BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9439

Length=896
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAD18102.1|  leucine-rich repeat receptor-like kinase               284   6e-87   Ipomoea batatas [batate]
ref|XP_010940158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        212   1e-59   Elaeis guineensis
ref|XP_006356418.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    211   1e-59   Solanum tuberosum [potatoes]
gb|KDO82336.1|  hypothetical protein CISIN_1g006968mg                   205   3e-59   Citrus sinensis [apfelsine]
ref|XP_009403878.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    210   3e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007044708.1|  Nsp-interacting kinase 3 isoform 1                 211   4e-59   Theobroma cacao [chocolate]
ref|XP_004238646.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        209   7e-59   Solanum lycopersicum
ref|XP_009403877.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    210   7e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006438322.1|  hypothetical protein CICLE_v10030967mg             209   1e-58   Citrus clementina [clementine]
ref|XP_012085434.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        208   2e-58   Jatropha curcas
ref|XP_011086598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        208   3e-58   
ref|XP_006378225.1|  hypothetical protein POPTR_0010s05300g             208   3e-58   
ref|XP_010251173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        208   3e-58   Nelumbo nucifera [Indian lotus]
ref|XP_011034116.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    208   4e-58   Populus euphratica
ref|XP_011034114.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    207   4e-58   Populus euphratica
ref|XP_009596637.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    207   4e-58   Nicotiana tomentosiformis
gb|KJB61042.1|  hypothetical protein B456_009G337000                    202   6e-58   Gossypium raimondii
gb|KDO82335.1|  hypothetical protein CISIN_1g006968mg                   206   6e-58   Citrus sinensis [apfelsine]
ref|XP_004237339.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    207   7e-58   Solanum lycopersicum
gb|KDO82334.1|  hypothetical protein CISIN_1g006968mg                   206   1e-57   Citrus sinensis [apfelsine]
ref|XP_006483905.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    206   1e-57   Citrus sinensis [apfelsine]
ref|XP_009390158.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    206   2e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009390157.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    206   2e-57   
ref|XP_008813583.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    206   2e-57   Phoenix dactylifera
ref|XP_009626005.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        206   3e-57   
ref|XP_008813582.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    206   3e-57   Phoenix dactylifera
ref|XP_009797107.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    202   6e-57   Nicotiana sylvestris
ref|XP_006366916.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    204   6e-57   Solanum tuberosum [potatoes]
gb|KJB61043.1|  hypothetical protein B456_009G337000                    202   9e-57   Gossypium raimondii
gb|EYU28436.1|  hypothetical protein MIMGU_mgv1a002888mg                204   1e-56   Erythranthe guttata [common monkey flower]
ref|XP_002315684.2|  hypothetical protein POPTR_0010s05300g             203   2e-56   
ref|XP_008389688.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    203   2e-56   Malus domestica [apple tree]
ref|XP_008389687.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    203   2e-56   Malus domestica [apple tree]
ref|XP_008389685.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    203   2e-56   Malus domestica [apple tree]
gb|KJB61041.1|  hypothetical protein B456_009G337000                    203   3e-56   Gossypium raimondii
ref|XP_010910388.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    202   3e-56   Elaeis guineensis
ref|XP_010100426.1|  Protein NSP-INTERACTING KINASE 3                   203   3e-56   Morus notabilis
gb|KJB61045.1|  hypothetical protein B456_009G337000                    202   3e-56   Gossypium raimondii
ref|XP_008812173.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        202   4e-56   Phoenix dactylifera
ref|XP_008340072.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    202   4e-56   
ref|XP_009800027.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        202   4e-56   Nicotiana sylvestris
ref|XP_008340070.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    202   4e-56   
ref|XP_008340071.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    202   4e-56   
gb|ACM89541.1|  leucine-rich repeat receptor-like kinase                200   5e-56   Glycine max [soybeans]
gb|KHN14560.1|  Protein NSP-INTERACTING KINASE 3                        201   7e-56   Glycine soja [wild soybean]
gb|KHN00370.1|  Protein NSP-INTERACTING KINASE 3                        201   1e-55   Glycine soja [wild soybean]
emb|CAN75190.1|  hypothetical protein VITISV_035381                     201   1e-55   Vitis vinifera
ref|XP_003519642.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    201   1e-55   Glycine max [soybeans]
ref|XP_010023506.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        201   1e-55   Eucalyptus grandis [rose gum]
ref|XP_010651607.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        201   2e-55   Vitis vinifera
ref|XP_003517653.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    201   2e-55   Glycine max [soybeans]
dbj|BAD68256.1|  putative brassinosteroid insensitive 1-associate...    195   4e-55   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003613191.1|  Leucine-rich repeat receptor-like kinase           199   6e-55   Medicago truncatula
ref|XP_006380012.1|  hypothetical protein POPTR_0008s19310g             199   6e-55   
ref|XP_002312685.1|  leucine-rich repeat family protein                 199   9e-55   
ref|XP_010682518.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        198   1e-54   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP13189.1|  unnamed protein product                                197   2e-54   Coffea canephora [robusta coffee]
dbj|BAD68255.1|  putative brassinosteroid insensitive 1-associate...    197   3e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006392114.1|  hypothetical protein EUTSA_v10023342mg             195   2e-53   Eutrema salsugineum [saltwater cress]
ref|XP_002455108.1|  hypothetical protein SORBIDRAFT_03g004450          195   2e-53   
ref|XP_010533910.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        194   4e-53   Tarenaya hassleriana [spider flower]
ref|XP_004489819.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    194   5e-53   Cicer arietinum [garbanzo]
emb|CDY61461.1|  BnaC01g43240D                                          194   7e-53   Brassica napus [oilseed rape]
ref|XP_004297396.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    193   7e-53   Fragaria vesca subsp. vesca
ref|XP_011463143.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    193   8e-53   Fragaria vesca subsp. vesca
ref|XP_004142972.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    193   1e-52   Cucumis sativus [cucumbers]
ref|XP_010248542.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    192   1e-52   Nelumbo nucifera [Indian lotus]
ref|XP_004968347.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    193   1e-52   Setaria italica
ref|XP_009104025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    192   1e-52   Brassica rapa
ref|XP_009104018.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    192   1e-52   Brassica rapa
emb|CDY46185.1|  BnaA01g23070D                                          192   1e-52   Brassica napus [oilseed rape]
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    192   2e-52   Nelumbo nucifera [Indian lotus]
gb|AFO67891.1|  leucine-rich repeat receptor-like kinase                191   4e-52   Brassica rapa subsp. oleifera [biennial turnip rape]
ref|XP_007157369.1|  hypothetical protein PHAVU_002G064400g             191   6e-52   Phaseolus vulgaris [French bean]
ref|XP_008654537.1|  PREDICTED: uncharacterized LOC100272802 isof...    191   7e-52   
ref|XP_010510907.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    191   8e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010510906.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    191   8e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008221850.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    191   1e-51   Prunus mume [ume]
ref|XP_008221852.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    191   1e-51   Prunus mume [ume]
ref|XP_008444352.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    190   1e-51   Cucumis melo [Oriental melon]
dbj|BAK02609.1|  predicted protein                                      190   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001169689.1|  LOC100383570 precursor                             189   2e-51   Zea mays [maize]
ref|XP_006841062.1|  PREDICTED: protein NSP-INTERACTING KINASE 3        189   3e-51   Amborella trichopoda
ref|XP_010473259.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    189   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010473260.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    189   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_002525400.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    188   7e-51   
gb|KCW86694.1|  hypothetical protein EUGRSUZ_B03306                     185   8e-51   Eucalyptus grandis [rose gum]
ref|XP_003569325.2|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    187   2e-50   Brachypodium distachyon [annual false brome]
ref|XP_010230511.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    186   2e-50   
ref|XP_010230510.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    186   2e-50   
ref|XP_010230509.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    187   2e-50   Brachypodium distachyon [annual false brome]
gb|KCW86687.1|  hypothetical protein EUGRSUZ_B03306                     186   3e-50   Eucalyptus grandis [rose gum]
ref|XP_010044599.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    186   3e-50   Eucalyptus grandis [rose gum]
ref|XP_010044598.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    186   3e-50   
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                     186   4e-50   Eucalyptus grandis [rose gum]
ref|XP_010044597.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    186   4e-50   
ref|XP_010044596.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    186   4e-50   
ref|XP_010044595.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    186   4e-50   
ref|XP_010044594.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    186   4e-50   Eucalyptus grandis [rose gum]
gb|KCW86693.1|  hypothetical protein EUGRSUZ_B03306                     186   4e-50   Eucalyptus grandis [rose gum]
gb|KCW86692.1|  hypothetical protein EUGRSUZ_B03306                     186   4e-50   Eucalyptus grandis [rose gum]
gb|KCW86690.1|  hypothetical protein EUGRSUZ_B03306                     186   5e-50   Eucalyptus grandis [rose gum]
ref|XP_002886588.1|  nsp-interacting kinase 3                           186   5e-50   
gb|KCW86691.1|  hypothetical protein EUGRSUZ_B03306                     186   5e-50   Eucalyptus grandis [rose gum]
ref|XP_010418025.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    185   6e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010418023.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    186   6e-50   Camelina sativa [gold-of-pleasure]
ref|NP_176279.1|  NSP-interacting kinase 3                              184   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010319667.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    181   2e-48   Solanum lycopersicum
ref|XP_006301740.1|  hypothetical protein CARUB_v10022201mg             181   3e-48   
gb|EPS73511.1|  hypothetical protein M569_01245                         177   6e-47   Genlisea aurea
gb|KDO70179.1|  hypothetical protein CISIN_1g007025mg                   173   7e-47   Citrus sinensis [apfelsine]
ref|XP_010558545.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    177   9e-47   Tarenaya hassleriana [spider flower]
ref|XP_010558548.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    176   9e-47   Tarenaya hassleriana [spider flower]
ref|XP_010929457.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    176   2e-46   Elaeis guineensis
gb|KDO70178.1|  hypothetical protein CISIN_1g007025mg                   174   4e-46   Citrus sinensis [apfelsine]
ref|XP_006430876.1|  hypothetical protein CICLE_v10011302mg             174   5e-46   Citrus clementina [clementine]
gb|KDO58880.1|  hypothetical protein CISIN_1g036225mg                   174   5e-46   Citrus sinensis [apfelsine]
ref|XP_006482337.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    174   5e-46   Citrus sinensis [apfelsine]
ref|XP_006437790.1|  hypothetical protein CICLE_v10030970mg             174   6e-46   Citrus clementina [clementine]
ref|XP_006484307.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    174   6e-46   Citrus sinensis [apfelsine]
ref|XP_010528022.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        173   1e-45   Tarenaya hassleriana [spider flower]
ref|XP_008783060.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    172   2e-45   Phoenix dactylifera
ref|XP_011649490.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    172   2e-45   Cucumis sativus [cucumbers]
ref|XP_002876917.1|  nsp-interacting kinase 2                           172   3e-45   
ref|XP_008807034.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    172   4e-45   Phoenix dactylifera
ref|XP_008807033.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    171   5e-45   Phoenix dactylifera
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    171   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    171   1e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002311408.2|  hypothetical protein POPTR_0008s10970g             170   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_002305306.2|  hypothetical protein POPTR_0004s10790g             170   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_011012715.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    170   2e-44   Populus euphratica
ref|XP_006384231.1|  hypothetical protein POPTR_0004s10790g             170   2e-44   Populus trichocarpa [western balsam poplar]
ref|XP_011012714.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    170   2e-44   Populus euphratica
ref|XP_008797566.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    170   2e-44   Phoenix dactylifera
ref|XP_010032589.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        170   2e-44   Eucalyptus grandis [rose gum]
ref|XP_008444353.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...    169   3e-44   Cucumis melo [Oriental melon]
ref|XP_011020829.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    169   3e-44   Populus euphratica
ref|XP_010549936.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        169   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_011011496.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    169   3e-44   Populus euphratica
ref|XP_002532890.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    169   3e-44   Ricinus communis
ref|NP_197104.1|  NSP-interacting kinase 1                              169   3e-44   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65586.1|  receptor protein kinase-like protein                    169   4e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453748.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        169   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010927979.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    169   4e-44   
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    169   5e-44   Elaeis guineensis
ref|XP_012080508.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    169   5e-44   Jatropha curcas
ref|XP_009418103.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    168   6e-44   
ref|XP_009417563.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    167   7e-44   
ref|XP_002269902.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        168   7e-44   Vitis vinifera
ref|XP_009417562.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    168   7e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006395648.1|  hypothetical protein EUTSA_v10003811mg             168   7e-44   Eutrema salsugineum [saltwater cress]
ref|XP_010492459.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    168   8e-44   Camelina sativa [gold-of-pleasure]
ref|XP_009418102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    168   9e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006643812.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...    167   1e-43   
ref|XP_006400129.1|  hypothetical protein EUTSA_v10012948mg             168   1e-43   Eutrema salsugineum [saltwater cress]
ref|XP_002314905.1|  hypothetical protein POPTR_0010s14410g             167   1e-43   
ref|XP_007033440.1|  NSP-interacting kinase 1                           167   1e-43   
ref|XP_009152132.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    167   1e-43   Brassica rapa
ref|XP_002871697.1|  nsp-interacting kinase 1                           167   1e-43   Arabidopsis lyrata subsp. lyrata
ref|XP_006603947.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    166   2e-43   
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    167   2e-43   Elaeis guineensis
emb|CDY48073.1|  BnaA06g33550D                                          167   2e-43   Brassica napus [oilseed rape]
ref|XP_006338306.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    167   2e-43   Solanum tuberosum [potatoes]
gb|ABG73621.1|  leucine-rich repeat receptor-like kinase                167   2e-43   Populus tomentosa [Chinese white poplar]
gb|EMT25229.1|  Putative LRR receptor-like serine/threonine-prote...    167   2e-43   
ref|XP_010502426.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        167   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_006287253.1|  hypothetical protein CARUB_v10000442mg             167   3e-43   Capsella rubella
ref|XP_008811184.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    167   3e-43   Phoenix dactylifera
gb|KJB43138.1|  hypothetical protein B456_007G186300                    167   3e-43   Gossypium raimondii
ref|XP_012088120.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        167   3e-43   Jatropha curcas
gb|KHN07744.1|  Protein NSP-INTERACTING KINASE 2                        166   3e-43   Glycine soja [wild soybean]
ref|XP_010100900.1|  Protein NSP-INTERACTING KINASE 1                   167   3e-43   
ref|XP_006574993.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    166   3e-43   
gb|KHN30771.1|  Protein NSP-INTERACTING KINASE 1                        166   3e-43   Glycine soja [wild soybean]
ref|XP_003555046.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    166   4e-43   Glycine max [soybeans]
ref|XP_007045670.1|  LRR receptor-like serine/threonine-protein k...    168   4e-43   
gb|KEH21801.1|  NSP-interacting kinase-like protein                     165   4e-43   Medicago truncatula
gb|KEH21800.1|  NSP-interacting kinase-like protein                     166   4e-43   Medicago truncatula
ref|XP_009396215.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    166   4e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001146634.1|  uncharacterized LOC100280233 precursor             166   5e-43   Zea mays [maize]
gb|EYU44266.1|  hypothetical protein MIMGU_mgv1a002951mg                166   6e-43   Erythranthe guttata [common monkey flower]
emb|CDX83534.1|  BnaC07g22740D                                          166   7e-43   
gb|KHN07168.1|  Protein NSP-INTERACTING KINASE 1                        165   7e-43   Glycine soja [wild soybean]
ref|XP_004232118.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        166   7e-43   Solanum lycopersicum
ref|XP_003517902.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    165   9e-43   Glycine max [soybeans]
ref|XP_010091686.1|  Protein NSP-INTERACTING KINASE 2                   165   9e-43   
ref|XP_008459453.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        165   1e-42   Cucumis melo [Oriental melon]
ref|XP_007139356.1|  hypothetical protein PHAVU_008G022700g             165   1e-42   Phaseolus vulgaris [French bean]
ref|XP_011009019.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    165   1e-42   Populus euphratica
gb|KHG05227.1|  nsp-interacting kinase 2 -like protein                  165   1e-42   Gossypium arboreum [tree cotton]
ref|XP_011021148.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    165   1e-42   Populus euphratica
ref|XP_011021146.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    165   1e-42   Populus euphratica
ref|XP_010681338.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    165   1e-42   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB80538.1|  hypothetical protein B456_013G102600                    164   1e-42   Gossypium raimondii
gb|KHN14464.1|  Protein NSP-INTERACTING KINASE 1                        164   2e-42   Glycine soja [wild soybean]
ref|XP_003531900.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    164   2e-42   Glycine max [soybeans]
ref|XP_010514169.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    164   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_004953781.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    164   3e-42   Setaria italica
ref|XP_010424117.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    162   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_004507264.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    163   4e-42   Cicer arietinum [garbanzo]
gb|KFK25832.1|  hypothetical protein AALP_AA8G167900                    163   5e-42   Arabis alpina [alpine rockcress]
ref|XP_009356495.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    163   5e-42   Pyrus x bretschneideri [bai li]
ref|XP_009630581.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        162   1e-41   Nicotiana tomentosiformis
ref|XP_010257839.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    162   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_004141483.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        162   1e-41   Cucumis sativus [cucumbers]
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    162   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006844161.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        162   1e-41   Amborella trichopoda
emb|CDY26481.1|  BnaC09g41870D                                          162   1e-41   Brassica napus [oilseed rape]
ref|XP_007151443.1|  hypothetical protein PHAVU_004G046800g             161   2e-41   Phaseolus vulgaris [French bean]
gb|KJB60823.1|  hypothetical protein B456_009G327400                    161   2e-41   Gossypium raimondii
ref|XP_009378313.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    161   2e-41   Pyrus x bretschneideri [bai li]
emb|CDP02372.1|  unnamed protein product                                161   2e-41   Coffea canephora [robusta coffee]
dbj|BAG93736.1|  unnamed protein product                                157   2e-41   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008379484.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    161   3e-41   
gb|KEH25224.1|  NSP-interacting kinase-like protein                     160   3e-41   Medicago truncatula
ref|XP_004491764.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    160   3e-41   Cicer arietinum [garbanzo]
ref|XP_007153543.1|  hypothetical protein PHAVU_003G044400g             160   4e-41   Phaseolus vulgaris [French bean]
gb|AHF18212.1|  brassinosteroid insensitive 1-associated receptor...    160   4e-41   Saccharum hybrid cultivar [sugarcane]
ref|XP_002452616.1|  hypothetical protein SORBIDRAFT_04g029170          160   4e-41   Sorghum bicolor [broomcorn]
ref|XP_009121529.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        160   4e-41   Brassica rapa
gb|KEH25223.1|  NSP-interacting kinase-like protein                     160   4e-41   Medicago truncatula
ref|XP_002309372.1|  leucine-rich repeat family protein                 160   6e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006593318.1|  PREDICTED: NSP-interacting kinase isoform X2       159   6e-41   Glycine max [soybeans]
ref|XP_006290715.1|  hypothetical protein CARUB_v10016813mg             160   8e-41   Capsella rubella
emb|CDX69484.1|  BnaA10g18330D                                          159   8e-41   
ref|XP_003572984.2|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    159   9e-41   Brachypodium distachyon [annual false brome]
ref|XP_010236002.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    159   9e-41   Brachypodium distachyon [annual false brome]
ref|XP_009400110.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    159   9e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006593317.1|  PREDICTED: NSP-interacting kinase isoform X1       159   9e-41   Glycine max [soybeans]
ref|XP_009400102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    159   9e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001238448.1|  NSP-interacting kinase precursor                   159   1e-40   Glycine max [soybeans]
ref|XP_009394555.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    159   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDO96836.1|  unnamed protein product                                159   1e-40   Coffea canephora [robusta coffee]
ref|XP_008389350.1|  PREDICTED: LOW QUALITY PROTEIN: protein NSP-...    159   1e-40   
ref|XP_008230341.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        159   1e-40   Prunus mume [ume]
ref|XP_007221991.1|  hypothetical protein PRUPE_ppa002873mg             159   1e-40   Prunus persica
emb|CBI16897.3|  unnamed protein product                                158   2e-40   Vitis vinifera
ref|XP_002278965.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        158   2e-40   Vitis vinifera
ref|XP_008341829.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    158   2e-40   Malus domestica [apple tree]
gb|KFK39862.1|  hypothetical protein AALP_AA3G298400                    158   2e-40   Arabis alpina [alpine rockcress]
gb|KHN13790.1|  Protein NSP-INTERACTING KINASE 1                        158   3e-40   Glycine soja [wild soybean]
gb|EEC73926.1|  hypothetical protein OsI_08784                          158   3e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_009373732.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    158   3e-40   Pyrus x bretschneideri [bai li]
gb|EEE57731.1|  hypothetical protein OsJ_08242                          158   3e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009131513.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        158   4e-40   Brassica rapa
ref|XP_011099082.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    157   4e-40   Sesamum indicum [beniseed]
ref|XP_011018089.1|  PREDICTED: probable LRR receptor-like serine...    157   5e-40   Populus euphratica
ref|XP_004304172.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        157   5e-40   Fragaria vesca subsp. vesca
ref|XP_010268431.1|  PREDICTED: probable LRR receptor-like serine...    157   5e-40   Nelumbo nucifera [Indian lotus]
gb|EMT30099.1|  Putative LRR receptor-like serine/threonine-prote...    157   5e-40   
ref|XP_009803320.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    157   5e-40   Nicotiana sylvestris
ref|XP_009619542.1|  PREDICTED: probable LRR receptor-like serine...    157   5e-40   Nicotiana tomentosiformis
ref|XP_009619541.1|  PREDICTED: probable LRR receptor-like serine...    157   5e-40   Nicotiana tomentosiformis
ref|XP_009803321.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    157   5e-40   Nicotiana sylvestris
gb|KJB30563.1|  hypothetical protein B456_005G149000                    148   6e-40   Gossypium raimondii
ref|XP_008339771.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    157   6e-40   
ref|NP_001057375.2|  Os06g0274300                                       150   7e-40   
ref|XP_010274434.1|  PREDICTED: probable LRR receptor-like serine...    157   8e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010274433.1|  PREDICTED: probable LRR receptor-like serine...    157   8e-40   Nelumbo nucifera [Indian lotus]
emb|CDX70667.1|  BnaC03g07510D                                          157   8e-40   
ref|XP_003552626.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    156   9e-40   Glycine max [soybeans]
emb|CDX78667.1|  BnaA03g05790D                                          157   9e-40   
gb|ADD60694.1|  putative somatic embryogenesis receptor kinase 1        149   1e-39   Oryza officinalis
ref|XP_006647834.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    156   1e-39   Oryza brachyantha
gb|KHG18235.1|  hypothetical protein F383_07279                         156   1e-39   Gossypium arboreum [tree cotton]
ref|XP_009360005.1|  PREDICTED: probable LRR receptor-like serine...    156   1e-39   Pyrus x bretschneideri [bai li]
ref|XP_006412696.1|  hypothetical protein EUTSA_v10024678mg             155   2e-39   
ref|XP_007214944.1|  hypothetical protein PRUPE_ppa002897mg             156   2e-39   Prunus persica
ref|XP_008243752.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        155   2e-39   
gb|KEH17047.1|  NSP-interacting kinase-like protein                     155   2e-39   Medicago truncatula
ref|XP_006412695.1|  hypothetical protein EUTSA_v10024678mg             155   2e-39   
ref|XP_003563960.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    155   2e-39   Brachypodium distachyon [annual false brome]
ref|XP_004965216.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    155   3e-39   Setaria italica
gb|ABD96908.1|  hypothetical protein                                    155   3e-39   Tarenaya spinosa
ref|XP_009345903.1|  PREDICTED: probable LRR receptor-like serine...    155   3e-39   Pyrus x bretschneideri [bai li]
ref|XP_009781121.1|  PREDICTED: probable LRR receptor-like serine...    155   4e-39   Nicotiana sylvestris
ref|NP_189183.2|  NSP-interacting kinase 2                              155   4e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974360.1|  NSP-interacting kinase 2                              155   4e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189971.1|  NSP-interacting kinase 2                           155   5e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009781120.1|  PREDICTED: probable LRR receptor-like serine...    154   5e-39   
ref|XP_011039407.1|  PREDICTED: probable LRR receptor-like serine...    154   5e-39   
emb|CDY39685.1|  BnaA04g14020D                                          154   6e-39   
ref|XP_011039404.1|  PREDICTED: probable LRR receptor-like serine...    154   7e-39   
ref|XP_004490300.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    154   7e-39   
ref|XP_006404888.1|  hypothetical protein EUTSA_v10000081mg             154   9e-39   
ref|XP_008359493.1|  PREDICTED: probable LRR receptor-like serine...    154   9e-39   
ref|XP_006845438.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        154   1e-38   
ref|XP_002522232.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    153   1e-38   
ref|XP_011033358.1|  PREDICTED: probable LRR receptor-like serine...    154   1e-38   
ref|XP_002880534.1|  leucine-rich repeat family protein                 154   1e-38   
ref|XP_009129052.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        147   1e-38   
ref|XP_002305735.1|  leucine-rich repeat transmembrane protein ki...    153   1e-38   
ref|XP_009402861.1|  PREDICTED: probable LRR receptor-like serine...    153   1e-38   
ref|XP_010525766.1|  PREDICTED: probable LRR receptor-like serine...    153   2e-38   
ref|XP_010438169.1|  PREDICTED: probable LRR receptor-like serine...    153   2e-38   
ref|XP_006358118.1|  PREDICTED: probable LRR receptor-like serine...    152   2e-38   
ref|XP_010316837.1|  PREDICTED: probable LRR receptor-like serine...    152   3e-38   
ref|XP_006358117.1|  PREDICTED: probable LRR receptor-like serine...    152   3e-38   
ref|XP_011655740.1|  PREDICTED: protein NSP-INTERACTING KINASE 2 ...    152   3e-38   
ref|XP_011655741.1|  PREDICTED: protein NSP-INTERACTING KINASE 2 ...    152   3e-38   
ref|XP_006358116.1|  PREDICTED: probable LRR receptor-like serine...    152   4e-38   
ref|XP_004135130.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    152   4e-38   
ref|XP_008383876.1|  PREDICTED: probable LRR receptor-like serine...    149   4e-38   
ref|XP_009417455.1|  PREDICTED: probable LRR receptor-like serine...    152   4e-38   
ref|XP_010548642.1|  PREDICTED: probable LRR receptor-like serine...    152   5e-38   
ref|XP_011099081.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    152   5e-38   
ref|XP_004507770.1|  PREDICTED: probable LRR receptor-like serine...    152   5e-38   
ref|XP_010999763.1|  PREDICTED: probable LRR receptor-like serine...    151   6e-38   
ref|XP_008781387.1|  PREDICTED: probable LRR receptor-like serine...    151   6e-38   
gb|KCW74133.1|  hypothetical protein EUGRSUZ_E02764                     151   6e-38   
ref|XP_010447704.1|  PREDICTED: probable LRR receptor-like serine...    151   6e-38   
gb|ADD60669.1|  putative somatic embryogenesis protein kinase 1         151   7e-38   
ref|XP_002317403.1|  leucine-rich repeat transmembrane protein ki...    151   7e-38   
ref|XP_007148028.1|  hypothetical protein PHAVU_006G174400g             151   8e-38   
ref|XP_006282454.1|  hypothetical protein CARUB_v10004330mg             151   8e-38   
ref|XP_007045673.1|  NSP-interacting kinase 2, putative                 150   1e-37   
emb|CBI30706.3|  unnamed protein product                                150   1e-37   
ref|XP_006373507.1|  hypothetical protein POPTR_0017s14360g             150   1e-37   
ref|XP_010432978.1|  PREDICTED: probable LRR receptor-like serine...    151   1e-37   
ref|XP_007213585.1|  hypothetical protein PRUPE_ppa003046mg             150   1e-37   
ref|XP_003633015.1|  PREDICTED: probable LRR receptor-like serine...    150   1e-37   
ref|NP_001057376.1|  Os06g0274500                                       150   1e-37   
ref|XP_008446507.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    150   1e-37   
ref|XP_008446508.1|  PREDICTED: protein NSP-INTERACTING KINASE 1 ...    150   1e-37   
gb|ADD60695.1|  putative somatic embryogenesis protein kinase 1         150   1e-37   
ref|XP_008225339.1|  PREDICTED: probable LRR receptor-like serine...    150   1e-37   
gb|KFK39861.1|  hypothetical protein AALP_AA3G298300                    145   1e-37   
gb|EAZ36607.1|  hypothetical protein OsJ_20953                          150   1e-37   
ref|XP_008658830.1|  PREDICTED: uncharacterized LOC100382590 isof...    150   2e-37   
ref|XP_010417134.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
ref|XP_004485913.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
ref|XP_003610256.1|  Somatic embryogenesis receptor-like kinase         150   2e-37   
ref|XP_008658828.1|  PREDICTED: uncharacterized LOC100382590 isof...    150   2e-37   
gb|ACN30679.1|  unknown                                                 150   2e-37   
ref|XP_004236956.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        150   2e-37   
ref|XP_006594544.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
ref|XP_011085976.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
ref|XP_008223590.1|  PREDICTED: probable LRR receptor-like serine...    150   2e-37   
dbj|BAJ89901.1|  predicted protein                                      150   2e-37   
ref|XP_008792970.1|  PREDICTED: probable LRR receptor-like serine...    149   3e-37   
ref|XP_010914291.1|  PREDICTED: probable LRR receptor-like serine...    149   3e-37   
ref|XP_008371496.1|  PREDICTED: probable LRR receptor-like serine...    149   3e-37   
ref|XP_002533978.1|  lrr receptor protein kinase, putative              149   3e-37   
ref|NP_001152329.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    149   3e-37   
ref|XP_008371495.1|  PREDICTED: probable LRR receptor-like serine...    149   3e-37   
ref|XP_010246460.1|  PREDICTED: probable LRR receptor-like serine...    149   3e-37   
ref|XP_008439728.1|  PREDICTED: probable LRR receptor-like serine...    149   3e-37   
emb|CDY65182.1|  BnaC04g56200D                                          149   3e-37   
ref|XP_010100747.1|  putative LRR receptor-like serine/threonine-...    149   3e-37   
gb|EEC80384.1|  hypothetical protein OsI_22508                          149   3e-37   
ref|XP_008647816.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    149   3e-37   
gb|KJB53859.1|  hypothetical protein B456_009G008400                    149   3e-37   
ref|XP_010246459.1|  PREDICTED: probable LRR receptor-like serine...    149   3e-37   
ref|XP_010246458.1|  PREDICTED: probable LRR receptor-like serine...    149   3e-37   
ref|XP_008647814.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    149   3e-37   
gb|AFW76897.1|  putative leucine-rich repeat receptor-like protei...    149   4e-37   
ref|NP_001147975.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...    149   4e-37   
ref|XP_008792202.1|  PREDICTED: probable LRR receptor-like serine...    149   4e-37   
emb|CAB79770.1|  receptor-like kinase homolog                           149   4e-37   
gb|ADD60682.1|  putative somatic embryogenesis protein kinase 1         149   4e-37   
ref|XP_006656876.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    149   4e-37   
gb|ADD60706.1|  putative somatic embryogenesis protein kinase 1         149   4e-37   
ref|XP_009596696.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    149   4e-37   
ref|XP_012071584.1|  PREDICTED: probable LRR receptor-like serine...    149   6e-37   
ref|XP_010925613.1|  PREDICTED: probable LRR receptor-like serine...    148   6e-37   
ref|NP_001046389.1|  Os02g0236100                                       149   6e-37   
gb|EEC72800.1|  hypothetical protein OsI_06491                          148   6e-37   
ref|XP_006344295.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    148   6e-37   
ref|NP_194781.2|  senescence-associated receptor-like kinase            149   6e-37   
emb|CAN63733.1|  hypothetical protein VITISV_025883                     148   7e-37   
ref|XP_004134925.1|  PREDICTED: probable LRR receptor-like serine...    148   8e-37   
ref|XP_009803965.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    148   9e-37   
ref|XP_010925612.1|  PREDICTED: probable LRR receptor-like serine...    148   9e-37   
ref|XP_009140509.1|  PREDICTED: probable LRR receptor-like serine...    148   1e-36   
ref|XP_009351465.1|  PREDICTED: probable LRR receptor-like serine...    148   1e-36   
ref|XP_010235160.1|  PREDICTED: probable LRR receptor-like serine...    147   1e-36   
ref|XP_010687665.1|  PREDICTED: probable LRR receptor-like serine...    148   1e-36   
ref|XP_010687666.1|  PREDICTED: probable LRR receptor-like serine...    148   1e-36   
ref|XP_006474063.1|  PREDICTED: probable LRR receptor-like serine...    148   1e-36   
ref|XP_006453537.1|  hypothetical protein CICLE_v10007718mg             148   1e-36   
ref|XP_007013912.1|  Leucine-rich repeat protein kinase family pr...    148   1e-36   
ref|XP_010942232.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    147   1e-36   
ref|XP_010429349.1|  PREDICTED: probable LRR receptor-like serine...    147   1e-36   
ref|XP_004951350.1|  PREDICTED: probable LRR receptor-like serine...    147   2e-36   
gb|KDP21117.1|  hypothetical protein JCGZ_21588                         147   2e-36   
emb|CDX99771.1|  BnaC02g35490D                                          142   2e-36   
ref|XP_003571896.1|  PREDICTED: probable LRR receptor-like serine...    147   2e-36   
ref|XP_006295562.1|  hypothetical protein CARUB_v10024669mg             147   2e-36   
ref|XP_002436855.1|  hypothetical protein SORBIDRAFT_10g010010          147   2e-36   
ref|XP_011462643.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    147   3e-36   
ref|XP_012091804.1|  PREDICTED: probable LRR receptor-like serine...    147   3e-36   
ref|XP_010686227.1|  PREDICTED: probable LRR receptor-like serine...    146   3e-36   
gb|KFK29623.1|  hypothetical protein AALP_AA7G158000                    146   4e-36   
ref|XP_009796362.1|  PREDICTED: probable LRR receptor-like serine...    146   4e-36   
ref|XP_010277987.1|  PREDICTED: probable LRR receptor-like serine...    147   4e-36   
gb|EYU34317.1|  hypothetical protein MIMGU_mgv1a0033341mg               139   4e-36   
gb|KFK32690.1|  hypothetical protein AALP_AA6G276300                    146   6e-36   
emb|CDY39211.1|  BnaA03g50230D                                          145   6e-36   
ref|XP_010274431.1|  PREDICTED: probable LRR receptor-like serine...    146   6e-36   
ref|XP_010274432.1|  PREDICTED: probable LRR receptor-like serine...    146   6e-36   
emb|CDY46500.1|  BnaA02g27500D                                          141   6e-36   
gb|KHG07759.1|  hypothetical protein F383_34545                         145   6e-36   
dbj|BAD68023.1|  somatic embryogenesis receptor kinase 1-like           140   6e-36   
ref|XP_010472390.1|  PREDICTED: probable LRR receptor-like serine...    145   7e-36   
emb|CDX72249.1|  BnaC07g42710D                                          145   7e-36   
ref|XP_009137929.1|  PREDICTED: probable LRR receptor-like serine...    145   7e-36   
ref|NP_179973.2|  leucine-rich repeat protein kinase family protein     145   8e-36   
ref|XP_011085975.1|  PREDICTED: probable LRR receptor-like serine...    145   8e-36   
ref|XP_011070875.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    145   9e-36   
ref|XP_009101570.1|  PREDICTED: probable LRR receptor-like serine...    145   9e-36   
ref|XP_009352740.1|  PREDICTED: probable LRR receptor-like serine...    145   9e-36   
gb|ACL52449.1|  unknown                                                 145   1e-35   
emb|CAM31941.1|  hypothetical protein                                   145   1e-35   
ref|XP_006449530.1|  hypothetical protein CICLE_v10014603mg             145   1e-35   
gb|AFO67892.1|  leucine-rich repeat receptor-like kinase                145   1e-35   
ref|XP_009101569.1|  PREDICTED: probable LRR receptor-like serine...    145   1e-35   
ref|XP_002453589.1|  hypothetical protein SORBIDRAFT_04g008570          145   1e-35   
gb|KDO77893.1|  hypothetical protein CISIN_1g006907mg                   145   1e-35   
ref|XP_006467628.1|  PREDICTED: probable LRR receptor-like serine...    145   1e-35   
ref|XP_006467627.1|  PREDICTED: probable LRR receptor-like serine...    145   1e-35   
emb|CDY39449.1|  BnaAnng05800D                                          145   1e-35   
gb|AFO67893.1|  leucine-rich repeat receptor-like kinase                145   1e-35   
ref|XP_004297175.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        145   1e-35   
gb|EYU28925.1|  hypothetical protein MIMGU_mgv1a003010mg                144   1e-35   
gb|ADD60668.1|  putative somatic embryogenesis receptor kinase 1        138   1e-35   
ref|XP_007025340.1|  Leucine-rich repeat protein kinase family pr...    144   1e-35   
ref|XP_007025341.1|  Leucine-rich repeat protein kinase family pr...    144   2e-35   
ref|XP_010108365.1|  putative LRR receptor-like serine/threonine-...    145   2e-35   
gb|ACD56664.1|  putative leucine-rich repeat transmembrane protein      144   2e-35   
gb|AAT64017.1|  putative leucine-rich repeat transmembrane protein      144   2e-35   
ref|XP_004149504.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    144   2e-35   
emb|CDX77614.1|  BnaC07g18680D                                          144   2e-35   
ref|XP_006398263.1|  hypothetical protein EUTSA_v10000817mg             144   2e-35   
gb|KJB76637.1|  hypothetical protein B456_012G097800                    144   2e-35   
emb|CAH56437.1|  somatic embryogenesis receptor-like kinase 1           144   2e-35   
gb|ACD56650.1|  putative leucine-rich repeat transmembrane protein      144   2e-35   
ref|XP_009611184.1|  PREDICTED: probable LRR receptor-like serine...    144   2e-35   
gb|KJB76636.1|  hypothetical protein B456_012G097800                    144   2e-35   
ref|XP_010518814.1|  PREDICTED: probable LRR receptor-like serine...    144   3e-35   
gb|KJB69702.1|  hypothetical protein B456_011G038400                    144   3e-35   
gb|AAT64032.1|  putative leucine-rich repeat transmembrane protein      144   3e-35   
gb|KJB69703.1|  hypothetical protein B456_011G038400                    144   3e-35   
ref|XP_008443821.1|  PREDICTED: probable LRR receptor-like serine...    144   4e-35   
ref|XP_003518230.1|  PREDICTED: probable LRR receptor-like serine...    143   4e-35   
gb|KHN30285.1|  Putative LRR receptor-like serine/threonine-prote...    143   4e-35   
ref|XP_004146714.1|  PREDICTED: probable LRR receptor-like serine...    143   5e-35   
gb|ADD60704.1|  putative somatic embryogenesis receptor kinase 1        137   5e-35   
ref|XP_004242632.1|  PREDICTED: probable LRR receptor-like serine...    143   5e-35   
ref|XP_004295585.1|  PREDICTED: probable LRR receptor-like serine...    143   6e-35   
gb|EMT29112.1|  Putative LRR receptor-like serine/threonine-prote...    141   6e-35   
ref|XP_006656875.1|  PREDICTED: probable LRR receptor-like serine...    137   7e-35   
ref|XP_009390537.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...    143   7e-35   
emb|CDP02874.1|  unnamed protein product                                143   7e-35   
gb|EAZ22359.1|  hypothetical protein OsJ_06018                          142   7e-35   
ref|XP_011077619.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        143   7e-35   
dbj|BAJ91470.1|  predicted protein                                      143   7e-35   
gb|KHN28623.1|  Putative LRR receptor-like serine/threonine-prote...    142   8e-35   
ref|XP_006659455.1|  PREDICTED: probable LRR receptor-like serine...    142   9e-35   
ref|XP_003549524.2|  PREDICTED: probable LRR receptor-like serine...    142   1e-34   
gb|KHN17525.1|  Putative LRR receptor-like serine/threonine-prote...    142   1e-34   
ref|XP_010518811.1|  PREDICTED: probable LRR receptor-like serine...    142   1e-34   
ref|XP_006343723.1|  PREDICTED: probable LRR receptor-like serine...    142   1e-34   
emb|CAH56436.1|  somatic embryogenesis receptor-like kinase 2           142   1e-34   
dbj|BAD10033.1|  somatic embryogenesis receptor kinase-like protein     141   1e-34   
ref|XP_010518810.1|  PREDICTED: probable LRR receptor-like serine...    142   1e-34   
ref|XP_010518809.1|  PREDICTED: probable LRR receptor-like serine...    142   1e-34   
ref|XP_002445573.1|  hypothetical protein SORBIDRAFT_07g021820          142   2e-34   
ref|XP_008664637.1|  PREDICTED: probable LRR receptor-like serine...    142   2e-34   
ref|XP_004973571.1|  PREDICTED: probable LRR receptor-like serine...    142   2e-34   
gb|EYU37129.1|  hypothetical protein MIMGU_mgv1a003448mg                141   2e-34   
ref|XP_002325107.1|  leucine-rich repeat family protein                 141   2e-34   
ref|XP_008659447.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    134   2e-34   
ref|XP_010047875.1|  PREDICTED: probable LRR receptor-like serine...    141   3e-34   
ref|XP_008664636.1|  PREDICTED: probable LRR receptor-like serine...    142   3e-34   
ref|NP_001061919.1|  Os08g0442700                                       142   3e-34   
ref|XP_011620472.1|  PREDICTED: probable LRR receptor-like serine...    140   3e-34   
ref|XP_008664634.1|  PREDICTED: probable LRR receptor-like serine...    142   4e-34   
ref|XP_009803966.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    140   5e-34   
ref|XP_008664633.1|  PREDICTED: probable LRR receptor-like serine...    142   5e-34   
ref|XP_007154851.1|  hypothetical protein PHAVU_003G152900g             140   5e-34   
dbj|BAB01326.1|  receptor-like kinase                                   140   5e-34   
ref|XP_009596697.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    140   5e-34   
ref|XP_011079354.1|  PREDICTED: probable LRR receptor-like serine...    140   6e-34   
gb|EAZ42894.1|  hypothetical protein OsJ_27488                          141   7e-34   
ref|XP_010261776.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    140   8e-34   
gb|EAZ07144.1|  hypothetical protein OsI_29394                          140   8e-34   
ref|XP_008465988.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    139   9e-34   
ref|XP_002436858.1|  hypothetical protein SORBIDRAFT_10g010020          133   1e-33   
gb|KHG21712.1|  nsp-interacting kinase 2 -like protein                  132   2e-33   
gb|KEH36623.1|  LRR receptor-like kinase                                138   4e-33   
ref|XP_009402860.1|  PREDICTED: probable LRR receptor-like serine...    138   5e-33   
ref|XP_009625494.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    137   6e-33   
ref|XP_011069822.1|  PREDICTED: probable LRR receptor-like serine...    136   1e-32   
ref|XP_009765506.1|  PREDICTED: protein NSP-INTERACTING KINASE 2-...    135   3e-32   
ref|NP_199390.2|  putative LRR receptor-like serine/threonine-pro...    134   5e-32   
gb|KCW86417.1|  hypothetical protein EUGRSUZ_B03087                     133   7e-32   
ref|XP_010044332.1|  PREDICTED: protein NSP-INTERACTING KINASE 2        134   7e-32   
ref|XP_002863454.1|  hypothetical protein ARALYDRAFT_330836             133   1e-31   
ref|XP_008647815.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...    132   2e-31   
ref|XP_003633168.1|  PREDICTED: probable LRR receptor-like serine...    132   3e-31   



