

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG ++TMFS +I++GQHPFSLSNI  V+NI++KL+ RH FP EKF E +K+ME RYGAK
Sbjct  313   GSGLSSTMFSFKIQDGQHPFSLSNIVNVMNISQKLELRHVFPTEKFAETMKLMERRYGAK  372

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK--------ETKAAVANGH  1709
             DFVTSKD SLL PGT+YLT+VDS YRR+YAKK            +  NGH
Sbjct  373   DFVTSKDTSLLYPGTFYLTQVDSLYRRYYAKKGADDTTVIHANRSFVNGH  422



>gb|KDO60145.1| hypothetical protein CISIN_1g012253mg [Citrus sinensis]
Length=354

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/345 (85%), Positives = 317/345 (92%), Gaps = 0/345 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILAL+IYFPPTC+ QEALE HDG SKGKYT+GLGQDCMAFCSEVEDVISMSLT VT
Sbjct  7     KNVGILALDIYFPPTCVLQEALEVHDGVSKGKYTVGLGQDCMAFCSEVEDVISMSLTVVT  66

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DP QIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  67    SLLEKYKIDPTQIGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDIEGVDSTNACYGGTA  126

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AML+GPDAPI FESKLR
Sbjct  127   ALFNCVNWVESASWDGRYGLVVCTDSAVYAEGPARPTGGAAAVAMLIGPDAPIAFESKLR  186

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C K+EKLEG+ FS+ D D
Sbjct  187   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKYFCQKFEKLEGRQFSMLDVD  246

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL FNDFLRNAS ++E  KEKLAP+S+L+  ESY +RDLEKAS
Sbjct  247   YFVFHSPYNKLVQKSFARLFFNDFLRNASSVDEIAKEKLAPYSTLSDVESYQSRDLEKAS  306

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTL  1373
             QQV+K  YD KVQPSTL+PKQVGNMYTAS+YAAF SL+H KHS+L
Sbjct  307   QQVAKQLYDLKVQPSTLIPKQVGNMYTASLYAAFASLLHEKHSSL  351



>gb|ABE73758.1| 3-hydroxy-3-methylglutaryl CoA synthase [Medicago truncatula]
Length=348

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/331 (86%), Positives = 310/331 (94%), Gaps = 0/331 (0%)
 Frame = +3

Query  342   NVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVTS  521
             NVGILAL+IYFPP C+QQEALEAHDGASKGKYTIGLGQDCM+FCS+VEDVISMSLT V++
Sbjct  8     NVGILALDIYFPPNCVQQEALEAHDGASKGKYTIGLGQDCMSFCSDVEDVISMSLTVVST  67

Query  522   LLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTAA  701
             LL+KYE+DPKQIGRLEVGSETVIDKSKSIK+FLMQIFEK GNTDIEGVDSTNACYGGTAA
Sbjct  68    LLQKYEIDPKQIGRLEVGSETVIDKSKSIKSFLMQIFEKYGNTDIEGVDSTNACYGGTAA  127

Query  702   LFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRG  881
             LFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAML+GPDAPI FESKLRG
Sbjct  128   LFNCVNWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLIGPDAPISFESKLRG  187

Query  882   SHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADADY  1061
             SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALD+C+K+ C KYEK EGK FS++DADY
Sbjct  188   SHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDTCFKNFCQKYEKHEGKQFSLSDADY  247

Query  1062  FVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKASQ  1241
             FVFHSPYNKLVQKSFARL+F+DFLRN S  +E   EKL PF++L+ DESY +RDLEKASQ
Sbjct  248   FVFHSPYNKLVQKSFARLVFSDFLRNPSSKDEVTNEKLGPFTTLSDDESYQSRDLEKASQ  307

Query  1242  QVSKPFYDAKVQPSTLVPKQVGNMYTASIYA  1334
             QV+KP YD KVQPSTL+PKQVGNMYTASIYA
Sbjct  308   QVAKPLYDEKVQPSTLIPKQVGNMYTASIYA  338



>ref|XP_001774681.1| predicted protein [Physcomitrella patens]
 gb|EDQ60496.1| predicted protein [Physcomitrella patens]
Length=461

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/455 (63%), Positives = 359/455 (79%), Gaps = 3/455 (1%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MA++ +NVGILA+++YFP + + QE LE HDG SKGKYTIGLGQD +AFC+++EDVISMS
Sbjct  1     MAARPQNVGILAMDVYFPASYVSQEELEEHDGVSKGKYTIGLGQDRLAFCTDLEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V SLLEKYE+   +IGRLEVGSETVIDKSK+IKT LMQ+FE  GN DIEGVDSTNAC
Sbjct  61    LTVVKSLLEKYEIPADRIGRLEVGSETVIDKSKAIKTSLMQLFEDSGNGDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAAL NC+NWVESS+WDGRY +VV  DSAVYAEGPARPTGGA A+AML+GPDAPIVF
Sbjct  121   YGGTAALQNCLNWVESSAWDGRYAIVVAADSAVYAEGPARPTGGAGAVAMLIGPDAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             E +L G+HMA+ YDFYKP L SEYPVVDGKLSQTCYL A+DSCY+  C KYEK  GK F+
Sbjct  181   ERRLSGTHMANAYDFYKPNLASEYPVVDGKLSQTCYLQAVDSCYRRFCLKYEKFAGKPFT  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             ++DA Y + H+PYNKLVQKSFARL++ND+LRNAS+++E    +  PF+ L+  +S  NRD
Sbjct  241   LSDASYVICHAPYNKLVQKSFARLVYNDYLRNASFVDEEAGARFQPFAILSPTDSLLNRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK SQ+V+K  Y+ KV P+T++PK++GNMY AS+YA   +L+HNK S+L G+R++MFSY
Sbjct  301   LEKVSQEVAKKQYNEKVGPTTMLPKELGNMYCASLYAGLATLVHNKSSSLDGERILMFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  A++FS +   GQ    LS IA  ++I  KL SR    P++FVE + +ME RYGAK
Sbjct  361   GSGLAASLFSCKFTGGQK---LSEIAEKMDIVAKLDSRIAVTPKEFVETMHLMETRYGAK  417

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETK  1688
             D+      S L P T+Y+T+VD+ YRR Y + + K
Sbjct  418   DYTPISSKSTLRPSTFYITQVDALYRRTYERYQAK  452



>ref|XP_001772764.1| predicted protein [Physcomitrella patens]
 gb|EDQ62478.1| predicted protein [Physcomitrella patens]
Length=459

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/452 (64%), Positives = 359/452 (79%), Gaps = 3/452 (1%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             M ++ +NVGILA+++YFP + + QEALE HDG SKGKYTIGLGQD +AFC+++EDVISMS
Sbjct  1     MTTRPQNVGILAMDVYFPASYVHQEALEEHDGVSKGKYTIGLGQDRLAFCTDLEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V SLLEKY + P+ IGRLEVGSETVIDKSK+IKT LMQ+FE+ GN DIEGVDSTNAC
Sbjct  61    LTVVKSLLEKYGIAPESIGRLEVGSETVIDKSKAIKTCLMQLFEESGNGDIEGVDSTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAAL N +NWVESS+WDGRY +VV  DSAVYAEG ARPTGGA A+AML+GP+APIVF
Sbjct  121   YGGTAALQNSLNWVESSAWDGRYAIVVAADSAVYAEGAARPTGGAGAVAMLIGPNAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             E  L G+HMA+VYDFYKP L SEYP+VDGKLSQTCYL ALDSCY+  C KYEK  GK F+
Sbjct  181   ERCLSGTHMANVYDFYKPNLASEYPIVDGKLSQTCYLQALDSCYRRFCEKYEKHSGKPFT  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             ++DA Y V H+PYNKLVQKSFARL++ND++RNAS+++E       PF++L+  +S  NRD
Sbjct  241   LSDASYVVCHAPYNKLVQKSFARLVYNDYIRNASFVSEDAAALFEPFATLSPTDSLLNRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK SQQV+K  YD KV P+T++PK++GNMY AS+YA   +L+HNK S+L GQR+++FSY
Sbjct  301   LEKVSQQVAKKQYDVKVAPTTMLPKELGNMYCASLYAGLATLVHNKSSSLDGQRILLFSY  360

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  +++FS +  EGQ    L+ IA  ++IA KL+SR    P +FVE + +ME RYGAK
Sbjct  361   GSGLASSLFSCKFVEGQK---LAEIAEKMDIAAKLQSRIAVTPTEFVETMHLMETRYGAK  417

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             DF+     S L P TYY+T+VD+ YRR Y + 
Sbjct  418   DFIPVSSKSTLRPMTYYITQVDNLYRRSYDRN  449



>ref|XP_002982918.1| hypothetical protein SELMODRAFT_228892 [Selaginella moellendorffii]
 gb|EFJ16163.1| hypothetical protein SELMODRAFT_228892 [Selaginella moellendorffii]
Length=457

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/461 (62%), Positives = 360/461 (78%), Gaps = 6/461 (1%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MA    +VGILALE+YFPP+C++Q+ LE HDG S GKYT GLGQ+ +AFC++VEDVISMS
Sbjct  1     MAGCPGDVGILALEVYFPPSCVRQDELEKHDGVSAGKYTAGLGQERLAFCTDVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V +LLEKY + P+++GRLEVGSETVIDKSKSIKT+LM++FE+ GN+DI+GVDS+NAC
Sbjct  61    LTVVKNLLEKYSIAPEKVGRLEVGSETVIDKSKSIKTWLMRLFEESGNSDIQGVDSSNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAAL NC+NWVESS WDGRYGLVV  DSAVYAEGPARP+GGA A+AML+GP+AP V 
Sbjct  121   YGGTAALINCLNWVESSGWDGRYGLVVAADSAVYAEGPARPSGGAGAVAMLIGPNAPFVI  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             + K  G+HM+H YDFYKP L SEYPV+DG+LSQ CYLMALD CY   C KYEK +GK FS
Sbjct  181   DRKYMGTHMSHTYDFYKPNLSSEYPVLDGRLSQKCYLMALDLCYNRYCQKYEKADGKPFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + D +Y VFHSPYNKLVQKSFARL++ND  R        + EKL PF++++ DESY+N+D
Sbjct  241   LQDVNYAVFHSPYNKLVQKSFARLVYNDIQRKT----RPEDEKLKPFANISEDESYTNKD  296

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKA+Q ++KP Y+ KV PSTL+PKQVGNMY A++YAA  SLIHNK   L G  ++MFSY
Sbjct  297   LEKATQDIAKPDYNLKVVPSTLIPKQVGNMYCAALYAALASLIHNKAEELLGNTILMFSY  356

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  +++F++ +R+G   F ++NIA  + ++  L+SR +  PE FV  +++ME RYGAK
Sbjct  357   GSGLASSLFTIHVRQGDGLFRVANIAKRMEVSSSLESRVQVSPEDFVHTMELMETRYGAK  416

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
              F    D + L PGT+YLT+VD  YRRFY +     A +NG
Sbjct  417   GFTPVSDLARLRPGTFYLTQVDDLYRRFYDR--LPQATSNG  455



>ref|XP_002981938.1| hypothetical protein SELMODRAFT_179152 [Selaginella moellendorffii]
 gb|EFJ17031.1| hypothetical protein SELMODRAFT_179152 [Selaginella moellendorffii]
Length=457

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/461 (62%), Positives = 361/461 (78%), Gaps = 6/461 (1%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             MA +  +VGILALE+YFPP+C++Q+ LE HDG S GKYT GLGQ+ +AFC++VEDVISMS
Sbjct  1     MAVRPGDVGILALEVYFPPSCVRQDELEKHDGVSAGKYTAGLGQERLAFCTDVEDVISMS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V +LLEKY + P+++GRLEVGSETVIDKSKSIKT+LM++FE+ GN+DI+GVDS+NAC
Sbjct  61    LTVVKNLLEKYSIAPEKVGRLEVGSETVIDKSKSIKTWLMRLFEESGNSDIQGVDSSNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAAL NC+NWVESS WDGRYGLVV  DSAVYAEGPARP+GGA A+AML+GP+AP V 
Sbjct  121   YGGTAALINCLNWVESSGWDGRYGLVVAADSAVYAEGPARPSGGAGAVAMLIGPNAPFVI  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             + K  G+HM+H YDFYKP L SEYPV+DG+LSQ CYLMALD CY   C KYEK +GK FS
Sbjct  181   DRKYMGTHMSHTYDFYKPNLSSEYPVLDGRLSQKCYLMALDLCYNRYCQKYEKADGKPFS  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + D +Y VFHSPYNKLVQKSFARL++ND  R        + EKL PF++++ DESY+N+D
Sbjct  241   LQDVNYAVFHSPYNKLVQKSFARLVYNDIQRK----TRPEDEKLKPFANISEDESYTNKD  296

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEKA+Q ++KP Y+ KV PSTL+PKQVGNMY A++YAA  SLIH+K   L G  ++MFSY
Sbjct  297   LEKATQDIAKPDYNLKVVPSTLIPKQVGNMYCAALYAALASLIHSKAEELLGNTILMFSY  356

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  +++F++ +R+G   F ++NIA  + ++  L+SR +  PE FV  +++ME RYGAK
Sbjct  357   GSGLASSLFTIHVRQGDGLFRVANIAKRMEVSSSLESRVQVSPEDFVHTMELMETRYGAK  416

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
              F    D + L PGT+YLT+VD  YRRFY +     A +NG
Sbjct  417   GFTPVSDLARLRPGTFYLTQVDDLYRRFYDR--LPQATSNG  455



>gb|KDO63607.1| hypothetical protein CISIN_1g012353mg [Citrus sinensis]
Length=305

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/298 (89%), Positives = 286/298 (96%), Gaps = 0/298 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQ+CMAFCSEVEDVISMSLTAVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +LLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    NLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+ MLVGPDAP+ FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK LCSKYEKLEGK FS+++AD
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEK  1232
             YFVFHSPYNKLVQKSFARLLFNDF+RNAS ++EA KEKL PFS+L+GDESY +RDLEK
Sbjct  243   YFVFHSPYNKLVQKSFARLLFNDFMRNASSVDEAAKEKLGPFSTLSGDESYQSRDLEK  300



>gb|EYU39003.1| hypothetical protein MIMGU_mgv1a006016mg [Erythranthe guttata]
Length=383

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/304 (88%), Positives = 283/304 (93%), Gaps = 0/304 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA+E+YFPPTC+QQE LEAHDGASKGKYTIGLGQDCMAFC EVEDVISMS+TAVT
Sbjct  3     KNVGILAMEVYFPPTCIQQEVLEAHDGASKGKYTIGLGQDCMAFCDEVEDVISMSMTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY VDPKQIGRLEVGSETV+DKSKSIKTFLM IFEKCGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYGVDPKQIGRLEVGSETVLDKSKSIKTFLMPIFEKCGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNC+NWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPI FESKLR
Sbjct  123   ALFNCINWVESNSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHM+HVYDFYKP L SEYPVVDGKLSQTCYLMALDSCYKSLC KYEK+EGK FS+ DAD
Sbjct  183   ASHMSHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYKSLCDKYEKMEGKQFSINDAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSF+RLLFNDF R AS I+EA KEKL+PFSSL+ DESY +RDLEK  
Sbjct  243   YFVFHSPYNKLVQKSFSRLLFNDFTRAASSIDEAAKEKLSPFSSLSNDESYQSRDLEKVF  302

Query  1239  QQVS  1250
               ++
Sbjct  303   NHLT  306



>ref|XP_007038550.1| Hydroxymethylglutaryl-CoA synthase / HMG-CoA synthase / 3-hydroxy-3-methylglutaryl 
coenzyme A synthase isoform 3 [Theobroma 
cacao]
 gb|EOY23051.1| Hydroxymethylglutaryl-CoA synthase / HMG-CoA synthase / 3-hydroxy-3-methylglutaryl 
coenzyme A synthase isoform 3 [Theobroma 
cacao]
Length=307

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 260/304 (86%), Positives = 281/304 (92%), Gaps = 0/304 (0%)
 Frame = +3

Query  462   MAFCSEVEDVISMSLTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKC  641
             MAFC+EVEDVISMSLT VTSLLEKYE+DP +IGRLEVGSETVIDKSKSIKTFLMQIFE+C
Sbjct  1     MAFCTEVEDVISMSLTVVTSLLEKYEIDPTKIGRLEVGSETVIDKSKSIKTFLMQIFEEC  60

Query  642   GNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA  821
             GNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA
Sbjct  61    GNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAA  120

Query  822   AIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKS  1001
             AIAMLVGP+API FESK RGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD CYK 
Sbjct  121   AIAMLVGPNAPIAFESKFRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDLCYKH  180

Query  1002  LCSKYEKLEGKSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAP  1181
                K+EKL+G+ FS++DADYFVFHSPYNKLVQKSFARL FNDFLRNASYI+E  KEKL P
Sbjct  181   FYEKFEKLQGRPFSISDADYFVFHSPYNKLVQKSFARLFFNDFLRNASYIDEGAKEKLTP  240

Query  1182  FSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNK  1361
             FS L+ DESY +RDLEKASQQV+KP YD+ VQPSTL+PKQVGNMYTAS+YAAF SL+HNK
Sbjct  241   FSGLSNDESYQSRDLEKASQQVAKPLYDSMVQPSTLLPKQVGNMYTASLYAAFASLLHNK  300

Query  1362  HSTL  1373
             H++L
Sbjct  301   HTSL  304



>ref|XP_007038551.1| Hydroxymethylglutaryl-CoA synthase / HMG-CoA synthase / 3-hydroxy-3-methylglutaryl 
coenzyme A synthase isoform 4, partial 
[Theobroma cacao]
 gb|EOY23052.1| Hydroxymethylglutaryl-CoA synthase / HMG-CoA synthase / 3-hydroxy-3-methylglutaryl 
coenzyme A synthase isoform 4, partial 
[Theobroma cacao]
Length=310

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 252/309 (82%), Positives = 283/309 (92%), Gaps = 0/309 (0%)
 Frame = +3

Query  621   MQIFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPA  800
             MQIFE+CGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPA
Sbjct  1     MQIFEECGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPA  60

Query  801   RPTGGAAAIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMA  980
             RPTGGAAAIAMLVGP+API FESK RGSHM+H YDFYKP L SEYPVVDGKLSQTCYLMA
Sbjct  61    RPTGGAAAIAMLVGPNAPIAFESKFRGSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMA  120

Query  981   LDSCYKSLCSKYEKLEGKSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEA  1160
             LD CYK    K+EKL+G+ FS++DADYFVFHSPYNKLVQKSFARL FNDFLRNASYI+E 
Sbjct  121   LDLCYKHFYEKFEKLQGRPFSISDADYFVFHSPYNKLVQKSFARLFFNDFLRNASYIDEG  180

Query  1161  DKEKLAPFSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAF  1340
              KEKL PFS L+ DESY +RDLEKASQQV+KP YD+ VQPSTL+PKQVGNMYTAS+YAAF
Sbjct  181   AKEKLTPFSGLSNDESYQSRDLEKASQQVAKPLYDSMVQPSTLLPKQVGNMYTASLYAAF  240

Query  1341  ISLIHNKHSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRH  1520
              SL+HNKH++L G+RVVMFSYGSG TAT+FSL++++G+HPF+L NIA ++N++EKLK RH
Sbjct  241   ASLLHNKHTSLAGKRVVMFSYGSGLTATIFSLKLQDGRHPFNLLNIAKLMNVSEKLKLRH  300

Query  1521  EFPPEKFVE  1547
             EFPPEKFV+
Sbjct  301   EFPPEKFVD  309



>ref|XP_006421822.1| hypothetical protein CICLE_v10005099mg [Citrus clementina]
 gb|ESR35062.1| hypothetical protein CICLE_v10005099mg [Citrus clementina]
Length=326

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 259/306 (85%), Positives = 277/306 (91%), Gaps = 0/306 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILAL+IYFPPTC+ QEALE HDG SKGKYT+GLGQDCMAFCSEVEDVISMSLT VT
Sbjct  7     KNVGILALDIYFPPTCVLQEALEVHDGVSKGKYTVGLGQDCMAFCSEVEDVISMSLTVVT  66

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DP QIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  67    SLLEKYKIDPTQIGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDIEGVDSTNACYGGTA  126

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AML+GPDAPI FESKLR
Sbjct  127   ALFNCVNWVESASWDGRYGLVVCTDSAVYAEGPARPTGGAAAVAMLIGPDAPIAFESKLR  186

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C K+EKLEG+ FS+ D D
Sbjct  187   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKYFCQKFEKLEGRQFSMLDVD  246

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             YFVFHSPYNKLVQKSFARL FNDFLRNAS ++E  KEKLAP+S+L+  ESY +RDLEK S
Sbjct  247   YFVFHSPYNKLVQKSFARLFFNDFLRNASSVDEIAKEKLAPYSTLSDVESYQSRDLEKVS  306

Query  1239  QQVSKP  1256
                  P
Sbjct  307   YHSDCP  312



>ref|XP_002984961.1| hypothetical protein SELMODRAFT_121372 [Selaginella moellendorffii]
 gb|EFJ13836.1| hypothetical protein SELMODRAFT_121372 [Selaginella moellendorffii]
Length=450

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/448 (60%), Positives = 330/448 (74%), Gaps = 4/448 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGILA+E+YFP  C+ Q  L   D      YT GLGQ+ +AFC + EDVISMSLT V 
Sbjct  3     KDVGILAMEVYFPGVCVNQVDLARFDKVPPKYYTEGLGQERLAFCEDTEDVISMSLTVVK  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLE Y + P  IGRLEVGSETVIDKSKSIK++LM +FE+  N+ IEGVDSTNACYGGTA
Sbjct  63    SLLENYNISPSSIGRLEVGSETVIDKSKSIKSYLMPLFEE--NSGIEGVDSTNACYGGTA  120

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNW+ES SWDGR  +VV  D AVYAEG ARP+GGA A+AMLVGP+AP+V E    
Sbjct  121   ALFNCVNWIESRSWDGRLAIVVAADIAVYAEGTARPSGGAGAVAMLVGPNAPLVLERSYT  180

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             G++MAHVYDFYKP L SEYPVVD KLSQ CYL ALD CYK  C +YE +E + F+V +AD
Sbjct  181   GTYMAHVYDFYKPDLSSEYPVVDSKLSQKCYLKALDVCYKRYCERYESIEARPFTVQEAD  240

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             + VFH+P+NKLV++SF RLL+ND+ R+ S + E D EKL PF  LT D   SN  L++  
Sbjct  241   FLVFHAPFNKLVRRSFERLLWNDYQRDCSSLGE-DGEKLKPFQGLTADSIVSNASLKEVM  299

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTL-PGQRVVMFSYGSGS  1415
             + V++P YDAKV PSTL+P++VGN Y AS+YA   SL+HNK S L  GQ ++MFSYGSG 
Sbjct  300   KAVAEPGYDAKVSPSTLIPRRVGNTYCASLYAGLASLVHNKASLLDDGQSILMFSYGSGL  359