>dbj|BAD18102.1| leucine-rich repeat receptor-like kinase [Ipomoea batatas]
Length=627

 Score =   284 bits (726),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 139/142 (98%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            MEREWFL FKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN
Sbjct  1    MEREWFLPFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  60

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI
Sbjct  61   SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  120

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL RL TLDLSNNKFNGDIPS
Sbjct  121  GKLERLQTLDLSNNKFNGDIPS  142



>ref|XP_010940158.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Elaeis guineensis]
Length=629

 Score =   212 bits (540),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 118/139 (85%), Gaps = 6/139 (4%)
 Frame = +2

Query  497  KVLGLGIWML------IATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVD  658
            +VLG   WML           +ATLSPSG+NYEVVAL+AIK  L+DPYNVLENWD+NSVD
Sbjct  4    RVLGFAFWMLGLLLWAWPEMAAATLSPSGINYEVVALMAIKMELNDPYNVLENWDINSVD  63

Query  659  PCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKL  838
            PCSWRMVTCS DGYVSALG+PSQSLSGTLSPGIGNLTNLQSVLLQNNAISG IPA+IGKL
Sbjct  64   PCSWRMVTCSADGYVSALGMPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGPIPADIGKL  123

Query  839  XRLXTLDLSNNKFNGDIPS  895
             +L TLDLSNN+F+G +PS
Sbjct  124  EKLQTLDLSNNQFHGGMPS  142



>ref|XP_006356418.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356419.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006356420.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Solanum 
tuberosum]
Length=600

 Score =   211 bits (537),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +2

Query  491  LFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSW  670
            LF  +GL ++  +  S SATLSP+GVNYEVVAL  IK  LHDPYNVL+NWDVNSVDPCSW
Sbjct  4    LFWNVGLLLFCTLMESSSATLSPAGVNYEVVALTEIKKALHDPYNVLDNWDVNSVDPCSW  63

Query  671  RMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLX  850
            RMVTCS DGYVSAL LPSQSL+GTLSPGIGNLTNLQ VLLQNNAISGHIP  IGKL +L 
Sbjct  64   RMVTCSLDGYVSALALPSQSLAGTLSPGIGNLTNLQYVLLQNNAISGHIPDVIGKLQKLQ  123

Query  851  TLDLSNNKFNGDIPS  895
            TLDLSNNKF G+IP+
Sbjct  124  TLDLSNNKFEGEIPT  138



>gb|KDO82336.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=391

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 2/141 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME + +  ++V G  +  LI   C ATLSP+G+NYEVVAL+A+K  LHDPYNVLENWD+ 
Sbjct  1    MEMKSYKFWRV-GFLVLALIDI-CYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDIT  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRM+TCSPDGYVSALGLPSQSLSGTLSP IGNLT LQSVLLQNNAI G IPA +
Sbjct  59   SVDPCSWRMITCSPDGYVSALGLPSQSLSGTLSPWIGNLTKLQSVLLQNNAILGPIPASL  118

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            GKL +L TLDLSNNKF G+IP
Sbjct  119  GKLEKLQTLDLSNNKFTGEIP  139



>ref|XP_009403878.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=607

 Score =   210 bits (535),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+AIK  LHDPYNVLENWD+NSVDPCSWRMVTCS DGYVSALG
Sbjct  21   SSSATLSPSGINYEVVALMAIKMELHDPYNVLENWDINSVDPCSWRMVTCSADGYVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSLSG LSPGIGNLTNLQS+LLQNNAISG IPAEIGKL +L  LDLSNN+F G IPS
Sbjct  81   LPSQSLSGMLSPGIGNLTNLQSMLLQNNAISGSIPAEIGKLEKLQMLDLSNNQFRGTIPS  140



>ref|XP_007044708.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
 gb|EOY00540.1| Nsp-interacting kinase 3 isoform 1 [Theobroma cacao]
Length=626

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 122/142 (86%), Gaps = 2/142 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M+R   +LF+ LGL +  L+  S SATLSP+G+N+EVVAL+AIK  LHDPYNVLENWD+N
Sbjct  1    MDRRSLMLFR-LGLLVLALMGIS-SATLSPTGINFEVVALMAIKYNLHDPYNVLENWDMN  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTCS DGYVSALGLPSQSLSGTLSP IGNL+NLQSVLLQNNAISG IP+ I
Sbjct  59   SVDPCSWRMVTCSTDGYVSALGLPSQSLSGTLSPSIGNLSNLQSVLLQNNAISGPIPSTI  118

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL +L TLDLSNN F G+IP+
Sbjct  119  GKLEKLETLDLSNNTFRGEIPT  140



>ref|XP_004238646.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Solanum lycopersicum]
Length=603

 Score =   209 bits (533),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            MER   L + V+ L    LI +S SATLSP+GVNYEVVAL  IK  LHDPYNVL+NWDV 
Sbjct  1    MERMLHLFWNVVLLLFCTLIESS-SATLSPAGVNYEVVALTEIKKALHDPYNVLDNWDVT  59

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTCS +GYVSAL LPSQSLSGTLSPGIGNLTNLQ VLLQNNAISGHIP  I
Sbjct  60   SVDPCSWRMVTCSLEGYVSALALPSQSLSGTLSPGIGNLTNLQYVLLQNNAISGHIPDVI  119

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL +L TLDLSNNKF G+IP+
Sbjct  120  GKLQKLQTLDLSNNKFEGEIPT  141



>ref|XP_009403877.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=626

 Score =   210 bits (534),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+AIK  LHDPYNVLENWD+NSVDPCSWRMVTCS DGYVSALG
Sbjct  21   SSSATLSPSGINYEVVALMAIKMELHDPYNVLENWDINSVDPCSWRMVTCSADGYVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSLSG LSPGIGNLTNLQS+LLQNNAISG IPAEIGKL +L  LDLSNN+F G IPS
Sbjct  81   LPSQSLSGMLSPGIGNLTNLQSMLLQNNAISGSIPAEIGKLEKLQMLDLSNNQFRGTIPS  140



>ref|XP_006438322.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
 gb|ESR51562.1| hypothetical protein CICLE_v10030967mg [Citrus clementina]
Length=623

 Score =   209 bits (532),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 118/141 (84%), Gaps = 2/141 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME + +  ++V G  +  LI   C ATLSP+G+NYEVVAL+A+K  LHDPYNVLENWD+ 
Sbjct  1    MEMKSYKFWRV-GFLVLALIDI-CYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDIT  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRM+TCSPDGYVSALGLPSQSLSGTLSP IGNLT LQSVLLQNNAISG IPA +
Sbjct  59   SVDPCSWRMITCSPDGYVSALGLPSQSLSGTLSPWIGNLTKLQSVLLQNNAISGPIPASL  118

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            GKL +L TLDLSNNKF G+IP
Sbjct  119  GKLEKLQTLDLSNNKFTGEIP  139



>ref|XP_012085434.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Jatropha curcas]
 gb|KDP26621.1| hypothetical protein JCGZ_17779 [Jatropha curcas]
Length=626

 Score =   208 bits (530),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME     L+KV GL +W L+  S SATLSP+G+NYEVVAL+ IKT LHDPYNVLE+WD+N
Sbjct  1    MEGRSLWLWKV-GLVVWALMEIS-SATLSPTGINYEVVALVNIKTALHDPYNVLESWDIN  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTCS DGYVSALGLPSQSLSGTLS  IGNLTNLQSVLLQNNAISG IPA I
Sbjct  59   SVDPCSWRMVTCSSDGYVSALGLPSQSLSGTLSSWIGNLTNLQSVLLQNNAISGPIPAAI  118

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            G+L RL TLDLSNN F+G+IP+
Sbjct  119  GRLGRLQTLDLSNNTFSGEIPA  140



>ref|XP_011086598.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Sesamum indicum]
Length=625

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 115/142 (81%), Gaps = 4/142 (3%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCS-ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDV  646
            MER  FL +KV   G+ +L    CS +TLSPSGVNYEVVALIAIK  L DPYNVLENWD 
Sbjct  1    MERGKFLFWKV---GLLVLAMVECSYSTLSPSGVNYEVVALIAIKNDLRDPYNVLENWDA  57

Query  647  NSVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAE  826
            NSVDPCSWRMVTCS DGYVSALGLPS SLSGTLSPGIGNLTNLQSVLLQNN I G IP  
Sbjct  58   NSVDPCSWRMVTCSQDGYVSALGLPSLSLSGTLSPGIGNLTNLQSVLLQNNEIMGAIPPV  117

Query  827  IGKLXRLXTLDLSNNKFNGDIP  892
            IGKL +L TLDLSNNK  GDIP
Sbjct  118  IGKLEKLQTLDLSNNKLTGDIP  139



>ref|XP_006378225.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|ERP56022.1| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=624

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 121/140 (86%), Gaps = 2/140 (1%)
 Frame = +2

Query  476  REWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSV  655
            R  F L +V+ L + ++  ++  ATLSP+G+NYEVVAL+AIKT L DPYNVL+NWD+NSV
Sbjct  4    RRSFRLCRVVFLVLALMEIST--ATLSPAGINYEVVALVAIKTALRDPYNVLDNWDINSV  61

Query  656  DPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGK  835
            DPCSWRMVTC+PDGYVSALGLPSQSLSGTLSP IGNLTNLQSVLLQNNAISG IPA IGK
Sbjct  62   DPCSWRMVTCTPDGYVSALGLPSQSLSGTLSPSIGNLTNLQSVLLQNNAISGPIPAAIGK  121

Query  836  LXRLXTLDLSNNKFNGDIPS  895
            L +L TLDLSNN F+G++P+
Sbjct  122  LEKLLTLDLSNNTFSGEMPT  141



>ref|XP_010251173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
 ref|XP_010251174.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nelumbo nucifera]
Length=628

 Score =   208 bits (529),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 123/143 (86%), Gaps = 3/143 (2%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLI-ATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDV  646
            MER   L+F  +GL + +L      +ATLSPSGVNYEVVAL+AIK  L+DPYNVLENWD+
Sbjct  1    MERN--LVFWGVGLVLLVLAWMEGSAATLSPSGVNYEVVALMAIKNDLNDPYNVLENWDI  58

Query  647  NSVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAE  826
            NSVDPCSWRMVTCS DGYVSALGLPSQSLSGTLSPGIGNL+NLQ+VLLQNNAISG IPA+
Sbjct  59   NSVDPCSWRMVTCSADGYVSALGLPSQSLSGTLSPGIGNLSNLQTVLLQNNAISGPIPAD  118

Query  827  IGKLXRLXTLDLSNNKFNGDIPS  895
            IGKL +L TLDLSNNKF+G IPS
Sbjct  119  IGKLEKLQTLDLSNNKFSGVIPS  141



>ref|XP_011034116.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Populus 
euphratica]
Length=624

 Score =   208 bits (529),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SATLSP+G+N+EVVAL+AIKT L DPYNVLENWD+NSVDPCSWRMVTCSPDGYVSALGLP
Sbjct  24   SATLSPTGINFEVVALMAIKTALLDPYNVLENWDINSVDPCSWRMVTCSPDGYVSALGLP  83

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQSLSGTLSP +GNLTNLQSVLLQNNAISG IPA IGKL +L TLDLSNN F+GD+P+
Sbjct  84   SQSLSGTLSPSVGNLTNLQSVLLQNNAISGPIPAAIGKLEKLQTLDLSNNTFSGDMPT  141



>ref|XP_011034114.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
 ref|XP_011034115.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   207 bits (528),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SATLSP+G+N+EVVAL+AIKT L DPYNVLENWD+NSVDPCSWRMVTCSPDGYVSALGLP
Sbjct  24   SATLSPTGINFEVVALMAIKTALLDPYNVLENWDINSVDPCSWRMVTCSPDGYVSALGLP  83

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQSLSGTLSP +GNLTNLQSVLLQNNAISG IPA IGKL +L TLDLSNN F+GD+P+
Sbjct  84   SQSLSGTLSPSVGNLTNLQSVLLQNNAISGPIPAAIGKLEKLQTLDLSNNTFSGDMPT  141



>ref|XP_009596637.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Nicotiana tomentosiformis]
Length=601

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  488  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCS  667
            LL+ V  L I  L+  S SATLSP+G+NYEVVAL  IK  LHDPYNVL+NWDVNSVDPCS
Sbjct  4    LLWNVGLLLICTLMMESSSATLSPTGINYEVVALTEIKKALHDPYNVLDNWDVNSVDPCS  63

Query  668  WRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRL  847
            WRMVTCS DGYVSAL LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISG IP  IGKL +L
Sbjct  64   WRMVTCSFDGYVSALALPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGPIPDVIGKLQKL  123

Query  848  XTLDLSNNKFNGDIPS  895
             T+DLSNNKF G+IP+
Sbjct  124  QTIDLSNNKFEGEIPT  139



>gb|KJB61042.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
 gb|KJB61044.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=391

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME +  +LF+ LGL I  L   S SATLSP+G+NYEVVAL+AIK+ LHDPYNVLENWD N
Sbjct  1    MEIKNLMLFR-LGLLILALNGVS-SATLSPTGINYEVVALMAIKSNLHDPYNVLENWDSN  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTC+ DGYVSALGLPSQSLSG+LS  IGNL+ LQSVLLQNNAISG IPA I
Sbjct  59   SVDPCSWRMVTCTADGYVSALGLPSQSLSGSLSTSIGNLSYLQSVLLQNNAISGSIPATI  118

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL +L TLDLSNN F+G+IP+
Sbjct  119  GKLEKLVTLDLSNNTFSGEIPA  140



>gb|KDO82335.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=540

 Score =   206 bits (523),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 2/141 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME + +  ++V G  +  LI   C ATLSP+G+NYEVVAL+A+K  LHDPYNVLENWD+ 
Sbjct  1    MEMKSYKFWRV-GFLVLALIDI-CYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDIT  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRM+TCSPDGYVSALGLPSQSLSGTLSP IGNLT LQSVLLQNNAI G IPA +
Sbjct  59   SVDPCSWRMITCSPDGYVSALGLPSQSLSGTLSPWIGNLTKLQSVLLQNNAILGPIPASL  118

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            GKL +L TLDLSNNKF G+IP
Sbjct  119  GKLEKLQTLDLSNNKFTGEIP  139



>ref|XP_004237339.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319665.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
 ref|XP_010319666.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Solanum 
lycopersicum]
Length=623

 Score =   207 bits (527),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 115/142 (81%), Gaps = 6/142 (4%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            MER+W +   V+ L        SC A+LSP+G+NYEVVALI IK  LHDPYNVLENWDV 
Sbjct  1    MERKWCMFLYVVAL------MESCYASLSPTGINYEVVALIEIKKALHDPYNVLENWDVT  54