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
              +++FS+R+R  +   SL N+A  + I+EKL S     PEKFVE +KIME RYG+KDFV 
Sbjct  360   ASSLFSIRVRRVEGVHSLENVAKTMAISEKLDSCVAVSPEKFVETMKIMESRYGSKDFVP  419

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
               D + + PG +YL  VDS YRR Y ++
Sbjct  420   MGDLATVRPGAFYLAGVDSLYRRTYERR  447



>ref|XP_002986147.1| hypothetical protein SELMODRAFT_123543 [Selaginella moellendorffii]
 gb|EFJ12678.1| hypothetical protein SELMODRAFT_123543 [Selaginella moellendorffii]
Length=450

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/448 (59%), Positives = 331/448 (74%), Gaps = 4/448 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGILA+E+YFP  C+ Q  L   D      YT GLGQ+ +AFC + EDVISMSLT V 
Sbjct  3     KDVGILAMEVYFPGVCVNQVDLAKFDKVPPKYYTEGLGQERLAFCEDTEDVISMSLTVVK  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLE Y + P  IGRLEVGSETVIDKSKSIK++LM +FE+  N+ IEGVDSTNACYGGTA
Sbjct  63    SLLENYNISPSSIGRLEVGSETVIDKSKSIKSYLMPLFEE--NSGIEGVDSTNACYGGTA  120

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNW+ES SWDGR  +VV  D AVYAEG ARP+GGA A+AMLVGP+AP+V +    
Sbjct  121   ALFNCVNWIESRSWDGRLAIVVAADIAVYAEGAARPSGGAGAVAMLVGPNAPLVLDRSYT  180

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             G++MAHVYDFYKP L SEYPVVD KLSQ CYL ALD CYK  C +YE +E + F+V +A 
Sbjct  181   GTYMAHVYDFYKPDLSSEYPVVDSKLSQKCYLKALDVCYKRYCERYESMEARPFTVQEAH  240

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
             + VFH+P+NKLV++SF RLL+ND+ R+ S + E D EKL PF  LT D+  SN  L++  
Sbjct  241   FLVFHAPFNKLVRRSFERLLWNDYQRDCSSLGE-DGEKLKPFQGLTADDIVSNASLKEVM  299

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTL-PGQRVVMFSYGSGS  1415
             + V++P YDAKV PSTL+P++VGNMY AS+YA   SL+HNK S L  GQ ++MFSYGSG 
Sbjct  300   KAVAEPGYDAKVSPSTLIPRRVGNMYCASLYAGLASLVHNKASLLDDGQSILMFSYGSGL  359

Query  1416  TATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVT  1595
              +++FS+R+R  +   SL N+A  + I+EKL S     PEKFVE +K+ME RYG+KDFV 
Sbjct  360   ASSLFSIRVRRVEGVHSLENVAKTMAISEKLDSCVAVSPEKFVETMKLMESRYGSKDFVP  419

Query  1596  SKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
               D + + PG +YL  VDS YRR Y ++
Sbjct  420   LGDLAPVRPGAFYLARVDSLYRRTYERR  447



>gb|ABD57974.2| hydroxy-methylglutaryl CoA synthase, partial [Arnebia euchroma]
Length=317

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/317 (79%), Positives = 286/317 (90%), Gaps = 1/317 (0%)
 Frame = +3

Query  762   VCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSEYPV  941
             +CTDSAVYA+GPARPTGGAAA+AML+GPDAPI FESKLRGSHMAHVYDFYKP L SEYPV
Sbjct  1     ICTDSAVYADGPARPTGGAAAVAMLIGPDAPIAFESKLRGSHMAHVYDFYKPNLASEYPV  60

Query  942   VDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADADYFVFHSPYNKLVQKSFARLLF  1121
             VDGKLSQTCYLMALDSCYK+LC+KY+KLEGK FS++DADYFVFHSPYNKLV KSFARLLF
Sbjct  61    VDGKLSQTCYLMALDSCYKTLCNKYKKLEGKQFSISDADYFVFHSPYNKLVHKSFARLLF  120

Query  1122  NDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQ  1301
             NDF+ NAS I+EA KEK APF+SLTGDESY++RDLEK +QQV+KPFYD KVQP+TL+PKQ
Sbjct  121   NDFVNNASSIDEAAKEKFAPFASLTGDESYASRDLEKVAQQVAKPFYDTKVQPATLIPKQ  180

Query  1302  VGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPFSLSNIA  1481
             VGNMYTAS+YAAF SL+HNK+S+L G+RV+MFSYGS STATMFSLR+REGQ PFSLSNIA
Sbjct  181   VGNMYTASLYAAFASLLHNKNSSLDGKRVMMFSYGSDSTATMFSLRLREGQQPFSLSNIA  240

Query  1482  AVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYR  1661
              V+N+   L        +KFV+++++MEHRYG KDFVTSKDCSLLAPGTYYLTEVDSKYR
Sbjct  241   TVMNVQRSLSQGMSCLQKKFVDLMQLMEHRYGGKDFVTSKDCSLLAPGTYYLTEVDSKYR  300

Query  1662  RFYAKKETK-AAVANGH  1709
             RFY+KKE++   +ANGH
Sbjct  301   RFYSKKESENGKLANGH  317



>gb|ABO27206.1| cytosolic 3-hydroxy-3-methylglutaryl-CoA synthase [Chara vulgaris]
Length=463

 Score =   540 bits (1390),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/454 (57%), Positives = 333/454 (73%), Gaps = 4/454 (1%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             M ++ +NVGILA+E+YFP   + Q  LE  D AS GKYTIGLGQD + FC++ EDVISMS
Sbjct  2     MRTRPQNVGILAIEVYFPCNSVLQSELEVFDKASTGKYTIGLGQDRLGFCTDHEDVISMS  61

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V +LLEKY +DP  +GR+EVGSETVIDKSKSIK+ LM +F+K GN+DIEGVDSTNAC
Sbjct  62    LTVVQNLLEKYSIDPTNVGRIEVGSETVIDKSKSIKSCLMLLFQKSGNSDIEGVDSTNAC  121

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAAL N +NWVESSSWDGRY +VV +DSAVYAEGPARPTGGA A+AML+GPDAPI  
Sbjct  122   YGGTAALLNAMNWVESSSWDGRYAIVVASDSAVYAEGPARPTGGAGAVAMLIGPDAPIAM  181

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
                   ++MAH YDFYKP L SEYPVVDGKL+Q CYL ALD+CY  +  KYEK   +  S
Sbjct  182   NRTCIATYMAHTYDFYKPNLASEYPVVDGKLTQICYLRALDACYNLIGQKYEKQSQQKLS  241

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             ++D D+ V HSPYNKLVQKSFARLL+NDF  + + +   D + L  ++ +   ESY+NRD
Sbjct  242   LSDIDFVVCHSPYNKLVQKSFARLLYNDFCNHGASV--VDLKPLHAYAGIPVAESYTNRD  299

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK    +SK  Y +KV PS L+PKQVGNMY AS+YA   SL+H++   L G+R++MFSY
Sbjct  300   LEKTLMTISKEEYASKVHPSALIPKQVGNMYCASLYAGLASLLHSQREKLTGKRILMFSY  359

Query  1404  GSGSTATMFSLRIREG--QHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYG  1577
             GSG  ++MF L  R+   Q  F+L ++A  + ++  L+SR+   PE+F + +++ME RYG
Sbjct  360   GSGLASSMFFLETRDPSLQSRFNLHHLADSMGLSHLLESRNIITPEEFNKTMELMETRYG  419

Query  1578  AKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
               +FV S   + +  G Y+LT VD K+RR Y +K
Sbjct  420   GCNFVPSSPLNQIREGVYHLTGVDEKFRRTYERK  453



>gb|ABO27205.1| cytosolic 3-hydroxy-3-methylglutaryl-CoA synthase [Chara vulgaris]
Length=463

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 261/454 (57%), Positives = 333/454 (73%), Gaps = 4/454 (1%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             M ++ +NVGILA+E+YFP   + Q  LE  D AS GKYTIGLGQD + FC++ EDVISMS
Sbjct  2     MRTRPQNVGILAIEVYFPCNSVLQSELEVFDKASTGKYTIGLGQDRLGFCTDHEDVISMS  61

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V +LLEKY +DP  +GR+EVGSETVIDKSKSIK+ LM +F+K GN+DIEGVDSTNAC
Sbjct  62    LTVVQNLLEKYSIDPTNVGRIEVGSETVIDKSKSIKSCLMLLFQKSGNSDIEGVDSTNAC  121

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAAL N +NWVESSSWDGRY +VV +DSAVYAEGPARPTGGA A+AML+GPDAPI  
Sbjct  122   YGGTAALLNAMNWVESSSWDGRYAIVVASDSAVYAEGPARPTGGAGAVAMLIGPDAPIAM  181

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
                   ++MAH YDFYKP L SEYPVVDGKL+Q CYL ALD+CY  +  KYEK   +  S
Sbjct  182   NRTCIATYMAHTYDFYKPNLASEYPVVDGKLTQICYLRALDACYNLIGQKYEKQSQQKLS  241

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             ++D D+ V HSPYNKLVQKSFARLL+NDF  + + +   D + L  ++ +   ESY+NRD
Sbjct  242   LSDIDFVVCHSPYNKLVQKSFARLLYNDFCNHGASV--VDLKPLHAYAGIPVAESYTNRD  299

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSY  1403
             LEK    +SK  Y +KV PS L+PKQVGNMY AS+YA   SL+H++   L G+R++MFSY
Sbjct  300   LEKTLMTISKEEYASKVHPSALIPKQVGNMYCASLYAGLASLLHSQREKLTGKRILMFSY  359

Query  1404  GSGSTATMFSLRIREG--QHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYG  1577
             GSG  ++MF L  R+   Q  F+L ++A  + ++  L+SR+   PE+F + +++ME RYG
Sbjct  360   GSGLASSMFFLETRDPSLQSRFNLHHLADSMGLSHLLESRNIVTPEEFNKTMELMETRYG  419

Query  1578  AKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
               +FV S   + +  G Y+LT VD K+RR Y +K
Sbjct  420   GCNFVPSSPLNQIREGVYHLTGVDEKFRRTYERK  453



>gb|KDO63608.1| hypothetical protein CISIN_1g012353mg [Citrus sinensis]
Length=281

 Score =   525 bits (1352),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 245/268 (91%), Positives = 260/268 (97%), Gaps = 0/268 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA++IYFPPTC+QQEALEAHDGASKGKYTIGLGQ+CMAFCSEVEDVISMSLTAVT
Sbjct  3     KNVGILAMDIYFPPTCVQQEALEAHDGASKGKYTIGLGQECMAFCSEVEDVISMSLTAVT  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +LLEKY++DPKQIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  63    NLLEKYKIDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKFGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAA+ MLVGPDAP+ FESKLR
Sbjct  123   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAVVMLVGPDAPVAFESKLR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALD+CYK LCSKYEKLEGK FS+++AD
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDTCYKCLCSKYEKLEGKQFSLSNAD  242

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNA  1142
             YFVFHSPYNKLVQKSFARLLFNDF+RNA
Sbjct  243   YFVFHSPYNKLVQKSFARLLFNDFMRNA  270



>gb|KDO60146.1| hypothetical protein CISIN_1g012253mg [Citrus sinensis]
Length=280

 Score =   512 bits (1319),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 240/269 (89%), Positives = 252/269 (94%), Gaps = 0/269 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILAL+IYFPPTC+ QEALE HDG SKGKYT+GLGQDCMAFCSEVEDVISMSLT VT
Sbjct  7     KNVGILALDIYFPPTCVLQEALEVHDGVSKGKYTVGLGQDCMAFCSEVEDVISMSLTVVT  66

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DP QIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  67    SLLEKYKIDPTQIGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDIEGVDSTNACYGGTA  126

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AML+GPDAPI FESKLR
Sbjct  127   ALFNCVNWVESASWDGRYGLVVCTDSAVYAEGPARPTGGAAAVAMLIGPDAPIAFESKLR  186

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C K+EKLEG+ FS+ D D
Sbjct  187   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKYFCQKFEKLEGRQFSMLDVD  246

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNAS  1145
             YFVFHSPYNKLVQKSFARL FNDFLRNAS
Sbjct  247   YFVFHSPYNKLVQKSFARLFFNDFLRNAS  275



>ref|XP_006421821.1| hypothetical protein CICLE_v10005099mg [Citrus clementina]
 gb|ESR35061.1| hypothetical protein CICLE_v10005099mg [Citrus clementina]
Length=297

 Score =   511 bits (1316),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 239/270 (89%), Positives = 252/270 (93%), Gaps = 0/270 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILAL+IYFPPTC+ QEALE HDG SKGKYT+GLGQDCMAFCSEVEDVISMSLT VT
Sbjct  7     KNVGILALDIYFPPTCVLQEALEVHDGVSKGKYTVGLGQDCMAFCSEVEDVISMSLTVVT  66

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY++DP QIGRLEVGSETVIDKSKSIKTFLMQIFEK GNTDIEGVDSTNACYGGTA
Sbjct  67    SLLEKYKIDPTQIGRLEVGSETVIDKSKSIKTFLMQIFEKYGNTDIEGVDSTNACYGGTA  126

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES+SWDGRYGLVVCTDSAVYAEGPARPTGGAAA+AML+GPDAPI FESKLR
Sbjct  127   ALFNCVNWVESASWDGRYGLVVCTDSAVYAEGPARPTGGAAAVAMLIGPDAPIAFESKLR  186

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C K+EKLEG+ FS+ D D
Sbjct  187   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKYFCQKFEKLEGRQFSMLDVD  246

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASY  1148
             YFVFHSPYNKLVQKSFARL FNDFLRNA +
Sbjct  247   YFVFHSPYNKLVQKSFARLFFNDFLRNARF  276



>gb|EFA74817.1| hydroxymethylglutaryl-CoA synthase [Polysphondylium pallidum 
PN500]
Length=462

 Score =   488 bits (1257),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 239/452 (53%), Positives = 310/452 (69%), Gaps = 9/452 (2%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             M+ + +N+GIL +EIYFP T + QE LE  DG + GKYT+GLGQ  MAFC ++ED+ S+S
Sbjct  1     MSKRAENIGILGMEIYFPKTYVAQEDLEKFDGVAAGKYTVGLGQTNMAFCGDLEDIYSLS  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             + AVT+L+EKY+VDP  IGRLEVG+ETVIDK+KSIKT LM +F K GNT I+G+D+ NAC
Sbjct  61    MNAVTNLMEKYDVDPHSIGRLEVGTETVIDKAKSIKTVLMDLFAKSGNTAIDGIDTINAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGT+AL N + W+ESS WDGR  +VV  D AVY +GPARPTGGA  +AML+GP+API F
Sbjct  121   YGGTSALHNTLQWMESSYWDGRNAIVVAGDIAVYEKGPARPTGGAGVVAMLIGPNAPITF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE-KLEGKSF  1040
             ES LRG HM +VYDFYKP +DSEYP VDGKLS +CYL A+D+CY    S +E K     F
Sbjct  181   ESGLRGVHMENVYDFYKPDMDSEYPRVDGKLSISCYLRAIDNCYSRYRSVFEKKFSPDQF  240

Query  1041  SVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNR  1220
             S+   DY VFHSPYNKLVQKSF R+L+NDFLRN    N    + LA +  L  +++Y N 
Sbjct  241   SLDKVDYAVFHSPYNKLVQKSFGRMLYNDFLRNP---NAEVFKSLAAYKDLKAEDTYFNT  297

Query  1221  DLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFS  1400
             DLEKA   +SK  Y+ KV PSTL+ KQ+GN Y  S Y   +SL   K   L G+RV+ FS
Sbjct  298   DLEKALVALSKEDYNKKVAPSTLLAKQLGNTYCGSTYGGLLSLFCEKSDDLVGKRVLTFS  357

Query  1401  YGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGA  1580
             YGSG +A+ FS ++ +     S+  +   +++ ++L  R    PE+F   L + E R+  
Sbjct  358   YGSGLSASAFSFKVNQ-----SIEEMVKKVDLKKRLDQRQRVTPEEFTNKLSLREQRHNL  412

Query  1581  KDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAK  1676
             K++  S   S L PG++YL  VD   RR Y +
Sbjct  413   KNYSPSDSVSTLFPGSFYLKHVDDAGRRCYER  444



>ref|XP_003293379.1| hydroxymethylglutaryl-CoA synthase [Dictyostelium purpureum]
 gb|EGC30092.1| hydroxymethylglutaryl-CoA synthase [Dictyostelium purpureum]
Length=488

 Score =   486 bits (1252),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 233/449 (52%), Positives = 311/449 (69%), Gaps = 8/449 (2%)
 Frame = +3

Query  330   SQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT  509
             S+ +N+GI A+E+YFP T + QE LE  DG S GKYT+GLGQ  MAFC + ED+ S+SL 
Sbjct  2     SKPQNIGIHAIEVYFPSTYVAQEDLEKFDGVSAGKYTLGLGQTNMAFCGDREDIYSLSLN  61

Query  510   AVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYG  689
             AV +L+EK+ VDP+ IGRLEVG+ETVIDKSKS+KT LM +F K GNT I+G+D+ NACYG
Sbjct  62    AVNNLMEKFNVDPQSIGRLEVGTETVIDKSKSVKTVLMDLFAKHGNTSIDGIDTINACYG  121

Query  690   GTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFES  869
             GT+AL N + W+ESS WDGR  +VV  D AVY +GPARPTGGA  IAML+GPDAPIVFES
Sbjct  122   GTSALHNALQWMESSYWDGRNAIVVAGDIAVYEKGPARPTGGAGVIAMLIGPDAPIVFES  181

Query  870   KLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVA  1049
              LRG HM +VYDFYKP +DSEYP VDGKLS +CY  A+D+CY      +EK  G+ F++ 
Sbjct  182   GLRGVHMENVYDFYKPDMDSEYPRVDGKLSISCYFRAIDNCYNRYAKTFEKKYGQKFTLD  241

Query  1050  DADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLE  1229
               DY +FHSPYNKLVQKSF R+L+NDFL N    N+A  + L  +     +E+Y N DLE
Sbjct  242   QVDYALFHSPYNKLVQKSFGRMLYNDFLNNK---NDAKFQTLEQYKQFQPEETYFNTDLE  298

Query  1230  KASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGS  1409
             KA   ++K  Y +KV P+T + KQ+GN Y  S YA  +SL+  K + L G+RV+ FSYGS
Sbjct  299   KALTALTKTDYQSKVAPTTNLAKQLGNTYCGSTYAGLLSLVDEKSNDLLGKRVLTFSYGS  358

Query  1410  GSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDF  1589
             G  A+ FS ++ +      +++I   +++  +L +R    P++F + L + E R+  KD+
Sbjct  359   GLAASAFSFKVEK-----PINHIVEKVDLKNRLANRVRVSPQEFTDKLSLRETRHNLKDY  413

Query  1590  VTSKDCSLLAPGTYYLTEVDSKYRRFYAK  1676
             V S     + PG++YL+ VD   +R Y +
Sbjct  414   VPSDQVQNMFPGSFYLSHVDEAGKRKYDR  442



>ref|XP_002304459.2| hypothetical protein POPTR_0003s12040g [Populus trichocarpa]
 gb|EEE79438.2| hypothetical protein POPTR_0003s12040g [Populus trichocarpa]
Length=270

 Score =   478 bits (1229),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 222/250 (89%), Positives = 233/250 (93%), Gaps = 0/250 (0%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA+ IYFPPTC+QQEALEAHDGASKGKYTIG GQDCM FC+EVEDVISMSLTAV+
Sbjct  3     KNVGILAMHIYFPPTCVQQEALEAHDGASKGKYTIGHGQDCMGFCTEVEDVISMSLTAVS  62

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             SLLEKY VDPKQIGRLEVGSETVID+SKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA
Sbjct  63    SLLEKYNVDPKQIGRLEVGSETVIDRSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  122

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFNCVNWVES SWDGRYGLVVCTDS+VYAEGPARPTGGAAAIAML+GPDAPI FESK R
Sbjct  123   ALFNCVNWVESCSWDGRYGLVVCTDSSVYAEGPARPTGGAAAIAMLIGPDAPITFESKFR  182

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
             GSHM+H YDFYKP L SEYPVVDGKLSQTCYLMALDSCYK  C+KYEK  GK F ++DA 
Sbjct  183   GSHMSHAYDFYKPNLASEYPVVDGKLSQTCYLMALDSCYKKFCAKYEKSTGKQFFISDAA  242

Query  1059  YFVFHSPYNK  1088
             YFVFHSPYNK
Sbjct  243   YFVFHSPYNK  252



>ref|XP_004362382.1| hydroxymethylglutaryl-CoA synthase [Dictyostelium fasciculatum]
 gb|EGG24531.1| hydroxymethylglutaryl-CoA synthase [Dictyostelium fasciculatum]
Length=463

 Score =   482 bits (1240),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 235/450 (52%), Positives = 308/450 (68%), Gaps = 9/450 (2%)
 Frame = +3

Query  330   SQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT  509
             ++ +NVGIL +EIYFP T + QE LE  DG S GKYT+GLGQ  M+FC + ED+ S+SL 
Sbjct  4     TRPENVGILGMEIYFPKTYVAQEDLEKFDGVSAGKYTVGLGQTNMSFCGDREDIYSLSLN  63

Query  510   AVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYG  689
             AV++LLEKY VDP  IGRLEVG+ETVIDK+KSIKT LM +F   GNT I+G+D+ NACYG
Sbjct  64    AVSNLLEKYNVDPHSIGRLEVGTETVIDKAKSIKTVLMDLFAASGNTSIDGIDTINACYG  123

Query  690   GTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFES  869
             GT+AL N + W+ESS WDGR  +VV  D AVY +GPARPTGGA  +AML+GP+API FES
Sbjct  124   GTSALHNALQWIESSYWDGRNAIVVAGDIAVYEKGPARPTGGAGVVAMLIGPNAPITFES  183

Query  870   KLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE-KLEGKSFSV  1046
              LRG HM +VYDFYKP ++SEYP VDGKLS +CYL A+D+CY    + +E K     F +
Sbjct  184   GLRGVHMENVYDFYKPDMESEYPRVDGKLSISCYLRAIDNCYGRYRNTFERKYSPSKFDL  243

Query  1047  ADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDL  1226
             +  DY +FHSPYNKLVQKSF R+L+NDFL N    NE   + L  ++SL  +E+Y N DL
Sbjct  244   SQVDYAIFHSPYNKLVQKSFGRMLYNDFLNNP---NEEKFKSLQQYASLKPEETYFNTDL  300

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYG  1406
             EKA   +SK  Y+ KV PSTL+ KQ+GN Y  S Y+  +SL + +   L G+RV+ FSYG
Sbjct  301   EKALISLSKEDYNTKVAPSTLLAKQLGNTYCGSTYSGLLSLFNERSKDLIGKRVLTFSYG  360