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTCS DGYVS+LGLPSQSLSGTLSPGIGNLT L+S+LLQNNAI G+IP  +
Sbjct  55   SVDPCSWRMVTCSNDGYVSSLGLPSQSLSGTLSPGIGNLTKLESILLQNNAIYGYIPDVV  114

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            G L  L TLDLSNNKF+G+IP+
Sbjct  115  GNLESLQTLDLSNNKFDGEIPA  136



>gb|KDO82334.1| hypothetical protein CISIN_1g006968mg [Citrus sinensis]
Length=623

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 2/141 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME + +  ++V G  +  LI   C ATLSP+G+NYEVVAL+A+K  LHDPYNVLENWD+ 
Sbjct  1    MEMKSYKFWRV-GFLVLALIDI-CYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDIT  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRM+TCSPDGYVSALGLPSQSLSGTLSP IGNLT LQSVLLQNNAI G IPA +
Sbjct  59   SVDPCSWRMITCSPDGYVSALGLPSQSLSGTLSPWIGNLTKLQSVLLQNNAILGPIPASL  118

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            GKL +L TLDLSNNKF G+IP
Sbjct  119  GKLEKLQTLDLSNNKFTGEIP  139



>ref|XP_006483905.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Citrus sinensis]
Length=623

 Score =   206 bits (525),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 117/141 (83%), Gaps = 2/141 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME + +  ++V G  +  LI   C ATLSP+G+NYEVVAL+A+K  LHDPYNVLENWD+ 
Sbjct  1    MEMKSYKFWRV-GFLVLALIDI-CYATLSPAGINYEVVALVAVKNNLHDPYNVLENWDIT  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRM+TCSPDGYVSALGLPSQSLSGTLSP IGNLT LQSVLLQNNAI G IPA +
Sbjct  59   SVDPCSWRMITCSPDGYVSALGLPSQSLSGTLSPWIGNLTKLQSVLLQNNAILGPIPASL  118

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            GKL +L TLDLSNNKF G+IP
Sbjct  119  GKLEKLQTLDLSNNKFTGEIP  139



>ref|XP_009390158.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=659

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 120/141 (85%), Gaps = 3/141 (2%)
 Frame = +2

Query  479  EWFLLF--KVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNS  652
            EW ++F  + L L +   +  S +ATLSPSG+NYEVVAL+AIK  L+DPYNVLENWD+NS
Sbjct  34   EWKVVFFCRTLCLVLLHFLYLS-AATLSPSGINYEVVALVAIKMELNDPYNVLENWDINS  92

Query  653  VDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIG  832
            VDPCSWRMVTC+ DGYVSALGLPSQSLSG LSPG+GNLTNLQSVLLQNNAISG IPAEIG
Sbjct  93   VDPCSWRMVTCTSDGYVSALGLPSQSLSGKLSPGMGNLTNLQSVLLQNNAISGPIPAEIG  152

Query  833  KLXRLXTLDLSNNKFNGDIPS  895
            KL +L TLDLSNN+F G IPS
Sbjct  153  KLEKLQTLDLSNNQFGGTIPS  173



>ref|XP_009390157.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390159.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009390160.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=665

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 120/141 (85%), Gaps = 3/141 (2%)
 Frame = +2

Query  479  EWFLLF--KVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNS  652
            EW ++F  + L L +   +  S +ATLSPSG+NYEVVAL+AIK  L+DPYNVLENWD+NS
Sbjct  34   EWKVVFFCRTLCLVLLHFLYLS-AATLSPSGINYEVVALVAIKMELNDPYNVLENWDINS  92

Query  653  VDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIG  832
            VDPCSWRMVTC+ DGYVSALGLPSQSLSG LSPG+GNLTNLQSVLLQNNAISG IPAEIG
Sbjct  93   VDPCSWRMVTCTSDGYVSALGLPSQSLSGKLSPGMGNLTNLQSVLLQNNAISGPIPAEIG  152

Query  833  KLXRLXTLDLSNNKFNGDIPS  895
            KL +L TLDLSNN+F G IPS
Sbjct  153  KLEKLQTLDLSNNQFGGTIPS  173



>ref|XP_008813583.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Phoenix 
dactylifera]
Length=643

 Score =   206 bits (524),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 118/134 (88%), Gaps = 1/134 (1%)
 Frame = +2

Query  494  FKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWR  673
            F +LGL +W     S +ATLSPSG+NYEVVAL+AI+  L+DPYNVLENWD+NSVDPCSWR
Sbjct  24   FWMLGLLLWAGPLVS-AATLSPSGINYEVVALMAIRMELNDPYNVLENWDINSVDPCSWR  82

Query  674  MVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXT  853
            MVTCS DGYVSA+G+PSQ LSGTLSPGIGNLTNLQSVLLQNNAISG IPA+IGKL +L T
Sbjct  83   MVTCSADGYVSAIGMPSQRLSGTLSPGIGNLTNLQSVLLQNNAISGPIPADIGKLEKLQT  142

Query  854  LDLSNNKFNGDIPS  895
            LDLSNN+F+G +PS
Sbjct  143  LDLSNNQFDGGVPS  156



>ref|XP_009626005.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana tomentosiformis]
Length=626

 Score =   206 bits (523),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 118/142 (83%), Gaps = 2/142 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME +W +L+ V GL +  L+  SC A+LSP+G+NYEVVAL  IK  LHDPYNVLENWDV 
Sbjct  1    MEGKWCMLWYV-GLLVLTLM-ESCYASLSPTGINYEVVALTEIKKALHDPYNVLENWDVT  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTCS DGYVSALGLPSQSLSGTLSPGIGNLT LQSVLLQNNAISG IP  I
Sbjct  59   SVDPCSWRMVTCSIDGYVSALGLPSQSLSGTLSPGIGNLTKLQSVLLQNNAISGPIPDVI  118

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            G L +L TLDLSNNKF G++P+
Sbjct  119  GNLEKLQTLDLSNNKFEGEMPA  140



>ref|XP_008813582.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Phoenix 
dactylifera]
Length=649

 Score =   206 bits (524),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 118/134 (88%), Gaps = 1/134 (1%)
 Frame = +2

Query  494  FKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWR  673
            F +LGL +W     S +ATLSPSG+NYEVVAL+AI+  L+DPYNVLENWD+NSVDPCSWR
Sbjct  24   FWMLGLLLWAGPLVS-AATLSPSGINYEVVALMAIRMELNDPYNVLENWDINSVDPCSWR  82

Query  674  MVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXT  853
            MVTCS DGYVSA+G+PSQ LSGTLSPGIGNLTNLQSVLLQNNAISG IPA+IGKL +L T
Sbjct  83   MVTCSADGYVSAIGMPSQRLSGTLSPGIGNLTNLQSVLLQNNAISGPIPADIGKLEKLQT  142

Query  854  LDLSNNKFNGDIPS  895
            LDLSNN+F+G +PS
Sbjct  143  LDLSNNQFDGGVPS  156



>ref|XP_009797107.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Nicotiana sylvestris]
Length=520

 Score =   202 bits (515),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 116/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M R   LL+ V  L I  L+  S  ATLSP+G+NYEVVAL  IK  LHDPYNVL+NWDVN
Sbjct  8    MGRMLHLLWNVGLLLICTLMENSF-ATLSPTGINYEVVALTEIKKALHDPYNVLDNWDVN  66

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTCS DGYVSAL LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISG IP  I
Sbjct  67   SVDPCSWRMVTCSFDGYVSALALPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGSIPDVI  126

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL +L T+DLSNNKF G+IP+
Sbjct  127  GKLQKLQTIDLSNNKFEGEIPT  148



>ref|XP_006366916.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Solanum tuberosum]
Length=622

 Score =   204 bits (520),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 116/142 (82%), Gaps = 5/142 (4%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M+R+W +   V+     + +  SC A+LSP+G+NYEVVALI IK  LHDPYNVLENWDV 
Sbjct  1    MDRKWCMFLYVV-----LTLMESCYASLSPTGINYEVVALIEIKKALHDPYNVLENWDVT  55

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTCS DGYVS+LGLPSQSLSGTLSPGIGNLT L+S+LLQNNAI G IP  +
Sbjct  56   SVDPCSWRMVTCSNDGYVSSLGLPSQSLSGTLSPGIGNLTKLESILLQNNAIYGPIPDVV  115

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            G L +L TLDLSNNKF+G+IP+
Sbjct  116  GNLEKLQTLDLSNNKFDGEIPA  137



>gb|KJB61043.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=536

 Score =   202 bits (515),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME +  +LF+ LGL I  L   S SATLSP+G+NYEVVAL+AIK+ LHDPYNVLENWD N
Sbjct  1    MEIKNLMLFR-LGLLILALNGVS-SATLSPTGINYEVVALMAIKSNLHDPYNVLENWDSN  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTC+ DGYVSALGLPSQSLSG+LS  IGNL+ LQSVLLQNNAISG IPA I
Sbjct  59   SVDPCSWRMVTCTADGYVSALGLPSQSLSGSLSTSIGNLSYLQSVLLQNNAISGSIPATI  118

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL +L TLDLSNN F+G+IP+
Sbjct  119  GKLEKLVTLDLSNNTFSGEIPA  140



>gb|EYU28436.1| hypothetical protein MIMGU_mgv1a002888mg [Erythranthe guttata]
Length=628

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/117 (86%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +2

Query  545  ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPS  724
            +TLSPSGVNYEVVALIAIK+ LHDPYNVLENWD NSVDPCSWRMVTCSPDGYVSALGLPS
Sbjct  24   STLSPSGVNYEVVALIAIKSDLHDPYNVLENWDANSVDPCSWRMVTCSPDGYVSALGLPS  83

Query  725  QSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
             SLSGTLSPGIGNLTNLQSVLLQNN I+G IP  IGKL RL TLDLSNNK  G+IP+
Sbjct  84   LSLSGTLSPGIGNLTNLQSVLLQNNEITGLIPPVIGKLERLQTLDLSNNKITGEIPN  140



>ref|XP_002315684.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
 gb|EEF01855.2| hypothetical protein POPTR_0010s05300g [Populus trichocarpa]
Length=628

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/141 (73%), Positives = 121/141 (86%), Gaps = 3/141 (2%)
 Frame = +2

Query  476  REWFLLFKVLGLGIWMLIATSCSATLSPSGVNYE-VVALIAIKTGLHDPYNVLENWDVNS  652
            R  F L +V+ L + ++  ++  ATLSP+G+NYE VVAL+AIKT L DPYNVL+NWD+NS
Sbjct  4    RRSFRLCRVVFLVLALMEIST--ATLSPAGINYEAVVALVAIKTALRDPYNVLDNWDINS  61

Query  653  VDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIG  832
            VDPCSWRMVTC+PDGYVSALGLPSQSLSGTLSP IGNLTNLQSVLLQNNAISG IPA IG
Sbjct  62   VDPCSWRMVTCTPDGYVSALGLPSQSLSGTLSPSIGNLTNLQSVLLQNNAISGPIPAAIG  121

Query  833  KLXRLXTLDLSNNKFNGDIPS  895
            KL +L TLDLSNN F+G++P+
Sbjct  122  KLEKLLTLDLSNNTFSGEMPT  142



>ref|XP_008389688.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=630

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M R  F L+K LGL +  L+  + SATLSP+GVNYEV AL AIK+ L DP+NVLENWD N
Sbjct  8    MGRSTFTLWK-LGLLVLALVE-AASATLSPTGVNYEVEALAAIKSDLRDPHNVLENWDSN  65

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTC+PDGYVSALGLPSQSLSG LSP IGNL+NLQSVLLQNN ISG IPA I
Sbjct  66   SVDPCSWRMVTCTPDGYVSALGLPSQSLSGILSPAIGNLSNLQSVLLQNNEISGPIPASI  125

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            G L +L TLDLSNN FNGDIP
Sbjct  126  GNLEKLQTLDLSNNNFNGDIP  146



>ref|XP_008389687.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=631

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M R  F L+K LGL +  L+  + SATLSP+GVNYEV AL AIK+ L DP+NVLENWD N
Sbjct  8    MGRSTFTLWK-LGLLVLALVE-AASATLSPTGVNYEVEALAAIKSDLRDPHNVLENWDSN  65

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTC+PDGYVSALGLPSQSLSG LSP IGNL+NLQSVLLQNN ISG IPA I
Sbjct  66   SVDPCSWRMVTCTPDGYVSALGLPSQSLSGILSPAIGNLSNLQSVLLQNNEISGPIPASI  125

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            G L +L TLDLSNN FNGDIP
Sbjct  126  GNLEKLQTLDLSNNNFNGDIP  146



>ref|XP_008389685.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
 ref|XP_008389686.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=632

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 116/141 (82%), Gaps = 2/141 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M R  F L+K LGL +  L+  + SATLSP+GVNYEV AL AIK+ L DP+NVLENWD N
Sbjct  8    MGRSTFTLWK-LGLLVLALVE-AASATLSPTGVNYEVEALAAIKSDLRDPHNVLENWDSN  65

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTC+PDGYVSALGLPSQSLSG LSP IGNL+NLQSVLLQNN ISG IPA I
Sbjct  66   SVDPCSWRMVTCTPDGYVSALGLPSQSLSGILSPAIGNLSNLQSVLLQNNEISGPIPASI  125

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            G L +L TLDLSNN FNGDIP
Sbjct  126  GNLEKLQTLDLSNNNFNGDIP  146



>gb|KJB61041.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=628

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME +  +LF+ LGL I  L   S SATLSP+G+NYEVVAL+AIK+ LHDPYNVLENWD N
Sbjct  1    MEIKNLMLFR-LGLLILALNGVS-SATLSPTGINYEVVALMAIKSNLHDPYNVLENWDSN  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTC+ DGYVSALGLPSQSLSG+LS  IGNL+ LQSVLLQNNAISG IPA I
Sbjct  59   SVDPCSWRMVTCTADGYVSALGLPSQSLSGSLSTSIGNLSYLQSVLLQNNAISGSIPATI  118

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL +L TLDLSNN F+G+IP+
Sbjct  119  GKLEKLVTLDLSNNTFSGEIPA  140



>ref|XP_010910388.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Elaeis guineensis]
Length=629

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 118/147 (80%), Gaps = 12/147 (8%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLI------ATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVL  631
            MER      +V G   WML         + +ATLSPSG+NYEVVAL+AIK  L+DPYNVL
Sbjct  1    MER------RVSGFSFWMLGLLLWAGPLASAATLSPSGINYEVVALMAIKMELNDPYNVL  54

Query  632  ENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISG  811
            ENWD+NSVDPCSWRMVTCS DGYVSALG+PSQSLSGTLSPGIGNLTNLQSVLLQNN ISG
Sbjct  55   ENWDINSVDPCSWRMVTCSVDGYVSALGMPSQSLSGTLSPGIGNLTNLQSVLLQNNVISG  114

Query  812  HIPAEIGKLXRLXTLDLSNNKFNGDIP  892
             IP +IGKL +L TLDLS+N+F+G IP
Sbjct  115  PIPTDIGKLEKLQTLDLSSNQFDGGIP  141



>ref|XP_010100426.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
 gb|EXB82560.1| Protein NSP-INTERACTING KINASE 3 [Morus notabilis]
Length=637

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +2

Query  485  FLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPC  664
            FL   V  L +++ +  + SATLSP+G+NYEVVAL+AIKT L+DP+NVLENWDVNSVDPC
Sbjct  15   FLWNLVGALLVFLALLQASSATLSPTGINYEVVALVAIKTALNDPHNVLENWDVNSVDPC  74

Query  665  SWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXR  844
            SWRMVTC+ DGYVSALGLPSQSLSGTLSP IGNLTNLQSVLLQNNAISG IPA IGKL +
Sbjct  75   SWRMVTCTSDGYVSALGLPSQSLSGTLSPWIGNLTNLQSVLLQNNAISGPIPATIGKLEK  134

Query  845  LXTLDLSNNKFNGDIP  892
            L TLDLSNN   G+IP
Sbjct  135  LQTLDLSNNALTGEIP  150



>gb|KJB61045.1| hypothetical protein B456_009G337000 [Gossypium raimondii]
Length=625

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME +  +LF+ LGL I  L   S SATLSP+G+NYEVVAL+AIK+ LHDPYNVLENWD N
Sbjct  1    MEIKNLMLFR-LGLLILALNGVS-SATLSPTGINYEVVALMAIKSNLHDPYNVLENWDSN  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTC+ DGYVSALGLPSQSLSG+LS  IGNL+ LQSVLLQNNAISG IPA I
Sbjct  59   SVDPCSWRMVTCTADGYVSALGLPSQSLSGSLSTSIGNLSYLQSVLLQNNAISGSIPATI  118

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL +L TLDLSNN F+G+IP+
Sbjct  119  GKLEKLVTLDLSNNTFSGEIPA  140



>ref|XP_008812173.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Phoenix dactylifera]
Length=629

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 115/139 (83%), Gaps = 6/139 (4%)
 Frame = +2

Query  497  KVLGLGIWML------IATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVD  658
            +VLG   WML           +ATLSPSG+NYEVVAL+AIK  L+DPYNVLENWD+NSVD
Sbjct  4    RVLGFPFWMLGLLLWAWPELPAATLSPSGINYEVVALMAIKMELNDPYNVLENWDINSVD  63

Query  659  PCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKL  838
            PCSWRMVTCS DGYVSALG+PSQSLSGTLS GIGNLTNLQSVLLQNN ISG IPA+I KL
Sbjct  64   PCSWRMVTCSADGYVSALGMPSQSLSGTLSRGIGNLTNLQSVLLQNNVISGPIPADITKL  123

Query  839  XRLXTLDLSNNKFNGDIPS  895
             +L TLDLSNN+F+G IPS
Sbjct  124  EKLQTLDLSNNQFDGGIPS  142



>ref|XP_008340072.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Malus 
domestica]
Length=628

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 117/141 (83%), Gaps = 2/141 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M R  F+L K LGL + + +A + SATLSP+GVNYEV AL AIK+ L DP+NVLENWD N
Sbjct  8    MGRSNFMLCK-LGL-LVLALAEASSATLSPTGVNYEVEALAAIKSDLIDPHNVLENWDSN  65

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTC+PDGYVSALGLPSQSLSG LSP IGNL+NLQSVLLQNNAISG IP  I
Sbjct  66   SVDPCSWRMVTCTPDGYVSALGLPSQSLSGILSPAIGNLSNLQSVLLQNNAISGPIPTSI  125

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            G L +L TLDLSNN FNGDIP
Sbjct  126  GNLVKLQTLDLSNNNFNGDIP  146



>ref|XP_009800027.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Nicotiana sylvestris]
Length=626

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 118/142 (83%), Gaps = 2/142 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME +W +L+ V GL +  L+ +S  A+LSP+G+NYEVVAL  IK  LHDPYNVLENWDV 
Sbjct  1    MEGKWCMLWYV-GLLVLTLMESSY-ASLSPTGINYEVVALTEIKKALHDPYNVLENWDVT  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTCS DGYVSALGLPSQSLSGTLSPGIGNLT LQSVLLQNNAISG IP  I
Sbjct  59   SVDPCSWRMVTCSLDGYVSALGLPSQSLSGTLSPGIGNLTKLQSVLLQNNAISGPIPDVI  118

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            G L +L TLDLSNNKF G++P+
Sbjct  119  GNLEKLQTLDLSNNKFEGEMPA  140



>ref|XP_008340070.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Malus 
domestica]
Length=630

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 117/141 (83%), Gaps = 2/141 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M R  F+L K LGL + + +A + SATLSP+GVNYEV AL AIK+ L DP+NVLENWD N
Sbjct  8    MGRSNFMLCK-LGL-LVLALAEASSATLSPTGVNYEVEALAAIKSDLIDPHNVLENWDSN  65

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTC+PDGYVSALGLPSQSLSG LSP IGNL+NLQSVLLQNNAISG IP  I
Sbjct  66   SVDPCSWRMVTCTPDGYVSALGLPSQSLSGILSPAIGNLSNLQSVLLQNNAISGPIPTSI  125

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            G L +L TLDLSNN FNGDIP
Sbjct  126  GNLVKLQTLDLSNNNFNGDIP  146



>ref|XP_008340071.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Malus 
domestica]
Length=629

 Score =   202 bits (514),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 117/141 (83%), Gaps = 2/141 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M R  F+L K LGL + + +A + SATLSP+GVNYEV AL AIK+ L DP+NVLENWD N
Sbjct  8    MGRSNFMLCK-LGL-LVLALAEASSATLSPTGVNYEVEALAAIKSDLIDPHNVLENWDSN  65

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTC+PDGYVSALGLPSQSLSG LSP IGNL+NLQSVLLQNNAISG IP  I
Sbjct  66   SVDPCSWRMVTCTPDGYVSALGLPSQSLSGILSPAIGNLSNLQSVLLQNNAISGPIPTSI  125

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            G L +L TLDLSNN FNGDIP
Sbjct  126  GNLVKLQTLDLSNNNFNGDIP  146



>gb|ACM89541.1| leucine-rich repeat receptor-like kinase [Glycine max]
Length=515

 Score =   200 bits (508),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SA LSPSG+NYEVVAL+AIK  L DP+NVLENWD+NSVDPCSWRM+TCSPDG VSALGLP
Sbjct  5    SAALSPSGINYEVVALMAIKNDLIDPHNVLENWDINSVDPCSWRMITCSPDGSVSALGLP  64

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ+LSGTLSPGIGNLTNLQSVLLQNNAISG IPA IG L +L TLDLSNN F+G+IPS
Sbjct  65   SQNLSGTLSPGIGNLTNLQSVLLQNNAISGRIPAAIGSLEKLQTLDLSNNTFSGEIPS  122



>gb|KHN14560.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=623

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SA LSPSG+NYEVVAL+AIK GL DP+NVLENWD+NSVDPCSWRM+TCSPDG VS LGLP
Sbjct  23   SAALSPSGINYEVVALMAIKNGLIDPHNVLENWDINSVDPCSWRMITCSPDGSVSVLGLP  82

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ+LSGTLSPGIGNLTNLQSVLLQNNAISG IPA IG L +L TLDLSNN F+G+IPS
Sbjct  83   SQNLSGTLSPGIGNLTNLQSVLLQNNAISGRIPAAIGSLEKLQTLDLSNNAFSGEIPS  140



>gb|KHN00370.1| Protein NSP-INTERACTING KINASE 3 [Glycine soja]
Length=624

 Score =   201 bits (511),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SA LSPSG+NYEVVAL+AIK  L DP+NVLENWD+NSVDPCSWRM+TCSPDG VSALGLP
Sbjct  24   SAALSPSGINYEVVALMAIKNDLIDPHNVLENWDINSVDPCSWRMITCSPDGSVSALGLP  83

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ+LSGTLSPGIGNLTNLQSVLLQNNAISG IPA IG L +L TLDLSNN F+G+IPS
Sbjct  84   SQNLSGTLSPGIGNLTNLQSVLLQNNAISGRIPAAIGSLEKLQTLDLSNNTFSGEIPS  141



>emb|CAN75190.1| hypothetical protein VITISV_035381 [Vitis vinifera]
Length=608

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SATLSPSG+NYEVVAL+ IK  L+DPYNVLENWD+NSVDPCSWRMVTCS DGYVSALGLP
Sbjct  5    SATLSPSGINYEVVALMTIKNNLNDPYNVLENWDINSVDPCSWRMVTCSSDGYVSALGLP  64

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQSLSGTLSP IGNLTNLQSVLLQNNAISG IP  IGKL +L TLDLS+NKF+G IPS
Sbjct  65   SQSLSGTLSPWIGNLTNLQSVLLQNNAISGPIPDSIGKLEKLETLDLSHNKFDGGIPS  122



>ref|XP_003519642.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform 1 [Glycine 
max]
Length=624

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SA LSPSG+NYEVVAL+AIK  L DP+NVLENWD+NSVDPCSWRM+TCSPDG VSALGLP
Sbjct  24   SAALSPSGINYEVVALMAIKNDLIDPHNVLENWDINSVDPCSWRMITCSPDGSVSALGLP  83

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ+LSGTLSPGIGNLTNLQSVLLQNNAISG IPA IG L +L TLDLSNN F+G+IPS
Sbjct  84   SQNLSGTLSPGIGNLTNLQSVLLQNNAISGRIPAAIGSLEKLQTLDLSNNTFSGEIPS  141



>ref|XP_010023506.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Eucalyptus grandis]
 gb|KCW59799.1| hypothetical protein EUGRSUZ_H02547 [Eucalyptus grandis]
Length=621

 Score =   201 bits (510),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            SCSA+LSP+GVNYEV+AL+AIKT LHDPYNVLE WDV SVDPCSWRMVTC+ DG+VS+LG
Sbjct  16   SCSASLSPAGVNYEVMALMAIKTALHDPYNVLEGWDVTSVDPCSWRMVTCTGDGFVSSLG  75

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSLSGTLSP IGNLTNLQSVLLQNN ISG +PA IG L +L TLDLSNN FNG+IPS
Sbjct  76   LPSQSLSGTLSPEIGNLTNLQSVLLQNNLISGPMPATIGNLQKLQTLDLSNNTFNGEIPS  135



>ref|XP_010651607.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Vitis vinifera]
 emb|CBI28568.3| unnamed protein product [Vitis vinifera]
Length=626

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SATLSPSG+NYEVVAL+ IK  L+DPYNVLENWD+NSVDPCSWRMVTCS DGYVSALGLP
Sbjct  23   SATLSPSGINYEVVALMTIKNNLNDPYNVLENWDINSVDPCSWRMVTCSSDGYVSALGLP  82

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQSLSGTLSP IGNLTNLQSVLLQNNAISG IP  IGKL +L TLDLS+NKF+G IPS
Sbjct  83   SQSLSGTLSPWIGNLTNLQSVLLQNNAISGPIPDSIGKLEKLETLDLSHNKFDGGIPS  140



>ref|XP_003517653.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Glycine max]
Length=623

 Score =   201 bits (510),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SA LSPSG+NYEVVAL+AIK GL DP+NVLENWD+NSVDPCSWRM+TCSPDG VS LGLP
Sbjct  23   SAALSPSGINYEVVALMAIKNGLIDPHNVLENWDINSVDPCSWRMITCSPDGSVSVLGLP  82

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ+LSGTLSPGIGNLTNLQSVLLQNNAISG IPA IG L +L TLD+SNN F+G+IPS
Sbjct  83   SQNLSGTLSPGIGNLTNLQSVLLQNNAISGRIPAAIGSLEKLQTLDISNNAFSGEIPS  140



>dbj|BAD68256.1| putative brassinosteroid insensitive 1-associated receptor kinase 
1 [Oryza sativa Japonica Group]
Length=418

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S +ATLSP+G+NYEVVAL+AIKT L DPYNVL+NWD+NSVDPCSWRMVTCS DGYVSALG
Sbjct  21   SSTATLSPAGINYEVVALMAIKTELQDPYNVLDNWDINSVDPCSWRMVTCSADGYVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSLSG LSPGIGNLT LQSVLLQNNAISG IPA IG+L  L TLD+S+N+  G IPS
Sbjct  81   LPSQSLSGKLSPGIGNLTRLQSVLLQNNAISGTIPASIGRLGMLQTLDMSDNQITGSIPS  140



>ref|XP_003613191.1| Leucine-rich repeat receptor-like kinase [Medicago truncatula]
 gb|ADO15296.1| somatic embryogenesis receptor kinase-like protein 2 [Medicago 
truncatula]
 gb|AES96149.1| LRR receptor-like kinase [Medicago truncatula]
Length=625

 Score =   199 bits (506),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SA LSPSG+NYEVVAL+AIK  L+DP+NVLENWD+N VDPCSWRM+TC+PDG VSALG P
Sbjct  23   SAALSPSGINYEVVALMAIKNDLNDPHNVLENWDINYVDPCSWRMITCTPDGSVSALGFP  82

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ+LSGTLSP IGNLTNLQSVLLQNNAISGHIPA IG L +L TLDLSNN+F+G+IPS
Sbjct  83   SQNLSGTLSPRIGNLTNLQSVLLQNNAISGHIPAAIGSLEKLQTLDLSNNEFSGEIPS  140



>ref|XP_006380012.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
 gb|ERP57809.1| hypothetical protein POPTR_0008s19310g [Populus trichocarpa]
Length=622

 Score =   199 bits (506),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SATLSP+G+N+E  AL+AIKT L DPYNVLENWD+NSVDPCSWRMVTCSPDGYVSALGLP
Sbjct  24   SATLSPTGINFE--ALVAIKTALLDPYNVLENWDINSVDPCSWRMVTCSPDGYVSALGLP  81

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQSLSGTLSP IGNLTNLQSVLLQNNAISG IP  IGKL +L TLDLSNN F+GD+P+
Sbjct  82   SQSLSGTLSPSIGNLTNLQSVLLQNNAISGPIPVAIGKLEKLQTLDLSNNTFSGDMPT  139



>ref|XP_002312685.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE90052.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=625

 Score =   199 bits (505),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 107/118 (91%), Gaps = 2/118 (2%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SATLSP+G+N+E  AL+AIKT L DPYNVLENWD+NSVDPCSWRMVTCSPDGYVSALGLP
Sbjct  24   SATLSPTGINFE--ALVAIKTALLDPYNVLENWDINSVDPCSWRMVTCSPDGYVSALGLP  81

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQSLSGTLSP IGNLTNLQSVLLQNNAISG IP  IGKL +L TLDLSNN F+GD+P+
Sbjct  82   SQSLSGTLSPSIGNLTNLQSVLLQNNAISGPIPVAIGKLEKLQTLDLSNNTFSGDMPT  139



>ref|XP_010682518.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Beta vulgaris subsp. 
vulgaris]
Length=621

 Score =   198 bits (504),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 111/135 (82%), Gaps = 1/135 (1%)
 Frame = +2

Query  491  LFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSW  670
                +GL  ++L+  + SATLSP+GVNYEVVAL+AIK  L DPY+ LENWD+NSVDPCSW
Sbjct  4    FLTTVGLLFFILVGAA-SATLSPTGVNYEVVALMAIKNELKDPYDALENWDINSVDPCSW  62

Query  671  RMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLX  850
            RM+TCS DGYVSALGLPSQS+SG LSP I NLT L+SVLLQNNAISGHIP EIGKL  L 
Sbjct  63   RMITCSSDGYVSALGLPSQSVSGMLSPAIQNLTKLESVLLQNNAISGHIPVEIGKLEMLQ  122

Query  851  TLDLSNNKFNGDIPS  895
            TLDLSNN F G+IPS
Sbjct  123  TLDLSNNGFTGEIPS  137



>emb|CDP13189.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME +W +L KV+ L +++L+ +S SA+LSP+G+NYEVVAL+AIK  L DPYNVLENWD N
Sbjct  1    MEMKWSVLGKVVLL-VFILVHSS-SASLSPTGINYEVVALMAIKNDLKDPYNVLENWDTN  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            +VDPCSW  VTCSPDG VSALGLPSQSL GTLS  IGNL+NL+SVLLQNNAI G IP+ +
Sbjct  59   AVDPCSWTRVTCSPDGSVSALGLPSQSLFGTLSSAIGNLSNLESVLLQNNAIYGPIPSAV  118

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL +L TLDLSNNKF+GDIPS
Sbjct  119  GKLVKLQTLDLSNNKFDGDIPS  140



>dbj|BAD68255.1| putative brassinosteroid insensitive 1-associated receptor kinase 
1 [Oryza sativa Japonica Group]
 dbj|BAE96298.1| SERK like protein kinase [Oryza sativa Japonica Group]
 gb|EAZ10713.1| hypothetical protein OsJ_00547 [Oryza sativa Japonica Group]
 dbj|BAG94399.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC70017.1| hypothetical protein OsI_00578 [Oryza sativa Indica Group]
Length=628

 Score =   197 bits (501),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S +ATLSP+G+NYEVVAL+AIKT L DPYNVL+NWD+NSVDPCSWRMVTCS DGYVSALG
Sbjct  21   SSTATLSPAGINYEVVALMAIKTELQDPYNVLDNWDINSVDPCSWRMVTCSADGYVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSLSG LSPGIGNLT LQSVLLQNNAISG IPA IG+L  L TLD+S+N+  G IPS
Sbjct  81   LPSQSLSGKLSPGIGNLTRLQSVLLQNNAISGTIPASIGRLGMLQTLDMSDNQITGSIPS  140



>ref|XP_006392114.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
 gb|ESQ29400.1| hypothetical protein EUTSA_v10023342mg [Eutrema salsugineum]
Length=634

 Score =   195 bits (496),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 114/138 (83%), Gaps = 6/138 (4%)
 Frame = +2

Query  482  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDP  661
            W L F VL   +W L  +S  ATLSP+GVNYEV AL+AIK  L+DPYNVLENWDVNSVDP
Sbjct  9    WRLGFLVL---VWFLDVSS--ATLSPTGVNYEVTALVAIKNELNDPYNVLENWDVNSVDP  63

Query  662  CSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLX  841
            CSWRMVTC+ DGYVSALGLPSQSLSGTLSP IGNLT LQSVLLQNNAISG IP  IG+L 
Sbjct  64   CSWRMVTCT-DGYVSALGLPSQSLSGTLSPRIGNLTYLQSVLLQNNAISGPIPDTIGRLE  122

Query  842  RLXTLDLSNNKFNGDIPS  895
            +L TLDLSNN F G+IP+
Sbjct  123  KLQTLDLSNNSFTGEIPA  140



>ref|XP_002455108.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
 gb|EES00228.1| hypothetical protein SORBIDRAFT_03g004450 [Sorghum bicolor]
Length=615

 Score =   195 bits (495),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = +2

Query  476  REWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSV  655
            R W   + V    +  +I    +ATLSP+G+NYEVVAL+AIKT L DPYNVL+NWD+NSV
Sbjct  7    RMWMRWWWVAVAALLAVILPPSNATLSPAGINYEVVALMAIKTELEDPYNVLDNWDINSV  66

Query  656  DPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGK  835
            DPCSWRMVTCS DGYVSALGLPSQSLSG LSPGIGNLT LQSVLLQNNAISG IP  IGK
Sbjct  67   DPCSWRMVTCSSDGYVSALGLPSQSLSGKLSPGIGNLTRLQSVLLQNNAISGPIPGTIGK  126

Query  836  LXRLXTLDLSNNKFNGDIPS  895
            L  L TLD+S+N+  G IPS
Sbjct  127  LGMLKTLDMSDNQLTGSIPS  146



>ref|XP_010533910.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Tarenaya hassleriana]
Length=640

 Score =   194 bits (494),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME   F+L++ LG  + +L+    +ATLSPSG+NYEVVAL+AIK+ L+DPYNVLENWDVN
Sbjct  1    MEGVRFVLWR-LGFLVLVLLLDVSAATLSPSGINYEVVALMAIKSELNDPYNVLENWDVN  59

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTCS  GYVS+LGLPSQSLSGTLSP IGNLTNLQSVLLQNNAISG IP  I
Sbjct  60   SVDPCSWRMVTCSY-GYVSSLGLPSQSLSGTLSPRIGNLTNLQSVLLQNNAISGPIPDTI  118

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            G+L +L TLDLSNN F G+IPS
Sbjct  119  GRLEKLQTLDLSNNLFTGEIPS  140



>ref|XP_004489819.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Cicer arietinum]
Length=625

 Score =   194 bits (492),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SA LSPSG+NYEVVAL+AIK  L+DP+NVLE+WD+NSVDPCSWRM+TC+PDG VSALGLP
Sbjct  23   SAALSPSGINYEVVALMAIKNELNDPHNVLESWDINSVDPCSWRMITCNPDGSVSALGLP  82

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ++SG+LSP IGNL+NLQSVLLQNNAISG IPA IG L +L TLDLSNN+F+GDIPS
Sbjct  83   SQNVSGSLSPRIGNLSNLQSVLLQNNAISGRIPAAIGNLEKLQTLDLSNNEFSGDIPS  140



>emb|CDY61461.1| BnaC01g43240D [Brassica napus]
Length=635

 Score =   194 bits (492),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = +2

Query  488  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCS  667
            L+F  LG  + +      +ATLSP+GVNYEV AL+AIK+ L+DPYNVLENWDVNSVDPCS
Sbjct  6    LVFWRLGFLVLVWFPDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDPCS  65

Query  668  WRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRL  847
            WRMVTC+ DGYVSALGLPSQSLSGTLSP IGNL+ LQSVLLQNNAISG IP  IG+L +L
Sbjct  66   WRMVTCT-DGYVSALGLPSQSLSGTLSPRIGNLSYLQSVLLQNNAISGPIPDTIGRLEKL  124

Query  848  XTLDLSNNKFNGDIPS  895
             TLDLSNN F G+IP+
Sbjct  125  QTLDLSNNSFTGEIPA  140



>ref|XP_004297396.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=629

 Score =   193 bits (491),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  521  MLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGY  700
            +++A + SATLSP+GVNYEV AL+AIK+ L DP+NVLENWD NSVDPCSWRMVTC+PDGY
Sbjct  19   LVLADASSATLSPTGVNYEVEALVAIKSDLIDPHNVLENWDSNSVDPCSWRMVTCTPDGY  78

Query  701  VSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFN  880
            VSALGLPSQ+LSG LSP IGNL+NLQSVLLQNNAISG IPA IG L +L TLDLSNN F 
Sbjct  79   VSALGLPSQNLSGILSPAIGNLSNLQSVLLQNNAISGPIPASIGNLEKLQTLDLSNNNFI  138

Query  881  GDIP  892
            G IP
Sbjct  139  GGIP  142



>ref|XP_011463143.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=626

 Score =   193 bits (491),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 108/124 (87%), Gaps = 0/124 (0%)
 Frame = +2

Query  521  MLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGY  700
            +++A + SATLSP+GVNYEV AL+AIK+ L DP+NVLENWD NSVDPCSWRMVTC+PDGY
Sbjct  19   LVLADASSATLSPTGVNYEVEALVAIKSDLIDPHNVLENWDSNSVDPCSWRMVTCTPDGY  78

Query  701  VSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFN  880
            VSALGLPSQ+LSG LSP IGNL+NLQSVLLQNNAISG IPA IG L +L TLDLSNN F 
Sbjct  79   VSALGLPSQNLSGILSPAIGNLSNLQSVLLQNNAISGPIPASIGNLEKLQTLDLSNNNFI  138

Query  881  GDIP  892
            G IP
Sbjct  139  GGIP  142



>ref|XP_004142972.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Cucumis 
sativus]
 gb|KGN62304.1| hypothetical protein Csa_2G348900 [Cucumis sativus]
Length=621

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +2

Query  539  CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGL  718
             SATLSPSGVN+EVVAL+AIK  L DP+NVLENWD NSVDPCSWRMVTCSPDGYVS LGL
Sbjct  21   ASATLSPSGVNFEVVALMAIKYDLLDPHNVLENWDSNSVDPCSWRMVTCSPDGYVSVLGL  80

Query  719  PSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            PSQSLSG LSPGIGNLT L+SVLLQNN ISG IPA IGKL  L TLDLSNN F+G IPS
Sbjct  81   PSQSLSGVLSPGIGNLTKLESVLLQNNDISGPIPATIGKLENLQTLDLSNNLFSGQIPS  139



>ref|XP_010248542.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Nelumbo 
nucifera]
Length=582

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = +2

Query  479  EWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVD  658
            E  L F  +GL +   I  S SATLSPSG+NYEV AL+ IKTGL DP+NVL+NWD  SVD
Sbjct  2    EGSLAFWGVGLLVLSWIEES-SATLSPSGINYEVEALVNIKTGLRDPHNVLDNWDSTSVD  60

Query  659  PCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKL  838
            PC WRM+TCSPDGYVS+LGL SQSLSGTLSPGIGNL+NL+SV LQNNA+SG IPAEIGKL
Sbjct  61   PCGWRMITCSPDGYVSSLGLASQSLSGTLSPGIGNLSNLKSVSLQNNALSGPIPAEIGKL  120

Query  839  XRLXTLDLSNNKFNGDIPS  895
             +L  LDLSNNKF+G IPS
Sbjct  121  EKLEQLDLSNNKFSGVIPS  139



>ref|XP_004968347.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Setaria italica]
Length=633

 Score =   193 bits (490),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +2

Query  512  GIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSP  691
            G+  +I    +ATLSP+G+NYEVVAL+AIKT L DP+NVL+NWD+NSVDPCSWRMVTCS 
Sbjct  18   GLLAVILPPSTATLSPAGINYEVVALMAIKTELEDPHNVLDNWDINSVDPCSWRMVTCSS  77

Query  692  DGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNN  871
            DGYVSALGLPSQSLSG LSPGIGNLT LQSVLLQNNAISG IP  IG+L  L TLD+S+N
Sbjct  78   DGYVSALGLPSQSLSGKLSPGIGNLTRLQSVLLQNNAISGSIPGTIGRLGMLKTLDMSDN  137

Query  872  KFNGDIPS  895
            +  G IPS
Sbjct  138  QLTGSIPS  145



>ref|XP_009104025.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brassica 
rapa]
Length=635

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +2

Query  488  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCS  667
            L+F  LG  + +      +ATLSP+GVNYEV AL+AIK+ L+DPYNVLENWDVNSVDPCS
Sbjct  6    LVFWRLGFLVLVWFHDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDPCS  65

Query  668  WRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRL  847
            WRMVTC+ DGYVS LGLPSQSLSGTLSP IGNLT LQSVLLQNNAISG IP  IG+L +L
Sbjct  66   WRMVTCT-DGYVSTLGLPSQSLSGTLSPRIGNLTYLQSVLLQNNAISGPIPDTIGRLEKL  124

Query  848  XTLDLSNNKFNGDIPS  895
             TLDLSNN F G+IP+
Sbjct  125  QTLDLSNNSFTGEIPT  140



>ref|XP_009104018.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brassica 
rapa]
Length=636

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +2

Query  488  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCS  667
            L+F  LG  + +      +ATLSP+GVNYEV AL+AIK+ L+DPYNVLENWDVNSVDPCS
Sbjct  6    LVFWRLGFLVLVWFHDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDPCS  65

Query  668  WRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRL  847
            WRMVTC+ DGYVS LGLPSQSLSGTLSP IGNLT LQSVLLQNNAISG IP  IG+L +L
Sbjct  66   WRMVTCT-DGYVSTLGLPSQSLSGTLSPRIGNLTYLQSVLLQNNAISGPIPDTIGRLEKL  124

Query  848  XTLDLSNNKFNGDIPS  895
             TLDLSNN F G+IP+
Sbjct  125  QTLDLSNNSFTGEIPT  140



>emb|CDY46185.1| BnaA01g23070D [Brassica napus]
Length=636

 Score =   192 bits (489),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +2

Query  488  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCS  667
            L+F  LG  + +      +ATLSP+GVNYEV AL+AIK+ L+DPYNVLENWDVNSVDPCS
Sbjct  6    LVFWRLGFLVLVWFHDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDPCS  65

Query  668  WRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRL  847
            WRMVTC+ DGYVS LGLPSQSLSGTLSP IGNLT LQSVLLQNNAISG IP  IG+L +L
Sbjct  66   WRMVTCT-DGYVSTLGLPSQSLSGTLSPRIGNLTYLQSVLLQNNAISGPIPDTIGRLEKL  124

Query  848  XTLDLSNNKFNGDIPS  895
             TLDLSNN F G+IP+
Sbjct  125  QTLDLSNNSFTGEIPA  140



>ref|XP_010248541.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Nelumbo 
nucifera]
Length=626

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 114/139 (82%), Gaps = 1/139 (1%)
 Frame = +2

Query  479  EWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVD  658
            E  L F  +GL +   I  S SATLSPSG+NYEV AL+ IKTGL DP+NVL+NWD  SVD
Sbjct  2    EGSLAFWGVGLLVLSWIEES-SATLSPSGINYEVEALVNIKTGLRDPHNVLDNWDSTSVD  60

Query  659  PCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKL  838
            PC WRM+TCSPDGYVS+LGL SQSLSGTLSPGIGNL+NL+SV LQNNA+SG IPAEIGKL
Sbjct  61   PCGWRMITCSPDGYVSSLGLASQSLSGTLSPGIGNLSNLKSVSLQNNALSGPIPAEIGKL  120

Query  839  XRLXTLDLSNNKFNGDIPS  895
             +L  LDLSNNKF+G IPS
Sbjct  121  EKLEQLDLSNNKFSGVIPS  139



>gb|AFO67891.1| leucine-rich repeat receptor-like kinase (mitochondrion) [Brassica 
rapa subsp. oleifera]
Length=635

 Score =   191 bits (486),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +2

Query  488  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCS  667
            L+F  LG  + +      +ATLSP+GVNYEV AL+AIK+ L+DPYNVLENWDVNSVDPCS
Sbjct  6    LVFWRLGFLVLVWFHDVTTATLSPTGVNYEVTALVAIKSELNDPYNVLENWDVNSVDPCS  65

Query  668  WRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRL  847
            WRMVTC+ DGYVS LGLPSQSLSGTLSP IGNL+ LQSVLLQNNAISG IP  IG+L +L
Sbjct  66   WRMVTCT-DGYVSTLGLPSQSLSGTLSPRIGNLSYLQSVLLQNNAISGPIPDTIGRLEKL  124

Query  848  XTLDLSNNKFNGDIPS  895
             TLDLSNN F G+IP+
Sbjct  125  QTLDLSNNSFTGEIPA  140



>ref|XP_007157369.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
 gb|ESW29363.1| hypothetical protein PHAVU_002G064400g [Phaseolus vulgaris]
Length=623

 Score =   191 bits (485),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SA LSPSG+NYEVVAL+AIK  L DP+NVLENWD +SVDPCSWRM+TCS DG VSALGLP
Sbjct  23   SAALSPSGINYEVVALMAIKGALTDPHNVLENWDSSSVDPCSWRMITCSSDGSVSALGLP  82

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ+LSGTLSPGIGNLTNLQSVLLQNN ISG IPA +G L +L TLDLSNN F+G+IPS
Sbjct  83   SQNLSGTLSPGIGNLTNLQSVLLQNNGISGKIPAALGNLEKLHTLDLSNNAFSGEIPS  140



>ref|XP_008654537.1| PREDICTED: uncharacterized LOC100272802 isoform X1 [Zea mays]
 gb|AFW80157.1| putative leucine-rich repeat receptor-like protein kinase family 
protein [Zea mays]
Length=630

 Score =   191 bits (484),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 104/123 (85%), Gaps = 0/123 (0%)
 Frame = +2

Query  527  IATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVS  706
            I  S  ATLSP+G+NYEVVAL+AIKT L DPYNVL+NWD+NSVDPCSWRMVTCS DGYVS
Sbjct  17   ILPSSDATLSPAGINYEVVALMAIKTELEDPYNVLDNWDINSVDPCSWRMVTCSSDGYVS  76

Query  707  ALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGD  886
            ALGLPSQ+LSG LSPGIGNLT LQSVLLQNN ISG IP  IG+L  L TLD+S+N+  G 
Sbjct  77   ALGLPSQTLSGKLSPGIGNLTRLQSVLLQNNGISGPIPGTIGRLGMLKTLDMSDNQLTGT  136

Query  887  IPS  895
            IPS
Sbjct  137  IPS  139



>ref|XP_010510907.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Camelina 
sativa]
Length=633

 Score =   191 bits (484),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 6/138 (4%)
 Frame = +2

Query  482  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDP  661
            W L F VL   +W+   ++  ATLSP+GVNYEV AL+A+K  L+DPYNVLENWDVNSVDP
Sbjct  11   WRLGFLVL---VWLFDVST--ATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDP  65

Query  662  CSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLX  841
            CSWRMV+C+ DGYVS LGLPSQSLSGTLSP IGNLT+LQSVLLQNNAI+G IP  IG+L 
Sbjct  66   CSWRMVSCT-DGYVSMLGLPSQSLSGTLSPRIGNLTHLQSVLLQNNAITGPIPETIGRLE  124

Query  842  RLXTLDLSNNKFNGDIPS  895
            +L TLDLSNN F G+IP+
Sbjct  125  KLQTLDLSNNSFTGEIPA  142



>ref|XP_010510906.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Camelina 
sativa]
Length=636

 Score =   191 bits (484),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 6/138 (4%)
 Frame = +2

Query  482  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDP  661
            W L F VL   +W+   ++  ATLSP+GVNYEV AL+A+K  L+DPYNVLENWDVNSVDP
Sbjct  11   WRLGFLVL---VWLFDVST--ATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDP  65

Query  662  CSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLX  841
            CSWRMV+C+ DGYVS LGLPSQSLSGTLSP IGNLT+LQSVLLQNNAI+G IP  IG+L 
Sbjct  66   CSWRMVSCT-DGYVSMLGLPSQSLSGTLSPRIGNLTHLQSVLLQNNAITGPIPETIGRLE  124

Query  842  RLXTLDLSNNKFNGDIPS  895
            +L TLDLSNN F G+IP+
Sbjct  125  KLQTLDLSNNSFTGEIPA  142



>ref|XP_008221850.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Prunus 
mume]
Length=656

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = +2

Query  485  FLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPC  664
            F+L+KV GL +   I  S SATLSP+GVNYEV AL+AIK+ L DP+NVLENWD NSVDPC
Sbjct  36   FMLWKV-GLLLLASIEAS-SATLSPTGVNYEVEALVAIKSDLIDPHNVLENWDSNSVDPC  93

Query  665  SWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXR  844
            SWRMVTC+ DGYVSALGLPSQSLSG LSP IGNL+NLQSVLLQNN I+G IPA IG L +
Sbjct  94   SWRMVTCTADGYVSALGLPSQSLSGILSPAIGNLSNLQSVLLQNNGIAGPIPATIGNLEK  153

Query  845  LXTLDLSNNKFNGDIP  892
            L TLDLSNN F G++P
Sbjct  154  LQTLDLSNNFFTGEVP  169



>ref|XP_008221852.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Prunus 
mume]
Length=655

 Score =   191 bits (484),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = +2

Query  485  FLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPC  664
            F+L+KV GL +   I  S SATLSP+GVNYEV AL+AIK+ L DP+NVLENWD NSVDPC
Sbjct  36   FMLWKV-GLLLLASIEAS-SATLSPTGVNYEVEALVAIKSDLIDPHNVLENWDSNSVDPC  93

Query  665  SWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXR  844
            SWRMVTC+ DGYVSALGLPSQSLSG LSP IGNL+NLQSVLLQNN I+G IPA IG L +
Sbjct  94   SWRMVTCTADGYVSALGLPSQSLSGILSPAIGNLSNLQSVLLQNNGIAGPIPATIGNLEK  153

Query  845  LXTLDLSNNKFNGDIP  892
            L TLDLSNN F G++P
Sbjct  154  LQTLDLSNNFFTGEVP  169



>ref|XP_008444352.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Cucumis 
melo]
Length=621

 Score =   190 bits (482),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/116 (83%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +2

Query  548  TLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQ  727
            TLSPSGVN+EVVAL+AIK  L DP+NVLENWD NSVDPCSWRMVTCSPDGYVS LGLPSQ
Sbjct  24   TLSPSGVNFEVVALMAIKYDLLDPHNVLENWDSNSVDPCSWRMVTCSPDGYVSVLGLPSQ  83

Query  728  SLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SLSG LSPGIGNLT L+SVLLQNN ISG IPA IGKL  L TLDLSNN F+G IPS
Sbjct  84   SLSGVLSPGIGNLTKLESVLLQNNDISGPIPATIGKLENLQTLDLSNNVFSGQIPS  139



>dbj|BAK02609.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=632

 Score =   190 bits (482),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +2

Query  512  GIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSP  691
            G+  L+    +ATLSP+G+NYEVVAL+AIKT L D YNVL+NWD+NSVDPCSWRMVTCS 
Sbjct  16   GVLCLLLPPAAATLSPTGINYEVVALMAIKTDLQDHYNVLDNWDINSVDPCSWRMVTCSS  75

Query  692  DGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNN  871
            DGYVSALGLPSQ LSG LSPGIGNLT LQSVLLQNNAISG IP+ IG+L  L TLD+S+N
Sbjct  76   DGYVSALGLPSQRLSGKLSPGIGNLTRLQSVLLQNNAISGTIPSTIGRLGMLQTLDMSDN  135

Query  872  KFNGDIPS  895
               G IP+
Sbjct  136  HLTGSIPT  143



>ref|NP_001169689.1| LOC100383570 precursor [Zea mays]
 gb|ACN34528.1| unknown [Zea mays]
 tpg|DAA53256.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=634

 Score =   189 bits (481),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +2

Query  545  ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPS  724
            ATLSP+G+NYEVVAL+AIKT L DPYNVL+NWD+NSVDPCSWRMVTCS DGYVSALGLPS
Sbjct  30   ATLSPAGINYEVVALMAIKTELEDPYNVLDNWDINSVDPCSWRMVTCSSDGYVSALGLPS  89

Query  725  QSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            QSLSG LSPGIGNLT LQSVLLQNN ISG IP+ IG+L  L TLD+S+N+  G IP
Sbjct  90   QSLSGKLSPGIGNLTRLQSVLLQNNVISGPIPSTIGRLGMLKTLDMSDNQLTGSIP  145



>ref|XP_006841062.1| PREDICTED: protein NSP-INTERACTING KINASE 3 [Amborella trichopoda]
 gb|ERN02737.1| hypothetical protein AMTR_s00085p00173590 [Amborella trichopoda]
Length=629

 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S  ATLSPSG+NYEVVAL+AIK  L DP+NVLENWD+NSVDPCSWRMVTCS DGYVS+LG
Sbjct  22   SSFATLSPSGINYEVVALMAIKNDLVDPHNVLENWDMNSVDPCSWRMVTCSADGYVSSLG  81

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            +PSQ+LSGTLSPGIGNL+NLQ+VLLQ+NAI G IP+EI +L +L  LDLSNN+F+G IPS
Sbjct  82   MPSQNLSGTLSPGIGNLSNLQNVLLQSNAIMGPIPSEIVRLQKLQALDLSNNRFSGAIPS  141



>ref|XP_010473259.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 105/118 (89%), Gaps = 1/118 (1%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SATLSP+GVNYEV AL+A+K  L+DPYNVLENWDVNSVDPCSWRMV+C+ DGYVS LGLP
Sbjct  26   SATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVSCT-DGYVSMLGLP  84

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQSLSGTLSP IGNLT+LQSVLLQNNAI+G IP  IG+L +L TLDLSNN F G+IP+
Sbjct  85   SQSLSGTLSPRIGNLTHLQSVLLQNNAITGPIPETIGRLEKLQTLDLSNNSFTGEIPA  142



>ref|XP_010473260.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 105/118 (89%), Gaps = 1/118 (1%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SATLSP+GVNYEV AL+A+K  L+DPYNVLENWDVNSVDPCSWRMV+C+ DGYVS LGLP
Sbjct  26   SATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVSCT-DGYVSMLGLP  84

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQSLSGTLSP IGNLT+LQSVLLQNNAI+G IP  IG+L +L TLDLSNN F G+IP+
Sbjct  85   SQSLSGTLSPRIGNLTHLQSVLLQNNAITGPIPETIGRLEKLQTLDLSNNSFTGEIPA  142



>ref|XP_002525400.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF37038.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=618

 Score =   188 bits (477),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 113/137 (82%), Gaps = 7/137 (5%)
 Frame = +2

Query  485  FLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPC  664
            F L++V GL +  L+  S SATLSP+     VVAL  IK+ LHDPYNVLE+WD NSVDPC
Sbjct  3    FWLWRV-GLLVLTLVEIS-SATLSPT-----VVALANIKSALHDPYNVLESWDANSVDPC  55

Query  665  SWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXR  844
            SWRMVTCSPDGYV+ALGLPSQSLSGTLS GIGNLTNLQSVLLQNNAISG IP  IG+L +
Sbjct  56   SWRMVTCSPDGYVTALGLPSQSLSGTLSSGIGNLTNLQSVLLQNNAISGPIPFAIGRLEK  115

Query  845  LXTLDLSNNKFNGDIPS  895
            L TLDLSNN F+GDIP+
Sbjct  116  LQTLDLSNNSFSGDIPA  132



>gb|KCW86694.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=479

 Score =   185 bits (470),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SVDPC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSL GTLSP IGNLTNL+SVLLQNN ISG IP+ +G L +L  LDLSNN F+G+IPS
Sbjct  81   LPSQSLHGTLSPAIGNLTNLESVLLQNNHISGPIPSSVGMLEKLQALDLSNNMFSGEIPS  140



>ref|XP_003569325.2| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Brachypodium 
distachyon]
Length=631

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            +ATLSP+G+NYEVVAL+AIKT L D YNVL+NWD+NSVDPCSWRMVTCS DGYVSALGLP
Sbjct  25   AATLSPAGINYEVVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSSDGYVSALGLP  84

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ LSG LSPGIGNLT LQSVLLQNNAISG IP  IG+L  L TLD+S+N   G IPS
Sbjct  85   SQRLSGKLSPGIGNLTRLQSVLLQNNAISGPIPGSIGRLGMLQTLDISDNLLTGSIPS  142



>ref|XP_010230511.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X4 [Brachypodium 
distachyon]
Length=601

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            +ATLSP+G+NYEVVAL+AIKT L D YNVL+NWD+NSVDPCSWRMVTCS DGYVSALGLP
Sbjct  25   AATLSPAGINYEVVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSSDGYVSALGLP  84

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ LSG LSPGIGNLT LQSVLLQNNAISG IP  IG+L  L TLD+S+N   G IPS
Sbjct  85   SQRLSGKLSPGIGNLTRLQSVLLQNNAISGPIPGSIGRLGMLQTLDISDNLLTGSIPS  142



>ref|XP_010230510.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X3 [Brachypodium 
distachyon]
Length=603

 Score =   186 bits (473),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            +ATLSP+G+NYEVVAL+AIKT L D YNVL+NWD+NSVDPCSWRMVTCS DGYVSALGLP
Sbjct  25   AATLSPAGINYEVVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSSDGYVSALGLP  84

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ LSG LSPGIGNLT LQSVLLQNNAISG IP  IG+L  L TLD+S+N   G IPS
Sbjct  85   SQRLSGKLSPGIGNLTRLQSVLLQNNAISGPIPGSIGRLGMLQTLDISDNLLTGSIPS  142