Query  1407  SGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKD  1586
             SG +A+ FS ++R      S+  +   +++  +L +R    PE+F   L + E R+  KD
Sbjct  361   SGLSASAFSFKVRS-----SIEEMVQKVDLKNRLDARTRVTPEEFTSTLTLREQRHNLKD  415

Query  1587  FVTSKDCSLLAPGTYYLTEVDSKYRRFYAK  1676
             +  S   + L P ++YL  VD   RR Y +
Sbjct  416   YTPSDSVNSLFPNSFYLKRVDDVGRRQYDR  445



>emb|CEG68468.1| Putative Hydroxymethylglutaryl-CoA synthase [Rhizopus microsporus]
 emb|CEI96145.1| Putative Hydroxymethylglutaryl-CoA synthase [Rhizopus microsporus]
Length=449

 Score =   475 bits (1223),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 239/453 (53%), Positives = 301/453 (66%), Gaps = 16/453 (4%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             +NVGILA+E+YFP  C+ Q  +E  DG S GKYTIGLGQ+ MAF  + EDV S+ LTAV 
Sbjct  8     QNVGILAMEMYFPKRCVIQSEMETFDGVSAGKYTIGLGQEKMAFIDDREDVQSICLTAVQ  67

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +L+EKY +    IGRLEVG+ET+IDKSK++KT LM +F + GNT+IEG+D+TNACYGG +
Sbjct  68    NLMEKYNIAYTDIGRLEVGTETIIDKSKAVKTVLMTLFSEHGNTEIEGIDTTNACYGGFS  127

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             A  N VNW+ESSSWDGRY +VV  D A+YA G ARPT GA  +AML+G DAPIV E  LR
Sbjct  128   AFSNAVNWIESSSWDGRYAIVVAGDLALYASGAARPTSGAGVVAMLIGKDAPIVLERGLR  187

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSF-SVADA  1055
              +HM H YDFYKP + SEYPVVDGK S  CYL A D+CY+   S+  KLE K   S+ D 
Sbjct  188   ATHMEHAYDFYKPDMHSEYPVVDGKFSNVCYLRAFDTCYRRYMSRLSKLENKEKPSMDDI  247

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEK---LAPFSSLTGDESYSNRDL  1226
             DY V HSPY KLV KSFAR  +NDFL       + + EK   L PF SLT  ES  NRDL
Sbjct  248   DYVVCHSPYAKLVNKSFARAAYNDFLL------DTENEKYAILQPFQSLTYAESLENRDL  301

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHS-TLPGQRVVMFSY  1403
             EKA    +K  Y  KV P   VPKQ+GNMYTA+++A   SLI    S TL G+R++++SY
Sbjct  302   EKACMAFTKSGYTQKVGPCAFVPKQIGNMYTAAVWAGLASLISEVDSDTLQGKRILLYSY  361

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  A+M S R+       S  NI   LN+ E+L +R    PE+F E + I E  +   
Sbjct  362   GSGLAASMVSFRVNS-----STENIKGNLNLRERLAARTHSKPEEFAEAMAIREKTHNVC  416

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE  1682
             D+    +   +  G YY+ ++D K+RRFY +K+
Sbjct  417   DYTPVGNLDNIDSGVYYIEKIDDKWRRFYKRKD  449



>emb|CEJ04633.1| Putative Hydroxymethylglutaryl-CoA synthase [Rhizopus microsporus]
Length=449

 Score =   474 bits (1221),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 239/453 (53%), Positives = 301/453 (66%), Gaps = 16/453 (4%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             +NVGILA+E+YFP  C+ Q  +E  DG S GKYTIGLGQ+ MAF  + EDV S+ LTAV 
Sbjct  8     QNVGILAMEMYFPKRCVIQSEMEVFDGVSAGKYTIGLGQEKMAFIDDREDVQSICLTAVQ  67

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +L+EKY +    IGRLEVG+ET+IDKSK++KT LM +F + GNT+IEG+D+TNACYGG +
Sbjct  68    NLMEKYNIAYTDIGRLEVGTETIIDKSKAVKTVLMTLFSEHGNTEIEGIDTTNACYGGFS  127

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             A  N VNW+ESSSWDGRY +VV  D A+YA G ARPT GA  +AML+G DAPIV E  LR
Sbjct  128   AFSNAVNWIESSSWDGRYAIVVAGDLALYASGAARPTSGAGVVAMLIGKDAPIVLERGLR  187

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSF-SVADA  1055
              +HM H YDFYKP + SEYPVVDGK S  CYL A D+CY+   S+  KLE K   S+ D 
Sbjct  188   ATHMEHAYDFYKPDMHSEYPVVDGKFSNVCYLRAFDTCYRRYMSRLSKLENKEKPSMDDI  247

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEK---LAPFSSLTGDESYSNRDL  1226
             DY V HSPY KLV KSFAR  +NDFL       + + EK   L PF SLT  ES  NRDL
Sbjct  248   DYVVCHSPYAKLVNKSFARAAYNDFLL------DTENEKYAILKPFQSLTYAESLENRDL  301

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHS-TLPGQRVVMFSY  1403
             EKA    +K  Y  KV P   VPKQ+GNMYTA+++A   SLI    S TL G+R++++SY
Sbjct  302   EKACMTFTKSGYAQKVGPCAFVPKQIGNMYTAAVWAGLASLISEVDSDTLQGKRILLYSY  361

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  A+M S R+       S  NI   LN+ E+L +R    PE+F E + I E  +   
Sbjct  362   GSGLAASMVSFRVSS-----STENIKGNLNLRERLAARTHSKPEEFAEAMAIREKTHNVC  416

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE  1682
             D+    +   +  G YY+ ++D K+RRFY +K+
Sbjct  417   DYTPVGNLDNIDSGVYYIEKIDDKWRRFYKRKD  449



>dbj|GAM26369.1| hypothetical protein SAMD00019534_095440 [Acytostelium subglobosum 
LB1]
Length=468

 Score =   475 bits (1222),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 228/449 (51%), Positives = 309/449 (69%), Gaps = 8/449 (2%)
 Frame = +3

Query  330   SQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT  509
             ++  N+GILA+++YFP T + QE LE  DG S GKYT+GLGQ  MAFC + ED+ S+ L 
Sbjct  2     TKPNNIGILAIDVYFPKTYVAQEDLEKFDGVSAGKYTVGLGQTNMAFCGDREDIYSLCLN  61

Query  510   AVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYG  689
             AV +L+ KY+VDP  +GRLEVG+ETVIDK+KSIKT LM +F   GNT I+G+D+ NACYG
Sbjct  62    AVNNLMVKYDVDPHSVGRLEVGTETVIDKAKSIKTVLMDLFASSGNTSIDGIDTINACYG  121

Query  690   GTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFES  869
             GT+AL N V W+ES+ WDGR  +VV  D AVY +GPARPTGGA  +AML+GP+API F+S
Sbjct  122   GTSALHNAVQWIESTYWDGRNAIVVAGDIAVYEKGPARPTGGAGVVAMLIGPNAPITFDS  181

Query  870   KLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVA  1049
              LRG HM +VYDFYKP ++SEYP VDGKLS +CYL A+D+CY    S++EK  G+ F ++
Sbjct  182   GLRGVHMENVYDFYKPDMESEYPRVDGKLSISCYLRAIDNCYSRYRSQFEKKFGQPFDLS  241

Query  1050  DADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLE  1229
               DY VFHSPYNKLVQKSF R+L+NDFL+N +   +   + L  +  L  +++Y N DLE
Sbjct  242   KVDYAVFHSPYNKLVQKSFGRMLYNDFLKNPT---DEKFKTLESYRQLKPEDTYFNSDLE  298

Query  1230  KASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGS  1409
             KA   ++K  Y  KV PST + KQ+GN Y  S Y+  +SL   K   L G+RV+ FSYGS
Sbjct  299   KALLSLTKETYANKVAPSTALAKQLGNTYCGSTYSGLLSLFSEKRDELVGKRVLTFSYGS  358

Query  1410  GSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDF  1589
             G +A+ FS ++ +     S+  I   +++  +L+SR    PE+F   L + E R+  K++
Sbjct  359   GLSASAFSFKVDK-----SIEEIVEKVDLKNRLESRQRVTPEEFTAKLSLREQRHNLKNY  413

Query  1590  VTSKDCSLLAPGTYYLTEVDSKYRRFYAK  1676
               S   S L PG+++L +VD+  RR Y +
Sbjct  414   TPSDCTSTLFPGSFFLKQVDNVGRRQYDR  442



>ref|XP_636713.1| hydroxymethylglutaryl-CoA synthase [Dictyostelium discoideum 
AX4]
 sp|P54872.2|HMCSA_DICDI RecName: Full=Hydroxymethylglutaryl-CoA synthase A; Short=HMG-CoA 
synthase A; AltName: Full=3-hydroxy-3-methylglutaryl coenzyme 
A synthase A [Dictyostelium discoideum]
 gb|EAL63202.1| hydroxymethylglutaryl-CoA synthase [Dictyostelium discoideum 
AX4]
Length=482

 Score =   475 bits (1223),  Expect = 5e-158, Method: Compositional matrix adjust.
 Identities = 228/456 (50%), Positives = 314/456 (69%), Gaps = 8/456 (2%)
 Frame = +3

Query  330   SQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLT  509
             ++ +N+GI  +E+YFP T + QE LE  DG S+GKYT+GLGQ  MAFC + ED+ S+SL 
Sbjct  2     TKPENIGIHGIEVYFPSTYVAQEDLEKFDGVSQGKYTLGLGQTNMAFCGDREDIYSLSLN  61

Query  510   AVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYG  689
             AV +L++K+ VDP  IGRLEVG+ETVIDKSKS+KT LM +F K GNT I+G+D+ NACYG
Sbjct  62    AVNNLMDKFNVDPNSIGRLEVGTETVIDKSKSVKTVLMDLFAKHGNTSIDGIDTINACYG  121

Query  690   GTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFES  869
             GT+AL N + W+ESS WDGR  +VV  D AVY +GPARPTGGA  +AML+GP+API FES
Sbjct  122   GTSALHNALQWMESSYWDGRNAIVVAGDIAVYEKGPARPTGGAGVVAMLIGPNAPITFES  181

Query  870   KLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVA  1049
              LRG HM +VYDFYKP +DSEYP VDGKLS +CY  A+D+CY      +EK  GKSFS+ 
Sbjct  182   GLRGVHMENVYDFYKPDMDSEYPRVDGKLSISCYFRAIDNCYNRYAKAFEKKYGKSFSLD  241

Query  1050  DADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLE  1229
               D+ +FHSPYNKLVQKSF R+L+NDFL N    N++    L  + ++  +++Y +  LE
Sbjct  242   QVDFALFHSPYNKLVQKSFGRMLYNDFLNNP---NDSRYASLEAYKNVKPEDTYFDSVLE  298

Query  1230  KASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHSTLPGQRVVMFSYGS  1409
             KA   ++K  Y  KV P+TL+ KQ+GN Y  S Y+  +SL+  K + L G+RV+ FSYGS
Sbjct  299   KALSAITKNDYATKVAPTTLLAKQLGNTYCGSTYSGLLSLLDEKSNDLVGKRVLTFSYGS  358

Query  1410  GSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDF  1589
             G  A+ FS ++ +      +++I   +++  +L  R    PE F E L + E R+  K++
Sbjct  359   GLAASAFSFKVEK-----PINHIVEKVDLKNRLAKRVRVEPEIFTEKLSLRETRHNLKNY  413

Query  1590  VTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAV  1697
             V S + + + PG++YL+ VD+   R Y +  + +AV
Sbjct  414   VPSDETTNMFPGSFYLSSVDNAGIRKYDRTYSTSAV  449



>ref|XP_005650241.1| hydroxymethylglutaryl-CoA synthase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25697.1| hydroxymethylglutaryl-CoA synthase [Coccomyxa subellipsoidea 
C-169]
Length=519

 Score =   476 bits (1226),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 247/473 (52%), Positives = 316/473 (67%), Gaps = 27/473 (6%)
 Frame = +3

Query  333   QQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTA  512
             + K+VGILALE+YFP   + Q+ LE HD  ++GKYT+GLGQ CMAFC + EDV+SMSLTA
Sbjct  49    RAKHVGILALEVYFPNIYVSQDELEVHDKVAQGKYTLGLGQRCMAFCGDQEDVVSMSLTA  108

Query  513   VTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGG  692
             V SLLEKY+VDPK IGRLEVG+E+ +D+SKSIKTFLM +F + GN DIEGVDS NACYGG
Sbjct  109   VHSLLEKYDVDPKSIGRLEVGTESALDRSKSIKTFLMTLFAEHGNHDIEGVDSLNACYGG  168

Query  693   TAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESK  872
             TAALFN VNWVES +WDGR  +VV TD A+YA GPARP+GG  AIAML+GPDAP+  E  
Sbjct  169   TAALFNAVNWVESRAWDGRLAIVVATDIAMYAAGPARPSGGCGAIAMLIGPDAPLDLERG  228

Query  873   LRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKS-----  1037
             L  SHM H YDFYKP     YP+VDGK S  CYL+ALD CY SLC K+E+   ++     
Sbjct  229   LCASHMEHAYDFYKPC--GFYPLVDGKSSVACYLIALDRCYASLCEKFERQRRRATLGNT  286

Query  1038  ----------FSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFS  1187
                       FS+ADAD+ + HSP+ K+V+K FARL++ D LR  S  N+A +   A  +
Sbjct  287   CTQSNGSPPRFSLADADFCILHSPFVKMVRKGFARLVYQDHLRAKSR-NQALQATRAGAA  345

Query  1188  SLTG---------DESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAF  1340
             SL            ESYS+R LE+A+   S   +   VQP      + GNMY AS++A  
Sbjct  346   SLDAYPADPDAFSPESYSDRGLERAATTASAEAFSRMVQPGLTAAAECGNMYAASVHAGL  405

Query  1341  ISLIHNKHSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRH  1520
              SLI  + + L G+RV+M+SYGSG  A+++SL  R     F+L ++A+ L+I  +L +R 
Sbjct  406   ASLIEAEGTALEGRRVLMYSYGSGLAASLWSLIGRRIDGKFALGSVASKLDIQARLAARR  465

Query  1521  EFPPEKFVEILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
                P +FV  L++ E R+G   +   +  S L  GTYYL EVDS YRR YA+K
Sbjct  466   RADPAEFVATLELQERRHGEAGYKPERPISDLRSGTYYLCEVDSLYRRTYARK  518



>gb|ELU04623.1| hypothetical protein CAPTEDRAFT_155025 [Capitella teleta]
Length=503

 Score =   471 bits (1212),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 249/473 (53%), Positives = 314/473 (66%), Gaps = 13/473 (3%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
              +VGI+ALEIYFP   + Q  LEAHDGAS GKYTIGLGQ  M FCS+ ED+ S+ LT V 
Sbjct  14    NDVGIIALEIYFPYCYVDQAELEAHDGASAGKYTIGLGQTKMGFCSDREDINSLCLTTVQ  73

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+E+ ++    IGRLEVG+ET+IDKSKS+KT LMQ+FE+ GNT++EG+D+TNACYGGTA
Sbjct  74    RLMERNKLSYTDIGRLEVGTETIIDKSKSVKTCLMQLFEESGNTNVEGIDTTNACYGGTA  133

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AMLVGPDA +V E  LR
Sbjct  134   ALFNAVNWVESSSWDGRYALVVAGDIAVYATGNARPTGGAGAVAMLVGPDAALVIERGLR  193

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYK-----SLCSKYEKLEGKSFS  1043
             G+HMAH YDFYKP L SE+PVVDGKLS  CYL ALD CY+     +     +  + +SFS
Sbjct  194   GNHMAHAYDFYKPDLMSEFPVVDGKLSIQCYLDALDRCYRLYRQHADSQSLQNGKQESFS  253

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEK-LAPFSSLTGDESYSNR  1220
             +  AD F+FHSPY KLVQKS  RLL NDFL N     +AD  K +  F  +  +++Y NR
Sbjct  254   LQSADAFLFHSPYCKLVQKSLGRLLLNDFLVNP----DADSFKDVQEFRDVKLEDTYFNR  309

Query  1221  DLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLI-HNKHSTLPGQRVVMF  1397
             D+EKA    SK F+  K QP  ++   VGNMYT S+Y    S I  N   TL G R V+F
Sbjct  310   DVEKAFVTASKKFFAEKTQPYLMIATMVGNMYTPSLYGGLASYIAQNSAETLAGSRSVLF  369

Query  1398  SYGSGSTATMFSLRIREGQHPFS-LSNIAAVL-NIAEKLKSRHEFPPEKFVEILKIMEHR  1571
             SYGSG  ++M+SLR      P S L  I   L ++ ++L+SR +  P +F + LK+ E  
Sbjct  370   SYGSGLASSMYSLRASTDLSPDSPLRRIQQSLADLQQRLESRLKVSPVEFEQTLKLREET  429

Query  1572  YGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH*PESIKC  1730
             +    +        + PGT++LT VD K+RR Y +K  +    NG   E+++ 
Sbjct  430   HHLAPYSPVGSTEKMFPGTWFLTHVDDKHRRQYERKPLQPVFTNGSNGETVEA  482



>ref|XP_007574126.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic [Poecilia 
formosa]
Length=519

 Score =   471 bits (1212),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 246/483 (51%), Positives = 316/483 (65%), Gaps = 20/483 (4%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGI+A+E+YFP   + Q  LE  DG + GKYT+GLGQ  M FCS+ ED+ S+ LT V 
Sbjct  15    KDVGIIAMELYFPSQYVDQAELEEFDGVAAGKYTVGLGQARMGFCSDREDINSLCLTVVQ  74

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+E+  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE  GNTD+EG+D+TNACYGGTA
Sbjct  75    RLMERNSLSYDCIGRLEVGTETIIDKSKSVKTVLMQLFEDSGNTDVEGIDTTNACYGGTA  134

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AML+GP+A + FE  LR
Sbjct  135   ALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLIGPNAALAFERGLR  194

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE---KLEG--KSFS  1043
             G+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    +K     + EG  K FS
Sbjct  195   GTHMQHAYDFYKPDMVSEYPVVDGKLSVECYLSALDRCYSVYRNKIHAQWQREGSDKHFS  254

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADK-EKLAPFSSLTGDESYSNR  1220
             + D D+ VFHSPY KLVQKS ARL+ NDFL++ S   EA        F  +  +E+Y +R
Sbjct  255   LDDFDFLVFHSPYCKLVQKSVARLMLNDFLKHPSPDTEAGPFAGFDAFRDVKPEETYFDR  314

Query  1221  DLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLI-HNKHSTLPGQRVVMF  1397
             D+EKA  + S   ++ K + S L+  Q GNMYT S+Y    SLI  +  S L GQRV +F
Sbjct  315   DVEKAFMKASAQLFETKTKASLLLSSQNGNMYTPSVYGCLASLIAQHTASQLAGQRVGLF  374

Query  1398  SYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILKIMEHR  1571
             SYGSG  AT++SLR+ +   P S  +  ++++ ++  +L SR +  P  F EI+K+ E  
Sbjct  375   SYGSGFAATLYSLRVTQDHTPGSALDKLVSSLTDLRVRLDSRRKMSPAAFSEIMKLREET  434

Query  1572  YGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE-----------TKAAVANGH*PE  1718
             +    +V       L PGT+YLT VD K+RR YA++             + A A+ H P 
Sbjct  435   HHLASYVPRSSVEDLFPGTWYLTRVDDKHRREYARRALDDELPAEPELVRTASASEHIPS  494

Query  1719  SIK  1727
              +K
Sbjct  495   PVK  497



>gb|ESA11911.1| hypothetical protein GLOINDRAFT_347600 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX74262.1| hydroxymethylglutaryl-CoA synthase [Rhizophagus irregularis DAOM 
197198w]
Length=451

 Score =   468 bits (1205),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 235/459 (51%), Positives = 323/459 (70%), Gaps = 18/459 (4%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             M+   +NVGILA+E+YFP   + Q  LE HDG S GKYTIGLGQ  M FC + ED+ S++
Sbjct  1     MSLYPENVGILAVELYFPKRYVDQAELEKHDGVSAGKYTIGLGQTKMGFCDDREDINSIA  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V +L+EKY++    IGR+EVG+ET+IDKSKS+K+ LMQ+F++ GNTDIEG+D+TNAC
Sbjct  61    LTVVHNLIEKYKISYNDIGRIEVGTETIIDKSKSVKSVLMQLFKESGNTDIEGIDTTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGT+ALFN +NW+ESSSWDGRY +V+  D AVYA GPARPTGGA  +A+L+G DAPIVF
Sbjct  121   YGGTSALFNAINWIESSSWDGRYAIVIAGDIAVYATGPARPTGGAGCVALLIGKDAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKY---EKLEGK  1034
             +  LRG+HM H +DFYKP L SE+P VDG+LS  CYL +LD CY    +K    EK+E  
Sbjct  181   DRGLRGTHMEHAWDFYKPDLSSEFPEVDGQLSNECYLKSLDKCYDRYMTKLTTKEKVETP  240

Query  1035  SFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYS  1214
             +  +   DY +FH+PY KLVQKS+ARL +NDF RN    + +    +  F  ++ +ES+ 
Sbjct  241   TIKL--FDYVLFHAPYCKLVQKSYARLYYNDFKRNP---DNSIFASVQQFKDMSAEESFR  295

Query  1215  NRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHS-TLPGQRVV  1391
             ++DLEKA   +SK  Y+ +V P+ L   Q+GNMY AS+Y +  SL+ N  S  L G+RV 
Sbjct  296   SKDLEKAFITLSKSDYNKRVIPTLLAATQIGNMYCASLYGSLASLLSNVPSDELIGKRVG  355

Query  1392  MFSYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHR  1571
             MFSYGSG +++ FS +I++     S+++I+ VL++  +LKSR E  P++F E++++ E  
Sbjct  356   MFSYGSGLSSSFFSFQIKK-----SIADISKVLDVPNRLKSRLELTPKQFSEVMRLREET  410

Query  1572  YGAKDFVTSKDCSLLA----PGTYYLTEVDSKYRRFYAK  1676
             +G K +    D SL+      GTYYL E+DSK+RR Y +
Sbjct  411   HGKKGYKPVGDDSLVKDAFFSGTYYLEEIDSKWRRSYKR  449



>ref|NP_001087380.1| 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble) [Xenopus 
laevis]
 gb|AAH79694.1| MGC80816 protein [Xenopus laevis]
Length=520

 Score =   471 bits (1212),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 246/460 (53%), Positives = 316/460 (69%), Gaps = 11/460 (2%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             +S  K+VGI+ALEIYFP   + QE LE  DG S GKYTIGLGQ  M FCS+ ED+ S+ L
Sbjct  11    SSWPKDVGIVALEIYFPSQYVDQEELEKFDGVSAGKYTIGLGQSKMGFCSDREDINSLCL  70

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             TAV  L+E+  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE+ GNTD+EG+D+TNACY
Sbjct  71    TAVQRLMERNNLSYDCIGRLEVGTETIIDKSKSVKTVLMQLFEESGNTDVEGIDTTNACY  130

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AMLVGP+A +VFE
Sbjct  131   GGTAALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGPNATLVFE  190

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCY----KSLCSKYEKLEG-  1031
               LRG+HM H YDFYKP ++SEYPVVDGKLS  CYL ALD CY    K + ++++K EG 
Sbjct  191   RGLRGTHMQHAYDFYKPDMESEYPVVDGKLSIQCYLSALDHCYSTYRKKIHAQWQK-EGT  249

Query  1032  -KSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADK-EKLAPFSSLTGDE  1205
              K F++ D  + +FHSPY KLVQKSFARLL NDF+ +++   E+     L  F  L  +E
Sbjct  250   EKPFTLNDFGFMIFHSPYCKLVQKSFARLLVNDFISDSNPNTESGVYVGLDSFRDLKLEE  309

Query  1206  SYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHN-KHSTLPGQ  1382
             +Y +RD+EKA  + S   ++ K + S LV K+ GNMYT S+Y    S++       L GQ
Sbjct  310   TYFDRDVEKAFLKASTELFNEKTKTSLLVSKENGNMYTPSVYGCLASVLAQYSPQQLAGQ  369

Query  1383  RVVMFSYGSGSTATMFSLRIREGQHP-FSLSNIAAVL-NIAEKLKSRHEFPPEKFVEILK  1556
             R+ +FSYGSG  AT++SLR+ +   P  SL  + + L ++  +L SR    P  F + +K
Sbjct  370   RIGVFSYGSGFAATLYSLRVSQDAMPGSSLDKLTSSLSDLKARLDSRKNVSPSIFADNMK  429

Query  1557  IMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAK  1676
             + E  +   ++V       L PGT+YL  VD K+RRFYA+
Sbjct  430   LREDTHHLANYVPQGSVDDLFPGTWYLVRVDEKHRRFYAR  469



>gb|KJE90152.1| hydroxymethylglutaryl-CoA synthase 1, variant [Capsaspora owczarzaki 
ATCC 30864]
Length=477

 Score =   469 bits (1207),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 239/471 (51%), Positives = 307/471 (65%), Gaps = 11/471 (2%)
 Frame = +3

Query  300   VVAFSEP*MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSE  479
             VV  S P   +  +NVGILAL++YFP TC+ Q ALE  D A  GKYT+GLGQ  MAFCS+
Sbjct  16    VVPGSRP---ATPENVGILALDVYFPGTCVNQTALETFDNAGAGKYTVGLGQTNMAFCSD  72

Query  480   VEDVISMSLTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIE  659
              ED+ S+ LT V SL+ KY V    IGRLEVG+ET++DKSKS+K+ LM++FE+ GN+++E
Sbjct  73    REDIHSICLTVVQSLMTKYNVPYTAIGRLEVGTETIVDKSKSVKSVLMRLFEESGNSEVE  132

Query  660   GVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLV  839
             GVD+TNACYGGT ALFN VNWVES SWDGR+ LVV  D AVYA G ARPTGGA  +AMLV
Sbjct  133   GVDTTNACYGGTNALFNAVNWVESRSWDGRFALVVAGDIAVYASGSARPTGGAGVVAMLV  192

Query  840   GPDAPIVFESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE  1019
             GP+APIVFES LR +HM H YDFYKP L+SEYP VDGKLS   YL A+D CY    ++ E
Sbjct  193   GPNAPIVFESGLRSTHMEHAYDFYKPRLESEYPEVDGKLSVQLYLKAVDVCYNRYAARAE  252

Query  1020  KLEGKSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTG  1199
                 K+FS+   D+  FHSP+NKLVQKS  R++FNDF R       A  EK   F++   
Sbjct  253   AQGEKNFSLDSTDFVAFHSPFNKLVQKSLGRIMFNDFRRTPENPKFAGLEK---FAATKP  309

Query  1200  DESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFIS-LIHNKHSTLP  1376
             ++SY +R+LE A  + SK  Y  K QP+ L+ KQ+GNMYT S+Y   +S L+    + L 
Sbjct  310   EDSYFDRELESAFLERSKKTYAEKTQPTVLLAKQLGNMYTGSLYGGLVSLLVERSPAELV  369

Query  1377  GQRVVMFSYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILK  1556
             G+RV+MFSYGSG  A+MFSLR        +      + ++  +L SR    P  F  ++ 
Sbjct  370   GKRVIMFSYGSGLAASMFSLRFVSAPETIA----TGLSDVKPRLDSRIVVDPADFDRLMH  425

Query  1557  IMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             + E  +    +    +   L PGT+YL  VD K+RR Y +K   A   +G 
Sbjct  426   LREETHNLTKYAPVGNVDHLFPGTWYLDFVDEKFRRTYKQKPAVALAVSGQ  476



>gb|EPB91550.1| hydroxymethylglutaryl-CoA synthase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=452

 Score =   468 bits (1204),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 234/453 (52%), Positives = 306/453 (68%), Gaps = 16/453 (4%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             +NVG+LA+E+YFP  C+ Q  +E  DG S GKYTIGLGQD MAF  + ED+ S+ LTAV 
Sbjct  11    ENVGVLAMEMYFPKRCVIQSEMETFDGVSAGKYTIGLGQDKMAFIDDREDIQSICLTAVQ  70

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +L+EK+ +    IGRLEVG+ET+IDKSK++KT LM +F + GNT++EG+D+TNACYGG A
Sbjct  71    NLMEKHNISYSDIGRLEVGTETIIDKSKAVKTCLMTLFTEQGNTEVEGIDTTNACYGGFA  130

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             A  N VNW+ESSSWDGRY +VV  D A+YA G ARPT GA  +AML+G DAPIV E  LR
Sbjct  131   AFSNAVNWIESSSWDGRYAIVVAGDLALYASGAARPTSGAGVVAMLIGKDAPIVVERGLR  190

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSF-SVADA  1055
              +HM H YDFYKP + SEYPVVDGK S TCYL A DSCY+   ++  KLE K   S+ D 
Sbjct  191   STHMEHAYDFYKPDMHSEYPVVDGKFSNTCYLRAFDSCYRRYMARLAKLENKEKPSLDDI  250

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLA---PFSSLTGDESYSNRDL  1226
             DY V HSPY KLV KSFAR  +NDFL       + D EK A   PF  ++  +S  N+DL
Sbjct  251   DYVVCHSPYAKLVNKSFARASYNDFLL------DTDNEKFAALKPFEEMSYADSLENKDL  304

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHS-TLPGQRVVMFSY  1403
             E+A   +SK  Y  KV P+   PKQ+GNMYTA+++A   SLI    S TL  +R++++SY
Sbjct  305   ERALMGLSKAGYAQKVGPAAYAPKQIGNMYTAAVWAGLASLISEVDSETLQDKRIMLYSY  364

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  A+M S R+R      S + I + LN+ E+L +R    PE+F   +K+ E+ + A 
Sbjct  365   GSGLAASMISFRVRG-----STNEIKSKLNLRERLDARTHSKPEEFAAAMKMRENTHNAC  419

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE  1682
             +F  S     +A G YY+ ++D K+RRFY +K+
Sbjct  420   NFNPSGSLDNIATGVYYVEKIDDKWRRFYKRKD  452



>emb|CDS11516.1| Putative Hydroxymethylglutaryl-CoA synthase [Absidia idahoensis 
var. thermophila]
Length=452

 Score =   468 bits (1203),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 238/453 (53%), Positives = 302/453 (67%), Gaps = 16/453 (4%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             KNVGILA+E+YFP  C++Q  +E  DG S GKYTIGLGQ+ MAF  + ED+ S+ LTAV 
Sbjct  11    KNVGILAMEMYFPHRCVEQSEMEVFDGVSSGKYTIGLGQEKMAFIDDREDIQSICLTAVQ  70

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +L+EKY +D   IGRLEVG+ET+IDKSKS+K+ LM +F + GNT+IEG+D+TNACYGG  
Sbjct  71    TLMEKYNIDYTDIGRLEVGTETIIDKSKSVKSTLMTLFGEHGNTEIEGIDTTNACYGGFN  130

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             A  N VNW+ESSSWDGR  +V+  D A+YA G ARPT GA  +AMLVGP+APIV E  LR
Sbjct  131   AFSNAVNWIESSSWDGRKAIVIAGDLALYASGAARPTSGAGVVAMLVGPNAPIVVERGLR  190

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEK-LEGKSFSVADA  1055
              +HM H YDFYKP + SEYPVVDGK S  CYL A D+CYK   S+  K L  +  S+ D 
Sbjct  191   STHMEHAYDFYKPDMHSEYPVVDGKFSNICYLRAFDTCYKRYMSRLGKQLNKEKPSMDDI  250

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAP---FSSLTGDESYSNRDL  1226
             DY V HSPY KLV KSFAR  +NDFL       + D EK AP   F  L   +S  NRDL
Sbjct  251   DYVVCHSPYAKLVNKSFARASYNDFLL------DRDNEKYAPIQAFGELDYGQSLENRDL  304

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHS-TLPGQRVVMFSY  1403
             EKA    +K  Y  KV P   VPKQ+GNMYTA+++A   SL+    S  L G+RV+++SY
Sbjct  305   EKACVAFTKAGYAQKVGPCAFVPKQIGNMYTAAVWAGLASLVSEVDSENLQGKRVLLYSY  364

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  A+M S RI +     + +NI   LN+ E+L +R    PE F E +KI E+ + A 
Sbjct  365   GSGLAASMISFRILD-----NTTNIKEKLNLRERLAARIHSKPEAFAEAMKIRENTHNAC  419

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE  1682
             D+        +A G YY+ ++D K+RRFY +K+
Sbjct  420   DYTPVGSLDNIASGVYYIEKIDDKWRRFYKRKD  452



>ref|XP_004364367.1| hydroxymethylglutaryl-CoA synthase 1 [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE90151.1| hydroxymethylglutaryl-CoA synthase 1 [Capsaspora owczarzaki ATCC 
30864]
Length=523

 Score =   470 bits (1210),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 239/471 (51%), Positives = 307/471 (65%), Gaps = 11/471 (2%)
 Frame = +3

Query  300   VVAFSEP*MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSE  479
             VV  S P   +  +NVGILAL++YFP TC+ Q ALE  D A  GKYT+GLGQ  MAFCS+
Sbjct  62    VVPGSRP---ATPENVGILALDVYFPGTCVNQTALETFDNAGAGKYTVGLGQTNMAFCSD  118

Query  480   VEDVISMSLTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIE  659
              ED+ S+ LT V SL+ KY V    IGRLEVG+ET++DKSKS+K+ LM++FE+ GN+++E
Sbjct  119   REDIHSICLTVVQSLMTKYNVPYTAIGRLEVGTETIVDKSKSVKSVLMRLFEESGNSEVE  178

Query  660   GVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLV  839
             GVD+TNACYGGT ALFN VNWVES SWDGR+ LVV  D AVYA G ARPTGGA  +AMLV
Sbjct  179   GVDTTNACYGGTNALFNAVNWVESRSWDGRFALVVAGDIAVYASGSARPTGGAGVVAMLV  238

Query  840   GPDAPIVFESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE  1019
             GP+APIVFES LR +HM H YDFYKP L+SEYP VDGKLS   YL A+D CY    ++ E
Sbjct  239   GPNAPIVFESGLRSTHMEHAYDFYKPRLESEYPEVDGKLSVQLYLKAVDVCYNRYAARAE  298

Query  1020  KLEGKSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTG  1199
                 K+FS+   D+  FHSP+NKLVQKS  R++FNDF R       A  EK   F++   
Sbjct  299   AQGEKNFSLDSTDFVAFHSPFNKLVQKSLGRIMFNDFRRTPENPKFAGLEK---FAATKP  355

Query  1200  DESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFIS-LIHNKHSTLP  1376
             ++SY +R+LE A  + SK  Y  K QP+ L+ KQ+GNMYT S+Y   +S L+    + L 
Sbjct  356   EDSYFDRELESAFLERSKKTYAEKTQPTVLLAKQLGNMYTGSLYGGLVSLLVERSPAELV  415

Query  1377  GQRVVMFSYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILK  1556
             G+RV+MFSYGSG  A+MFSLR        +      + ++  +L SR    P  F  ++ 
Sbjct  416   GKRVIMFSYGSGLAASMFSLRFVSAPETIA----TGLSDVKPRLDSRIVVDPADFDRLMH  471

Query  1557  IMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
             + E  +    +    +   L PGT+YL  VD K+RR Y +K   A   +G 
Sbjct  472   LREETHNLTKYAPVGNVDHLFPGTWYLDFVDEKFRRTYKQKPAVALAVSGQ  522



>gb|EIE88360.1| hydroxymethylglutaryl-CoA synthase [Rhizopus delemar RA 99-880]
Length=449

 Score =   467 bits (1202),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 234/453 (52%), Positives = 299/453 (66%), Gaps = 16/453 (4%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             +N+GILA+E+YFP  C+ Q  +E+ DG S GKYTIGLGQ+ MAF  + ED+ S+ LTAV 
Sbjct  8     QNIGILAMEMYFPQRCVNQPEMESFDGVSAGKYTIGLGQEKMAFIDDREDIQSICLTAVQ  67

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +L+EKY +    IGRLEVG+ET+IDKSK++KT LM +F + GN +IEG+D+TNACYGG +
Sbjct  68    NLMEKYNIAYTDIGRLEVGTETIIDKSKAVKTCLMTLFSEHGNNEIEGIDTTNACYGGFS  127

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             A  N VNW+ESSSWDGRY +VV  D A+YA G ARPT GA  +A+L+G DAPIV E  LR
Sbjct  128   AFSNAVNWIESSSWDGRYAIVVAGDLALYASGSARPTSGAGVVAILIGKDAPIVVERGLR  187

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKS-FSVADA  1055
              +HM H YDFYKP + SEYPVVDGK S TCYL A DSCY+   ++  K+E K   S+ D 
Sbjct  188   ATHMEHAYDFYKPDMHSEYPVVDGKFSNTCYLRAFDSCYRRYMARLAKIENKEKTSMDDV  247

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFL---RNASYINEADKEKLAPFSSLTGDESYSNRDL  1226
             DY V HSPY KLV KSFAR  +NDFL    N  Y        L PF  LT  ES  ++DL
Sbjct  248   DYVVCHSPYAKLVNKSFARASYNDFLLDPENEKYAT------LKPFQDLTYAESLESKDL  301

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHS-TLPGQRVVMFSY  1403
             EKA   ++K  Y  KV P   VPKQ+GNMYTA+++A   SL+    S TL  +RV+ +SY
Sbjct  302   EKACMTLTKAGYAQKVGPCAFVPKQIGNMYTAAVWAGLASLVSEVDSETLQNKRVLFYSY  361

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  A+M S RI       S   I   LN+ E+L +R    PE F E +K+ E  + A+
Sbjct  362   GSGLAASMISFRINS-----STEKIKNTLNLRERLAARTHSKPEDFSEAMKMRELTHNAR  416

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE  1682
             DF        +A G YY+ ++D K+RRFY +K+
Sbjct  417   DFSPKGSLEHIASGVYYIEKIDDKWRRFYKRKD  449



>ref|XP_008421310.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X2 [Poecilia reticulata]
Length=519

 Score =   469 bits (1208),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 245/483 (51%), Positives = 316/483 (65%), Gaps = 20/483 (4%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGI+A+E+YFP   + Q  +E  DG + GKYT+GLGQ  M FCS+ ED+ S+ LT V 
Sbjct  15    KDVGIIAMELYFPSQYVDQAEMEKFDGVAAGKYTVGLGQARMGFCSDREDINSLCLTVVQ  74

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+E+  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE  GNTD+EG+D+TNACYGGTA
Sbjct  75    RLMERNSLSYDCIGRLEVGTETIIDKSKSVKTVLMQLFEDSGNTDVEGIDTTNACYGGTA  134

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AML+GP+A + FE  LR
Sbjct  135   ALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLIGPNAALAFERGLR  194

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE---KLEG--KSFS  1043
             G+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    +K     + EG  K FS
Sbjct  195   GTHMQHAYDFYKPDMVSEYPVVDGKLSVECYLSALDRCYSVYRNKIHAQWQREGSDKHFS  254

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADK-EKLAPFSSLTGDESYSNR  1220
             + D D+ VFHSPY KLVQKS ARL+ NDFL++ S   EA        F  +  +E+Y +R
Sbjct  255   LDDFDFLVFHSPYCKLVQKSVARLMLNDFLKHPSPDTEAGPFAGFDAFRDVKPEETYFDR  314

Query  1221  DLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLI-HNKHSTLPGQRVVMF  1397
             D+EKA  + S   ++ K + S L+  Q GNMYT S+Y    SLI  +  S L GQRV +F
Sbjct  315   DVEKAFMKASAQLFETKTKASLLLSSQNGNMYTPSVYGCLASLIAQHTASQLAGQRVGLF  374

Query  1398  SYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILKIMEHR  1571
             SYGSG  AT++SLR+ +   P S  +  ++++ ++  +L SR +  P  F EI+K+ E  
Sbjct  375   SYGSGFAATLYSLRVTQDHTPGSALDKLVSSLTDLGVRLDSRRKMSPAAFSEIMKLREET  434

Query  1572  YGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE-----------TKAAVANGH*PE  1718
             +    +V       L PGT+YLT VD K+RR YA++             + A A+ H P 
Sbjct  435   HHLASYVPRSLVEDLFPGTWYLTRVDDKHRREYARRALDDELPAEPELVRTASASEHIPS  494

Query  1719  SIK  1727
              +K
Sbjct  495   PVK  497



>ref|XP_011205537.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Bactrocera dorsalis]
 ref|XP_011205538.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Bactrocera dorsalis]
 ref|XP_011205539.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Bactrocera dorsalis]
 ref|XP_011205540.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Bactrocera dorsalis]
 ref|XP_011205541.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Bactrocera dorsalis]
Length=460

 Score =   467 bits (1201),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 238/461 (52%), Positives = 313/461 (68%), Gaps = 11/461 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             +NVGI A+E  FP   + Q  LE  DGAS GKYTIGLGQ  M FCS+ EDV S+ LT V+
Sbjct  4     ENVGIRAIEAIFPSQFVDQTELEQFDGASAGKYTIGLGQGKMGFCSDREDVNSLCLTVVS  63

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              LLE+Y++ P++IGRLEVG+ET+IDKSKS+K+ LMQ+F   GNTDIEG+D+TNACYGGTA
Sbjct  64    RLLERYQIKPQEIGRLEVGTETIIDKSKSVKSVLMQLFADSGNTDIEGIDTTNACYGGTA  123

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN +NW+ESSSWDGRY L VC D AVYA+G ARPTGGA AIAMLVGP+AP++FE  LR
Sbjct  124   ALFNSINWIESSSWDGRYALAVCADIAVYAKGAARPTGGAGAIAMLVGPNAPLIFERGLR  183

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKL--EGKSFSVAD  1052
              +HM H YDFYKP L SEYP VDGKLS  CYL ALD+CY+  C K+ K   +   F++ +
Sbjct  184   ATHMEHAYDFYKPDLSSEYPTVDGKLSIQCYLSALDTCYQLYCKKFAKKYPQEAEFTLDN  243

Query  1053  ADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEK  1232
              +  +FH+P+ KLVQKS AR++FNDFL+ +          L  F+  T  ++Y +RD+EK
Sbjct  244   FEALLFHTPFCKLVQKSVARVVFNDFLQCSIEKRALKYPGLERFNECTLAQTYFDRDVEK  303

Query  1233  ASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHS-TLPGQRVVMFSYGS  1409
             A        ++ K + S L+  QVGNMYT S+Y+  +SL+ N  S  L G+R+ +FSYGS
Sbjct  304   AFMTQFADVFETKTRQSLLLANQVGNMYTPSVYSGLVSLLINTPSERLIGKRIGLFSYGS  363

Query  1410  GSTATMFSLRIREGQHPFS--LSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             G  ATM+S+++ +    F   +S +  VL +   L SR +  PE F +++++ E    A 
Sbjct  364   GLAATMYSMQVTKDAAAFKQLVSKLDYVLPM---LNSREKVAPELFSQLMEVREKNNHAA  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
              +  +   S L PGTYYL  VD  +RR Y +K T   +ANG
Sbjct  421   PYTPTGSVSALFPGTYYLQFVDDMHRRTYERKPT---IANG  458



>ref|XP_005816295.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
[Xiphophorus maculatus]
Length=515

 Score =   469 bits (1206),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 244/483 (51%), Positives = 315/483 (65%), Gaps = 20/483 (4%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGI+ +E+YFP   + Q  LE  DG + GKYT+GLGQ  M FCS+ ED+ S+ LT V 
Sbjct  15    KDVGIITMELYFPSQYVDQAELEEFDGVTAGKYTVGLGQARMGFCSDREDINSLCLTVVQ  74

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+E+  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE  GNTD+EG+D+TNACYGGTA
Sbjct  75    RLMERNSLSYDCIGRLEVGTETIIDKSKSVKTVLMQLFEDSGNTDVEGIDTTNACYGGTA  134

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AML+GP+A + FE  LR
Sbjct  135   ALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLIGPNAALTFERGLR  194

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE---KLEG--KSFS  1043
             G+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    +K     + EG  K FS
Sbjct  195   GTHMQHAYDFYKPDMVSEYPVVDGKLSVECYLSALDRCYSVYRNKIHAQWQREGSDKHFS  254

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADK-EKLAPFSSLTGDESYSNR  1220
             + D D+ VFHSPY KLVQKS ARL+ NDFL++ S   EA        F  +  +E+Y +R
Sbjct  255   LDDFDFLVFHSPYCKLVQKSVARLMLNDFLKHPSPDTEAGPFAGFDAFRDVKPEETYFDR  314

Query  1221  DLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLI-HNKHSTLPGQRVVMF  1397
             D+EKA  + S   ++ K + S L+  Q GNMYT S+Y    SLI  +  S L GQRV +F
Sbjct  315   DVEKAFMKASAQLFETKTKASLLLSSQNGNMYTPSVYGCLASLIAQHTASQLAGQRVGLF  374

Query  1398  SYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILKIMEHR  1571
             SYGSG  AT++SLR+ +   P S  +  ++++ ++  +L SR +  P  F EI+K+ E  
Sbjct  375   SYGSGFAATLYSLRVTQDHTPGSALDKLVSSLSDLRVRLDSRRKMSPAAFSEIMKLREET  434

Query  1572  YGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE-----------TKAAVANGH*PE  1718
             +    ++       L PGT+YLT VD K+RR YA++             + A A+ H P 
Sbjct  435   HHLASYIPRSSVEDLFPGTWYLTRVDDKHRREYARRALDDELPAEPELVRTASASEHIPS  494

Query  1719  SIK  1727
              +K
Sbjct  495   PVK  497



>dbj|GAN05349.1| hydroxymethylglutaryl-CoA synthase 1 [Mucor ambiguus]
Length=452