>ref|XP_010230509.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X1 [Brachypodium 
distachyon]
Length=633

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            +ATLSP+G+NYEVVAL+AIKT L D YNVL+NWD+NSVDPCSWRMVTCS DGYVSALGLP
Sbjct  25   AATLSPAGINYEVVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSSDGYVSALGLP  84

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ LSG LSPGIGNLT LQSVLLQNNAISG IP  IG+L  L TLD+S+N   G IPS
Sbjct  85   SQRLSGKLSPGIGNLTRLQSVLLQNNAISGPIPGSIGRLGMLQTLDISDNLLTGSIPS  142



>gb|KCW86687.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
 gb|KCW86688.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=622

 Score =   186 bits (473),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SVDPC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSL GTLSP IGNLTNL+SVLLQNN ISG IP+ +G L +L  LDLSNN F+G+IPS
Sbjct  81   LPSQSLHGTLSPAIGNLTNLESVLLQNNHISGPIPSSVGMLEKLQALDLSNNMFSGEIPS  140



>ref|XP_010044599.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X6 [Eucalyptus 
grandis]
Length=578

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SVDPC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSL GTLSP IGNLTNL+SVLLQNN ISG IP+ +G L +L  LDLSNN F+G+IPS
Sbjct  81   LPSQSLHGTLSPAIGNLTNLESVLLQNNHISGPIPSSVGMLEKLQALDLSNNMFSGEIPS  140



>ref|XP_010044598.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X5 [Eucalyptus 
grandis]
Length=624

 Score =   186 bits (472),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SVDPC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSL GTLSP IGNLTNL+SVLLQNN ISG IP+ +G L +L  LDLSNN F+G+IPS
Sbjct  81   LPSQSLHGTLSPAIGNLTNLESVLLQNNHISGPIPSSVGMLEKLQALDLSNNMFSGEIPS  140



>gb|KCW86689.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=598

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SVDPC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSL GTLSP IGNLTNL+SVLLQNN ISG IP+ +G L +L  LDLSNN F+G+IPS
Sbjct  81   LPSQSLHGTLSPAIGNLTNLESVLLQNNHISGPIPSSVGMLEKLQALDLSNNMFSGEIPS  140



>ref|XP_010044597.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X4 [Eucalyptus 
grandis]
Length=625

 Score =   186 bits (472),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SVDPC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSL GTLSP IGNLTNL+SVLLQNN ISG IP+ +G L +L  LDLSNN F+G+IPS
Sbjct  81   LPSQSLHGTLSPAIGNLTNLESVLLQNNHISGPIPSSVGMLEKLQALDLSNNMFSGEIPS  140



>ref|XP_010044596.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X3 [Eucalyptus 
grandis]
Length=626

 Score =   186 bits (472),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SVDPC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSL GTLSP IGNLTNL+SVLLQNN ISG IP+ +G L +L  LDLSNN F+G+IPS
Sbjct  81   LPSQSLHGTLSPAIGNLTNLESVLLQNNHISGPIPSSVGMLEKLQALDLSNNMFSGEIPS  140



>ref|XP_010044595.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Eucalyptus 
grandis]
Length=626

 Score =   186 bits (472),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SVDPC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSL GTLSP IGNLTNL+SVLLQNN ISG IP+ +G L +L  LDLSNN F+G+IPS
Sbjct  81   LPSQSLHGTLSPAIGNLTNLESVLLQNNHISGPIPSSVGMLEKLQALDLSNNMFSGEIPS  140



>ref|XP_010044594.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Eucalyptus 
grandis]
Length=627

 Score =   186 bits (472),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SVDPC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSL GTLSP IGNLTNL+SVLLQNN ISG IP+ +G L +L  LDLSNN F+G+IPS
Sbjct  81   LPSQSLHGTLSPAIGNLTNLESVLLQNNHISGPIPSSVGMLEKLQALDLSNNMFSGEIPS  140



>gb|KCW86693.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=623

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SVDPC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSL GTLSP IGNLTNL+SVLLQNN ISG IP+ +G L +L  LDLSNN F+G+IPS
Sbjct  81   LPSQSLHGTLSPAIGNLTNLESVLLQNNHISGPIPSSVGMLEKLQALDLSNNMFSGEIPS  140



>gb|KCW86692.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=623

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SVDPC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSL GTLSP IGNLTNL+SVLLQNN ISG IP+ +G L +L  LDLSNN F+G+IPS
Sbjct  81   LPSQSLHGTLSPAIGNLTNLESVLLQNNHISGPIPSSVGMLEKLQALDLSNNMFSGEIPS  140



>gb|KCW86690.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=622

 Score =   186 bits (471),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SVDPC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSL GTLSP IGNLTNL+SVLLQNN ISG IP+ +G L +L  LDLSNN F+G+IPS
Sbjct  81   LPSQSLHGTLSPAIGNLTNLESVLLQNNHISGPIPSSVGMLEKLQALDLSNNMFSGEIPS  140



>ref|XP_002886588.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62847.1| nsp-interacting kinase 3 [Arabidopsis lyrata subsp. lyrata]
Length=629

 Score =   186 bits (471),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 3/127 (2%)
 Frame = +2

Query  515  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPD  694
            +W+L  ++  ATLSP+GVNYEV AL+A+K  L+DPYNVLENWDVNSVDPCSWRMVTC+ D
Sbjct  12   VWLLDVST--ATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVTCT-D  68

Query  695  GYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNK  874
            GYVS L LPSQSLSGTLSP IGNLT L+SVLLQNNAI+G IP  IG+L +L TLDLSNN 
Sbjct  69   GYVSGLVLPSQSLSGTLSPRIGNLTYLESVLLQNNAITGPIPETIGRLEKLQTLDLSNNS  128

Query  875  FNGDIPS  895
            F G+IP+
Sbjct  129  FTGEIPA  135



>gb|KCW86691.1| hypothetical protein EUGRSUZ_B03306 [Eucalyptus grandis]
Length=625

 Score =   186 bits (471),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S SATLSPSG+NYEVVAL+ IK  L DPYNVLE+WD  SVDPC WRMVTC+PDG VSALG
Sbjct  21   SSSATLSPSGINYEVVALMTIKAALRDPYNVLESWDRTSVDPCGWRMVTCTPDGSVSALG  80

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LPSQSL GTLSP IGNLTNL+SVLLQNN ISG IP+ +G L +L  LDLSNN F+G+IPS
Sbjct  81   LPSQSLHGTLSPAIGNLTNLESVLLQNNHISGPIPSSVGMLEKLQALDLSNNMFSGEIPS  140



>ref|XP_010418025.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Camelina 
sativa]
Length=633

 Score =   185 bits (470),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            +ATLSP+GVNYEV AL+A+K  L+DPYNVLENWDVNSVDPCSWRMV+C+ DGYVS LGLP
Sbjct  26   TATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVSCT-DGYVSMLGLP  84

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQSLSGTLSP IGNLT+LQSVLLQNNAI+G IP  IG+L +L TLDLSNN F  +IP+
Sbjct  85   SQSLSGTLSPRIGNLTHLQSVLLQNNAITGPIPETIGRLEKLQTLDLSNNSFTREIPA  142



>ref|XP_010418023.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Camelina 
sativa]
Length=636

 Score =   186 bits (471),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 104/118 (88%), Gaps = 1/118 (1%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            +ATLSP+GVNYEV AL+A+K  L+DPYNVLENWDVNSVDPCSWRMV+C+ DGYVS LGLP
Sbjct  26   TATLSPTGVNYEVTALVAVKNELNDPYNVLENWDVNSVDPCSWRMVSCT-DGYVSMLGLP  84

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQSLSGTLSP IGNLT+LQSVLLQNNAI+G IP  IG+L +L TLDLSNN F  +IP+
Sbjct  85   SQSLSGTLSPRIGNLTHLQSVLLQNNAITGPIPETIGRLEKLQTLDLSNNSFTREIPA  142



>ref|NP_176279.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
 sp|Q93ZS4.1|NIK3_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 3; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK3; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL07143.1| putative receptor kinase [Arabidopsis thaliana]
 gb|AAN12912.1| putative receptor kinase [Arabidopsis thaliana]
 gb|ACN59261.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE33734.1| NSP-interacting kinase 3 [Arabidopsis thaliana]
Length=632

 Score =   184 bits (467),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 115/142 (81%), Gaps = 2/142 (1%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME   F++++ LG  +++      SATLSP+GVNYEV AL+A+K  L+DPY VLENWDVN
Sbjct  1    MEGVRFVVWR-LGFLVFVWFFDISSATLSPTGVNYEVTALVAVKNELNDPYKVLENWDVN  59

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMV+C+ DGYVS+L LPSQSLSGTLSP IGNLT LQSV+LQNNAI+G IP  I
Sbjct  60   SVDPCSWRMVSCT-DGYVSSLDLPSQSLSGTLSPRIGNLTYLQSVVLQNNAITGPIPETI  118

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            G+L +L +LDLSNN F G+IP+
Sbjct  119  GRLEKLQSLDLSNNSFTGEIPA  140



>ref|XP_010319667.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X2 [Solanum 
lycopersicum]
Length=575

 Score =   181 bits (459),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 107/142 (75%), Gaps = 6/142 (4%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            MER+W +   V+ L        SC A+LSP+G+NYEVVALI IK  LHDPYNVLENWDV 
Sbjct  1    MERKWCMFLYVVAL------MESCYASLSPTGINYEVVALIEIKKALHDPYNVLENWDVT  54

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSWRMVTCS DGYVS+LGLPSQSLSGTLSPGIGNLT L+S+ L NN+++G+IP  +
Sbjct  55   SVDPCSWRMVTCSNDGYVSSLGLPSQSLSGTLSPGIGNLTKLESIRLNNNSLTGNIPQSL  114

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
              +  L  +D+S N  +G +P 
Sbjct  115  SNIGGLALVDVSFNNLSGPLPK  136



>ref|XP_006301740.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
 gb|EOA34638.1| hypothetical protein CARUB_v10022201mg [Capsella rubella]
Length=634

 Score =   181 bits (458),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 109/138 (79%), Gaps = 7/138 (5%)
 Frame = +2

Query  494  FKVLGLG----IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDP  661
            F V  LG    +W L  +S  ATLSP+GVNYEV AL+A+K  L+DP NVL NWDVNSVDP
Sbjct  6    FVVCRLGFLVLVWFLDVSS--ATLSPTGVNYEVTALVAVKNELNDPDNVLANWDVNSVDP  63

Query  662  CSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLX  841
            CSWRMVTC+ DGYVSALGLPSQSLSG LSP IGNLT LQSV LQNNAI+G IP  IG+L 
Sbjct  64   CSWRMVTCT-DGYVSALGLPSQSLSGKLSPRIGNLTYLQSVWLQNNAITGPIPETIGRLE  122

Query  842  RLXTLDLSNNKFNGDIPS  895
            +L TLDLSNN F G+IP+
Sbjct  123  KLQTLDLSNNLFTGEIPA  140



>gb|EPS73511.1| hypothetical protein M569_01245, partial [Genlisea aurea]
Length=636

 Score =   177 bits (449),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +2

Query  545  ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPS  724
            +TLSPSGVNYEVVALI+IK  L+DPYN LE+WDVNSVDPCSWR VTCSPDG+VSALGL S
Sbjct  1    STLSPSGVNYEVVALISIKGSLNDPYNALESWDVNSVDPCSWRTVTCSPDGFVSALGLTS  60

Query  725  QSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
             SLSGT+S GI NLTN+QS++LQNN ISG IP  +GKL +L TLDLS+N F+G IP
Sbjct  61   LSLSGTISTGIENLTNVQSIVLQNNEISGQIPDVVGKLEKLQTLDLSSNSFSGRIP  116



>gb|KDO70179.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=400

 Score =   173 bits (439),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 102/142 (72%), Gaps = 5/142 (4%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M RE  +   V   G+W    T     LSP GVNYEV AL+ IK  LHDP++VL NWD N
Sbjct  1    MRREEAVFCFVALFGLW----TCACGLLSPKGVNYEVQALMGIKDSLHDPHDVLNNWDEN  56

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSW +VTCS DG V+ LG PSQ+LSGTLS  IGNLTNLQ VLLQNN ISGHIP EI
Sbjct  57   SVDPCSWALVTCS-DGLVTGLGAPSQNLSGTLSSSIGNLTNLQLVLLQNNNISGHIPTEI  115

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL +L TLDLSNN F G IPS
Sbjct  116  GKLSKLLTLDLSNNFFTGPIPS  137



>ref|XP_010558545.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010558546.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Tarenaya 
hassleriana]
Length=637

 Score =   177 bits (448),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = +2

Query  494  FKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWR  673
            F V   G  +L+  S +A LSP GVN+EV AL+ IK  LHDP+ VLE+WD ++VDPCSW 
Sbjct  14   FPVCFFGFLLLLG-SANALLSPQGVNFEVQALMDIKASLHDPHGVLESWDRDAVDPCSWT  72

Query  674  MVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXT  853
            MVTCS D +V +LG PSQSLSGTLSPGIGNLTNLQ VLLQNN ISG +PAE+G+L +L T
Sbjct  73   MVTCSSDNFVISLGTPSQSLSGTLSPGIGNLTNLQIVLLQNNNISGTLPAELGRLAKLQT  132

Query  854  LDLSNNKFNGDIPS  895
            LDLS+N F+G+IPS
Sbjct  133  LDLSSNFFHGEIPS  146



>ref|XP_010558548.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Tarenaya 
hassleriana]
Length=636

 Score =   176 bits (447),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 88/134 (66%), Positives = 106/134 (79%), Gaps = 1/134 (1%)
 Frame = +2

Query  494  FKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWR  673
            F V   G  +L+  S +A LSP GVN+EV AL+ IK  LHDP+ VLE+WD ++VDPCSW 
Sbjct  14   FPVCFFGFLLLLG-SANALLSPQGVNFEVQALMDIKASLHDPHGVLESWDRDAVDPCSWT  72

Query  674  MVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXT  853
            MVTCS D +V +LG PSQSLSGTLSPGIGNLTNLQ VLLQNN ISG +PAE+G+L +L T
Sbjct  73   MVTCSSDNFVISLGTPSQSLSGTLSPGIGNLTNLQIVLLQNNNISGTLPAELGRLAKLQT  132

Query  854  LDLSNNKFNGDIPS  895
            LDLS+N F+G+IPS
Sbjct  133  LDLSSNFFHGEIPS  146



>ref|XP_010929457.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score =   176 bits (445),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  518  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDG  697
            + L   S +A LSP GVN+EV AL+ IK  L DP+NVLENWD +SVDPCSW MVTCSP  
Sbjct  15   FFLSWASATAILSPKGVNFEVQALMGIKAFLKDPHNVLENWDKDSVDPCSWTMVTCSPQN  74

Query  698  YVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKF  877
             V+ LG PSQ+LSGTLSP IGNLTNL+ VLLQNN ISG +PAEIGKL RL TLDLSNN F
Sbjct  75   LVTGLGTPSQNLSGTLSPSIGNLTNLEIVLLQNNNISGPLPAEIGKLSRLRTLDLSNNYF  134

Query  878  NGDIPS  895
            +G+IPS
Sbjct  135  SGEIPS  140



>gb|KDO70178.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=517

 Score =   174 bits (440),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 102/142 (72%), Gaps = 5/142 (4%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M RE  +   V   G+W    T     LSP GVNYEV AL+ IK  LHDP++VL NWD N
Sbjct  1    MRREEAVFCFVALFGLW----TCACGLLSPKGVNYEVQALMGIKDSLHDPHDVLNNWDEN  56

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSW +VTCS DG V+ LG PSQ+LSGTLS  IGNLTNLQ VLLQNN ISGHIP EI
Sbjct  57   SVDPCSWALVTCS-DGLVTGLGAPSQNLSGTLSSSIGNLTNLQLVLLQNNNISGHIPTEI  115

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL +L TLDLSNN F G IPS
Sbjct  116  GKLSKLLTLDLSNNFFTGPIPS  137



>ref|XP_006430876.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
 gb|ESR44116.1| hypothetical protein CICLE_v10011302mg [Citrus clementina]
Length=622

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 104/140 (74%), Gaps = 4/140 (3%)
 Frame = +2

Query  476  REWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSV  655
            RE F +  V  L  W    T+ +  LS  GVNYEV AL+ +K  LHDP+ VLENWD ++V
Sbjct  4    REVFAICFVAFLCFW----TTANGLLSAKGVNYEVQALMGVKHSLHDPHGVLENWDEDAV  59

Query  656  DPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGK  835
            DPCSW MVTCSP+  V  LG+PSQ+LSGTLSP IGNLTNLQ VLLQNN I+G IPAEIG+
Sbjct  60   DPCSWTMVTCSPESLVIGLGIPSQNLSGTLSPSIGNLTNLQIVLLQNNNITGPIPAEIGR  119

Query  836  LXRLXTLDLSNNKFNGDIPS  895
            L +L TLDLSNN F G+IPS
Sbjct  120  LTKLQTLDLSNNFFTGEIPS  139



>gb|KDO58880.1| hypothetical protein CISIN_1g036225mg [Citrus sinensis]
Length=622

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 104/140 (74%), Gaps = 4/140 (3%)
 Frame = +2

Query  476  REWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSV  655
            RE F +  V  L  W    T+ +  LS  GVNYEV AL+ +K  LHDP+ VLENWD ++V
Sbjct  4    REVFAICFVAFLCFW----TTANGLLSAKGVNYEVQALMGVKHSLHDPHGVLENWDEDAV  59

Query  656  DPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGK  835
            DPCSW MVTCSP+  V  LG+PSQ+LSGTLSP IGNLTNLQ VLLQNN I+G IPAEIG+
Sbjct  60   DPCSWTMVTCSPESLVIGLGIPSQNLSGTLSPSIGNLTNLQIVLLQNNNITGPIPAEIGR  119

Query  836  LXRLXTLDLSNNKFNGDIPS  895
            L +L TLDLSNN F G+IPS
Sbjct  120  LTKLQTLDLSNNFFTGEIPS  139



>ref|XP_006482337.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Citrus sinensis]
Length=622

 Score =   174 bits (442),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 89/140 (64%), Positives = 104/140 (74%), Gaps = 4/140 (3%)
 Frame = +2

Query  476  REWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSV  655
            RE F +  V  L  W    T+ +  LS  GVNYEV AL+ +K  LHDP+ VLENWD ++V
Sbjct  4    REVFAICFVAFLCFW----TTANGLLSAKGVNYEVQALMGVKHSLHDPHGVLENWDEDAV  59

Query  656  DPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGK  835
            DPCSW MVTCSP+  V  LG+PSQ+LSGTLSP IGNLTNLQ VLLQNN I+G IPAEIG+
Sbjct  60   DPCSWTMVTCSPESLVIGLGIPSQNLSGTLSPSIGNLTNLQIVLLQNNNITGPIPAEIGR  119

Query  836  LXRLXTLDLSNNKFNGDIPS  895
            L +L TLDLSNN F G+IPS
Sbjct  120  LTKLQTLDLSNNFFTGEIPS  139



>ref|XP_006437790.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
 gb|ESR51030.1| hypothetical protein CICLE_v10030970mg [Citrus clementina]
Length=621

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 102/142 (72%), Gaps = 5/142 (4%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M RE  +   V   G+W    T     LSP GVNYEV AL+ IK  LHDP++VL NWD N
Sbjct  1    MRREEAVFCFVALFGLW----TCACGLLSPKGVNYEVQALMGIKDSLHDPHDVLNNWDEN  56

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSW +VTCS DG V+ LG PSQ+LSGTLS  IGNLTNLQ VLLQNN ISGHIP EI
Sbjct  57   SVDPCSWALVTCS-DGLVTGLGAPSQNLSGTLSSSIGNLTNLQLVLLQNNNISGHIPTEI  115

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL +L TLDLSNN F G IPS
Sbjct  116  GKLSKLLTLDLSNNFFTGPIPS  137



>ref|XP_006484307.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Citrus sinensis]
 gb|KDO70177.1| hypothetical protein CISIN_1g007025mg [Citrus sinensis]
Length=621

 Score =   174 bits (441),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 102/142 (72%), Gaps = 5/142 (4%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M RE  +   V   G+W    T     LSP GVNYEV AL+ IK  LHDP++VL NWD N
Sbjct  1    MRREEAVFCFVALFGLW----TCACGLLSPKGVNYEVQALMGIKDSLHDPHDVLNNWDEN  56

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSW +VTCS DG V+ LG PSQ+LSGTLS  IGNLTNLQ VLLQNN ISGHIP EI
Sbjct  57   SVDPCSWALVTCS-DGLVTGLGAPSQNLSGTLSSSIGNLTNLQLVLLQNNNISGHIPTEI  115

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL +L TLDLSNN F G IPS
Sbjct  116  GKLSKLLTLDLSNNFFTGPIPS  137



>ref|XP_010528022.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Tarenaya hassleriana]
Length=637

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  515  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPD  694
             + L+  S SA L+  GVNYEV+AL+ IK  L DP+ VL+NWD  +VDPCSW MV+CSPD
Sbjct  21   FFFLLLGSSSAELTDKGVNYEVLALMGIKNSLVDPHEVLKNWDETAVDPCSWNMVSCSPD  80

Query  695  GYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNK  874
            G V  LG PSQ+LSGTL+P IGNLTNLQ+VLLQNN ISGHIP+EIG+L +L TLDLS+N 
Sbjct  81   GLVITLGAPSQNLSGTLAPSIGNLTNLQTVLLQNNYISGHIPSEIGRLVKLKTLDLSSNN  140

Query  875  FNGDIP  892
            F G IP
Sbjct  141  FTGQIP  146



>ref|XP_008783060.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 101/132 (77%), Gaps = 3/132 (2%)
 Frame = +2

Query  509  LGIWMLIA---TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMV  679
            L  WM+      S +A LSP GVN+EV AL+ +K  L DP+NVLENWD +SVDPCSW MV
Sbjct  9    LVFWMVFFWSWASATAILSPKGVNFEVQALMGLKAFLKDPHNVLENWDKDSVDPCSWTMV  68

Query  680  TCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLD  859
            TCSP   V+ LG PSQ+LSG LSP IGNLTNL+ VLLQNN ISG +PAEIGKL +L TLD
Sbjct  69   TCSPQNLVTGLGTPSQNLSGRLSPSIGNLTNLEIVLLQNNNISGVLPAEIGKLSKLRTLD  128

Query  860  LSNNKFNGDIPS  895
            LSNN F+G+IPS
Sbjct  129  LSNNYFSGEIPS  140



>ref|XP_011649490.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Cucumis 
sativus]
Length=609

 Score =   172 bits (437),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 94/119 (79%), Gaps = 12/119 (10%)
 Frame = +2

Query  539  CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGL  718
             SATLSPSGVN+E            DP+NVLENWD NSVDPCSWRMVTCSPDGYVS LGL
Sbjct  21   ASATLSPSGVNFE------------DPHNVLENWDSNSVDPCSWRMVTCSPDGYVSVLGL  68

Query  719  PSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            PSQSLSG LSPGIGNLT L+SVLLQNN ISG IPA IGKL  L TLDLSNN F+G IPS
Sbjct  69   PSQSLSGVLSPGIGNLTKLESVLLQNNDISGPIPATIGKLENLQTLDLSNNLFSGQIPS  127



>ref|XP_002876917.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53176.1| nsp-interacting kinase 2 [Arabidopsis lyrata subsp. lyrata]
Length=636

 Score =   172 bits (437),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/120 (69%), Positives = 97/120 (81%), Gaps = 0/120 (0%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
            +S SA L+  GVN+EV+ALI IK+ L DP+ VL+NWD  +VDPCSW M+TCSPDG+V +L
Sbjct  28   SSSSAELTDKGVNFEVLALIGIKSSLVDPHGVLQNWDDTAVDPCSWNMITCSPDGFVLSL  87

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            G PSQSLSGTLS  IGNLTNLQ+VLLQNN I+GHIP EIGKL +L TLDLS N F G IP
Sbjct  88   GAPSQSLSGTLSSSIGNLTNLQTVLLQNNYITGHIPHEIGKLMKLKTLDLSTNNFTGQIP  147



>ref|XP_008807034.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Phoenix 
dactylifera]
Length=604

 Score =   172 bits (435),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +2

Query  503  LGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVT  682
            L L ++     S +  LSP GVN+EV AL+ IK  L DP++VLENWD +SVDPCSW MVT
Sbjct  10   LFLMVFFWTWASAAGLLSPKGVNFEVQALMGIKASLKDPHSVLENWDQDSVDPCSWTMVT  69

Query  683  CSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDL  862
            CSPD  V +LG PSQSLSGTLSP IGNLTNL++VLLQNN I G +PAEIGKL +L TLDL
Sbjct  70   CSPDNLVISLGSPSQSLSGTLSPSIGNLTNLETVLLQNNNILGSLPAEIGKLSKLKTLDL  129

Query  863  SNNKFNGDIPS  895
            SNN F G+IP+
Sbjct  130  SNNYFTGEIPT  140



>ref|XP_008807033.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Phoenix 
dactylifera]
Length=624

 Score =   171 bits (434),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +2

Query  503  LGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVT  682
            L L ++     S +  LSP GVN+EV AL+ IK  L DP++VLENWD +SVDPCSW MVT
Sbjct  10   LFLMVFFWTWASAAGLLSPKGVNFEVQALMGIKASLKDPHSVLENWDQDSVDPCSWTMVT  69

Query  683  CSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDL  862
            CSPD  V +LG PSQSLSGTLSP IGNLTNL++VLLQNN I G +PAEIGKL +L TLDL
Sbjct  70   CSPDNLVISLGSPSQSLSGTLSPSIGNLTNLETVLLQNNNILGSLPAEIGKLSKLKTLDL  129

Query  863  SNNKFNGDIPS  895
            SNN F G+IP+
Sbjct  130  SNNYFTGEIPT  140



>ref|XP_009391272.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=646

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 102/137 (74%), Gaps = 4/137 (3%)
 Frame = +2

Query  485  FLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPC  664
            + LF ++ L  W+    S +  LSP GVNYEV AL+ +K  L DP++VLENWD +SVDPC
Sbjct  29   YELFALVFLFSWV----SAAGVLSPKGVNYEVQALMGVKASLKDPHSVLENWDQDSVDPC  84

Query  665  SWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXR  844
            SW MVTCSP+  V  LG PSQ+LSGTLSP IGNLTNLQ +LLQNN ISG IP EI +L  
Sbjct  85   SWTMVTCSPENLVIGLGTPSQNLSGTLSPSIGNLTNLQIILLQNNNISGPIPQEIARLSN  144

Query  845  LXTLDLSNNKFNGDIPS  895
            L TLDLSNN FNG+IP+
Sbjct  145  LKTLDLSNNNFNGEIPT  161



>ref|XP_009391273.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score =   171 bits (432),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 102/137 (74%), Gaps = 4/137 (3%)
 Frame = +2

Query  485  FLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPC  664
            + LF ++ L  W+    S +  LSP GVNYEV AL+ +K  L DP++VLENWD +SVDPC
Sbjct  29   YELFALVFLFSWV----SAAGVLSPKGVNYEVQALMGVKASLKDPHSVLENWDQDSVDPC  84

Query  665  SWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXR  844
            SW MVTCSP+  V  LG PSQ+LSGTLSP IGNLTNLQ +LLQNN ISG IP EI +L  
Sbjct  85   SWTMVTCSPENLVIGLGTPSQNLSGTLSPSIGNLTNLQIILLQNNNISGPIPQEIARLSN  144

Query  845  LXTLDLSNNKFNGDIPS  895
            L TLDLSNN FNG+IP+
Sbjct  145  LKTLDLSNNNFNGEIPT  161



>ref|XP_002311408.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
 gb|EEE88775.2| hypothetical protein POPTR_0008s10970g [Populus trichocarpa]
Length=622

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
            T+    L+ +GVNYEV AL+ IK  LHDP+N+L NWD ++VDPCSW MVTCSPD +V++L
Sbjct  21   TTAYGELTAAGVNYEVEALMGIKNSLHDPHNIL-NWDEHAVDPCSWAMVTCSPDNFVTSL  79

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            G PSQ LSGTLSP IGNLTNLQS+LLQ+N ISGHIP+E+G+L +L T+DLS+N F+G IP
Sbjct  80   GAPSQRLSGTLSPSIGNLTNLQSLLLQDNNISGHIPSELGRLSKLKTIDLSSNNFSGQIP  139

Query  893  S  895
            S
Sbjct  140  S  140



>ref|XP_002305306.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|EEE85817.2| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=627

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +2

Query  515  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPD  694
            +++  +T+ +  LSP GVNYEV ALI IK  LHDP+ VL+NWD ++VDPCSW MVTCSP+
Sbjct  17   VFLWFSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPE  76

Query  695  GYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNK  874
              V  LG PSQ+LSGTLSP IGNLTNLQ+VLLQ+N I+G IPAEI +L +L TLDLS+N 
Sbjct  77   SLVIGLGTPSQNLSGTLSPTIGNLTNLQTVLLQSNNITGPIPAEIARLSKLHTLDLSDNF  136