 Score =   466 bits (1199),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 231/453 (51%), Positives = 306/453 (68%), Gaps = 16/453 (4%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             +NVG+LA+E+YFP  C+ Q  +E  DG S GKYTIGLGQD MAF  + ED+ S+ LTAV 
Sbjct  11    ENVGVLAMEMYFPKRCVIQSEMETFDGVSAGKYTIGLGQDKMAFIDDREDIQSICLTAVQ  70

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
             +L+EK+ +    IGRLEVG+ET+IDKSK++KT LM +F + GNT++EG+D+TNACYGG A
Sbjct  71    NLMEKHNISYSDIGRLEVGTETIIDKSKAVKTCLMTLFTEQGNTEVEGIDTTNACYGGFA  130

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             A  N VNW+ESSSWDGRY +VV  D A+YA G ARPT GA  +AML+G DAPIV E  LR
Sbjct  131   AFSNAVNWIESSSWDGRYAIVVAGDLALYASGAARPTSGAGVVAMLIGKDAPIVVERGLR  190

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSF-SVADA  1055
              +HM H YDFYKP + SEYPVVDGK S TCY+ A DSCY+   ++  KLE K   S+ D 
Sbjct  191   STHMEHAYDFYKPDMHSEYPVVDGKFSNTCYIRAFDSCYRRYMARLAKLENKDKPSMDDI  250

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLA---PFSSLTGDESYSNRDL  1226
             DY V HSPY KLV KSFAR  +NDFL       + D EK A   PF  ++  +S  N+DL
Sbjct  251   DYVVCHSPYAKLVNKSFARASYNDFLL------DTDNEKFAALKPFEEMSYADSLENKDL  304

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHS-TLPGQRVVMFSY  1403
             E+A   ++K  Y  KV P+   PKQ+GNMYTA+++A   SL+    S TL  +R++++SY
Sbjct  305   ERALMGLTKAGYAQKVGPAAYAPKQIGNMYTAAVWAGLASLVSEVDSETLQDKRIMLYSY  364

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  A+M S R+R      S + I + LN+ E+L +R    PE+F   +K+ E+ + A 
Sbjct  365   GSGLAASMISFRVRG-----STAEIKSKLNLRERLDARTHSKPEEFASAMKMRENTHNAC  419

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKE  1682
             +F  S     +A G YY+ ++D K+RRFY +K+
Sbjct  420   NFNPSGSLDNIATGVYYVEKIDDKWRRFYKRKD  452



>ref|XP_008421309.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X1 [Poecilia reticulata]
Length=577

 Score =   470 bits (1209),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 252/521 (48%), Positives = 328/521 (63%), Gaps = 28/521 (5%)
 Frame = +3

Query  225   RERETCGRCLIIFCRCFDPFAVRRSVVAFSEP*MASQQKNVGILALEIYFPPTCLQQEAL  404
             R+ ET     ++F         RR   + S   +    K+VGI+A+E+YFP   + Q  +
Sbjct  43    RDTETFPLTTVVF--------TRRMPGSASNTCLGPWPKDVGIIAMELYFPSQYVDQAEM  94

Query  405   EAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVTSLLEKYEVDPKQIGRLEVGSET  584
             E  DG + GKYT+GLGQ  M FCS+ ED+ S+ LT V  L+E+  +    IGRLEVG+ET
Sbjct  95    EKFDGVAAGKYTVGLGQARMGFCSDREDINSLCLTVVQRLMERNSLSYDCIGRLEVGTET  154

Query  585   VIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVV  764
             +IDKSKS+KT LMQ+FE  GNTD+EG+D+TNACYGGTAALFN VNWVESSSWDGRY LVV
Sbjct  155   IIDKSKSVKTVLMQLFEDSGNTDVEGIDTTNACYGGTAALFNAVNWVESSSWDGRYALVV  214

Query  765   CTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSEYPVV  944
               D AVYA G ARPTGGA A+AML+GP+A + FE  LRG+HM H YDFYKP + SEYPVV
Sbjct  215   AGDIAVYATGSARPTGGAGAVAMLIGPNAALAFERGLRGTHMQHAYDFYKPDMVSEYPVV  274

Query  945   DGKLSQTCYLMALDSCYKSLCSKYE---KLEG--KSFSVADADYFVFHSPYNKLVQKSFA  1109
             DGKLS  CYL ALD CY    +K     + EG  K FS+ D D+ VFHSPY KLVQKS A
Sbjct  275   DGKLSVECYLSALDRCYSVYRNKIHAQWQREGSDKHFSLDDFDFLVFHSPYCKLVQKSVA  334

Query  1110  RLLFNDFLRNASYINEADK-EKLAPFSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPST  1286
             RL+ NDFL++ S   EA        F  +  +E+Y +RD+EKA  + S   ++ K + S 
Sbjct  335   RLMLNDFLKHPSPDTEAGPFAGFDAFRDVKPEETYFDRDVEKAFMKASAQLFETKTKASL  394

Query  1287  LVPKQVGNMYTASIYAAFISLI-HNKHSTLPGQRVVMFSYGSGSTATMFSLRIREGQHPF  1463
             L+  Q GNMYT S+Y    SLI  +  S L GQRV +FSYGSG  AT++SLR+ +   P 
Sbjct  395   LLSSQNGNMYTPSVYGCLASLIAQHTASQLAGQRVGLFSYGSGFAATLYSLRVTQDHTPG  454

Query  1464  SLSN--IAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDFVTSKDCSLLAPGTYYL  1637
             S  +  ++++ ++  +L SR +  P  F EI+K+ E  +    +V       L PGT+YL
Sbjct  455   SALDKLVSSLTDLGVRLDSRRKMSPAAFSEIMKLREETHHLASYVPRSLVEDLFPGTWYL  514

Query  1638  TEVDSKYRRFYAKKE-----------TKAAVANGH*PESIK  1727
             T VD K+RR YA++             + A A+ H P  +K
Sbjct  515   TRVDDKHRREYARRALDDELPAEPELVRTASASEHIPSPVK  555



>ref|XP_011181523.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Bactrocera cucurbitae]
 ref|XP_011181525.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Bactrocera cucurbitae]
 ref|XP_011181526.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Bactrocera cucurbitae]
 ref|XP_011181527.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Bactrocera cucurbitae]
 ref|XP_011181528.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Bactrocera cucurbitae]
 ref|XP_011181529.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Bactrocera cucurbitae]
Length=460

 Score =   465 bits (1196),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 238/461 (52%), Positives = 313/461 (68%), Gaps = 11/461 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             +NVGI A+E  FP   + Q  LE  DGAS GKYTIGLGQ  M FCS+ EDV S+ LT VT
Sbjct  4     ENVGIRAIEAIFPSQYVDQTELEQFDGASAGKYTIGLGQGKMGFCSDREDVNSLCLTVVT  63

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              LLE+Y++ P++IGRLEVG+ET+IDKSKS+K+ LMQ+F   GNTDIEG+D+TNACYGGTA
Sbjct  64    RLLERYQIKPQEIGRLEVGTETIIDKSKSVKSVLMQLFADSGNTDIEGLDTTNACYGGTA  123

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN +NW+ESSSWDGRY L VC D AVYA+G ARPTGGA AIAMLVGP+AP+VFE  LR
Sbjct  124   ALFNSINWIESSSWDGRYALAVCADIAVYAKGAARPTGGAGAIAMLVGPNAPLVFERGLR  183

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKL--EGKSFSVAD  1052
              +HM H YDFYKP L SEYP VDGKLS  CYL ALD+CY+    K+ K   +   F++ +
Sbjct  184   ATHMEHAYDFYKPDLSSEYPTVDGKLSIQCYLSALDTCYQLYRKKFAKKYPQEAEFTLDN  243

Query  1053  ADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEK  1232
              +  +FH+P+ KLVQKS AR++FNDFL+ +          L  F+  T +++Y +RD+EK
Sbjct  244   FEALLFHTPFCKLVQKSVARVVFNDFLQCSPEKRALKYPGLERFNDATLEKTYFDRDVEK  303

Query  1233  ASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHS-TLPGQRVVMFSYGS  1409
             A        ++ K + S L+  QVGNMYT S+Y+  +SL+ N  +  L G+R+ +FSYGS
Sbjct  304   AFMTQFAGAFETKTRQSLLLANQVGNMYTPSVYSGLVSLLINTPTEQLVGKRIGLFSYGS  363

Query  1410  GSTATMFSLRIREGQHPFS--LSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             G  ATM+S+++ +    F   +S +  VL +   L SR +  PE+F +++++ E    A 
Sbjct  364   GLAATMYSIQVTKDADAFKQLVSKLDYVLPL---LNSREKVAPEEFSQLMEVREKNNHAA  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
              +  S     L PGTYYL  VD  +RR Y +K T   +ANG
Sbjct  421   PYTPSGSVGALFPGTYYLKSVDDMHRRTYERKPT---IANG  458



>ref|XP_008101034.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic isoform 
X3 [Anolis carolinensis]
Length=522

 Score =   467 bits (1201),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 242/461 (52%), Positives = 311/461 (67%), Gaps = 11/461 (2%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             AS  K+VGI+ALEIYFP   + Q  LE  DG   GKYTIGLGQ  M FCS+ ED+ S+ L
Sbjct  11    ASWPKDVGIVALEIYFPSQYVDQAELEKFDGVDSGKYTIGLGQSKMGFCSDREDINSLCL  70

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             T V  L+E+  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE+ GNTD+EG+D+TNACY
Sbjct  71    TVVQKLMERNSLSYNCIGRLEVGTETIIDKSKSVKTVLMQLFEESGNTDVEGIDTTNACY  130

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFN +NWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AMLVGP+AP++FE
Sbjct  131   GGTAALFNAINWVESSSWDGRYALVVAGDIAVYATGNARPTGGAGAVAMLVGPNAPLIFE  190

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCY----KSLCSKYEKLEG-  1031
               LRG+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    K + ++++K EG 
Sbjct  191   RGLRGTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDRCYSVYRKKIRTQWQK-EGT  249

Query  1032  -KSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEAD-KEKLAPFSSLTGDE  1205
              K F++ D  + +FHSPY KLVQKS ARLL NDFL + + INE      L  F  +  ++
Sbjct  250   DKDFNLNDFGFMIFHSPYCKLVQKSVARLLLNDFLIDQTPINENGIYNGLEAFGDVKLED  309

Query  1206  SYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHN-KHSTLPGQ  1382
             +Y +RD+EKA  + S   ++ K + S LV  Q GNMYT S+Y    SL+       L GQ
Sbjct  310   TYFDRDVEKAFMKASAELFNQKTKASLLVSNQNGNMYTPSVYGCLASLLAQYSPQQLAGQ  369

Query  1383  RVVMFSYGSGSTATMFSLRIREGQHP-FSLSNIAAVL-NIAEKLKSRHEFPPEKFVEILK  1556
             R+ +FSYGSG  AT++S+++ +   P  SL  I A L ++  +L SR   PPE F E + 
Sbjct  370   RIGVFSYGSGFAATLYSIKVSQDATPGSSLDKITASLSDLKARLDSRKRIPPEVFAENMM  429

Query  1557  IMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             + +  +   +++       L  GT+YL  VD K+RR YA++
Sbjct  430   LRQETHHLANYIPKCSVDDLYEGTWYLVRVDEKHRRTYARR  470



>ref|XP_008101032.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic isoform 
X1 [Anolis carolinensis]
Length=564

 Score =   468 bits (1205),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 242/461 (52%), Positives = 311/461 (67%), Gaps = 11/461 (2%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             AS  K+VGI+ALEIYFP   + Q  LE  DG   GKYTIGLGQ  M FCS+ ED+ S+ L
Sbjct  78    ASWPKDVGIVALEIYFPSQYVDQAELEKFDGVDSGKYTIGLGQSKMGFCSDREDINSLCL  137

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             T V  L+E+  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE+ GNTD+EG+D+TNACY
Sbjct  138   TVVQKLMERNSLSYNCIGRLEVGTETIIDKSKSVKTVLMQLFEESGNTDVEGIDTTNACY  197

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFN +NWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AMLVGP+AP++FE
Sbjct  198   GGTAALFNAINWVESSSWDGRYALVVAGDIAVYATGNARPTGGAGAVAMLVGPNAPLIFE  257

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCY----KSLCSKYEKLEG-  1031
               LRG+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    K + ++++K EG 
Sbjct  258   RGLRGTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDRCYSVYRKKIRTQWQK-EGT  316

Query  1032  -KSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEAD-KEKLAPFSSLTGDE  1205
              K F++ D  + +FHSPY KLVQKS ARLL NDFL + + INE      L  F  +  ++
Sbjct  317   DKDFNLNDFGFMIFHSPYCKLVQKSVARLLLNDFLIDQTPINENGIYNGLEAFGDVKLED  376

Query  1206  SYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHN-KHSTLPGQ  1382
             +Y +RD+EKA  + S   ++ K + S LV  Q GNMYT S+Y    SL+       L GQ
Sbjct  377   TYFDRDVEKAFMKASAELFNQKTKASLLVSNQNGNMYTPSVYGCLASLLAQYSPQQLAGQ  436

Query  1383  RVVMFSYGSGSTATMFSLRIREGQHP-FSLSNIAAVL-NIAEKLKSRHEFPPEKFVEILK  1556
             R+ +FSYGSG  AT++S+++ +   P  SL  I A L ++  +L SR   PPE F E + 
Sbjct  437   RIGVFSYGSGFAATLYSIKVSQDATPGSSLDKITASLSDLKARLDSRKRIPPEVFAENMM  496

Query  1557  IMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             + +  +   +++       L  GT+YL  VD K+RR YA++
Sbjct  497   LRQETHHLANYIPKCSVDDLYEGTWYLVRVDEKHRRTYARR  537



>ref|XP_008101033.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic isoform 
X2 [Anolis carolinensis]
Length=531

 Score =   467 bits (1202),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 242/461 (52%), Positives = 311/461 (67%), Gaps = 11/461 (2%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             AS  K+VGI+ALEIYFP   + Q  LE  DG   GKYTIGLGQ  M FCS+ ED+ S+ L
Sbjct  20    ASWPKDVGIVALEIYFPSQYVDQAELEKFDGVDSGKYTIGLGQSKMGFCSDREDINSLCL  79

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             T V  L+E+  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE+ GNTD+EG+D+TNACY
Sbjct  80    TVVQKLMERNSLSYNCIGRLEVGTETIIDKSKSVKTVLMQLFEESGNTDVEGIDTTNACY  139

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFN +NWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AMLVGP+AP++FE
Sbjct  140   GGTAALFNAINWVESSSWDGRYALVVAGDIAVYATGNARPTGGAGAVAMLVGPNAPLIFE  199

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCY----KSLCSKYEKLEG-  1031
               LRG+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    K + ++++K EG 
Sbjct  200   RGLRGTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDRCYSVYRKKIRTQWQK-EGT  258

Query  1032  -KSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEAD-KEKLAPFSSLTGDE  1205
              K F++ D  + +FHSPY KLVQKS ARLL NDFL + + INE      L  F  +  ++
Sbjct  259   DKDFNLNDFGFMIFHSPYCKLVQKSVARLLLNDFLIDQTPINENGIYNGLEAFGDVKLED  318

Query  1206  SYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHN-KHSTLPGQ  1382
             +Y +RD+EKA  + S   ++ K + S LV  Q GNMYT S+Y    SL+       L GQ
Sbjct  319   TYFDRDVEKAFMKASAELFNQKTKASLLVSNQNGNMYTPSVYGCLASLLAQYSPQQLAGQ  378

Query  1383  RVVMFSYGSGSTATMFSLRIREGQHP-FSLSNIAAVL-NIAEKLKSRHEFPPEKFVEILK  1556
             R+ +FSYGSG  AT++S+++ +   P  SL  I A L ++  +L SR   PPE F E + 
Sbjct  379   RIGVFSYGSGFAATLYSIKVSQDATPGSSLDKITASLSDLKARLDSRKRIPPEVFAENMM  438

Query  1557  IMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             + +  +   +++       L  GT+YL  VD K+RR YA++
Sbjct  439   LRQETHHLANYIPKCSVDDLYEGTWYLVRVDEKHRRTYARR  479



>ref|XP_973437.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Tribolium castaneum]
 gb|EFA06304.1| hypothetical protein TcasGA2_TC009172 [Tribolium castaneum]
Length=463

 Score =   464 bits (1193),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 242/465 (52%), Positives = 305/465 (66%), Gaps = 6/465 (1%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             M S  ++VGI ALE+YFP   + Q  LE  DGAS GKYTIGLGQ  M FC++ ED+ S+ 
Sbjct  1     MGSWPQDVGIHALELYFPSQYVDQTELETFDGASAGKYTIGLGQQKMGFCTDREDINSLC  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V  LLEKY VD   IGRLEVG+ET+IDKSKS+KT LMQ+FE  G TDIEG+D+TNAC
Sbjct  61    LTVVKRLLEKYSVDYSAIGRLEVGTETIIDKSKSVKTVLMQLFEPHGVTDIEGIDTTNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFN ++WVESS+W+GRY LVVC D AVYA+G ARPTGGA A+AMLVGP+AP+VF
Sbjct  121   YGGTAALFNAISWVESSAWNGRYALVVCGDIAVYAKGSARPTGGAGAVAMLVGPNAPLVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             +  +R +++ H YDFYKP L SEYP VDGKLS  CYL ALD+CY+     Y K    +F 
Sbjct  181   DRGVRATYVKHAYDFYKPDLTSEYPTVDGKLSIQCYLSALDNCYQLYGKNYSKKNNSAFD  240

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             +   D  +FHSPY KLVQKS ARL  NDFL +A          L  F+S+   ESY +RD
Sbjct  241   LGCFDAVLFHSPYCKLVQKSLARLALNDFLTSAPNQRTVKFPGLENFNSVKLSESYFDRD  300

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKH-STLPGQRVVMFS  1400
             +EKA    +K  ++AK +PS L+  QVGNMYT S+Y   +SL+ NK  S L G ++ +FS
Sbjct  301   VEKAFLNFTKDTFEAKTKPSLLIASQVGNMYTPSLYGGLVSLLLNKTVSELAGCKIGLFS  360

Query  1401  YGSGSTATMFSLRIREGQHPFS--LSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRY  1574
             YGSG  A++FS+ + +  +  S     +  V  I   L  RH+  PEKF   L++ E   
Sbjct  361   YGSGLAASLFSITVTKDSNENSPLAKLVKNVQLIKPLLAQRHKVAPEKFEAYLELREKNC  420

Query  1575  GAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANGH  1709
                 +  +       PGTYYL ++D  +RRFY   E     ANGH
Sbjct  421   HKAPYEPAGAVDNFFPGTYYLAKIDELHRRFY---ERIPVAANGH  462



>gb|ETE73530.1| Hydroxymethylglutaryl-CoA synthase, cytoplasmic, partial [Ophiophagus 
hannah]
Length=551

 Score =   466 bits (1200),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 240/461 (52%), Positives = 310/461 (67%), Gaps = 11/461 (2%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             A   K+VGI+ALEIYFP   + Q  LE  DG   GKYTIGLGQ  M FCS+ ED+ S+ L
Sbjct  41    ACWPKDVGIVALEIYFPSQYVDQVELEKFDGVDAGKYTIGLGQSKMGFCSDREDINSLCL  100

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             TAV  L+E+  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE+ GNTD+EG+D+TNACY
Sbjct  101   TAVQKLMERNSLSYDCIGRLEVGTETIIDKSKSVKTVLMQLFEESGNTDVEGIDTTNACY  160

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFN +NWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AMLVGP+AP++FE
Sbjct  161   GGTAALFNAINWVESSSWDGRYALVVAGDIAVYATGNARPTGGAGAVAMLVGPNAPLIFE  220

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCY----KSLCSKYEKLEG-  1031
               LRG+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    K +C++++K EG 
Sbjct  221   RGLRGTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDRCYNVYRKKICAQWQK-EGI  279

Query  1032  -KSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEAD-KEKLAPFSSLTGDE  1205
              K F++ D  + +FHSPY KLVQKS ARLL NDFL   + + E D    L  F  +  ++
Sbjct  280   DKDFTLNDFGFIIFHSPYCKLVQKSVARLLLNDFLNEPTLLKENDIYNGLEAFRDIKLED  339

Query  1206  SYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHN-KHSTLPGQ  1382
             +Y +RD+EKA  + S   +  K + S LV  Q GNMYT S+Y    SL+       L GQ
Sbjct  340   TYFDRDMEKAFMKASSEIFSQKTKASLLVSNQNGNMYTPSVYGCLASLLAQYSPQQLAGQ  399

Query  1383  RVVMFSYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILK  1556
             R+ +FSYGSG  AT++S+++ +   P S  +  IA++ ++  +L SR    PE F E + 
Sbjct  400   RIGVFSYGSGFAATLYSIKVSQDATPGSSLDKIIASLTDLKARLDSRKCISPEVFAENMM  459

Query  1557  IMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             + E  +   +++       L  GT+YL  VD K+RR YA++
Sbjct  460   LREKTHHLANYIPQCSVDDLFEGTWYLVRVDEKHRRTYARR  500



>ref|XP_004564719.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X1 [Maylandia zebra]
 ref|XP_004564720.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X2 [Maylandia zebra]
Length=515

 Score =   465 bits (1196),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 240/456 (53%), Positives = 306/456 (67%), Gaps = 9/456 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGI+ALE+YFP   + Q  LE  DG   GKYT+GLGQ  M FCS+ ED+ S+ LT V 
Sbjct  15    KDVGIIALELYFPSQYVDQTELEEFDGVPAGKYTVGLGQARMGFCSDREDINSLCLTVVQ  74

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+EK  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE  GNTD+EG+DSTNACYGGTA
Sbjct  75    RLMEKNALSYNSIGRLEVGTETIIDKSKSVKTALMQLFENSGNTDVEGIDSTNACYGGTA  134

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+A+L+GP+AP+ FE  LR
Sbjct  135   ALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAILIGPNAPLAFERGLR  194

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE---KLEG--KSFS  1043
             G+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    +K     + EG  KSFS
Sbjct  195   GTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDRCYSVYRNKIHAQWQREGSDKSFS  254

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADK-EKLAPFSSLTGDESYSNR  1220
             + D  + VFHSPY KLVQKS ARL+ NDFL + S   E      L  F  +  +++Y +R
Sbjct  255   LEDFGFLVFHSPYCKLVQKSLARLMLNDFLNHPSPNTETGPFTGLEAFRDVQPEDTYFDR  314

Query  1221  DLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLI-HNKHSTLPGQRVVMF  1397
             D+EKA  + S   ++ K + S L+  Q GNMYT S+Y    SLI  +  S + GQR+ +F
Sbjct  315   DVEKAFMKASTDMFERKTKASLLISNQNGNMYTPSVYGCLASLIAQHTPSQMAGQRIGVF  374

Query  1398  SYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILKIMEHR  1571
             SYGSG  AT++SLR+ +   P S  +  + ++ ++  +L SR +  P  F E +K+ E  
Sbjct  375   SYGSGFAATLYSLRVTQDHIPGSSLDKLVLSLSDLKTRLDSRKKVSPALFSENMKLREDT  434

Query  1572  YGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             +   ++V       L PGT+YLT VD K+RR YA++
Sbjct  435   HHLANYVPQGSVEDLFPGTWYLTRVDDKHRREYARR  470



>ref|XP_003439547.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X1 [Oreochromis niloticus]
 ref|XP_005449570.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X2 [Oreochromis niloticus]
Length=515

 Score =   464 bits (1195),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 239/456 (52%), Positives = 306/456 (67%), Gaps = 9/456 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGI+ALE+YFP   + Q  LE  DG   GKYT+GLGQ  M FCS+ ED+ S+ LT V 
Sbjct  15    KDVGIIALELYFPSQYVDQTELEEFDGVPAGKYTVGLGQARMGFCSDREDINSLCLTVVQ  74

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+EK  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE  GNTD+EG+D+TNACYGGTA
Sbjct  75    RLMEKNALSYNSIGRLEVGTETIIDKSKSVKTALMQLFENSGNTDVEGIDTTNACYGGTA  134

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AML+GP+AP+ FE  LR
Sbjct  135   ALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLIGPNAPLAFERGLR  194

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE---KLEG--KSFS  1043
             G+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    +K     + EG  KSFS
Sbjct  195   GTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDRCYSVYRNKIHAQWQREGSDKSFS  254

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADK-EKLAPFSSLTGDESYSNR  1220
             + D  + VFHSPY KLVQKS ARL+ NDFL + +   E      L  F  +  +++Y +R
Sbjct  255   LEDFGFLVFHSPYCKLVQKSLARLMLNDFLNHPNPNTENGPFTGLEAFRDVQPEDTYFDR  314

Query  1221  DLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLI-HNKHSTLPGQRVVMF  1397
             D+EKA  + S   ++ K + S L+  Q GNMYT S+Y    SLI  +  S + GQR+ +F
Sbjct  315   DVEKAFMKASTDMFERKTKASLLISNQNGNMYTPSVYGCLASLIAQHTPSQMAGQRIGVF  374

Query  1398  SYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILKIMEHR  1571
             SYGSG  AT++SLR+ +   P S  +  + ++ ++  +L SR +  P  F E +K+ E  
Sbjct  375   SYGSGFAATLYSLRVTQDHTPGSSLDKLVLSLSDLKTRLDSRKKVSPALFSENMKLREDT  434

Query  1572  YGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             +   ++V       L PGT+YLT VD K+RR YA++
Sbjct  435   HHLANYVPQGSVEDLFPGTWYLTRVDDKHRREYARR  470



>ref|XP_002063005.1| GK21611 [Drosophila willistoni]
 gb|EDW73991.1| GK21611 [Drosophila willistoni]
Length=466

 Score =   462 bits (1188),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 237/462 (51%), Positives = 307/462 (66%), Gaps = 12/462 (3%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             + VGILA+E+ FP   + Q  LE  DGAS GKYTIGLGQ  M FCS+ EDV S+ LT V+
Sbjct  9     EKVGILAIEVLFPSQYVDQTELEQFDGASAGKYTIGLGQAKMGFCSDREDVNSLCLTVVS  68

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              LLE++ +   +IGRLEVG+ET++DKSKS+K+ LMQ+F   GNTDIEG+D+TNACYGGTA
Sbjct  69    RLLERHHIKHTEIGRLEVGTETIVDKSKSVKSVLMQLFADSGNTDIEGIDTTNACYGGTA  128

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN VNW+ESSSWDGRY L VC D AVYA+G ARPTGGA AIAMLVGP+AP+V E  LR
Sbjct  129   ALFNAVNWLESSSWDGRYALAVCADIAVYAKGAARPTGGAGAIAMLVGPNAPLVLERGLR  188

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              +HM H YDFYKP L SEYP VDGKLS  CYL ALD+CY+    K+EK++ K  S    D
Sbjct  189   ATHMEHAYDFYKPDLSSEYPTVDGKLSIQCYLSALDTCYRLYRKKFEKVQPKESSAVSLD  248

Query  1059  YF---VFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLE  1229
              F   +FH+P+ KLVQKS  RL FNDFL  +     A    L  F++ T + +Y +RDLE
Sbjct  249   KFDAIIFHTPFCKLVQKSVGRLSFNDFLLTSEEKRAAKYPDLERFNNSTLEGTYFDRDLE  308

Query  1230  KASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFIS-LIHNKHSTLPGQRVVMFSYG  1406
             KA    S   + +K + S L+  QVGNMYT S+Y+  +S LI     +L  +R+ +FSYG
Sbjct  309   KAFLTQSAEIFASKTKKSLLLANQVGNMYTPSVYSGLVSLLISEPPESLVDKRIAVFSYG  368

Query  1407  SGSTATMFSLRIREGQHPFS--LSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGA  1580
             SG  A+M+S+R+      F    S +  VL +   L SR +  PE+F +++++ E    A
Sbjct  369   SGLAASMYSIRVTSDAEKFKKFASQLDYVLPL---LSSREKVSPEQFSQLMEVREKNNHA  425

Query  1581  KDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
               +  +    +L PGTYYL +VD+ +RR Y +  T   + NG
Sbjct  426   APYTPTGKVGILFPGTYYLKDVDALHRRTYERTPT---ITNG  464



>ref|XP_008208687.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Nasonia vitripennis]
Length=458

 Score =   462 bits (1188),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 231/450 (51%), Positives = 310/450 (69%), Gaps = 4/450 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             +NVGI ALE+YFP   + Q  LE  DG S GKYTIGLGQ  M FC++ ED+ S+ LT V 
Sbjct  4     ENVGIKALEVYFPAQYVDQTDLEKFDGVSAGKYTIGLGQSRMGFCNDREDINSLCLTVVH  63

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              LL++Y + P+QIGRLEVG+ET++DKSKS+K+ LMQ+FE  GNTD+EG+D+TNACYGGTA
Sbjct  64    RLLDRYAIKPEQIGRLEVGTETILDKSKSVKSCLMQLFEPSGNTDVEGIDTTNACYGGTA  123

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN ++WVESS+WDGR  LVV  D+AVYA G ARPTGGA A+AMLVGPDAP+VF+  LR
Sbjct  124   ALFNAISWVESSAWDGRLALVVAADNAVYASGSARPTGGAGAVAMLVGPDAPLVFDRGLR  183

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE-KLEGKSFSVADA  1055
              S M H YDFYKP L SEYP VDGKLS  CYL +LD+CY+  C K + K +G   +V D 
Sbjct  184   ASCMRHAYDFYKPDLRSEYPTVDGKLSIQCYLSSLDTCYQRYCDKAKAKKQGHDVTVRDF  243

Query  1056  DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKA  1235
             D  +FHSPY KLVQKSFARL   DFL +A   +  +   L  FS+L+ +++Y +RD+EKA
Sbjct  244   DAMLFHSPYCKLVQKSFARLALVDFLNSAKSNSIQNHVDLQKFSNLSLEDTYFDRDVEKA  303

Query  1236  SQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKH-STLPGQRVVMFSYGSG  1412
                +SK  ++ K +PS  +  QVGNMYT S+Y+  +SL+ +K    L G+++ +FSYGSG
Sbjct  304   FMALSKNDFEQKTKPSLFIANQVGNMYTPSVYSGLVSLLIDKPIEALAGKKIGVFSYGSG  363

Query  1413  STATMFSLRI-REGQHPFSLSNIAAVLN-IAEKLKSRHEFPPEKFVEILKIMEHRYGAKD  1586
               ++M+S+ + ++     +LS +   L+ +  +L++R +  PE++ E L + E       
Sbjct  364   LASSMYSITVTKDVSQDSALSKLVTNLSYVKTQLEARRKVHPEEYTETLALREKNCHTVP  423

Query  1587  FVTSKDCSLLAPGTYYLTEVDSKYRRFYAK  1676
             F        + PGTYYL +VD  YRR Y +
Sbjct  424   FEPQSSIDNMFPGTYYLVKVDELYRRTYER  453



>ref|XP_008287032.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic [Stegastes 
partitus]
Length=515

 Score =   464 bits (1193),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 236/456 (52%), Positives = 306/456 (67%), Gaps = 9/456 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VG++A+E+YFP   + Q  LE  D  S GKYT+GLGQ  M FCS+ ED+ S+ LT V 
Sbjct  15    KDVGVIAMEVYFPSQYVDQTELEQFDSVSAGKYTVGLGQARMGFCSDREDINSLCLTVVQ  74

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+E+  +    IGRLEVG+ET+IDKSKS+KT +MQ+FE  GNTD+EGVD+TNACYGGTA
Sbjct  75    RLMERNSLSYDSIGRLEVGTETIIDKSKSVKTVIMQLFEDSGNTDVEGVDTTNACYGGTA  134

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AMLVGP+AP+ FE  LR
Sbjct  135   ALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGPNAPLAFERGLR  194

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE---KLEG--KSFS  1043
             G+HM H YDFYKP + SEYPVVDGK+S  CYL ALD CY    +K     + +G  K F+
Sbjct  195   GTHMQHAYDFYKPDMVSEYPVVDGKMSIECYLSALDRCYSVYRNKIHAQWQRDGSEKRFT  254

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADK-EKLAPFSSLTGDESYSNR  1220
             + D  + VFHSPY KLVQKS ARL+ NDFL + S   E      L  F  +  +E+Y +R
Sbjct  255   LEDFGFLVFHSPYCKLVQKSLARLMLNDFLSHPSPNTETGPFTGLDAFRDVQPEETYFDR  314

Query  1221  DLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLI-HNKHSTLPGQRVVMF  1397
             D+EKA  + S   ++ K +PS L+  Q GNMYT S+Y    SLI  +  S + GQRV +F
Sbjct  315   DVEKAFMKASADLFERKTKPSLLISNQNGNMYTPSVYGCLASLIAQHTSSQIAGQRVGVF  374

Query  1398  SYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILKIMEHR  1571
             SYGSG  AT++S+R+ +   P S  +  ++++ ++  +L SR +  P  F E +K+ E  
Sbjct  375   SYGSGFAATLYSVRVTQDHTPGSSLDKLVSSLSDLKARLDSRQKVSPAVFSENMKLREET  434

Query  1572  YGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             +    +V       L PGT+YLT VD K+RR YA++
Sbjct  435   HHLASYVPRGSVEDLFPGTWYLTRVDDKHRREYARR  470



>ref|XP_010747211.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic [Larimichthys 
crocea]
Length=515

 Score =   464 bits (1193),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 239/456 (52%), Positives = 304/456 (67%), Gaps = 9/456 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGI+A+E+YFP   + Q  LE  DG   GKYT+GLGQ  M FCS+ ED+ S+ LT V 
Sbjct  15    KDVGIIAMELYFPSQYVDQAELEQFDGVPAGKYTVGLGQARMGFCSDCEDINSLCLTVVQ  74

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+E+  +    +GRLE+G+ET+IDKSKS+KT +MQ+FE  GNTD+EG+D+TNACYGGTA
Sbjct  75    RLMERNGLSYDSVGRLEIGTETIIDKSKSVKTVIMQLFEDSGNTDVEGIDTTNACYGGTA  134

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AMLVGP+AP+ FE  LR
Sbjct  135   ALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGPNAPLAFERGLR  194

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE---KLEG--KSFS  1043
             G+HM H YDFYKP L SEYPVVDGKLS  CYL ALD CY    +K     + EG  K FS
Sbjct  195   GTHMQHAYDFYKPDLVSEYPVVDGKLSIECYLSALDRCYSVYRNKIHAQWQREGSEKRFS  254

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADK-EKLAPFSSLTGDESYSNR  1220
             + D  Y VFHSPY KLVQKS ARL+ NDFL N +   E      L  F  +  +E+Y +R
Sbjct  255   LDDFGYLVFHSPYCKLVQKSLARLMLNDFLSNPNPNTETGPFTGLDAFRDVRPEETYFDR  314

Query  1221  DLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLI-HNKHSTLPGQRVVMF  1397
             D+EKA  + S   ++ K + S L+  Q GNMYT S+Y    SLI     S + GQRV +F
Sbjct  315   DVEKAFMKASADLFEKKTKCSLLISNQNGNMYTPSVYGCLASLIAQQTASQIAGQRVGVF  374

Query  1398  SYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILKIMEHR  1571
             SYGSG  AT++SLR+ +   P S  +  +A++ ++  +L SR +  P  F E +K+ E  
Sbjct  375   SYGSGFAATLYSLRVTQDHTPGSALDKLVASLSDLQVRLDSRTKVSPAVFSENMKLREET  434

Query  1572  YGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             +    ++       L PGT+YLT VD K+RR YA++
Sbjct  435   HHLASYIPRGSVMDLFPGTWYLTRVDDKHRREYARR  470



>ref|XP_005751360.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X1 [Pundamilia nyererei]
 ref|XP_005751361.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X2 [Pundamilia nyererei]
Length=515

 Score =   464 bits (1193),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 238/457 (52%), Positives = 309/457 (68%), Gaps = 11/457 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGI+ALE+YFP   + Q  LE  DG   GKYT+GLGQ  M FCS+ ED+ S+ LT V 
Sbjct  15    KDVGIIALELYFPSQYVDQTELEEFDGVPAGKYTVGLGQARMGFCSDREDINSLCLTVVQ  74

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+EK  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE  GNTD+EG+D+TNACYGGTA
Sbjct  75    RLMEKNALSYNSIGRLEVGTETIIDKSKSVKTALMQLFENSGNTDVEGIDTTNACYGGTA  134

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+A+L+GP+AP+ FE  LR
Sbjct  135   ALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAILIGPNAPLAFERGLR  194

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCY----KSLCSKYEKLEG--KSF  1040
             G+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY      + +++++ EG  KSF
Sbjct  195   GTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDRCYSVYRNKIYAQWQR-EGSDKSF  253

Query  1041  SVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADK-EKLAPFSSLTGDESYSN  1217
             S+ D  + VFHSPY KLVQKS ARL+ NDFL + S   E      L  F  +  +++Y +
Sbjct  254   SLEDFGFLVFHSPYCKLVQKSLARLMLNDFLNHPSPNTETGPFTGLEAFRDVQPEDTYFD  313

Query  1218  RDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLI-HNKHSTLPGQRVVM  1394
             RD+EKA  + S   ++ K + S L+  Q GNMYT S+Y    SLI  +  S + GQR+ +
Sbjct  314   RDVEKAFMKASTDMFERKTKASLLISNQNGNMYTPSVYGCLASLIAQHTPSQMAGQRIGV  373

Query  1395  FSYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILKIMEH  1568
             FSYGSG  AT++SLR+ +   P S  +  + ++ ++  +L SR +  P  F E +K+ E 
Sbjct  374   FSYGSGFAATLYSLRVTQDHIPGSSLDKLVLSLSDLKTRLDSRKKVSPALFSENMKLRED  433

Query  1569  RYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
              +   ++V       L PGT+YLT VD K+RR YA++
Sbjct  434   THHLANYVPQGSVEDLFPGTWYLTRVDDKHRREYARR  470



>ref|XP_004333041.1| hydroxymethylglutarylCoA synthase [Acanthamoeba castellanii str. 
Neff]
 gb|ELR11028.1| hydroxymethylglutarylCoA synthase [Acanthamoeba castellanii str. 
Neff]
Length=513

 Score =   463 bits (1192),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 239/488 (49%), Positives = 316/488 (65%), Gaps = 18/488 (4%)
 Frame = +3

Query  240   CGRCLIIFCRCFDPFAVRRSVVAFSEP*MASQQKNVGILALEIYFPPTCLQQEALEAHDG  419
             CGR  I       P    R  VA      +   ++VGI+AL++YFP T + Q  LE HDG
Sbjct  36    CGRGGIATMLATSPTTSARRGVATD---FSHYPRDVGIVALDVYFPSTYVSQADLETHDG  92

Query  420   ASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVTSLLEKYEVDPKQIGRLEVGSETVIDKS  599
              + GKYT+GLGQ  MAF  + ED+ S+ LTAV SLLEKY +DPK +GR+EVG+ET++DKS
Sbjct  93    VAAGKYTVGLGQTSMAFTGDREDINSICLTAVQSLLEKYNIDPKDVGRVEVGTETIVDKS  152

Query  600   KSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTAALFNCVNWVESSSWDGRYGLVVCTDSA  779
             KS+K+ LM +F+K GNTDIEGVD+TNACYGGT ALFN +NWVESS WDGRY +VV  D A
Sbjct  153   KSVKSTLMDLFQKAGNTDIEGVDTTNACYGGTNALFNAINWVESSYWDGRYAVVVAGDIA  212

Query  780   VYAEGPARPTGGAAAIAMLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSEYPVVDGKLS  959
             VY  GPARPTGGAAA+AML+G  APIVFE  +R + M + +DFYKP++ SEYP+VDG LS
Sbjct  213   VYEAGPARPTGGAAAVAMLIGKGAPIVFERGIRSTFMENAWDFYKPVMGSEYPLVDGALS  272

Query  960   QTCYLMALDSCYKSLCSKYEKLEGKSFSV-ADADYFVFHSPYNKLVQKSFARLLFNDFLR  1136
              TCYL ALD C+ +   ++EK  GK  S+ AD DY +FHSPY KLVQKS+AR+ + + ++
Sbjct  273   NTCYLRALDQCFYTYAERFEKAHGKKLSLDADVDYALFHSPYTKLVQKSWARMNYLEAVK  332

Query  1137  NASYINEADKEKLAPFSSLTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMY  1316
             N ++   A  E L   + L  + +Y + +L K   + S   Y +KV PS  +PK++GN Y
Sbjct  333   NEAH---ALHESLKSQNKLQPETTYEDNNLMKEVIKYSDATYKSKVGPSLTLPKELGNSY  389

Query  1317  TASIYAAFISLI--HNKHSTLPGQ-RVVMFSYGSGSTATMFSLRIREGQHPFSLSNIAAV  1487
               S+Y   +SL+  H   +T   + R +MFSYGSG  A++FS++++ G     L  IA  
Sbjct  390   CGSLYTGLLSLVASHADAATSEAEKRALMFSYGSGLAASLFSVKLKSG-----LKKIADT  444

Query  1488  LNIAEKLKSRHEFPPEKFVEILKIMEHRYG---AKDFVTSKDCSLLAPGTYYLTEVDSKY  1658
              N   +L  R +  P  FVE LK  E        K FV S     L PGT+YL +VD K+
Sbjct  445   SNFQARLAQRKKVAPADFVEALKRRETATSDDVPKPFVPSDKVEDLFPGTFYLEQVDEKF  504

Query  1659  RRFYAKKE  1682
             RR YA+ +
Sbjct  505   RRTYARNQ  512



>ref|XP_010887875.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X2 [Esox lucius]
Length=520

 Score =   463 bits (1192),  Expect = 7e-153, Method: Compositional matrix adjust.
 Identities = 242/465 (52%), Positives = 308/465 (66%), Gaps = 19/465 (4%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             A+  K+VG++ALEIYFP   + Q  LE  DG S GKYT GLGQ  M FCS+ ED+ S+ L
Sbjct  11    ATWPKDVGVIALEIYFPSQYVDQAELEQFDGVSAGKYTAGLGQARMGFCSDREDINSLCL  70

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             T V  L+E+  +   Q+GRLEVG+ET+IDKSKS+KT +MQ+FE+ GNTD+EG+D+TNACY
Sbjct  71    TVVQRLMEQNGLSYDQVGRLEVGTETIIDKSKSVKTVVMQLFEESGNTDVEGIDTTNACY  130

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFN VNWVES+SWDGRY LVV  D AVYA G ARPTGGA AIAML+GP+AP+ F+
Sbjct  131   GGTAALFNAVNWVESTSWDGRYALVVAGDIAVYATGSARPTGGAGAIAMLIGPNAPLAFD  190

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE---KLEG--  1031
               LRG+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    +K     + EG  
Sbjct  191   RGLRGTHMQHAYDFYKPDMGSEYPVVDGKLSIKCYLSALDRCYAVYRNKIHAQWQREGVD  250

Query  1032  KSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTG----  1199
             + FS+ D  Y VFHSPY KLVQKS ARLL NDFL + S   E       PFS L      
Sbjct  251   RRFSLEDFGYMVFHSPYCKLVQKSLARLLLNDFLSHTSPDTET-----GPFSGLEAFRDV  305

Query  1200  --DESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFIS-LIHNKHST  1370
               +++Y +RD+EKA  + S   ++ K + S LV  Q GNMYT S+Y    S L  +    
Sbjct  306   KLEDTYFDRDVEKAFMKASTEMFEQKTKASLLVSSQNGNMYTPSVYGCLASVLAQHAPQD  365

Query  1371  LPGQRVVMFSYGSGSTATMFSLRIREGQHPFS-LSNI-AAVLNIAEKLKSRHEFPPEKFV  1544
             L GQR+ +FSYGSG  AT++SLR+ +   P S L  + A++ ++  +L SR +  P  F 
Sbjct  366   LAGQRIGLFSYGSGFAATLYSLRVSQDATPGSGLDKLCASLFDLKARLDSRRKVSPAVFA  425

Query  1545  EILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             + L++ E  +    +V       L PGT+YLT VD K+RR YA++
Sbjct  426   DNLQLREKTHHLAPYVPQGSVEDLFPGTWYLTRVDEKHRREYARR  470



>ref|XP_005174887.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Musca domestica]
 ref|XP_005174888.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Musca domestica]
Length=461

 Score =   461 bits (1186),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 238/461 (52%), Positives = 306/461 (66%), Gaps = 10/461 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             +NVGILA+E+ FP   + Q  LE  DGAS GKYTIGLGQ  M FCS+ EDV S+ LT VT
Sbjct  4     ENVGILAVEVLFPSQYVDQTELEQFDGASAGKYTIGLGQAKMGFCSDREDVNSLCLTVVT  63

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+E++++    IGRLEVG+ET++DKSKS+K+ LMQ+F   GNTD+EG+D+TNACYGGTA
Sbjct  64    RLMERHQIKATDIGRLEVGTETIVDKSKSVKSVLMQLFADSGNTDMEGIDTTNACYGGTA  123

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN +NWVESSSWDGR  L VC D AVYA+G ARPTGGA AIAMLVGP+AP+VFE  LR
Sbjct  124   ALFNSINWVESSSWDGRLALAVCADIAVYAKGAARPTGGAGAIAMLVGPNAPLVFERGLR  183

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLE---GKSFSVA  1049
              +HM H YDFYKP L SEYP VDGKLS  CYL ALD+CY+    K+EKL    GK   + 
Sbjct  184   ATHMEHAYDFYKPDLSSEYPTVDGKLSIQCYLSALDTCYQLYRKKFEKLNPQTGKE-GLD  242

Query  1050  DADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADK-EKLAPFSSLTGDESYSNRDL  1226
             + D  +FH+P+ KLVQKS ARL+FNDFL  A     A K   L  F++ T   +Y +RD+
Sbjct  243   NFDAILFHTPFCKLVQKSVARLVFNDFLLTADETKRAQKYPALEKFNNHTLATTYFDRDV  302