Query  875  FNGDIPS  895
            F G IPS
Sbjct  137  FTGKIPS  143



>ref|XP_011012715.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +2

Query  515  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPD  694
            +++  +T+ +  LSP GVNYEV ALI IK  LHDP+ VL+NWD ++VDPCSW MVTCSP+
Sbjct  17   VFLWFSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPE  76

Query  695  GYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNK  874
              V  LG PSQ+LSGTLSP IGNLTNLQ+VLLQ+N I+G IPAEI +L +L TLDLS+N 
Sbjct  77   SLVIGLGTPSQNLSGTLSPTIGNLTNLQTVLLQSNNITGPIPAEIARLSKLHTLDLSDNF  136

Query  875  FNGDIPS  895
            F G IPS
Sbjct  137  FTGKIPS  143



>ref|XP_006384231.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
 gb|ERP62028.1| hypothetical protein POPTR_0004s10790g [Populus trichocarpa]
Length=626

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +2

Query  515  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPD  694
            +++  +T+ +  LSP GVNYEV ALI IK  LHDP+ VL+NWD ++VDPCSW MVTCSP+
Sbjct  17   VFLWFSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPE  76

Query  695  GYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNK  874
              V  LG PSQ+LSGTLSP IGNLTNLQ+VLLQ+N I+G IPAEI +L +L TLDLS+N 
Sbjct  77   SLVIGLGTPSQNLSGTLSPTIGNLTNLQTVLLQSNNITGPIPAEIARLSKLHTLDLSDNF  136

Query  875  FNGDIPS  895
            F G IPS
Sbjct  137  FTGKIPS  143



>ref|XP_011012714.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +2

Query  515  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPD  694
            +++  +T+ +  LSP GVNYEV ALI IK  LHDP+ VL+NWD ++VDPCSW MVTCSP+
Sbjct  17   VFLWFSTTANGLLSPKGVNYEVQALIGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPE  76

Query  695  GYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNK  874
              V  LG PSQ+LSGTLSP IGNLTNLQ+VLLQ+N I+G IPAEI +L +L TLDLS+N 
Sbjct  77   SLVIGLGTPSQNLSGTLSPTIGNLTNLQTVLLQSNNITGPIPAEIARLSKLHTLDLSDNF  136

Query  875  FNGDIPS  895
            F G IPS
Sbjct  137  FTGKIPS  143



>ref|XP_008797566.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/130 (65%), Positives = 101/130 (78%), Gaps = 3/130 (2%)
 Frame = +2

Query  515  IWMLIATS---CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTC  685
             WM+   S    +A LSP GVN+EV AL+ IK  L DP+NVLENWD +SVDPCSW MVTC
Sbjct  11   FWMVFFWSWACAAAILSPKGVNFEVQALMGIKAFLKDPHNVLENWDKDSVDPCSWTMVTC  70

Query  686  SPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLS  865
            S    V+ LG PSQ+LSGTLSP IGNLTNL++VLLQNN ISG +PAEIG+L +L TL+LS
Sbjct  71   SSQKLVTTLGTPSQNLSGTLSPSIGNLTNLETVLLQNNNISGPLPAEIGRLSKLRTLELS  130

Query  866  NNKFNGDIPS  895
            NN F+G+IPS
Sbjct  131  NNYFSGEIPS  140



>ref|XP_010032589.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Eucalyptus grandis]
 gb|KCW52001.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
 gb|KCW52002.1| hypothetical protein EUGRSUZ_J01441 [Eucalyptus grandis]
Length=629

 Score =   170 bits (430),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = +2

Query  500  VLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMV  679
             L L  ++ I  S +  LSP GVN+EV AL+ IK  LHDP+NVLENWD ++VDPCSW MV
Sbjct  15   ALCLVAFLWIWNSANGLLSPKGVNFEVQALMRIKDCLHDPHNVLENWDKDAVDPCSWTMV  74

Query  680  TCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLD  859
            TCS D  V  LG PSQSLSGTLSP IGNLTNLQ VLLQNN I G +P E+G+L RL TLD
Sbjct  75   TCSTDSLVVGLGTPSQSLSGTLSPSIGNLTNLQIVLLQNNNIMGPLPPELGRLSRLRTLD  134

Query  860  LSNNKFNGDIPS  895
            LSNN F G+IPS
Sbjct  135  LSNNFFTGEIPS  146



>ref|XP_008444353.1| PREDICTED: protein NSP-INTERACTING KINASE 3 isoform X2 [Cucumis 
melo]
Length=609

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 88/116 (76%), Positives = 92/116 (79%), Gaps = 12/116 (10%)
 Frame = +2

Query  548  TLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQ  727
            TLSPSGVN+E            DP+NVLENWD NSVDPCSWRMVTCSPDGYVS LGLPSQ
Sbjct  24   TLSPSGVNFE------------DPHNVLENWDSNSVDPCSWRMVTCSPDGYVSVLGLPSQ  71

Query  728  SLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SLSG LSPGIGNLT L+SVLLQNN ISG IPA IGKL  L TLDLSNN F+G IPS
Sbjct  72   SLSGVLSPGIGNLTKLESVLLQNNDISGPIPATIGKLENLQTLDLSNNVFSGQIPS  127



>ref|XP_011020829.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
            T+    L+ +GVNYEV AL+ IK  LHDP+N+L NWD ++VDPCSW MVTCSPD +V++L
Sbjct  21   TTAYGELTAAGVNYEVEALMGIKNSLHDPHNIL-NWDEHAVDPCSWAMVTCSPDNFVTSL  79

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            G PSQ LSGTLSP IGNLTNLQS+LLQ+N ISGHIP+E+G+L +L T+DLS+N F+G IP
Sbjct  80   GAPSQRLSGTLSPSIGNLTNLQSLLLQDNNISGHIPSELGRLPKLKTIDLSSNNFSGQIP  139

Query  893  S  895
            S
Sbjct  140  S  140



>ref|XP_010549936.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Tarenaya hassleriana]
 gb|ABD96874.1| hypothetical protein [Cleome spinosa]
Length=634

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 105/135 (78%), Gaps = 3/135 (2%)
 Frame = +2

Query  494  FKVLGLG-IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSW  670
            F V   G +W+L   S SA LSP GVN+EV AL+ IK  L+DP+ VLE+WD ++VDPCSW
Sbjct  15   FSVCFFGFLWLL--GSASALLSPQGVNFEVRALMDIKASLNDPHGVLESWDRDAVDPCSW  72

Query  671  RMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLX  850
             MVTCS + +V +LG PSQSLSGTLSP IGNLTNLQ VLLQNN ISG +P E+G+L +L 
Sbjct  73   TMVTCSSENFVISLGTPSQSLSGTLSPSIGNLTNLQIVLLQNNNISGRLPTELGRLTKLQ  132

Query  851  TLDLSNNKFNGDIPS  895
            TLDLS+N F+G+IPS
Sbjct  133  TLDLSDNFFHGEIPS  147



>ref|XP_011011496.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 100/121 (83%), Gaps = 1/121 (1%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
            T+    L+ +GVNYEV AL+ IK  LHDP+N+L NWD ++VDPCSW MVTCSPD +V++L
Sbjct  21   TTAYGELTAAGVNYEVEALMGIKNSLHDPHNIL-NWDEHAVDPCSWAMVTCSPDNFVTSL  79

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            G PSQ LSGTLSP IGNLTNLQS+LLQ+N ISGHIP+E+G+L +L T+DLS+N F+G IP
Sbjct  80   GAPSQRLSGTLSPSIGNLTNLQSLLLQDNNISGHIPSELGRLPKLKTIDLSSNNFSGQIP  139

Query  893  S  895
            S
Sbjct  140  S  140



>ref|XP_002532890.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF29495.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=624

 Score =   169 bits (428),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +2

Query  527  IATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVS  706
              ++ +  LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++VDPCSW MVTCSP+  V 
Sbjct  18   FCSTANGLLSPKGVNFEVQALMGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPESLVI  77

Query  707  ALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGD  886
             LG PSQ+LSGTLSP IGNLTNLQ VLLQNN I+G IPAE+G+L +L TLDLSNN F GD
Sbjct  78   GLGTPSQNLSGTLSPSIGNLTNLQIVLLQNNNITGPIPAELGRLRKLQTLDLSNNFFTGD  137

Query  887  IPS  895
            +PS
Sbjct  138  VPS  140



>ref|NP_197104.1| NSP-interacting kinase 1 [Arabidopsis thaliana]
 sp|Q9LFS4.1|NIK1_ARATH RecName: Full=Protein NSP-INTERACTING KINASE 1; AltName: Full=LRR 
receptor-like serine/threonine-protein kinase NIK1; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAC01799.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAL66960.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|AAN86199.1| putative receptor protein kinase [Arabidopsis thaliana]
 gb|ACN59368.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED92233.1| NSP-interacting kinase 1 [Arabidopsis thaliana]
Length=638

 Score =   169 bits (429),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +2

Query  509  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCS  688
            LG   L+ +S    LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++VDPCSW MVTCS
Sbjct  19   LGFLCLLCSSVHGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCS  78

Query  689  PDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSN  868
             + +V  LG PSQ+LSGTLSP I NLTNL+ VLLQNN I G IPAEIG+L RL TLDLS+
Sbjct  79   SENFVIGLGTPSQNLSGTLSPSITNLTNLRIVLLQNNNIKGKIPAEIGRLTRLETLDLSD  138

Query  869  NKFNGDIP  892
            N F+G+IP
Sbjct  139  NFFHGEIP  146



>gb|AAM65586.1| receptor protein kinase-like protein [Arabidopsis thaliana]
Length=629

 Score =   169 bits (428),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +2

Query  509  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCS  688
            LG   L+ +S    LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++VDPCSW MVTCS
Sbjct  10   LGFLCLLCSSVHGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCS  69

Query  689  PDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSN  868
             + +V  LG PSQ+LSGTLSP I NLTNL+ VLLQNN I+G IPAEIG+L RL TLDLS+
Sbjct  70   SENFVIGLGTPSQNLSGTLSPSITNLTNLRIVLLQNNNITGKIPAEIGRLTRLETLDLSD  129

Query  869  NKFNGDIP  892
            N F+G+IP
Sbjct  130  NFFHGEIP  137



>ref|XP_010453748.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Camelina sativa]
Length=639

 Score =   169 bits (428),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +2

Query  509  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCS  688
            LG+ + + +S +  LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++VDPCSW MVTCS
Sbjct  19   LGLLLCVLSSVNGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCS  78

Query  689  PDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSN  868
             + +V  LG PSQ+LSGTLSP I NLTNL+ VLLQNN I+G IPAEIG+L RL TLDLS+
Sbjct  79   SENFVIGLGTPSQNLSGTLSPSITNLTNLRIVLLQNNNITGKIPAEIGRLTRLETLDLSD  138

Query  869  NKFNGDIP  892
            N F G+IP
Sbjct  139  NFFRGEIP  146



>ref|XP_010927979.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Elaeis 
guineensis]
Length=591

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 102/135 (76%), Gaps = 4/135 (3%)
 Frame = +2

Query  491  LFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSW  670
            LF ++ L  W     S +  LSP GVN+EV ALI IK  L DP++VLENWD +SVDPCSW
Sbjct  21   LFLMVFLWTW----ASAAGLLSPKGVNFEVQALIDIKVSLKDPHSVLENWDQDSVDPCSW  76

Query  671  RMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLX  850
             MVTCSPD  V +LG PSQSLSGTLS  IGNLTNL++VLLQNN ISG IP EIG+L +L 
Sbjct  77   AMVTCSPDNLVISLGSPSQSLSGTLSSSIGNLTNLETVLLQNNNISGPIPPEIGRLSKLK  136

Query  851  TLDLSNNKFNGDIPS  895
            TLDLSNN F G+IP+
Sbjct  137  TLDLSNNYFTGEIPT  151



>ref|XP_010927978.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Elaeis 
guineensis]
Length=635

 Score =   169 bits (427),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 102/135 (76%), Gaps = 4/135 (3%)
 Frame = +2

Query  491  LFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSW  670
            LF ++ L  W     S +  LSP GVN+EV ALI IK  L DP++VLENWD +SVDPCSW
Sbjct  21   LFLMVFLWTW----ASAAGLLSPKGVNFEVQALIDIKVSLKDPHSVLENWDQDSVDPCSW  76

Query  671  RMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLX  850
             MVTCSPD  V +LG PSQSLSGTLS  IGNLTNL++VLLQNN ISG IP EIG+L +L 
Sbjct  77   AMVTCSPDNLVISLGSPSQSLSGTLSSSIGNLTNLETVLLQNNNISGPIPPEIGRLSKLK  136

Query  851  TLDLSNNKFNGDIPS  895
            TLDLSNN F G+IP+
Sbjct  137  TLDLSNNYFTGEIPT  151



>ref|XP_012080508.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Jatropha curcas]
 gb|KDP31451.1| hypothetical protein JCGZ_11827 [Jatropha curcas]
Length=621

 Score =   169 bits (427),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 96/115 (83%), Gaps = 1/115 (1%)
 Frame = +2

Query  551  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQS  730
            LSP GVNYEVVAL++IK  LHDP+NVL NWD  +VDPCSW M+TCSPDG V+ LG PSQ 
Sbjct  26   LSPKGVNYEVVALMSIKGLLHDPHNVL-NWDETAVDPCSWTMITCSPDGLVTGLGAPSQY  84

Query  731  LSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LSG LSP IGNLTNLQ VLLQNN ISG +P+E+G+L +L TLDLSNN FNG++PS
Sbjct  85   LSGRLSPSIGNLTNLQLVLLQNNNISGPLPSELGRLSKLRTLDLSNNLFNGELPS  139



>ref|XP_009418103.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=573

 Score =   168 bits (425),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = +2

Query  506  GLGIWMLIA---TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRM  676
             L +W+L      + +A LSP GVN+EV AL+ IK  L DP+ VLENWD +SVDPCSW M
Sbjct  8    ALMLWVLFFWPWVTATAMLSPKGVNFEVQALMGIKASLEDPHGVLENWDQDSVDPCSWTM  67

Query  677  VTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTL  856
            VTCSP+  V  LG PSQ+LSGTLSP IGNLTNL+ VLLQNN ISG IP EIGKL  L TL
Sbjct  68   VTCSPENLVIGLGTPSQNLSGTLSPSIGNLTNLEVVLLQNNNISGSIPPEIGKLFGLHTL  127

Query  857  DLSNNKFNGDIPS  895
            DLSNN+F+G IP+
Sbjct  128  DLSNNEFSGAIPT  140



>ref|XP_009417563.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=542

 Score =   167 bits (424),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 104/141 (74%), Gaps = 5/141 (4%)
 Frame = +2

Query  473  EREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNS  652
             RE+ LL  V  L  W    +  +A LSP GVNYEV AL+ +K  L DP++VLENWD +S
Sbjct  16   RREYGLLVLVF-LWTW----SPAAAVLSPKGVNYEVQALMGVKASLKDPHSVLENWDQDS  70

Query  653  VDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIG  832
            VDPCSW MVTCSP+  V  LG PSQ+LSGTLSP IGNLTNL+ +LLQNN ISG IP EIG
Sbjct  71   VDPCSWTMVTCSPENLVIGLGSPSQNLSGTLSPSIGNLTNLEIILLQNNNISGPIPQEIG  130

Query  833  KLXRLXTLDLSNNKFNGDIPS  895
            +L +L TLDLS+N F GDIP+
Sbjct  131  RLSKLRTLDLSSNYFTGDIPT  151



>ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
 emb|CBI27432.3| unnamed protein product [Vitis vinifera]
Length=625

 Score =   168 bits (426),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 108/142 (76%), Gaps = 5/142 (4%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            + RE  L F V  L +W     S S+ LSP GVN+EV AL++IK  L DP +VLENWD +
Sbjct  4    LRREAVLCF-VAFLCLW----NSASSLLSPKGVNFEVQALMSIKNSLIDPRSVLENWDKD  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            +VDPCSW M+TCS D  V +LG PSQ+LSGTLSP IGNLTNLQ+VLLQ+N+ISG IP+E+
Sbjct  59   AVDPCSWNMITCSDDKLVISLGTPSQNLSGTLSPSIGNLTNLQTVLLQDNSISGPIPSEL  118

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL +L  LDLSNN FNG+IP+
Sbjct  119  GKLSKLHLLDLSNNFFNGEIPT  140



>ref|XP_009417562.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=638

 Score =   168 bits (426),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 104/141 (74%), Gaps = 5/141 (4%)
 Frame = +2

Query  473  EREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNS  652
             RE+ LL  V  L  W    +  +A LSP GVNYEV AL+ +K  L DP++VLENWD +S
Sbjct  16   RREYGLLVLVF-LWTW----SPAAAVLSPKGVNYEVQALMGVKASLKDPHSVLENWDQDS  70

Query  653  VDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIG  832
            VDPCSW MVTCSP+  V  LG PSQ+LSGTLSP IGNLTNL+ +LLQNN ISG IP EIG
Sbjct  71   VDPCSWTMVTCSPENLVIGLGSPSQNLSGTLSPSIGNLTNLEIILLQNNNISGPIPQEIG  130

Query  833  KLXRLXTLDLSNNKFNGDIPS  895
            +L +L TLDLS+N F GDIP+
Sbjct  131  RLSKLRTLDLSSNYFTGDIPT  151



>ref|XP_006395648.1| hypothetical protein EUTSA_v10003811mg [Eutrema salsugineum]
 gb|ESQ32934.1| hypothetical protein EUTSA_v10003811mg [Eutrema salsugineum]
Length=643

 Score =   168 bits (426),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  515  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPD  694
            I + +  S  A L+  GVN+EV+ALI IK+ L DP+ VL NWD  +VDPCSW M+TCSPD
Sbjct  30   IIIFLLCSSYAELTDKGVNFEVLALIGIKSSLIDPHGVLMNWDDTAVDPCSWNMITCSPD  89

Query  695  GYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNK  874
            G+V +LG PSQSLSGTL+  IGNLT LQ+VLLQNN I+GHIP EIGKL +L TLDLS NK
Sbjct  90   GFVLSLGAPSQSLSGTLASSIGNLTYLQTVLLQNNYITGHIPPEIGKLMKLKTLDLSTNK  149

Query  875  FNGDIP  892
            F+G IP
Sbjct  150  FSGQIP  155



>ref|XP_010492459.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Camelina sativa]
Length=640

 Score =   168 bits (426),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 101/128 (79%), Gaps = 1/128 (1%)
 Frame = +2

Query  509  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCS  688
            LG+  L+ +S +  LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++VDPCSW MVTCS
Sbjct  21   LGLLCLL-SSVNGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCS  79

Query  689  PDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSN  868
            P+ +V  LG PSQ+LSGTLSP I NLTNL+ VLLQNN I+G IPAEIG+L RL TLDLS+
Sbjct  80   PENFVIGLGTPSQNLSGTLSPSITNLTNLRIVLLQNNNITGKIPAEIGRLTRLETLDLSD  139

Query  869  NKFNGDIP  892
            N F G+IP
Sbjct  140  NFFRGEIP  147



>ref|XP_009418102.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=623

 Score =   168 bits (425),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 100/133 (75%), Gaps = 3/133 (2%)
 Frame = +2

Query  506  GLGIWMLIA---TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRM  676
             L +W+L      + +A LSP GVN+EV AL+ IK  L DP+ VLENWD +SVDPCSW M
Sbjct  8    ALMLWVLFFWPWVTATAMLSPKGVNFEVQALMGIKASLEDPHGVLENWDQDSVDPCSWTM  67

Query  677  VTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTL  856
            VTCSP+  V  LG PSQ+LSGTLSP IGNLTNL+ VLLQNN ISG IP EIGKL  L TL
Sbjct  68   VTCSPENLVIGLGTPSQNLSGTLSPSIGNLTNLEVVLLQNNNISGSIPPEIGKLFGLHTL  127

Query  857  DLSNNKFNGDIPS  895
            DLSNN+F+G IP+
Sbjct  128  DLSNNEFSGAIPT  140



>ref|XP_006643812.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like [Oryza brachyantha]
Length=590

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  590  IAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLT  769
            +AIKT L DPYNVL+NWD+NSVDPCSWRMVTCS DGYVSALGLPSQSLSG LSPGIGNLT
Sbjct  1    MAIKTELQDPYNVLDNWDINSVDPCSWRMVTCSADGYVSALGLPSQSLSGKLSPGIGNLT  60

Query  770  NLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
             LQSVLLQNNAISG IPA IG+L  L TLD+S+N+  G IP
Sbjct  61   RLQSVLLQNNAISGPIPASIGRLGMLQTLDMSDNQLTGSIP  101



>ref|XP_006400129.1| hypothetical protein EUTSA_v10012948mg [Eutrema salsugineum]
 gb|ESQ41582.1| hypothetical protein EUTSA_v10012948mg [Eutrema salsugineum]
Length=637

 Score =   168 bits (425),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +2

Query  518  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDG  697
            ++ + +S +  LS  GVN+EV AL+ IK  LHDP+ VL+NWD ++VDPCSW MVTCSP+ 
Sbjct  21   FLCLLSSVNGLLSSKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCSPEN  80

Query  698  YVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKF  877
            +V+ LG PSQ+LSGTLSP I NLTNL+ VLLQNN I+G IP+EIG+L RL TLDLS+N F
Sbjct  81   FVTGLGTPSQNLSGTLSPSITNLTNLRIVLLQNNNITGKIPSEIGRLTRLETLDLSDNFF  140

Query  878  NGDIP  892
             GDIP
Sbjct  141  RGDIP  145



>ref|XP_002314905.1| hypothetical protein POPTR_0010s14410g [Populus trichocarpa]
 gb|EEF01076.1| hypothetical protein POPTR_0010s14410g [Populus trichocarpa]
Length=627

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +2

Query  509  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCS  688
            +G+ + +  +    L+ +GVN+EV AL+ IK  LHDP++VL+ WD +SVDPCSW MVTCS
Sbjct  13   VGLLICLWNTAYGELTATGVNFEVEALMGIKASLHDPHDVLK-WDEHSVDPCSWIMVTCS  71

Query  689  PDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSN  868
             DG+V+ LG PSQSLSGTLSP IGNLTNLQS+LLQ+N ISGHIPAE+GKL +L T+DLS+
Sbjct  72   TDGFVTTLGAPSQSLSGTLSPSIGNLTNLQSLLLQDNNISGHIPAELGKLPKLKTIDLSS  131

Query  869  NKFNGDIPS  895
            N F+G IPS
Sbjct  132  NNFSGQIPS  140



>ref|XP_007033440.1| NSP-interacting kinase 1 [Theobroma cacao]
 gb|EOY04366.1| NSP-interacting kinase 1 [Theobroma cacao]
Length=649

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  551  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQS  730
            LSP GVNYEV +L+AIK  LHDP+ VL+NWD ++VDPCSW MVTCSP+  V  LG PSQ+
Sbjct  31   LSPKGVNYEVQSLMAIKAALHDPHGVLDNWDADAVDPCSWAMVTCSPESLVIGLGTPSQN  90

Query  731  LSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LSGTLSP IGNLTNLQ VLLQNN I+G IP E+GKL ++ TLDLS+N F G+IP+
Sbjct  91   LSGTLSPSIGNLTNLQIVLLQNNNITGPIPTELGKLSKIQTLDLSDNSFTGEIPT  145



>ref|XP_009152132.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
2-like [Brassica rapa]
Length=652

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 97/129 (75%), Gaps = 2/129 (2%)
 Frame = +2

Query  515  IWMLIATSCS--ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCS  688
            ++  IA  CS  A L+  GVNYEV+ALI IK+ L DP+ VL NWD  +VDPCSW M+TCS
Sbjct  19   LFFFIALLCSSSAELTDKGVNYEVLALIGIKSSLIDPHGVLMNWDDTAVDPCSWNMITCS  78

Query  689  PDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSN  868
             DG+V +LG PSQ LSGTLS  IGNLT LQ+VLLQNN I+GHIP EIGKL +L TLDLS 
Sbjct  79   ADGFVLSLGAPSQDLSGTLSSSIGNLTYLQTVLLQNNYITGHIPPEIGKLMKLKTLDLST  138

Query  869  NKFNGDIPS  895
            N F G IPS
Sbjct  139  NNFTGQIPS  147



>ref|XP_002871697.1| nsp-interacting kinase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47956.1| nsp-interacting kinase 1 [Arabidopsis lyrata subsp. lyrata]
Length=638

 Score =   167 bits (424),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +2

Query  509  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCS  688
            LG   L+++S    LSP G+N+EV AL+ IK  LHDP+ VL+NWD ++VDPCSW MVTCS
Sbjct  19   LGFLCLLSSSVDGLLSPKGINFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCS  78

Query  689  PDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSN  868
             + +V  LG PSQ+LSGTLSP I NLTNL+ VLLQNN I+G IP EIG+L RL TLDLS+
Sbjct  79   SENFVIGLGTPSQNLSGTLSPSITNLTNLRIVLLQNNNITGKIPTEIGRLTRLETLDLSD  138

Query  869  NKFNGDIP  892
            N F G+IP
Sbjct  139  NFFRGEIP  146



>ref|XP_006603947.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoform X2 [Glycine 
max]
Length=510

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +2

Query  500  VLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMV  679
            VL   ++    +  +A LSP GVN+EV+AL+ IK  L DP+ +L+NWD ++VDPCSW MV
Sbjct  9    VLCFVLFFWFCSFSNALLSPKGVNFEVLALMGIKASLVDPHGILDNWDEDAVDPCSWNMV  68

Query  680  TCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLD  859
            TCSP+  V +LG+PSQ+LSGTLSP IGNLTNLQ+V+LQNN I+G IP+EIGKL +L TLD
Sbjct  69   TCSPENLVISLGIPSQNLSGTLSPSIGNLTNLQTVVLQNNNITGPIPSEIGKLSKLQTLD  128

Query  860  LSNNKFNGDIP  892
            LS+N F+G+IP
Sbjct  129  LSDNFFSGEIP  139



>ref|XP_010905760.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=635

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 103/135 (76%), Gaps = 4/135 (3%)
 Frame = +2

Query  491  LFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSW  670
            LF ++ L  W     S +A LSP GVN+EV AL+ IK  L DP++VLENWD +SVDPCSW
Sbjct  21   LFLLVFLWTW----ASAAALLSPKGVNFEVQALMYIKDSLKDPHSVLENWDRDSVDPCSW  76

Query  671  RMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLX  850
             MVTCS +  V +LG+PSQ+LSGTLSP IGNLTNL++VLLQNN ISG IP EIGKL +L 
Sbjct  77   AMVTCSSENLVISLGIPSQNLSGTLSPSIGNLTNLETVLLQNNNISGPIPPEIGKLSKLK  136

Query  851  TLDLSNNKFNGDIPS  895
            TLDLSNN F G IP+
Sbjct  137  TLDLSNNYFTGGIPT  151



>emb|CDY48073.1| BnaA06g33550D [Brassica napus]
Length=640

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 97/129 (75%), Gaps = 2/129 (2%)
 Frame = +2

Query  515  IWMLIATSCS--ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCS  688
            ++  IA  CS  A L+  GVNYEV+ALI IK+ L DP+ VL NWD  +VDPCSW M+TCS
Sbjct  28   LFFFIALLCSSSAELTDKGVNYEVLALIGIKSSLIDPHGVLMNWDDTAVDPCSWNMITCS  87

Query  689  PDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSN  868
             DG+V +LG PSQ LSGTLS  IGNLT LQ+VLLQNN I+GHIP EIGKL +L TLDLS 
Sbjct  88   ADGFVLSLGAPSQDLSGTLSSSIGNLTYLQTVLLQNNYITGHIPPEIGKLMKLKTLDLST  147

Query  869  NKFNGDIPS  895
            N F G IPS
Sbjct  148  NNFTGQIPS  156



>ref|XP_006338306.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Solanum tuberosum]
Length=626

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME++  +    L +  ++++ +S +  LSP GVN+EV AL+AIK  L DP+ VL+NWD  
Sbjct  1    MEKKREIKVAFLYVATFLVLWSSAAGLLSPKGVNFEVQALMAIKVALKDPHGVLDNWDST  60

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSW MVTCS +  V  LG PSQ+LSGT SP IGNLTNLQ +LLQNN I+G IP EI
Sbjct  61   SVDPCSWAMVTCSSESLVIGLGAPSQNLSGTFSPSIGNLTNLQIILLQNNNITGPIPKEI  120

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            G+L +L TLDLS+N F GDIP
Sbjct  121  GRLSKLQTLDLSDNFFTGDIP  141



>gb|ABG73621.1| leucine-rich repeat receptor-like kinase [Populus tomentosa]
Length=622

 Score =   167 bits (423),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 99/121 (82%), Gaps = 1/121 (1%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
            T+    L+ +GVNYEV AL+  K  LHDP+N+L NWD ++VDPCSW MVTCSPD +V++L
Sbjct  21   TTAYGELTAAGVNYEVEALMGFKNSLHDPHNIL-NWDEHAVDPCSWAMVTCSPDNFVTSL  79

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            G PSQ LSGTLSP IGNLTNLQS+LLQ+N ISGHIP+E+G+L +L T+DLS+N F+G IP
Sbjct  80   GAPSQRLSGTLSPYIGNLTNLQSLLLQDNNISGHIPSELGRLPKLKTIDLSSNNFSGQIP  139

Query  893  S  895
            S
Sbjct  140  S  140



>gb|EMT25229.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=737

 Score =   167 bits (424),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 82/106 (77%), Positives = 90/106 (85%), Gaps = 0/106 (0%)
 Frame = +2

Query  578  VVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGI  757
            VVAL+AIKT L D YNVL+NWD+NSVDPCSWRMVTCS DGYVSALGLPSQ LSG LSPGI
Sbjct  132  VVALMAIKTELQDHYNVLDNWDINSVDPCSWRMVTCSSDGYVSALGLPSQRLSGKLSPGI  191

Query  758  GNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            GNLT LQSVLLQNNAISG IP+ IG+L  L TLD+S+N   G IP+
Sbjct  192  GNLTRLQSVLLQNNAISGTIPSTIGRLGMLQTLDMSDNHLTGSIPT  237



>ref|XP_010502426.1| PREDICTED: protein NSP-INTERACTING KINASE 2 [Camelina sativa]
Length=645

 Score =   167 bits (422),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  515  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPD  694
             ++   +  SA L+  GVNYEV+ALI IK+ L DP+ VL NWD  +VDPCSW M+TCSPD
Sbjct  31   FFICFLSFSSAELTDKGVNYEVLALIGIKSSLIDPHGVLMNWDDTAVDPCSWNMITCSPD  90

Query  695  GYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNK  874
            G+V +LG PSQ LSGTLS  IGNLT LQ+VLLQNN I+GHIP EIGKL +L TLDLS N 
Sbjct  91   GFVLSLGAPSQDLSGTLSSSIGNLTYLQTVLLQNNYITGHIPHEIGKLMKLKTLDLSTNN  150

Query  875  FNGDIP  892
            F G IP
Sbjct  151  FTGQIP  156



>ref|XP_006287253.1| hypothetical protein CARUB_v10000442mg [Capsella rubella]
 gb|EOA20151.1| hypothetical protein CARUB_v10000442mg [Capsella rubella]
Length=640

 Score =   167 bits (422),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 96/122 (79%), Gaps = 2/122 (2%)
 Frame = +2

Query  533  TSCSAT--LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVS  706
            TSCS    LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++VDPCSW MVTCS + +V 
Sbjct  27   TSCSVNGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCSSENFVI  86

Query  707  ALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGD  886
             LG PSQ+LSGTLSP I NLTNL+ VLLQNN I+G IPAEIG+L RL TLDLS+N F G+
Sbjct  87   GLGTPSQNLSGTLSPSITNLTNLRIVLLQNNNITGKIPAEIGRLTRLETLDLSDNFFRGE  146

Query  887  IP  892
            IP
Sbjct  147  IP  148



>ref|XP_008811184.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=635

 Score =   167 bits (422),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +2

Query  503  LGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVT  682
            L L +++    S +  LSP GVN+EV AL+ IK  L DP++VLENWD +SVDPCSW MVT
Sbjct  21   LFLMVFLWTLASAAGLLSPKGVNFEVQALMGIKASLKDPHSVLENWDRDSVDPCSWAMVT  80

Query  683  CSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDL  862
            CSP+  V +LG+PSQ+LSGTLS  IGNLTNL++VLLQNN ISG IP EIGKL +L TLDL
Sbjct  81   CSPENLVISLGIPSQNLSGTLSSSIGNLTNLETVLLQNNNISGPIPPEIGKLSKLKTLDL  140

Query  863  SNNKFNGDIPS  895
            SNN F G IP+
Sbjct  141  SNNYFTGGIPT  151



>gb|KJB43138.1| hypothetical protein B456_007G186300 [Gossypium raimondii]
Length=625

 Score =   167 bits (422),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 104/142 (73%), Gaps = 4/142 (3%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M R     + +  L  W+ I    +  LSP GVNYEV AL+AIK  LHDP+ VL+NWD +
Sbjct  3    MRRREMGFYFLAFLWFWVPI----NGLLSPKGVNYEVQALMAIKDALHDPHGVLDNWDAD  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            +VDPCSW MVTCSP+  V  LG PSQ+LSGTLSP IGNLTNL+ VLLQNN I+G IP+E+
Sbjct  59   AVDPCSWAMVTCSPESLVIGLGSPSQNLSGTLSPSIGNLTNLRIVLLQNNNITGPIPSEL  118

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL ++ TLDLS+N F G+IP+
Sbjct  119  GKLSKIQTLDLSDNSFTGEIPT  140



>ref|XP_012088120.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Jatropha curcas]
 gb|KDP24340.1| hypothetical protein JCGZ_25636 [Jatropha curcas]
Length=624

 Score =   167 bits (422),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  551  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQS  730
            LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++VDPCSW MVTCSP+  V  LG PSQ+
Sbjct  26   LSPKGVNFEVQALMGIKASLHDPHGVLDNWDGDAVDPCSWTMVTCSPESLVIGLGTPSQN  85

Query  731  LSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LSGTLSP IGNLTNLQ VLLQNN I+G IPAEIG+L +L TLDLS+N F G+IPS
Sbjct  86   LSGTLSPSIGNLTNLQIVLLQNNNITGPIPAEIGRLSKLHTLDLSDNFFTGEIPS  140



>gb|KHN07744.1| Protein NSP-INTERACTING KINASE 2 [Glycine soja]
Length=621

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            MER   +    L L     + TS +A LSP GVNYEV AL++IK  L DP++VL NWD +
Sbjct  1    MERSGDVALFCLAL---FFLWTSVAALLSPKGVNYEVQALMSIKNSLVDPHSVLNNWDTD  57

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            +VDPC+W MVTCS D +V ALG+PSQS+SGTLSP IGNLTNLQ+VLLQ+N I+G IP EI
Sbjct  58   AVDPCNWAMVTCSSDHFVIALGIPSQSISGTLSPSIGNLTNLQTVLLQDNNITGPIPFEI  117

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            G+L +L TLDLS+N F G +P
Sbjct  118  GRLQKLQTLDLSDNFFTGQLP  138



>ref|XP_010100900.1| Protein NSP-INTERACTING KINASE 1 [Morus notabilis]
 gb|EXB85824.1| Protein NSP-INTERACTING KINASE 1 [Morus notabilis]
Length=695

 Score =   167 bits (422),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 100/139 (72%), Gaps = 10/139 (7%)
 Frame = +2

Query  482  WFLLFKVLGLGIWMLIATSCS-ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVD  658
            WFL F    L  W     SC+   LSP GVN+EV AL+ IK  L DP+ VLENWD +SVD
Sbjct  12   WFLAF----LWFW-----SCANGILSPKGVNFEVQALMGIKHSLEDPHGVLENWDGDSVD  62

Query  659  PCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKL  838
            PCSW MVTCSP+  V  LG PSQ+LSGTLSP IGNLTNLQ VLLQNN I G +P E+GKL
Sbjct  63   PCSWTMVTCSPESLVIGLGTPSQNLSGTLSPSIGNLTNLQIVLLQNNNIRGPVPPELGKL  122

Query  839  XRLXTLDLSNNKFNGDIPS  895
             +L TLDLSNN F G+IPS
Sbjct  123  QKLHTLDLSNNMFTGEIPS  141



>ref|XP_006574993.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X1 [Glycine 
max]
 ref|XP_006574994.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like isoform X2 [Glycine 
max]
Length=621

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            MER   +    L L     + TS +A LSP GVNYEV AL++IK  L DP++VL NWD +
Sbjct  1    MERSGDVALFCLAL---FFLWTSVAALLSPKGVNYEVQALMSIKNSLVDPHSVLNNWDTD  57

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            +VDPC+W MVTCS D +V ALG+PSQS+SGTLSP IGNLTNLQ+VLLQ+N I+G IP EI
Sbjct  58   AVDPCNWAMVTCSSDHFVIALGIPSQSISGTLSPSIGNLTNLQTVLLQDNNITGPIPFEI  117

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            G+L +L TLDLS+N F G +P
Sbjct  118  GRLQKLQTLDLSDNFFTGQLP  138



>gb|KHN30771.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=619

 Score =   166 bits (421),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +2

Query  500  VLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMV  679
            VL   ++    +  +A LSP GVN+EV+AL+ IK  L DP+ +L+NWD ++VDPCSW MV
Sbjct  9    VLCFVLFFWFCSFSNALLSPKGVNFEVLALMGIKASLVDPHGILDNWDEDAVDPCSWNMV  68

Query  680  TCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLD  859
            TCSP+  V +LG+PSQ+LSGTLSP IGNLTNLQ+V+LQNN I+G IP+EIGKL +L TLD
Sbjct  69   TCSPENLVISLGIPSQNLSGTLSPSIGNLTNLQTVVLQNNNITGPIPSEIGKLSKLQTLD  128

Query  860  LSNNKFNGDIP  892
            LS+N F+G+IP
Sbjct  129  LSDNFFSGEIP  139



>ref|XP_003555046.1| PREDICTED: protein NSP-INTERACTING KINASE 1 isoformX1 [Glycine 
max]
Length=624

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 104/131 (79%), Gaps = 0/131 (0%)
 Frame = +2

Query  500  VLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMV  679
            VL   ++    +  +A LSP GVN+EV+AL+ IK  L DP+ +L+NWD ++VDPCSW MV
Sbjct  9    VLCFVLFFWFCSFSNALLSPKGVNFEVLALMGIKASLVDPHGILDNWDEDAVDPCSWNMV  68

Query  680  TCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLD  859
            TCSP+  V +LG+PSQ+LSGTLSP IGNLTNLQ+V+LQNN I+G IP+EIGKL +L TLD
Sbjct  69   TCSPENLVISLGIPSQNLSGTLSPSIGNLTNLQTVVLQNNNITGPIPSEIGKLSKLQTLD  128

Query  860  LSNNKFNGDIP  892
            LS+N F+G+IP
Sbjct  129  LSDNFFSGEIP  139



>ref|XP_007045670.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
 gb|EOY01502.1| LRR receptor-like serine/threonine-protein kinase [Theobroma 
cacao]
Length=926

 Score =   168 bits (426),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 105/142 (74%), Gaps = 4/142 (3%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
              +E F+L  V  L +W    +S    LSP GVN+EV AL+ IK  L DP+ VL+NWD  
Sbjct  302  FRKEKFVLCCVALLCLW----SSACGLLSPKGVNFEVQALMGIKNFLVDPHRVLDNWDEA  357

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            +VDPCSW MVTC+PDG V  LG PSQ+LSGTL+P IGNLTNLQ VLLQ+N I+GHIP+E+
Sbjct  358  AVDPCSWSMVTCTPDGLVVGLGAPSQNLSGTLAPTIGNLTNLQHVLLQDNNIAGHIPSEL  417

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            GKL +L TLDLS+N F+G IPS
Sbjct  418  GKLPKLNTLDLSSNSFSGQIPS  439


 Score =   163 bits (413),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +2

Query  530  ATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSA  709
            + S S  ++P+GV YEV+ALI IK  L DP+ VL+NWD +S DPCSW MVTCSPDG+V  
Sbjct  37   SASASPLVAPNGVGYEVLALIGIKRLLVDPHKVLDNWDDSSRDPCSWNMVTCSPDGFVVG  96

Query  710  LGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDI  889
            LG PSQ+LSG LSP IGNLTN+Q VLLQNN ISG IP+EIG L +L TLDLSNN F G I
Sbjct  97   LGAPSQNLSGFLSPTIGNLTNIQMVLLQNNHISGDIPSEIGSLSKLETLDLSNNNFAGQI  156

Query  890  PS  895
            PS
Sbjct  157  PS  158



>gb|KEH21801.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=525

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
            +S  A LS  GVNYEV AL++IK  L DP+ VLENWD ++VDPCSW MVTCS +  V+ L
Sbjct  22   SSSHALLSSKGVNYEVQALMSIKDSLVDPHGVLENWDGDAVDPCSWTMVTCSSENLVTGL  81

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            G PSQSLSGTLSP IGNLTNLQ VLLQNN I+G IP+E+GKL +L TLDLSNN FNG+IP
Sbjct  82   GTPSQSLSGTLSPSIGNLTNLQMVLLQNNNITGSIPSELGKLPKLQTLDLSNNFFNGEIP  141

Query  893  S  895
            +
Sbjct  142  T  142



>gb|KEH21800.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=626

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
            +S  A LS  GVNYEV AL++IK  L DP+ VLENWD ++VDPCSW MVTCS +  V+ L
Sbjct  22   SSSHALLSSKGVNYEVQALMSIKDSLVDPHGVLENWDGDAVDPCSWTMVTCSSENLVTGL  81

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            G PSQSLSGTLSP IGNLTNLQ VLLQNN I+G IP+E+GKL +L TLDLSNN FNG+IP
Sbjct  82   GTPSQSLSGTLSPSIGNLTNLQMVLLQNNNITGSIPSELGKLPKLQTLDLSNNFFNGEIP  141

Query  893  S  895
            +
Sbjct  142  T  142



>ref|XP_009396215.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396224.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 98/132 (74%), Gaps = 3/132 (2%)
 Frame = +2

Query  509  LGIWMLIA---TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMV  679
            L  WM+      + +A LSP GVNYEV AL+ IK  L DP++VLENWD +SVDPCSW M+
Sbjct  9    LVFWMMFFWSWAAATAVLSPKGVNYEVQALMGIKASLVDPHSVLENWDKDSVDPCSWTMI  68

Query  680  TCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLD  859
            TCS +  V  LG P Q LSGTLSP IGNLTNL+ VLLQNN ISG +P EIGKL +L TLD
Sbjct  69   TCSSENLVVGLGTPGQDLSGTLSPSIGNLTNLEIVLLQNNNISGPVPPEIGKLSKLHTLD  128

Query  860  LSNNKFNGDIPS  895
            LSNNKF+G IP+
Sbjct  129  LSNNKFSGRIPA  140



>ref|NP_001146634.1| uncharacterized LOC100280233 precursor [Zea mays]
 ref|XP_008643516.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 ref|XP_008643517.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 ref|XP_008643518.1| PREDICTED: uncharacterized LOC100280233 isoform X1 [Zea mays]
 gb|ACL54438.1| unknown [Zea mays]
 gb|AFW73243.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 1 [Zea mays]
 gb|AFW73244.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 2 [Zea mays]
 gb|AFW73245.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 3 [Zea mays]
 gb|AFW73246.1| putative leucine-rich repeat receptor-like protein kinase family 
protein isoform 4 [Zea mays]
Length=626

 Score =   166 bits (420),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 101/132 (77%), Gaps = 3/132 (2%)
 Frame = +2

Query  509  LGIWMLIATSC---SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMV  679
            L + +L   SC   S  LSP GVNYEV AL+ IK  L DP+ VL+NWD +SVDPCSW MV
Sbjct  10   LALVLLFFCSCGPASGLLSPKGVNYEVQALMMIKNYLKDPHGVLKNWDQDSVDPCSWTMV  69

Query  680  TCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLD  859
            TCSP+  V+ L  PSQ+LSG LSP IGNLTNL++VLLQNN I+G IPAEIGKL +L TLD
Sbjct  70   TCSPENLVTGLEAPSQNLSGILSPSIGNLTNLETVLLQNNNINGLIPAEIGKLRKLKTLD  129

Query  860  LSNNKFNGDIPS  895
            LS+N F+G+IPS
Sbjct  130  LSSNHFSGEIPS  141



>gb|EYU44266.1| hypothetical protein MIMGU_mgv1a002951mg [Erythranthe guttata]
Length=622

 Score =   166 bits (419),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
            TS +A LSP GVN+EV AL+ IK GL DP+ VL+NWD ++VDPCSW MVTCS +  V  L
Sbjct  17   TSAAALLSPKGVNFEVEALMGIKGGLRDPHGVLDNWDRDAVDPCSWTMVTCSSNNLVIGL  76

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            G PSQ+LSGTLSP IGNLTNLQ +LLQNN I+G IP E+GKL +L TLDLSNN F G+IP
Sbjct  77   GTPSQNLSGTLSPSIGNLTNLQIILLQNNNITGPIPGEVGKLLKLQTLDLSNNFFTGNIP  136



>emb|CDX83534.1| BnaC07g22740D [Brassica napus]
Length=640

 Score =   166 bits (419),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 97/129 (75%), Gaps = 0/129 (0%)
 Frame = +2

Query  509  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCS  688
            L  ++ +  S SA L+  GVNYEV+ALI IK+ L DP+ VL NWD  +VDPCSW M++CS
Sbjct  28   LFFFIALLYSSSAELTDKGVNYEVLALIGIKSSLIDPHGVLMNWDDTAVDPCSWNMISCS  87

Query  689  PDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSN  868
             DG+V +LG PSQ LSGTLS  IGNLT LQ+VLLQNN I+GHIP EIGKL +L TLDLS 
Sbjct  88   ADGFVLSLGAPSQDLSGTLSSSIGNLTYLQTVLLQNNYITGHIPPEIGKLMKLKTLDLST  147

Query  869  NKFNGDIPS  895
            N F G IPS
Sbjct  148  NNFTGQIPS  156



>gb|KHN07168.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=582

 Score =   165 bits (418),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            MER   +    L L     + TS +A LSP GVNYEV AL+ I+  L DP++VL NWD +
Sbjct  1    MERRRDVALFCLAL---FFLWTSVAALLSPKGVNYEVQALMGIRNSLADPHSVLNNWDPD  57

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            +VDPC+W MVTCS D +V ALG+PSQ++SGTLSP IGNLTNLQ+VLLQ+N I+G IP+EI
Sbjct  58   AVDPCNWAMVTCSSDHFVIALGIPSQNISGTLSPSIGNLTNLQTVLLQDNNITGPIPSEI  117

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            G+L +L TLDLS+N F G +P
Sbjct  118  GRLQKLQTLDLSDNFFTGQLP  138



>ref|XP_004232118.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Solanum lycopersicum]
Length=626

 Score =   166 bits (419),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            ME++  +    L +  ++ + +S +  LSP GVN+EV AL+AIK  L DP+ VL+NWD  
Sbjct  1    MEKKREIKASFLYVATFLALWSSAAGLLSPKGVNFEVQALMAIKVALKDPHGVLDNWDST  60

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSW MVTCS +  V  LG PSQ+LSGT SP IGNLTNLQ +LLQNN I+G IP EI
Sbjct  61   SVDPCSWAMVTCSSESLVIGLGAPSQNLSGTFSPSIGNLTNLQIILLQNNNITGPIPKEI  120

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            G+L +L TLDLS+N F GDIP
Sbjct  121  GRLSKLQTLDLSDNFFTGDIP  141



>ref|XP_003517902.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Glycine max]
Length=621

 Score =   165 bits (418),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 105/141 (74%), Gaps = 3/141 (2%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            MER   +    L L     + TS +A LSP GVNYEV AL+ I+  L DP++VL NWD +
Sbjct  1    MERRRDVALFCLAL---FFLWTSVAALLSPKGVNYEVQALMGIRNSLADPHSVLNNWDPD  57

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            +VDPC+W MVTCS D +V ALG+PSQ++SGTLSP IGNLTNLQ+VLLQ+N I+G IP+EI
Sbjct  58   AVDPCNWAMVTCSSDHFVIALGIPSQNISGTLSPSIGNLTNLQTVLLQDNNITGPIPSEI  117

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            G+L +L TLDLS+N F G +P
Sbjct  118  GRLQKLQTLDLSDNFFTGQLP  138



>ref|XP_010091686.1| Protein NSP-INTERACTING KINASE 2 [Morus notabilis]
 gb|EXB44952.1| Protein NSP-INTERACTING KINASE 2 [Morus notabilis]
Length=619

 Score =   165 bits (418),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 101/136 (74%), Gaps = 5/136 (4%)
 Frame = +2

Query  485  FLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPC  664
            FL F      I+ L   S +  LSP GVNYEV AL++IK  L DP+NVL NWD  +VDPC
Sbjct  10   FLFF----FNIFCLCHFS-AGMLSPKGVNYEVQALMSIKYLLKDPHNVLGNWDDAAVDPC  64

Query  665  SWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXR  844
            SW MVTCSPDG V +LG PSQ+LSGTLSP IGNLT +QSVLLQNN ISG IP+EIG+L +
Sbjct  65   SWTMVTCSPDGSVISLGAPSQNLSGTLSPSIGNLTYIQSVLLQNNNISGPIPSEIGRLQK  124

Query  845  LXTLDLSNNKFNGDIP  892
            L T+DLSNN F G IP
Sbjct  125  LDTIDLSNNNFTGQIP  140



>ref|XP_008459453.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Cucumis melo]
Length=626

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 99/132 (75%), Gaps = 3/132 (2%)
 Frame = +2

Query  500  VLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMV  679
            V  L IW+   +S +A LSP GVNYEV AL+ IK  L DP+ VLENWD ++VDPCSW MV
Sbjct  14   VASLLIWV---SSINALLSPKGVNYEVQALMGIKASLQDPHGVLENWDGDAVDPCSWTMV  70

Query  680  TCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLD  859
            TCSP+  V  LG PSQ+LSGTLS  IGNLTNLQ VLLQNN I+G IP E G+L +L TLD
Sbjct  71   TCSPESLVIGLGTPSQNLSGTLSSTIGNLTNLQIVLLQNNNITGPIPPEFGRLSKLQTLD  130

Query  860  LSNNKFNGDIPS  895
            LSNN F G+IPS
Sbjct  131  LSNNFFTGEIPS  142



>ref|XP_007139356.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 ref|XP_007139357.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11350.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
 gb|ESW11351.1| hypothetical protein PHAVU_008G022700g [Phaseolus vulgaris]
Length=623

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S  A LSP GVN+EV AL++IK  L DP+ VL+NWD ++VDPCSW MVTCS +  V  LG
Sbjct  20   SADAVLSPKGVNFEVQALMSIKQSLEDPHGVLDNWDGDAVDPCSWTMVTCSSENLVVGLG  79

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
             PSQSLSGTLSP IGNLTNLQ VLLQNN ISG IP+E+GKL +L TLDLSNN F G+IP
Sbjct  80   TPSQSLSGTLSPSIGNLTNLQIVLLQNNNISGSIPSELGKLPKLQTLDLSNNFFRGEIP  138



>ref|XP_011009019.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Populus euphratica]
Length=622

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +2

Query  509  LGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCS  688
            +G+ + +  +    L+ +GVN+EV AL+ IK  LHDP++VL+ WD +SVDPCSW MVTCS
Sbjct  13   VGLLICLWNTAYGELTATGVNFEVEALMGIKASLHDPHDVLK-WDEHSVDPCSWIMVTCS  71

Query  689  PDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSN  868
             DG+V+ LG PSQSLSGTLSP IGNLTNLQS+LLQ+N ISGHIP+E+G+L +L T+DLS+
Sbjct  72   TDGFVTTLGAPSQSLSGTLSPSIGNLTNLQSLLLQDNNISGHIPSELGRLPKLKTIDLSS  131

Query  869  NKFNGDIPS  895
            N F+G IP+
Sbjct  132  NNFSGQIPT  140



>gb|KHG05227.1| nsp-interacting kinase 2 -like protein [Gossypium arboreum]
Length=624

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +2

Query  515  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPD  694
            +  L  +S +A LSP GVN+EV AL+ IK  L DP+ VL+NWD  +VDPCSW MVTCS D
Sbjct  14   VLFLFCSSATALLSPKGVNFEVQALMGIKELLVDPHGVLDNWDEAAVDPCSWNMVTCSID  73

Query  695  GYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNK  874
            G V  LG PSQ+LSGTL+P IGNLTNLQ VLLQNN ISG+IP+E+GKL  L TLDLSNN 
Sbjct  74   GLVIGLGAPSQNLSGTLAPTIGNLTNLQLVLLQNNNISGYIPSELGKLPNLHTLDLSNNN  133

Query  875  FNGDIPS  895
            F+G IP+
Sbjct  134  FSGQIPT  140



>ref|XP_011021148.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 99/127 (78%), Gaps = 2/127 (2%)
 Frame = +2

Query  515  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPD  694
            +W+L  T+ +  L+P GVN+EV AL+ IK  L DP+ VLENWD ++VDPCSW MVTCS +
Sbjct  19   LWLL--TTVNGLLTPKGVNFEVQALMGIKASLDDPHGVLENWDGDAVDPCSWTMVTCSSE  76

Query  695  GYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNK  874
              V  LG PSQ+LSGTLSP IGNLTNLQ+VLLQ+N I+G IPAEIGKL +L TLDLSNN 
Sbjct  77   SLVIGLGTPSQNLSGTLSPTIGNLTNLQTVLLQSNNITGPIPAEIGKLSKLHTLDLSNNF  136

Query  875  FNGDIPS  895
            F G IPS
Sbjct  137  FTGKIPS  143



>ref|XP_011021146.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 99/127 (78%), Gaps = 2/127 (2%)
 Frame = +2

Query  515  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPD  694
            +W+L  T+ +  L+P GVN+EV AL+ IK  L DP+ VLENWD ++VDPCSW MVTCS +
Sbjct  19   LWLL--TTVNGLLTPKGVNFEVQALMGIKASLDDPHGVLENWDGDAVDPCSWTMVTCSSE  76

Query  695  GYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNK  874
              V  LG PSQ+LSGTLSP IGNLTNLQ+VLLQ+N I+G IPAEIGKL +L TLDLSNN 
Sbjct  77   SLVIGLGTPSQNLSGTLSPTIGNLTNLQTVLLQSNNITGPIPAEIGKLSKLHTLDLSNNF  136

Query  875  FNGDIPS  895
            F G IPS
Sbjct  137  FTGKIPS  143



>ref|XP_010681338.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Beta vulgaris 
subsp. vulgaris]
Length=627

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 96/121 (79%), Gaps = 3/121 (2%)
 Frame = +2

Query  539  CSATLS---PSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSA  709
            C+++LS   P GVNYEV AL+ IK  L DP+ VL+NWD N+VDPCSW MV+CS +  V +
Sbjct  21   CNSSLSLLTPDGVNYEVQALMDIKESLRDPHGVLDNWDRNAVDPCSWAMVSCSSEDRVIS  80

Query  710  LGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDI  889
            LG+PSQ L GTLSP IGNLTNLQ+VLLQNN ISGHIPAEIG+L +L TLD+S+N F G I
Sbjct  81   LGIPSQGLYGTLSPSIGNLTNLQTVLLQNNNISGHIPAEIGRLSKLQTLDISDNFFRGRI  140

Query  890  P  892
            P
Sbjct  141  P  141



>gb|KJB80538.1| hypothetical protein B456_013G102600 [Gossypium raimondii]
Length=624

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +2

Query  515  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPD  694
            +  L  +S +A LSP GVN+EV AL+ IK  L DP+ VL+NWD  +VDPCSW MVTCS D
Sbjct  14   VLFLFCSSATALLSPKGVNFEVQALMGIKELLVDPHGVLDNWDEAAVDPCSWNMVTCSID  73

Query  695  GYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNK  874
            G V  LG PSQ+LSGTL+P IGNLTNLQ VLLQNN ISG+IP+E+GKL  L TLDLSNN 
Sbjct  74   GLVIGLGAPSQNLSGTLAPTIGNLTNLQLVLLQNNNISGYIPSELGKLPNLHTLDLSNNN  133

Query  875  FNGDIPS  895
            F+G IP+
Sbjct  134  FSGQIPT  140



>gb|KHN14464.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=623

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = +2

Query  521  MLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGY  700
             L  +S +A LSP GVN+EV AL+ IK  L DP+ VL+NWD ++VDPCSW MVTCS +  
Sbjct  15   FLFWSSANALLSPKGVNFEVQALMGIKYSLEDPHGVLDNWDGDAVDPCSWTMVTCSSENL  74

Query  701  VSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFN  880
            V  LG PSQSLSGTLSP IGNLTNLQ VLLQNN ISG IP+E+GKL +L TLDLSNN F 
Sbjct  75   VIGLGTPSQSLSGTLSPSIGNLTNLQIVLLQNNNISGPIPSELGKLPKLQTLDLSNNFFK  134

Query  881  GDIP  892
            G+IP
Sbjct  135  GEIP  138



>ref|XP_003531900.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Glycine max]
Length=623

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = +2

Query  521  MLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGY  700
             L  +S +A LSP GVN+EV AL+ IK  L DP+ VL+NWD ++VDPCSW MVTCS +  
Sbjct  15   FLFWSSANALLSPKGVNFEVQALMGIKYSLEDPHGVLDNWDGDAVDPCSWTMVTCSSENL  74

Query  701  VSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFN  880
            V  LG PSQSLSGTLSP IGNLTNLQ VLLQNN ISG IP+E+GKL +L TLDLSNN F 
Sbjct  75   VIGLGTPSQSLSGTLSPSIGNLTNLQIVLLQNNNISGPIPSELGKLPKLQTLDLSNNFFK  134

Query  881  GDIP  892
            G+IP
Sbjct  135  GEIP  138



>ref|XP_010514169.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Camelina sativa]
Length=646