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFIS-LIHNKHSTLPGQRVVMFSY  1403
             EKA        ++ K + S L+  QVGNMYT S+Y+  +S L+  K   L G+R+ +FSY
Sbjct  303   EKAFMTQFANVFEEKTKKSLLLANQVGNMYTPSVYSGLVSLLVSEKPENLVGKRIAVFSY  362

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  A+M+S+++      F    +  +  +   L SR +  PE F E+++I E    A 
Sbjct  363   GSGLAASMYSIKVTSNSDVFQ-KFVEKLDYVMPLLNSREKVAPELFSELMEIREKNNHAA  421

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
              +  +   S L PGTYYL  VD  +RR Y +  T   ++NG
Sbjct  422   PYTPTGSISALFPGTYYLKSVDEMHRRTYERTPT---ISNG  459



>ref|NP_001120172.1| hydroxymethylglutaryl-CoA synthase, cytoplasmic [Xenopus (Silurana) 
tropicalis]
 gb|AAI59180.1| hmgcs1 protein [Xenopus (Silurana) tropicalis]
Length=520

 Score =   463 bits (1192),  Expect = 8e-153, Method: Compositional matrix adjust.
 Identities = 248/494 (50%), Positives = 320/494 (65%), Gaps = 32/494 (6%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             +S  K+VGI+ALEIYFP   + Q  LE  DG S GKYTIGLGQ  M FCS+ ED+ S+ L
Sbjct  11    SSWPKDVGIVALEIYFPSQYVDQVELEKFDGVSAGKYTIGLGQCKMGFCSDREDINSLCL  70

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             T V  L+E+  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE  GNTD+EG+D+TNACY
Sbjct  71    TVVQRLMERNNLSYDCIGRLEVGTETIIDKSKSVKTVLMQLFEDSGNTDVEGIDTTNACY  130

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AMLVGP+A +VFE
Sbjct  131   GGTAALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGPNATLVFE  190

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCY----KSLCSKYEKLEG-  1031
               LRG+HM H YDFYKP ++SEYPVVDGKLS  CYL ALD CY    K + ++++K EG 
Sbjct  191   RGLRGTHMQHAYDFYKPDMESEYPVVDGKLSIQCYLSALDHCYTTYRKKIHAQWQK-EGT  249

Query  1032  -KSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEK-----LAPFSSL  1193
              K F++ D  + +FHSPY KLVQKS ARLL NDF+ ++    + D E      L  F  L
Sbjct  250   DKPFTLNDFGFMIFHSPYCKLVQKSLARLLVNDFISDS----DPDMESGMYVGLDSFRDL  305

Query  1194  TGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHN-KHST  1370
               +E+Y +RD+EKA  + S   ++ K + S LV ++ GNMYT S+Y    S++       
Sbjct  306   KLEETYFDRDVEKAFLKASTELFNDKTKASLLVSRENGNMYTPSVYGCLASVLAQYSPQQ  365

Query  1371  LPGQRVVMFSYGSGSTATMFSLRIREGQHP-FSLSNIAAVL-NIAEKLKSRHEFPPEKFV  1544
             L GQR+ +FSYGSG  ATM+SLR+ +   P  SL  + + L ++  +L SR    P  F 
Sbjct  366   LAGQRIGVFSYGSGFAATMYSLRVSQDAMPGSSLDKLTSSLSDLKARLDSRKNVSPSNFA  425

Query  1545  EILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAK-------------KET  1685
             + +K+ +  +   +++       L PGT+YL  VD K+RRFYA+             +  
Sbjct  426   DTMKLRQDTHHLANYIPQGSVDDLFPGTWYLVRVDEKHRRFYARSSLMNDGPLDAAPESV  485

Query  1686  KAAVANGH*PESIK  1727
              A+ AN H P   K
Sbjct  486   HASTANEHFPSPAK  499



>ref|XP_011874686.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Vollenhovia 
emeryi]
 ref|XP_011874687.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Vollenhovia 
emeryi]
 ref|XP_011874688.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Vollenhovia 
emeryi]
Length=455

 Score =   461 bits (1185),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 242/455 (53%), Positives = 312/455 (69%), Gaps = 13/455 (3%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGI ALE+YFP   + Q+ LE HDG S GKYTIGLGQ  M FC++ ED+ S+ LT   
Sbjct  4     KDVGIRALEVYFPAQYVDQKELEVHDGVSAGKYTIGLGQSRMGFCNDREDINSLCLTVTH  63

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              LLE+Y + P+ IGRLEVG+ET++DKSKS+KT LMQ+FE  G TDIEG D+TNACYGGTA
Sbjct  64    RLLERYNIKPRDIGRLEVGTETILDKSKSVKTLLMQLFEPHGCTDIEGADTTNACYGGTA  123

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN + WVESS+WDGR+ LVV  D+AVY+ G ARPTGGA AIA+LVGPDAP+VF+  LR
Sbjct  124   ALFNSIGWVESSAWDGRFALVVAADNAVYSTGSARPTGGAGAIAILVGPDAPLVFDRGLR  183

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKY-EKLEGKS-FSVAD  1052
              S+M+H YDFYKP L SEYP+VDGKLS  CYL +LDSCY+  C K   K  G+S  ++A+
Sbjct  184   ASYMSHSYDFYKPNLRSEYPIVDGKLSIHCYLKSLDSCYQLYCEKVRRKSPGESPVTLAN  243

Query  1053  ADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLA-PFSSLTGDESYSNRDLE  1229
              D  +FHSPY KLVQKSFARL F DFL NA      D  K A  F +   +++Y N+++E
Sbjct  244   FDAMLFHSPYCKLVQKSFARLAFVDFL-NAPKNQIPDGYKDAVKFRTAKLEDTYFNQEIE  302

Query  1230  KASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKH-STLPGQRVVMFSYG  1406
             KA  Q+SK  ++ K +PS L+  QVGNMYT S+Y+  +SL+ +K  + L G ++ +FSYG
Sbjct  303   KAFMQLSKVDFEQKTKPSLLIANQVGNMYTPSVYSGLVSLLVSKPINELAGTKIGIFSYG  362

Query  1407  SGSTATMFSLRI----REGQHPFSLSNIAAVLN-IAEKLKSRHEFPPEKFVEILKIMEHR  1571
             SG  ++M+SL +    REG    +LS I   L+ +  +L+ RH   PE +  +L   E  
Sbjct  363   SGLCSSMYSLTVAKDTREGS---ALSQIITALSYVKSQLEGRHCVSPEDYTSVLAARERN  419

Query  1572  YGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAK  1676
                  F        + PGTYYLT+VD KYRR Y +
Sbjct  420   CHVVPFTPESSTDNMFPGTYYLTQVDEKYRRTYKR  454



>ref|XP_004533489.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1-like isoform 
X1 [Ceratitis capitata]
 ref|XP_004533490.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1-like isoform 
X2 [Ceratitis capitata]
 ref|XP_004533491.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1-like isoform 
X3 [Ceratitis capitata]
Length=460

 Score =   461 bits (1185),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 235/461 (51%), Positives = 309/461 (67%), Gaps = 11/461 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             +NVGI A+E+ FP   + Q  LE  DG S GKYT+GLGQ  M FCS+ EDV S+ LT V+
Sbjct  4     ENVGIRAMEVIFPSQYVDQTELEQFDGVSAGKYTLGLGQGKMGFCSDREDVNSLCLTVVS  63

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              LLE++++ P+ IGRLEVG+ET++DKSKS+K+ LMQ+F + GNTDIEG+D+TNACYGGTA
Sbjct  64    RLLERWQIKPQDIGRLEVGTETIVDKSKSVKSVLMQLFAESGNTDIEGLDTTNACYGGTA  123

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN +NW+ESSSWDGRY L VC D AVYA+GPARPTGGA A+AML+GP+AP+VFE  LR
Sbjct  124   ALFNSINWIESSSWDGRYALAVCADIAVYAKGPARPTGGAGAVAMLIGPNAPLVFERGLR  183

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              +HM H YDFYKP L SEYPVVDGKLS  CYL ALD CY+    KY K       V   +
Sbjct  184   ATHMEHAYDFYKPNLSSEYPVVDGKLSIQCYLSALDICYRRYRMKYAKKYPNEPEVTLDN  243

Query  1059  Y--FVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEK  1232
             +   VFH+P+ KLVQKS  R++FNDFL  +     A    L  F+ +  +++Y +RD+EK
Sbjct  244   FHALVFHTPFCKLVQKSVGRVVFNDFLNCSVEKRPAKYPGLERFNEVKLEDTYFDRDVEK  303

Query  1233  ASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLI-HNKHSTLPGQRVVMFSYGS  1409
             A        ++ K Q S L+  QVGNMYTAS+Y+   SL+ +N   +L G+R+ +FSYGS
Sbjct  304   AFMTQFANVFETKTQKSLLIANQVGNMYTASVYSGLASLLANNPAESLVGKRIGVFSYGS  363

Query  1410  GSTATMFSLRIREGQHPFS--LSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             G  ATM+S+ + +    F   +S +  VL     L +R +  P  F +++++ E    A 
Sbjct  364   GLAATMYSILVTKDDKVFQQFVSKLDYVL---PALSAREKVAPVVFSQLMEVREKNNHAA  420

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
              +  S   S L PGTYYL +VD  +RR Y +K T   +ANG
Sbjct  421   PYTPSGSVSALLPGTYYLKDVDDMHRRSYERKPT---IANG  458



>ref|XP_003965130.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic [Takifugu 
rubripes]
Length=515

 Score =   462 bits (1190),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 238/461 (52%), Positives = 309/461 (67%), Gaps = 9/461 (2%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             M    K+VGI+A+E+YFP   + Q  LE  DG   GKYT+GLGQ  M FCS+ ED+ S+ 
Sbjct  10    MGPWPKDVGIIAMELYFPSQYVDQAELEQFDGVLAGKYTVGLGQARMGFCSDCEDINSLC  69

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT V  L+E+  +    +GRLEVG+ET+IDKSKS+KT +MQ+FE  GNTD+EGVD+TNAC
Sbjct  70    LTVVHRLMERNGLSYDSVGRLEVGTETIIDKSKSVKTVIMQLFEDSGNTDVEGVDTTNAC  129

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGTAALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AMLVGP+AP+VF
Sbjct  130   YGGTAALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAMLVGPNAPLVF  189

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE---KLEG-  1031
             E  LR +HM H YDFYKP L SEYPVVDGKLS  CYL ALD CY    +K +   + +G 
Sbjct  190   ERGLRATHMKHAYDFYKPDLMSEYPVVDGKLSIECYLSALDRCYSVYRNKVQAQWQRDGS  249

Query  1032  -KSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADK-EKLAPFSSLTGDE  1205
              K FS+ D  + VFHSPY KLVQKS ARL+ NDFL + +   E      L  F  +  +E
Sbjct  250   EKRFSLEDFGFLVFHSPYCKLVQKSLARLMLNDFLSHPNPNTETGLFSGLDTFRDVQPEE  309

Query  1206  SYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKH-STLPGQ  1382
             +Y +RD+EKA  + S   ++ K + S L+  Q GNMYT S+Y    SLI  +  S L GQ
Sbjct  310   TYFDRDVEKAFMKASSDLFEKKTKSSLLISNQNGNMYTPSVYGCLASLIAQQTPSQLAGQ  369

Query  1383  RVVMFSYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILK  1556
             R+ +FSYGSG  AT++S+R+ +   P S+ +  ++++ ++  +L SR +  P  F E +K
Sbjct  370   RIGVFSYGSGFAATLYSVRVTQDHTPGSVLDKLVSSLSDLKVRLDSRKKVSPAVFSENMK  429

Query  1557  IMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             + E  +   ++V       L PGT+YLT VD K+RR YA++
Sbjct  430   LREETHHLANYVPRGSADDLFPGTWYLTRVDDKFRREYARR  470



>ref|XP_005112065.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X2 [Aplysia californica]
Length=495

 Score =   462 bits (1188),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 228/455 (50%), Positives = 306/455 (67%), Gaps = 3/455 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             ++VGI+ALEIYFP   + Q  LEA DG S GKYTIGLGQ  M FCS+ ED+ ++ LT V 
Sbjct  15    QDVGIVALEIYFPSQYVDQTQLEAFDGVSAGKYTIGLGQGKMGFCSDREDINTLCLTVVQ  74

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+++ ++   +IGRLEVG+ET+IDKSKS KT +MQ+FE+ GNTD+EGVD+TNACYGGTA
Sbjct  75    RLMQRNKIGYNEIGRLEVGTETIIDKSKSTKTVVMQLFEESGNTDLEGVDTTNACYGGTA  134

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN  NW+ESS+WDGRY LVV  D AVYA G AR TGGA A+AMLVGP+AP+V +  +R
Sbjct  135   ALFNAANWIESSAWDGRYALVVAGDIAVYATGNARCTGGAGAVAMLVGPNAPLVLDRGVR  194

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFSVADAD  1058
              SHM HVYDFYKP + SEYP VDGKLS  CYL ALD CY+   +K      +  ++   D
Sbjct  195   SSHMQHVYDFYKPDMSSEYPTVDGKLSIQCYLHALDMCYQRYTTKAVAAGIRRNTIDIGD  254

Query  1059  YFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLEKAS  1238
              F+FHSPY KLVQKSFARLL NDFLR+ +   +     L  F  +  +++Y +R +E A 
Sbjct  255   GFLFHSPYCKLVQKSFARLLLNDFLRDPNPDFQGRYNGLEAFREIKLEDTYFDRSVEGAV  314

Query  1239  QQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKH-STLPGQRVVMFSYGSGS  1415
                SK  ++ K +PS LV  QVGNMYT S+Y    S I +    ++ G+RVV+FSYGSG 
Sbjct  315   VTASKSLFEGKTKPSLLVANQVGNMYTPSLYGGLASFIASHTLDSIAGKRVVLFSYGSGL  374

Query  1416  TATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAKDF  1589
              +TMFS++  + + P    +  ++++ ++ ++L SR   PP+ F   +K+ E  +    +
Sbjct  375   ASTMFSMQFSDNKAPSGALDKLVSSLADLKQRLDSRQCVPPQDFDSNMKLREQTHHLAPY  434

Query  1590  VTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAA  1694
                   S+L PGT+YL+EVDS +RR Y +    + 
Sbjct  435   TPVGSLSVLFPGTWYLSEVDSMHRRKYERTSANSG  469



>gb|KKA18589.1| Hydroxymethylglutaryl-CoA synthase [Rasamsonia emersonii CBS 
393.64]
Length=458

 Score =   460 bits (1184),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 233/465 (50%), Positives = 318/465 (68%), Gaps = 21/465 (5%)
 Frame = +3

Query  324   MASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMS  503
             M+++ +N+GI A+EIYFP  C+ Q  LE  DG S+GKYTIGLGQ  M+FC + ED+ SM+
Sbjct  1     MSTRPQNIGIKAIEIYFPSQCVDQAELEKFDGVSEGKYTIGLGQTKMSFCDDREDIYSMA  60

Query  504   LTAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNAC  683
             LT ++SLL KY +DPK IGRLEVG+ET++DKSKS+K+ LMQ+FE  GNT++EGVD+ NAC
Sbjct  61    LTTLSSLLRKYNIDPKSIGRLEVGTETILDKSKSVKSVLMQLFEPSGNTNVEGVDTVNAC  120

Query  684   YGGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVF  863
             YGGT ALFN +NW+ESS+WDGR  +VVC D A+YA+G ARPTGGA  +AML+GPDAPIVF
Sbjct  121   YGGTNALFNSINWLESSAWDGRDAIVVCGDIALYAKGNARPTGGAGCVAMLIGPDAPIVF  180

Query  864   ESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS  1043
             E  LRG+H+AH YDFYKP L SEYPVVDG  S  CY  A+D+CYK+  ++ + L+ K  +
Sbjct  181   EPGLRGTHIAHAYDFYKPDLTSEYPVVDGHFSIKCYTQAVDACYKAYNAREQVLKEKGAA  240

Query  1044  ----VADA-------DYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSS  1190
                 VAD        D+ +FH+P  KLV KS+ARLL+ND+L N S+   A K+  A    
Sbjct  241   QNGVVADDKTPLDRFDHVLFHAPTCKLVAKSYARLLYNDYLANPSH--PAFKDVPAELRD  298

Query  1191  LTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHST  1370
             L  D+S S+R++EK    ++K  +D +V+PS  V    GNMY+AS+Y   +SL+ N  + 
Sbjct  299   LDYDKSLSDRNVEKTFMALTKKRFDERVKPSIEVATMCGNMYSASVYGGLVSLLSNV-TF  357

Query  1371  LPGQ--RVVMFSYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFV  1544
              P Q  RV +FSYGSG  ++MFS +I        +S +A  L++  +L +R    P+++ 
Sbjct  358   DPSQPKRVAVFSYGSGLASSMFSFKIVG-----DVSTMAKKLDLHNRLNARRVVSPQEYD  412

Query  1545  EILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
              +  + EH +  K+F  + +   +APGTYYL EVD  +RR Y  K
Sbjct  413   NMCLLREHAHLKKNFKPAGNPETIAPGTYYLVEVDDMFRRKYEIK  457



>ref|XP_010887874.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X1 [Esox lucius]
Length=527

 Score =   462 bits (1190),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 242/465 (52%), Positives = 308/465 (66%), Gaps = 19/465 (4%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             A+  K+VG++ALEIYFP   + Q  LE  DG S GKYT GLGQ  M FCS+ ED+ S+ L
Sbjct  18    ATWPKDVGVIALEIYFPSQYVDQAELEQFDGVSAGKYTAGLGQARMGFCSDREDINSLCL  77

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             T V  L+E+  +   Q+GRLEVG+ET+IDKSKS+KT +MQ+FE+ GNTD+EG+D+TNACY
Sbjct  78    TVVQRLMEQNGLSYDQVGRLEVGTETIIDKSKSVKTVVMQLFEESGNTDVEGIDTTNACY  137

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFN VNWVES+SWDGRY LVV  D AVYA G ARPTGGA AIAML+GP+AP+ F+
Sbjct  138   GGTAALFNAVNWVESTSWDGRYALVVAGDIAVYATGSARPTGGAGAIAMLIGPNAPLAFD  197

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE---KLEG--  1031
               LRG+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    +K     + EG  
Sbjct  198   RGLRGTHMQHAYDFYKPDMGSEYPVVDGKLSIKCYLSALDRCYAVYRNKIHAQWQREGVD  257

Query  1032  KSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTG----  1199
             + FS+ D  Y VFHSPY KLVQKS ARLL NDFL + S   E       PFS L      
Sbjct  258   RRFSLEDFGYMVFHSPYCKLVQKSLARLLLNDFLSHTSPDTET-----GPFSGLEAFRDV  312

Query  1200  --DESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFIS-LIHNKHST  1370
               +++Y +RD+EKA  + S   ++ K + S LV  Q GNMYT S+Y    S L  +    
Sbjct  313   KLEDTYFDRDVEKAFMKASTEMFEQKTKASLLVSSQNGNMYTPSVYGCLASVLAQHAPQD  372

Query  1371  LPGQRVVMFSYGSGSTATMFSLRIREGQHPFS-LSNI-AAVLNIAEKLKSRHEFPPEKFV  1544
             L GQR+ +FSYGSG  AT++SLR+ +   P S L  + A++ ++  +L SR +  P  F 
Sbjct  373   LAGQRIGLFSYGSGFAATLYSLRVSQDATPGSGLDKLCASLFDLKARLDSRRKVSPAVFA  432

Query  1545  EILKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             + L++ E  +    +V       L PGT+YLT VD K+RR YA++
Sbjct  433   DNLQLREKTHHLAPYVPQGSVEDLFPGTWYLTRVDEKHRREYARR  477



>ref|XP_007430524.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic isoform 
X3 [Python bivittatus]
Length=521

 Score =   462 bits (1189),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 239/461 (52%), Positives = 309/461 (67%), Gaps = 11/461 (2%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             A   K+VGI+ALEIYFP   + Q  LE  DG   GKYTIGLGQ  M FCS+ ED+ S+ L
Sbjct  11    ACWPKDVGIVALEIYFPSQYVDQAELEKFDGVDGGKYTIGLGQSKMGFCSDREDINSLCL  70

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             TAV  L+E+  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE+ GNTD+EG+D+TNACY
Sbjct  71    TAVQKLMERNSLSYNCIGRLEVGTETIIDKSKSVKTVLMQLFEESGNTDVEGIDTTNACY  130

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFN +NWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AMLVGP+AP++FE
Sbjct  131   GGTAALFNAINWVESSSWDGRYALVVAGDIAVYATGNARPTGGAGAVAMLVGPNAPLIFE  190

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCY----KSLCSKYEKLEG-  1031
               LRG+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    K + +K++K EG 
Sbjct  191   RGLRGTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDHCYTVYRKKIRAKWQK-EGI  249

Query  1032  -KSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEAD-KEKLAPFSSLTGDE  1205
              K F++ D  + +FHSPY KLVQKS ARLL NDFL + +   E D    L  F  +  ++
Sbjct  250   DKDFTLNDFGFIIFHSPYCKLVQKSVARLLLNDFLNDPTPTKENDIYNGLEAFRDIKLED  309

Query  1206  SYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHN-KHSTLPGQ  1382
             +Y +RD+EKA  + S   +  K + S LV  Q GNMYT S+Y    SL+       L GQ
Sbjct  310   TYFDRDVEKAFMKASAEIFSQKTKASLLVSNQNGNMYTPSVYGCLASLLAQYSPQQLAGQ  369

Query  1383  RVVMFSYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILK  1556
             R+ +FSYGSG  AT++S+++ +   P S  +  IA++ ++  +L SR    PE F E + 
Sbjct  370   RIGVFSYGSGFAATLYSIKVSQDATPGSSLDKIIASLTDLKARLDSRKCITPEVFAENMM  429

Query  1557  IMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             + +  +   +++       L  GT+YL  VD K+RR YA++
Sbjct  430   LRQETHHLANYIPQCSVDDLFEGTWYLVRVDEKHRRMYARR  470



>ref|XP_002015981.1| GL10732 [Drosophila persimilis]
 gb|EDW31871.1| GL10732 [Drosophila persimilis]
Length=465

 Score =   460 bits (1183),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 233/461 (51%), Positives = 310/461 (67%), Gaps = 9/461 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             +NVGI A+E+ FP   + Q  LE  DGAS GKYTIGLGQ  M FCS+ EDV S+ LT V+
Sbjct  7     ENVGIRAIEVLFPSQYVDQTELEQFDGASAGKYTIGLGQAKMGFCSDREDVNSLCLTVVS  66

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              LLE++ +   +IGRLEVG+ET++DKSKS+K+ LMQ+F   GNTDIEG+D+TNACYGGTA
Sbjct  67    RLLERHHIKHTEIGRLEVGTETIVDKSKSVKSVLMQLFADSGNTDIEGIDTTNACYGGTA  126

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN +NW+ESSSWDGRY L VC D AVYA+G ARPTGGA A+AMLVGP+AP+VFE  LR
Sbjct  127   ALFNAINWIESSSWDGRYALAVCADIAVYAKGAARPTGGAGAVAMLVGPNAPLVFERGLR  186

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKSFS----V  1046
              +HM H YDFYKP L SEYP VDGKLS  CYL ALD+CY+    K+EK + K+ S    +
Sbjct  187   ATHMEHAYDFYKPDLSSEYPTVDGKLSIQCYLSALDTCYRLYRQKFEKQQAKTQSGKVGL  246

Query  1047  ADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDL  1226
              + D  +FH+P+ KLVQKS  RL FNDFL  +          L  F++ T + +Y +RD+
Sbjct  247   DNFDAILFHTPFCKLVQKSVGRLSFNDFLLTSEGKRAEQFAGLERFNNATLEGTYFDRDV  306

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFIS-LIHNKHSTLPGQRVVMFSY  1403
             EKA    S   ++AK + + L+  QVGNMYT S+Y+  +S LI    + L G+R+ +FSY
Sbjct  307   EKAFLTQSADVFEAKTKKTLLLANQVGNMYTPSVYSGLVSLLIGVPAADLVGKRIGVFSY  366

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  A+M+S+ + +    F    +A +  +   L SR +  PE+F E++++ E    A 
Sbjct  367   GSGLAASMYSISVTQDAAAFE-KFVAQLDYVLPLLNSREKVAPEQFSELMEVREKNNHAA  425

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
              +  +    +L PGTYYL +VDS +RR Y +  T   ++NG
Sbjct  426   PYTPTGSVGVLFPGTYYLKDVDSLHRRTYERTPT---ISNG  463



>ref|XP_007430523.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic isoform 
X2 [Python bivittatus]
Length=526

 Score =   462 bits (1189),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 239/461 (52%), Positives = 309/461 (67%), Gaps = 11/461 (2%)
 Frame = +3

Query  327   ASQQKNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSL  506
             A   K+VGI+ALEIYFP   + Q  LE  DG   GKYTIGLGQ  M FCS+ ED+ S+ L
Sbjct  16    ACWPKDVGIVALEIYFPSQYVDQAELEKFDGVDGGKYTIGLGQSKMGFCSDREDINSLCL  75

Query  507   TAVTSLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACY  686
             TAV  L+E+  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE+ GNTD+EG+D+TNACY
Sbjct  76    TAVQKLMERNSLSYNCIGRLEVGTETIIDKSKSVKTVLMQLFEESGNTDVEGIDTTNACY  135

Query  687   GGTAALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFE  866
             GGTAALFN +NWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AMLVGP+AP++FE
Sbjct  136   GGTAALFNAINWVESSSWDGRYALVVAGDIAVYATGNARPTGGAGAVAMLVGPNAPLIFE  195

Query  867   SKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCY----KSLCSKYEKLEG-  1031
               LRG+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    K + +K++K EG 
Sbjct  196   RGLRGTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDHCYTVYRKKIRAKWQK-EGI  254

Query  1032  -KSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEAD-KEKLAPFSSLTGDE  1205
              K F++ D  + +FHSPY KLVQKS ARLL NDFL + +   E D    L  F  +  ++
Sbjct  255   DKDFTLNDFGFIIFHSPYCKLVQKSVARLLLNDFLNDPTPTKENDIYNGLEAFRDIKLED  314

Query  1206  SYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHN-KHSTLPGQ  1382
             +Y +RD+EKA  + S   +  K + S LV  Q GNMYT S+Y    SL+       L GQ
Sbjct  315   TYFDRDVEKAFMKASAEIFSQKTKASLLVSNQNGNMYTPSVYGCLASLLAQYSPQQLAGQ  374

Query  1383  RVVMFSYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILK  1556
             R+ +FSYGSG  AT++S+++ +   P S  +  IA++ ++  +L SR    PE F E + 
Sbjct  375   RIGVFSYGSGFAATLYSIKVSQDATPGSSLDKIIASLTDLKARLDSRKCITPEVFAENMM  434

Query  1557  IMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             + +  +   +++       L  GT+YL  VD K+RR YA++
Sbjct  435   LRQETHHLANYIPQCSVDDLFEGTWYLVRVDEKHRRMYARR  475



>ref|XP_011152580.1| PREDICTED: hydroxymethylglutaryl-CoA synthase 1 [Harpegnathos 
saltator]
 gb|EFN75750.1| Hydroxymethylglutaryl-CoA synthase 1 [Harpegnathos saltator]
Length=456

 Score =   459 bits (1182),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 240/452 (53%), Positives = 304/452 (67%), Gaps = 6/452 (1%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGILALE+YFP   ++Q  LEA+ G S GKYTIGLGQ  M FC++ ED+ S+ LT   
Sbjct  4     KDVGILALEVYFPAQYVEQSELEAYYGVSAGKYTIGLGQARMGFCNDREDINSLCLTVTH  63

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+E+Y V P+QIGRLEVG+ET+IDKSKS+K+ LMQ+FE  G TDIEG D+TNACYGGT 
Sbjct  64    RLMERYNVRPQQIGRLEVGTETIIDKSKSVKSVLMQLFEPHGCTDIEGADTTNACYGGTN  123

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN V WVESS+WDGR+ LVV  DSA+Y EG AR TGGA AIA+LVGPDAP+VF+  LR
Sbjct  124   ALFNAVAWVESSAWDGRWALVVAADSAIYDEGSARATGGAGAIAILVGPDAPLVFDRGLR  183

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKS---FSVA  1049
              S M H YDFYKP L SEYP+VDGKLS  CYL ALDSCY+    K  K + +S    S+A
Sbjct  184   ASCMRHSYDFYKPNLRSEYPMVDGKLSIQCYLSALDSCYQKYREKVAKRDPESSETASLA  243

Query  1050  DADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDLE  1229
             D D  +FHSPY KLVQKSFARL F DFL             +  F +   +++Y +RD+E
Sbjct  244   DFDAVLFHSPYCKLVQKSFARLAFIDFLNTPRERLPDGYGDVQTFHASKLEDTYFDRDIE  303

Query  1230  KASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFI-SLIHNKHSTLPGQRVVMFSYG  1406
             KA   +SK  ++ K QPS L+  QVGNMYT S+Y   + SLI      L G ++ +FSYG
Sbjct  304   KAFMGLSKRDFERKTQPSLLIANQVGNMYTPSVYCGLVSSLISKPIDELAGNKIAIFSYG  363

Query  1407  SGSTATMFSLRI-REGQHPFSLSNIAAVLN-IAEKLKSRHEFPPEKFVEILKIMEHRYGA  1580
             SG  ++M+SL + ++ Q   SL+ + A L+ I  +L++R    P  + + L + E  Y  
Sbjct  364   SGMCSSMYSLTVTKDTQKDSSLARMIAALSYIKSQLQARQRVSPADYTKTLALREQNYHV  423

Query  1581  KDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAK  1676
               FV       + PGTYYLT+VD KYRR YA+
Sbjct  424   VPFVPVSSTDNMFPGTYYLTQVDEKYRRTYAR  455



>ref|XP_005943122.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X1 [Haplochromis burtoni]
 ref|XP_005943123.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X2 [Haplochromis burtoni]
Length=515

 Score =   461 bits (1187),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 238/456 (52%), Positives = 305/456 (67%), Gaps = 9/456 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGI+ALE+YFP   + Q  LE  DG   GKYT+GLGQ  M FCS+ ED+ S+ LT V 
Sbjct  15    KDVGIIALELYFPSQYVDQTELEEFDGVPAGKYTVGLGQARMGFCSDREDINSLCLTVVQ  74

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+EK  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE  GNTD+EG+D+TNACYGGTA
Sbjct  75    RLMEKNALSYNSIGRLEVGTETIIDKSKSVKTALMQLFENSGNTDVEGIDTTNACYGGTA  134

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+A+L+GP+AP+ FE  LR
Sbjct  135   ALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAILIGPNAPLAFERGLR  194

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE---KLEG--KSFS  1043
             G+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    +K     + EG  KSFS
Sbjct  195   GTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDRCYSVYRNKIHAQWQREGSDKSFS  254

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADK-EKLAPFSSLTGDESYSNR  1220
             + D  + VFHSPY KLVQKS ARL+ NDFL + S   E      L  F  +  +++Y +R
Sbjct  255   LEDFGFLVFHSPYCKLVQKSLARLMLNDFLNHPSPNTETGPFTGLEAFRDVQPEDTYFDR  314

Query  1221  DLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLI-HNKHSTLPGQRVVMF  1397
             D+EKA  + S   ++ K + S L+  Q GNMYT S+Y    SLI  +  S + GQR+ +F
Sbjct  315   DVEKAFMKASTDMFERKTKASLLISNQNGNMYTPSVYGCLASLIAQHTPSQMAGQRIGVF  374

Query  1398  SYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILKIMEHR  1571
             SYGSG  AT++SLR+ +   P S  +  + ++ ++  +L  R +  P  F E +K+ E  
Sbjct  375   SYGSGFAATLYSLRVTQDHIPGSSLDKLVLSLSDLKTRLDLRKKVSPALFSENMKLREDT  434

Query  1572  YGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             +   ++V       L PGT+YLT VD K+RR YA++
Sbjct  435   HHLANYVPQGSVEDLFPGTWYLTRVDDKHRREYARR  470



>ref|XP_006797374.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X1 [Neolamprologus brichardi]
 ref|XP_006797375.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, cytoplasmic-like 
isoform X2 [Neolamprologus brichardi]
Length=515

 Score =   461 bits (1187),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 237/456 (52%), Positives = 305/456 (67%), Gaps = 9/456 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGI+ALE+YFP   + Q  LE  DG   GKYT+GLGQ  M FCS+ ED+ S+ LT V 
Sbjct  15    KDVGIIALELYFPSQYVDQTELEEFDGVPAGKYTVGLGQARMGFCSDREDINSLCLTVVQ  74

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+EK  +    IGRLEVG+ET+IDKSKS+KT LMQ+FE  GNTD+EG+D+TNACYGGTA
Sbjct  75    RLMEKNALSYNSIGRLEVGTETIIDKSKSVKTALMQLFENSGNTDVEGIDTTNACYGGTA  134

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+A+L+GP+AP+ FE  LR
Sbjct  135   ALFNAVNWVESSSWDGRYALVVAGDIAVYATGSARPTGGAGAVAILIGPNAPLAFERGLR  194

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE---KLEG--KSFS  1043
             G+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    +K     + EG  KSFS
Sbjct  195   GTHMQHAYDFYKPDMVSEYPVVDGKLSIQCYLSALDRCYSVYRNKIHAQWQREGSDKSFS  254

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADK-EKLAPFSSLTGDESYSNR  1220
             + D  + VFHSPY KLVQKS ARL+ NDFL + +   E      L  F  +  +++Y +R
Sbjct  255   LEDFGFLVFHSPYCKLVQKSLARLMLNDFLNHPTPNTETGPFTGLEAFRDVQPEDTYFDR  314

Query  1221  DLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLI-HNKHSTLPGQRVVMF  1397
             D+EKA  + S   ++ K + S L+  Q GNMYT S+Y    SLI  +  S + GQR+ +F
Sbjct  315   DVEKAFMKASTDMFERKTKASLLISNQNGNMYTPSVYGCLASLIAQHTPSQMAGQRIGVF  374

Query  1398  SYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILKIMEHR  1571
             SYGSG  AT++SLR+ +   P S  +  + ++ ++  +L  R +  P  F E +K+ E  
Sbjct  375   SYGSGFAATLYSLRVTQDHTPGSSLDKLVLSLSDLKTRLDLRKKVSPALFSENMKLREDT  434

Query  1572  YGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             +   ++V       L PGT+YLT VD K+RR YA++
Sbjct  435   HHLANYVPQGSVEDLFPGTWYLTRVDDKHRREYARR  470



>ref|XP_001360459.1| GA18098 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL25034.1| GA18098 [Drosophila pseudoobscura pseudoobscura]
Length=465

 Score =   459 bits (1182),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 232/461 (50%), Positives = 309/461 (67%), Gaps = 9/461 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             +NVGI A+E+ FP   + Q  LE  DGAS GKYTIGLGQ  M FCS+ EDV S+ LT V+
Sbjct  7     ENVGIRAIEVLFPSQYVDQTELEQFDGASAGKYTIGLGQAKMGFCSDREDVNSLCLTVVS  66

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              LLE++ +   +IGRLEVG+ET++DKSKS+K+ LMQ+F   GNTDIEG+D+TNACYGGTA
Sbjct  67    RLLERHHIKHTEIGRLEVGTETIVDKSKSVKSVLMQLFADSGNTDIEGIDTTNACYGGTA  126

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN +NW+ESSSWDGRY L VC D AVYA+G ARPTGGA A+AMLVGP+AP+VFE  LR
Sbjct  127   ALFNAINWIESSSWDGRYALAVCADIAVYAKGAARPTGGAGAVAMLVGPNAPLVFERGLR  186

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKS----FSV  1046
              +HM H YDFYKP L SEYP VDGKLS  CYL ALD+CY+    K+EK + K+      +
Sbjct  187   ATHMEHAYDFYKPDLSSEYPTVDGKLSIQCYLSALDTCYRLYRQKFEKQQAKTQGGKVGL  246

Query  1047  ADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRDL  1226
              + D  +FH+P+ KLVQKS  RL FNDFL  +          L  F++ T + +Y +RD+
Sbjct  247   DNFDAILFHTPFCKLVQKSVGRLSFNDFLLTSEGKRAEQFAGLERFNNATLEGTYFDRDV  306

Query  1227  EKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFIS-LIHNKHSTLPGQRVVMFSY  1403
             EKA    S   ++AK + + L+  QVGNMYT S+Y+  +S LI    + L G+R+ +FSY
Sbjct  307   EKAFLTQSADVFEAKTKKTLLLANQVGNMYTPSVYSGLVSLLIGVPAADLVGKRIGVFSY  366

Query  1404  GSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEILKIMEHRYGAK  1583
             GSG  A+M+S+ + +    F    +A +  +   L SR +  PE+F E++++ E    A 
Sbjct  367   GSGLAASMYSISVTQDAAAFE-KFVAQLDYVLPLLNSREKVAPEQFSELMEVREKNNHAA  425

Query  1584  DFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKKETKAAVANG  1706
              +  +    +L PGTYYL +VDS +RR Y +  T   ++NG
Sbjct  426   PYTPTGSVGVLFPGTYYLKDVDSLHRRTYERTPT---ISNG  463



>ref|XP_006900395.1| PREDICTED: hydroxymethylglutaryl-CoA synthase, mitochondrial 
[Elephantulus edwardii]
Length=508

 Score =   461 bits (1185),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 231/456 (51%), Positives = 307/456 (67%), Gaps = 10/456 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGILALE+YFP   + Q  LE ++    GKYT+GLGQ  M FCS  ED+ S+ LT V 
Sbjct  52    KDVGILALEVYFPAQYVDQTDLEKYNKVEAGKYTVGLGQTQMGFCSVQEDINSLCLTVVQ  111

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              L+E+ +V    +GRLEVG+ET+IDKSK++KT LM++F+  GNTDIEG+D+TNACYGGTA
Sbjct  112   RLMERTKVPWDAVGRLEVGTETIIDKSKAVKTVLMELFQDSGNTDIEGIDTTNACYGGTA  171

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             +LFN  NW+ESSSWDGRY +VVC D AVYA G ARPTGGA A+AMLVGP+AP+  E  LR
Sbjct  172   SLFNAANWMESSSWDGRYAMVVCGDIAVYASGSARPTGGAGAVAMLVGPEAPLALERGLR  231

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYE---KLEG--KSFS  1043
             G+HM +VYDFYKP L SEYP+VDGKLS  CY  ALD CY     K +   K  G  + F+
Sbjct  232   GTHMENVYDFYKPDLASEYPMVDGKLSVQCYFRALDQCYTFYRRKIQNQWKQAGIERPFT  291

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSSLTGDESYSNRD  1223
             + D  + +FH+PY KLVQKS ARL+FNDFL  +S I  +  + L  F  L  +++Y+NRD
Sbjct  292   LEDFQFMIFHTPYCKLVQKSLARLMFNDFLSASSDIQSSHYKGLEAFRGLKLEDTYTNRD  351

Query  1224  LEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHST--LPGQRVVMF  1397
             ++ A Q+ S   ++ K + S  +  + GNMYT+S+Y    SL+ ++HS   L G R+  F
Sbjct  352   VDSAFQKASLDMFNKKTKASLYLSTRNGNMYTSSLYGCLASLL-SQHSAQELAGSRIGAF  410

Query  1398  SYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILKIMEHR  1571
             SYGSG  A++FSLR+ +   P S     +A+V N+ ++L SR     E+F E++   EH 
Sbjct  411   SYGSGMAASLFSLRVSQDASPGSPLEKLVASVANLPDRLASRKRASAEEFTEVMDQREHF  470

Query  1572  YGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             Y   +F    D + L PGT+YL  VD  YRR YA++
Sbjct  471   YRKMNFSPPGDTNSLFPGTWYLERVDEMYRRKYARR  506



>gb|AFK11330.1| hydroxymethylglutaryl-CoA synthase 1 [Callorhinchus milii]
Length=568

 Score =   463 bits (1191),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 231/456 (51%), Positives = 306/456 (67%), Gaps = 9/456 (2%)
 Frame = +3

Query  339   KNVGILALEIYFPPTCLQQEALEAHDGASKGKYTIGLGQDCMAFCSEVEDVISMSLTAVT  518
             K+VGI+A+EIYFP   + Q  LE +DG   GKYTIGLGQ  M FCS+ ED+ S+ LT V 
Sbjct  67    KDVGIIAMEIYFPAQYVDQTELEQYDGVDAGKYTIGLGQSKMGFCSDREDINSLCLTVVE  126

Query  519   SLLEKYEVDPKQIGRLEVGSETVIDKSKSIKTFLMQIFEKCGNTDIEGVDSTNACYGGTA  698
              LLE+ ++  + +GRLEVG+ET+IDKSK++KT LMQ+F++ GN+D+EG+D+TNACYGGTA
Sbjct  127   RLLERNQIPYESVGRLEVGTETIIDKSKAVKTVLMQLFQESGNSDVEGIDTTNACYGGTA  186

Query  699   ALFNCVNWVESSSWDGRYGLVVCTDSAVYAEGPARPTGGAAAIAMLVGPDAPIVFESKLR  878
             ALFN VNWVESSSWDGRY LVV  D AVYA G ARPTGGA A+AMLVGP+AP+  E  LR
Sbjct  187   ALFNAVNWVESSSWDGRYALVVAGDIAVYASGSARPTGGAGAVAMLVGPNAPLSLERGLR  246

Query  879   GSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCSKYEKLEGKS-----FS  1043
             G+HM H YDFYKP + SEYPVVDGKLS  CYL ALD CY    +K + L  K       +
Sbjct  247   GTHMQHAYDFYKPDMVSEYPVVDGKLSIECYLSALDHCYTRYRNKEQALRQKEGSDTRIT  306

Query  1044  VADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEAD-KEKLAPFSSLTGDESYSNR  1220
             + D  Y VFH+PY KLVQKS ARLL NDFL + +   ++     L  F  +  +ESY ++
Sbjct  307   LQDFAYVVFHTPYCKLVQKSLARLLLNDFLSDPNPNTQSGLYSGLETFREVKLEESYFDK  366

Query  1221  DLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHST-LPGQRVVMF  1397
             D+EKA  + S   +  K +PS  +  Q GNMYT S+Y    +++  + +  L GQR+ +F
Sbjct  367   DVEKAFLKASSELFHQKTKPSLTLSNQNGNMYTPSVYGCLSAVLAQRTAQELSGQRIGLF  426

Query  1398  SYGSGSTATMFSLRIREGQHPFSLSN--IAAVLNIAEKLKSRHEFPPEKFVEILKIMEHR  1571
             SYGSG  AT+FSLR+     P S  +  ++++ ++  +L SRH   PE F   +K+ E  
Sbjct  427   SYGSGFAATLFSLRVSSDPSPGSRLDKIVSSLADLQARLDSRHRIQPEAFASSMKVREET  486

Query  1572  YGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK  1679
             +   ++        L PGT+YLT+VD K+RR YA++
Sbjct  487   HHLANYTPQSPVEDLFPGTWYLTQVDEKHRREYARR  522



>gb|ACN31023.1| unknown [Zea mays]
Length=303

 Score =   453 bits (1165),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 215/303 (71%), Positives = 252/303 (83%), Gaps = 10/303 (3%)
 Frame = +3

Query  831   MLVGPDAPIVFESKLRGSHMAHVYDFYKPILDSEYPVVDGKLSQTCYLMALDSCYKSLCS  1010
             ML+GP+API FESK R SHMAHVYDFYKP L SEYPVVDGKLSQTCYLMALDSCY+  C+
Sbjct  1     MLIGPNAPISFESKYRASHMAHVYDFYKPDLASEYPVVDGKLSQTCYLMALDSCYRQFCN  60

Query  1011  KYEKLEGKSFSVADADYFVFHSPYNKLVQKSFARLLFNDFLRNASYINEADKEKLAPFSS  1190
             KYEK+ GK FS++DA+YFVFHSPYNKLVQKSFARL +NDF+RN SY+++  KEKL  FS+
Sbjct  61    KYEKIAGKQFSISDAEYFVFHSPYNKLVQKSFARLYYNDFMRNCSYVDDDAKEKLQSFSN  120

Query  1191  LTGDESYSNRDLEKASQQVSKPFYDAKVQPSTLVPKQVGNMYTASIYAAFISLIHNKHST  1370
             LTG+ESY +RDLEKASQQV+K  Y  KVQP+TL+PKQ+GNMYTAS+YAA  S+++NKH +
Sbjct  121   LTGEESYQSRDLEKASQQVAKHLYGIKVQPTTLLPKQIGNMYTASLYAALASVLYNKHDS  180

Query  1371  LPGQRVVMFSYGSGSTATMFSLRIREGQHPFSLSNIAAVLNIAEKLKSRHEFPPEKFVEI  1550
             L GQR+VMFSYGSG T+TMFSLR+  GQHPFSLSNI +VL + EKL+SRHE  PEKFVE 
Sbjct  181   LNGQRIVMFSYGSGLTSTMFSLRLNNGQHPFSLSNIGSVLGVTEKLQSRHETLPEKFVET  240

Query  1551  LKIMEHRYGAKDFVTSKDCSLLAPGTYYLTEVDSKYRRFYAKK--------ETKA--AVA  1700
             LK+MEHRYGAKDF TS D SLL PGT+YLT+VDS YRRFY++K        +TK     A
Sbjct  241   LKLMEHRYGAKDFETSSDTSLLQPGTFYLTKVDSMYRRFYSQKPAEEIGGGKTKCCNGFA  300

Query  1701  NGH  1709
             NGH
Sbjct  301   NGH  303



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6208293198550