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +2

Query  545  ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPS  724
            A L+  GVNYEV+ALI IK+ L DP+ VL NWD  +VDPCSW M++CSPDG+V +LG PS
Sbjct  42   AELTDKGVNYEVLALIGIKSSLIDPHGVLMNWDDTAVDPCSWNMISCSPDGFVLSLGAPS  101

Query  725  QSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            Q LSGTLS  IGNLT LQ+VLLQNN I+GHIP EIGKL +L TLDLS N F G IP
Sbjct  102  QDLSGTLSSSIGNLTYLQTVLLQNNYITGHIPHEIGKLMKLKTLDLSTNNFTGQIP  157



>ref|XP_004953781.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Setaria 
italica]
 ref|XP_004953782.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Setaria 
italica]
 ref|XP_004953783.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X3 [Setaria 
italica]
Length=624

 Score =   164 bits (414),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/119 (68%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +2

Query  539  CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGL  718
             S  LSP GVNYEV AL+ IK  L DP+ VL+NWD +SVDPCSW MVTCSP+  V+ L  
Sbjct  22   ASGLLSPKGVNYEVQALMMIKNYLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTGLEA  81

Query  719  PSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            PSQ+LSG LSP IGNLTNL++VLLQNN I+G IPAEIGKL +L TLDLS+N F+G+IPS
Sbjct  82   PSQNLSGILSPSIGNLTNLETVLLQNNNINGLIPAEIGKLTKLKTLDLSSNHFSGEIPS  140



>ref|XP_010424117.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like, partial [Camelina 
sativa]
Length=493

 Score =   162 bits (411),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 81/134 (60%), Positives = 102/134 (76%), Gaps = 3/134 (2%)
 Frame = +2

Query  491  LFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSW  670
            +F  LGL   + + +S +  LSP GVN+EV AL+ IK  LHDP+ VL+NWD ++VDPCSW
Sbjct  15   IFCFLGL---ICLLSSVNGLLSPKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSW  71

Query  671  RMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLX  850
             MVTCS + +V  LG PSQ+LSGTLSP I NLTNL+ VLLQNN I+G IP++IG+L RL 
Sbjct  72   TMVTCSSENFVIGLGTPSQNLSGTLSPSITNLTNLRIVLLQNNNITGKIPSDIGRLTRLE  131

Query  851  TLDLSNNKFNGDIP  892
            TLDLS+N F G+IP
Sbjct  132  TLDLSDNFFRGEIP  145



>ref|XP_004507264.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cicer arietinum]
Length=626

 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 105/138 (76%), Gaps = 5/138 (4%)
 Frame = +2

Query  479  EWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVD  658
            E FL F       + L  +S +A LS  G+N+EV AL+ IKT L DP+ +LENWD ++VD
Sbjct  7    ETFLCFVA-----FFLFWSSSNALLSSKGINFEVQALMGIKTCLVDPHGILENWDGDAVD  61

Query  659  PCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKL  838
            PCSW MVTCS +  V +LG+PSQ+LSGTLSP IGNLTNLQ+++LQNN I+G IP+E+GKL
Sbjct  62   PCSWNMVTCSSENLVISLGIPSQNLSGTLSPSIGNLTNLQTIVLQNNNITGPIPSELGKL  121

Query  839  XRLXTLDLSNNKFNGDIP  892
             +L TLDLS+N FNG+IP
Sbjct  122  FKLQTLDLSDNFFNGEIP  139



>gb|KFK25832.1| hypothetical protein AALP_AA8G167900 [Arabis alpina]
Length=636

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 103/142 (73%), Gaps = 5/142 (4%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M R  F+ F    LG   L+  S +  LS  GVN+EV AL+ IK  LHDP+ VL+NWD +
Sbjct  9    MMRTSFVYF----LGFLCLLC-SVNGLLSSKGVNFEVQALMDIKASLHDPHGVLDNWDRD  63

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            +VDPCSW MVTCS + +V  LG PSQ+LSGTLSP I NLTNL+ VLLQNN I+G IP+EI
Sbjct  64   AVDPCSWTMVTCSSENFVIGLGTPSQNLSGTLSPSITNLTNLRIVLLQNNNITGKIPSEI  123

Query  830  GKLXRLXTLDLSNNKFNGDIPS  895
            G+L RL TLDLS+N F G+IPS
Sbjct  124  GRLMRLQTLDLSDNFFRGEIPS  145



>ref|XP_009356495.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Pyrus x bretschneideri]
 ref|XP_009356496.1| PREDICTED: protein NSP-INTERACTING KINASE 2-like [Pyrus x bretschneideri]
Length=624

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  497  KVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRM  676
            K L    +  +    +  LSP GVNYEV AL+ IK  L DP  VL NWD  SVDPC W M
Sbjct  8    KALCFVAFFCLWNCATGLLSPKGVNYEVQALVGIKGALEDPRGVLRNWDETSVDPCIWNM  67

Query  677  VTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTL  856
            VTCSPDG V  LG PSQ+LSGTLSP IGNLTNLQ V  Q+N I+G IPAE+G+L +L TL
Sbjct  68   VTCSPDGLVIGLGTPSQNLSGTLSPCIGNLTNLQLVTFQDNHITGTIPAELGRLQKLQTL  127

Query  857  DLSNNKFNGDIPS  895
            DLS+N FNG+IPS
Sbjct  128  DLSSNLFNGEIPS  140



>ref|XP_009630581.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Nicotiana tomentosiformis]
Length=625

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 99/135 (73%), Gaps = 5/135 (4%)
 Frame = +2

Query  488  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCS  667
             LF V  L +W     + +  LSP GVN+EV AL+AIK  L DP+ VL+NWD  SVDPCS
Sbjct  11   FLF-VTFLALW----NTATGLLSPKGVNFEVQALMAIKAALKDPHGVLDNWDGTSVDPCS  65

Query  668  WRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRL  847
            W MVTCS + +V  LG PSQ+LSG+LSP IGNLTNLQ +LLQNN I+G IP E+GKL +L
Sbjct  66   WAMVTCSAESFVIGLGSPSQNLSGSLSPSIGNLTNLQIILLQNNNITGPIPKEVGKLFKL  125

Query  848  XTLDLSNNKFNGDIP  892
             TLDLS+N F GDIP
Sbjct  126  QTLDLSDNFFTGDIP  140



>ref|XP_010257839.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Nelumbo nucifera]
Length=624

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            S  LSP GVN+EV AL+ IK  L DP+ VL+NWD +SVDPCSW MVTCSP   V+ LG P
Sbjct  23   SCLLSPKGVNFEVQALMGIKASLVDPHGVLDNWDGDSVDPCSWTMVTCSPQSLVTGLGTP  82

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ+LSGTLSP IGNLTNLQ VLLQNN ISG +P E+G+L +L TLDLSNN F+G+IP+
Sbjct  83   SQNLSGTLSPSIGNLTNLQIVLLQNNNISGPLPPELGRLSKLRTLDLSNNFFSGEIPT  140



>ref|XP_004141483.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Cucumis sativus]
 gb|KGN52542.1| hypothetical protein Csa_5G642730 [Cucumis sativus]
Length=626

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
            +S +  LSP GVNYEV AL+ IK  L DP+ VLENWD ++VDPCSW MVTCSP+  V  L
Sbjct  22   SSINGLLSPKGVNYEVQALMGIKASLQDPHGVLENWDGDAVDPCSWTMVTCSPESLVIGL  81

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            G PSQ+LSGTLS  IGNLTNLQ VLLQNN I+G IP E G+L +L TLDLSNN F G+IP
Sbjct  82   GTPSQNLSGTLSSTIGNLTNLQIVLLQNNNITGPIPPEFGRLSKLQTLDLSNNFFTGEIP  141

Query  893  S  895
            S
Sbjct  142  S  142



>ref|XP_009407942.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=623

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 96/125 (77%), Gaps = 0/125 (0%)
 Frame = +2

Query  518  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDG  697
            + L   + +A LSP GVN+EV AL+ IK  L DP++VLENWD +SVDPCSW MVTCSP+ 
Sbjct  15   FFLFWAAGTALLSPKGVNFEVQALMGIKASLMDPHSVLENWDQDSVDPCSWTMVTCSPEN  74

Query  698  YVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKF  877
             V  L  PSQ+LSGTLSP IGNLTNL+ + LQNN +SG IP EIGKL +L T+DLSNN F
Sbjct  75   LVVGLATPSQNLSGTLSPSIGNLTNLKILFLQNNNMSGPIPPEIGKLSKLQTIDLSNNYF  134

Query  878  NGDIP  892
            +G+IP
Sbjct  135  SGEIP  139



>ref|XP_006844161.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Amborella trichopoda]
 gb|ERN05836.1| hypothetical protein AMTR_s00006p00261510 [Amborella trichopoda]
Length=620

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
             S +A LSP GVN+EV AL+ IK  L DP +VLENWD +SVDPCSW M+TCSP+  V  L
Sbjct  17   ASSTALLSPKGVNFEVQALMGIKQALKDPLSVLENWDGDSVDPCSWAMITCSPENLVIGL  76

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            G P QSLSGTLSP IGNLTNLQ VLLQNN ISG IP EIG+L  L TLDLSNN F+  IP
Sbjct  77   GTPGQSLSGTLSPSIGNLTNLQIVLLQNNNISGSIPHEIGRLSMLKTLDLSNNLFDDSIP  136



>emb|CDY26481.1| BnaC09g41870D [Brassica napus]
Length=637

 Score =   162 bits (409),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 94/119 (79%), Gaps = 0/119 (0%)
 Frame = +2

Query  536  SCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALG  715
            S S  LS  GVN+EV AL+ IK  LHDP+ VL+NWD ++VDPCSW MVTCS + +V  LG
Sbjct  23   SVSGLLSSKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDPCSWTMVTCSSENFVIGLG  82

Query  716  LPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
             PSQ+LSGTLSP I NLTNL+ VLLQNN I+G IP+EIG+L RL TLDLS+N F+G+IP
Sbjct  83   TPSQNLSGTLSPSITNLTNLRIVLLQNNYITGKIPSEIGRLTRLETLDLSDNFFHGEIP  141



>ref|XP_007151443.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
 gb|ESW23437.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
Length=626

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 102/131 (78%), Gaps = 0/131 (0%)
 Frame = +2

Query  500  VLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMV  679
             + L ++    +S +A LSP GVN+EV AL+ IK  L DP+ +L+NWD ++VDPCSW MV
Sbjct  10   AISLVVFFWFWSSSNALLSPKGVNFEVQALMGIKAFLVDPHGILDNWDGDAVDPCSWNMV  69

Query  680  TCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLD  859
            TCSP+  V +LG+PSQ+LSG LSP IGNLT LQ+V+LQNN I+G IP+EIGKL +L TLD
Sbjct  70   TCSPENLVISLGIPSQNLSGILSPSIGNLTYLQTVVLQNNNITGPIPSEIGKLSKLQTLD  129

Query  860  LSNNKFNGDIP  892
            LS+N FNG+IP
Sbjct  130  LSDNFFNGEIP  140



>gb|KJB60823.1| hypothetical protein B456_009G327400 [Gossypium raimondii]
Length=624

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 103/141 (73%), Gaps = 4/141 (3%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            + ++ F+L  V  + +W    +S    LSP GVN+EV AL+ IK  L DP+  L NWD  
Sbjct  3    LRKDKFVLNCVALVCLW----SSAFGLLSPKGVNFEVQALMGIKAFLVDPHGALGNWDDT  58

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            +VDPCSW M+TCS DG V+ALG PSQ+LSG L+P IGNLTNLQ V LQNN ISG+IP+E+
Sbjct  59   AVDPCSWNMITCSSDGLVTALGAPSQNLSGNLAPTIGNLTNLQLVNLQNNNISGNIPSEL  118

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            GKL +L TLDLSNN+FNG IP
Sbjct  119  GKLSKLKTLDLSNNRFNGQIP  139



>ref|XP_009378313.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Pyrus x bretschneideri]
Length=636

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 92/121 (76%), Gaps = 0/121 (0%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
            T  +  LSP GVN+EV AL+ IK  L DP+ VL+NWD +SVDPCSW MVTCSP+  V  L
Sbjct  33   TCVNGLLSPKGVNFEVQALMGIKGSLVDPHGVLDNWDDDSVDPCSWTMVTCSPESLVIGL  92

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            G PSQSLSGTLSP IGNLTNLQ VLLQNN I+G IP EI KL RL TLD+SNN F G +P
Sbjct  93   GTPSQSLSGTLSPSIGNLTNLQIVLLQNNNITGAIPLEIEKLSRLHTLDISNNMFTGAVP  152

Query  893  S  895
            S
Sbjct  153  S  153



>emb|CDP02372.1| unnamed protein product [Coffea canephora]
Length=624

 Score =   161 bits (408),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 101/141 (72%), Gaps = 3/141 (2%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            M RE   + +VL   +     +S    LSP GVN+EV AL+AIK  L DP+ VL+NWD +
Sbjct  1    MRRESKDVSRVL---VLFCCWSSALGLLSPKGVNFEVQALMAIKDALEDPHGVLDNWDGD  57

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            SVDPCSW M+TCS +  V  LG PSQ+LSGTLSP IGNLTNLQ +LLQNN I+G IP+EI
Sbjct  58   SVDPCSWTMITCSAESLVIGLGTPSQNLSGTLSPSIGNLTNLQIILLQNNNITGSIPSEI  117

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            GKL  L TLDLS+N+F G IP
Sbjct  118  GKLPNLQTLDLSDNRFTGQIP  138



>dbj|BAG93736.1| unnamed protein product [Oryza sativa Japonica Group]
Length=324

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 92/117 (79%), Gaps = 0/117 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SA LSP GVNYEV AL+ IKT L DP+ VL+NWD +SVDPCSW MVTCSP+  V+ L  P
Sbjct  26   SALLSPKGVNYEVQALMMIKTSLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTGLEAP  85

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            SQ+LSG LS  IGNLTNL+ VLLQNN I+G IP EIG+L +L TLDLS+N F+G IP
Sbjct  86   SQNLSGLLSASIGNLTNLEIVLLQNNNINGPIPEEIGRLTKLKTLDLSSNHFSGGIP  142



>ref|XP_008379484.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Malus domestica]
Length=625

 Score =   161 bits (407),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/115 (70%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +2

Query  551  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQS  730
            LSP GVN+EV AL+ IK  L DP+ VL+NWD +SVDPCSW MVTCSP+  V  LG PSQS
Sbjct  28   LSPKGVNFEVQALMGIKGSLVDPHGVLDNWDDDSVDPCSWTMVTCSPESLVIGLGTPSQS  87

Query  731  LSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LSGTLSP IGNLTNLQ VLLQNN I+G IP+EI KL +L TLD+SNN F G IPS
Sbjct  88   LSGTLSPSIGNLTNLQIVLLQNNNITGAIPSEIEKLSKLHTLDISNNMFTGAIPS  142



>gb|KEH25224.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=527

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 104/139 (75%), Gaps = 7/139 (5%)
 Frame = +2

Query  479  EWFLLFKVLGLGIWMLIATSCS-ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSV  655
            E FL F  L +  W     SC+ A LSP G+N+EV AL++IK  L DP+ + ENWD ++V
Sbjct  7    EVFLCFVTLFM-FW-----SCANALLSPKGINFEVQALVSIKESLMDPHGIFENWDGDAV  60

Query  656  DPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGK  835
            DPCSW MVTCSP+  V +LG+PSQ+LSGTLS  IGNLTNLQ+V+LQNN I+G IP+E+GK
Sbjct  61   DPCSWNMVTCSPENLVVSLGIPSQNLSGTLSSSIGNLTNLQTVVLQNNNITGPIPSELGK  120

Query  836  LXRLXTLDLSNNKFNGDIP  892
            L  L TLDLS+N F+G IP
Sbjct  121  LSMLQTLDLSDNLFHGKIP  139



>ref|XP_004491764.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Cicer arietinum]
Length=629

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 96/120 (80%), Gaps = 0/120 (0%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
            +S +A LSP GVN+EV AL+ IK  L DP+ VL+NWD ++VDPCSW MVTCS +  V  L
Sbjct  22   SSSNALLSPKGVNFEVQALMGIKDFLMDPHGVLDNWDGDAVDPCSWTMVTCSNENLVIGL  81

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            G PSQSLSGTLSP IGNLTNLQ VLLQNN I+G IP+E+GKL +L TLDLSNN F+G+IP
Sbjct  82   GTPSQSLSGTLSPSIGNLTNLQIVLLQNNNITGSIPSELGKLPKLQTLDLSNNFFSGEIP  141



>ref|XP_007153543.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
 gb|ESW25537.1| hypothetical protein PHAVU_003G044400g [Phaseolus vulgaris]
Length=621

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 104/141 (74%), Gaps = 3/141 (2%)
 Frame = +2

Query  470  MEREWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVN  649
            MER   +    L L     ++TS    LSP GVNYEV AL++IK  L DP++VL NWD +
Sbjct  1    MERRGDVALFCLAL---FFLSTSVVGLLSPKGVNYEVQALMSIKNSLMDPHSVLGNWDAD  57

Query  650  SVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEI  829
            +VDPC+W MVTCS D +V+ALG+PSQ++SG LSP IG+LTNL +VLLQ+N I+G IP+EI
Sbjct  58   AVDPCNWAMVTCSSDHFVTALGIPSQNISGRLSPSIGSLTNLLTVLLQDNNITGPIPSEI  117

Query  830  GKLXRLXTLDLSNNKFNGDIP  892
            GKL +L TLDLS+N F G +P
Sbjct  118  GKLQKLQTLDLSDNFFTGQLP  138



>gb|AHF18212.1| brassinosteroid insensitive 1-associated receptor kinase 1 [Saccharum 
hybrid cultivar]
Length=626

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            S  LSP GVNYEV AL+ IK  L DP+ VL+NWD +SVDPCSW MVTCSP+  V+ L  P
Sbjct  25   SGLLSPKGVNYEVQALMMIKNYLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTGLEAP  84

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ+LSG LSP IGNLTNL++VLLQNN I+G IPAEIGKL +L TLDLS+N  +G+IPS
Sbjct  85   SQNLSGILSPSIGNLTNLETVLLQNNNINGLIPAEIGKLRKLKTLDLSSNHLSGEIPS  142



>ref|XP_002452616.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
 gb|EES05592.1| hypothetical protein SORBIDRAFT_04g029170 [Sorghum bicolor]
Length=626

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            S  LSP GVNYEV AL+ IK  L DP+ VL+NWD +SVDPCSW MVTCSP+  V+ L  P
Sbjct  25   SGLLSPKGVNYEVQALMMIKNYLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTGLEAP  84

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            SQ+LSG LSP IGNLTNL++VLLQNN I+G IPAEIGKL +L TLDLS+N  +G+IPS
Sbjct  85   SQNLSGILSPSIGNLTNLETVLLQNNNINGLIPAEIGKLRKLKTLDLSSNHLSGEIPS  142



>ref|XP_009121529.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Brassica rapa]
Length=634

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 97/137 (71%), Gaps = 8/137 (6%)
 Frame = +2

Query  482  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDP  661
            +FL F  L          S S  LS  GVN+EV AL+ IK  LHDP+ VL+NWD ++VDP
Sbjct  9    YFLAFSCL--------LCSVSGLLSSKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDP  60

Query  662  CSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLX  841
            CSW MVTCS + +V  LG PSQ+LSGTLSP I NLTNL+ VLLQNN I+G IP EIG+L 
Sbjct  61   CSWTMVTCSSENFVIGLGTPSQNLSGTLSPSITNLTNLRIVLLQNNNITGKIPYEIGRLT  120

Query  842  RLXTLDLSNNKFNGDIP  892
            RL TLDLS+N F G+IP
Sbjct  121  RLETLDLSDNFFRGEIP  137



>gb|KEH25223.1| NSP-interacting kinase-like protein [Medicago truncatula]
Length=625

 Score =   160 bits (406),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 104/139 (75%), Gaps = 7/139 (5%)
 Frame = +2

Query  479  EWFLLFKVLGLGIWMLIATSCS-ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSV  655
            E FL F  L +  W     SC+ A LSP G+N+EV AL++IK  L DP+ + ENWD ++V
Sbjct  7    EVFLCFVTLFM-FW-----SCANALLSPKGINFEVQALVSIKESLMDPHGIFENWDGDAV  60

Query  656  DPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGK  835
            DPCSW MVTCSP+  V +LG+PSQ+LSGTLS  IGNLTNLQ+V+LQNN I+G IP+E+GK
Sbjct  61   DPCSWNMVTCSPENLVVSLGIPSQNLSGTLSSSIGNLTNLQTVVLQNNNITGPIPSELGK  120

Query  836  LXRLXTLDLSNNKFNGDIP  892
            L  L TLDLS+N F+G IP
Sbjct  121  LSMLQTLDLSDNLFHGKIP  139



>ref|XP_002309372.1| leucine-rich repeat family protein [Populus trichocarpa]
 gb|EEE92895.1| leucine-rich repeat family protein [Populus trichocarpa]
Length=640

 Score =   160 bits (405),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = +2

Query  488  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCS  667
            +  K+L L I+ L     S +  P   N+EV ALI+I+  LHDPY VL NWD +SVDPCS
Sbjct  1    MALKLLHLSIFFLFLARLSLSYEPR--NHEVDALISIREALHDPYGVLNNWDEDSVDPCS  58

Query  668  WRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRL  847
            W M+TCSPD  V  LG PSQSLSGTLS  IGNLTNL+ VLLQNN ISG IP E+G L +L
Sbjct  59   WAMITCSPDNLVICLGAPSQSLSGTLSGAIGNLTNLRQVLLQNNNISGQIPPELGTLSKL  118

Query  848  XTLDLSNNKFNGDIP  892
             TLDLSNN+F+  +P
Sbjct  119  QTLDLSNNRFSSVVP  133



>ref|XP_006593318.1| PREDICTED: NSP-interacting kinase isoform X2 [Glycine max]
Length=510

 Score =   159 bits (402),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            +A LSP GVN+EV AL+ IK  L DP+ +L+NWD ++VDPCSW MVTCSP+  V +LG+P
Sbjct  23   NALLSPKGVNFEVQALMGIKASLVDPHGILDNWDGDAVDPCSWNMVTCSPENLVISLGIP  82

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            SQ+LSGTLSP IGNLTNLQ+V+LQNN I+G IP+E+GKL +L TLDLS+N  +G+IP
Sbjct  83   SQNLSGTLSPSIGNLTNLQTVVLQNNNITGPIPSELGKLSKLQTLDLSDNFLSGEIP  139



>ref|XP_006290715.1| hypothetical protein CARUB_v10016813mg [Capsella rubella]
 gb|EOA23613.1| hypothetical protein CARUB_v10016813mg [Capsella rubella]
Length=651

 Score =   160 bits (404),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/117 (68%), Positives = 88/117 (75%), Gaps = 0/117 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            SA L+  GVNYEV+ALI IK  L DP+ VL NWD  +VDPCSW M+TCS DG+V  LG P
Sbjct  46   SAELTDKGVNYEVLALIGIKNSLIDPHGVLMNWDDTAVDPCSWNMITCSSDGFVIILGAP  105

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            SQ LSGTLS  I NLT LQ+VLLQNN I+GHIP EIGKL +L TLDLS N F G IP
Sbjct  106  SQDLSGTLSSSISNLTYLQTVLLQNNYITGHIPHEIGKLMKLKTLDLSTNNFTGQIP  162



>emb|CDX69484.1| BnaA10g18330D [Brassica napus]
Length=634

 Score =   159 bits (403),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 97/137 (71%), Gaps = 8/137 (6%)
 Frame = +2

Query  482  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDP  661
            +FL F  L          S S  LS  GVN+EV AL+ IK  LHDP+ VL+NWD ++VDP
Sbjct  9    YFLAFSCL--------LCSVSGLLSSKGVNFEVQALMDIKASLHDPHGVLDNWDRDAVDP  60

Query  662  CSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLX  841
            CSW MVTCS + +V  LG PSQ+LSGTLSP I NL NL+ VLLQNN I+G IP+EIG+L 
Sbjct  61   CSWTMVTCSSENFVIGLGTPSQNLSGTLSPSITNLANLRIVLLQNNNITGKIPSEIGRLT  120

Query  842  RLXTLDLSNNKFNGDIP  892
            RL TLDLS+N F G+IP
Sbjct  121  RLETLDLSDNFFRGEIP  137



>ref|XP_003572984.2| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Brachypodium 
distachyon]
Length=628

 Score =   159 bits (403),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
            T  S  LSP GVNYEV AL+ IK  L DP+ VL NWD +SVDPCSW MVTCS +  V+ L
Sbjct  23   TPASGLLSPKGVNYEVQALMMIKNYLKDPHGVLRNWDQDSVDPCSWTMVTCSQENLVTGL  82

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
              PSQ+LSG LSP IGNLTNL+ VLLQNN I+G IPA+IGKL +L TLDLS+N F+G+IP
Sbjct  83   EAPSQNLSGLLSPSIGNLTNLEIVLLQNNNINGRIPADIGKLTKLKTLDLSSNHFSGEIP  142

Query  893  S  895
            S
Sbjct  143  S  143



>ref|XP_010236002.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Brachypodium 
distachyon]
Length=627

 Score =   159 bits (403),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 93/121 (77%), Gaps = 0/121 (0%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
            T  S  LSP GVNYEV AL+ IK  L DP+ VL NWD +SVDPCSW MVTCS +  V+ L
Sbjct  23   TPASGLLSPKGVNYEVQALMMIKNYLKDPHGVLRNWDQDSVDPCSWTMVTCSQENLVTGL  82

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
              PSQ+LSG LSP IGNLTNL+ VLLQNN I+G IPA+IGKL +L TLDLS+N F+G+IP
Sbjct  83   EAPSQNLSGLLSPSIGNLTNLEIVLLQNNNINGRIPADIGKLTKLKTLDLSSNHFSGEIP  142

Query  893  S  895
            S
Sbjct  143  S  143



>ref|XP_009400110.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=624

 Score =   159 bits (403),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  518  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDG  697
            +  + T  +ATLSP GVN+EV  L+ IK  L DP+ VLENWD +SVDPCSW MVTCSP+ 
Sbjct  18   FFFLWTIVTATLSPKGVNFEVQVLMGIKAYLVDPHGVLENWDQDSVDPCSWTMVTCSPEN  77

Query  698  YVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKF  877
             V  L  PSQ+LSGTL+P IGNLTNLQ + LQNN +SG +P EIGKL +L T+DLSNN F
Sbjct  78   SVIGLATPSQNLSGTLNPSIGNLTNLQILFLQNNNLSGPVPPEIGKLSKLQTVDLSNNYF  137

Query  878  NGDIPS  895
            +G IP+
Sbjct  138  SGKIPA  143



>ref|XP_006593317.1| PREDICTED: NSP-interacting kinase isoform X1 [Glycine max]
 gb|KHN02661.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=624

 Score =   159 bits (403),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            +A LSP GVN+EV AL+ IK  L DP+ +L+NWD ++VDPCSW MVTCSP+  V +LG+P
Sbjct  23   NALLSPKGVNFEVQALMGIKASLVDPHGILDNWDGDAVDPCSWNMVTCSPENLVISLGIP  82

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            SQ+LSGTLSP IGNLTNLQ+V+LQNN I+G IP+E+GKL +L TLDLS+N  +G+IP
Sbjct  83   SQNLSGTLSPSIGNLTNLQTVVLQNNNITGPIPSELGKLSKLQTLDLSDNFLSGEIP  139



>ref|XP_009400102.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=627

 Score =   159 bits (403),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = +2

Query  518  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDG  697
            +  + T  +ATLSP GVN+EV  L+ IK  L DP+ VLENWD +SVDPCSW MVTCSP+ 
Sbjct  18   FFFLWTIVTATLSPKGVNFEVQVLMGIKAYLVDPHGVLENWDQDSVDPCSWTMVTCSPEN  77

Query  698  YVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKF  877
             V  L  PSQ+LSGTL+P IGNLTNLQ + LQNN +SG +P EIGKL +L T+DLSNN F
Sbjct  78   SVIGLATPSQNLSGTLNPSIGNLTNLQILFLQNNNLSGPVPPEIGKLSKLQTVDLSNNYF  137

Query  878  NGDIPS  895
            +G IP+
Sbjct  138  SGKIPA  143



>ref|NP_001238448.1| NSP-interacting kinase precursor [Glycine max]
 gb|ACM89473.1| NSP-interacting kinase [Glycine max]
Length=600

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 97/117 (83%), Gaps = 0/117 (0%)
 Frame = +2

Query  542  SATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLP  721
            +A LSP GVN+EV AL+ IK  L DP+ +L+NWD ++VDPCSW MVTCSP+  V +LG+P
Sbjct  23   NALLSPKGVNFEVQALMGIKASLVDPHGILDNWDGDAVDPCSWNMVTCSPENLVISLGIP  82

Query  722  SQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            SQ+LSGTLSP IGNLTNLQ+V+LQNN I+G IP+E+GKL +L TLDLS+N  +G+IP
Sbjct  83   SQNLSGTLSPSIGNLTNLQTVVLQNNNITGPIPSELGKLSKLQTLDLSDNFLSGEIP  139



>ref|XP_009394555.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=634

 Score =   159 bits (403),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 97/139 (70%), Gaps = 9/139 (6%)
 Frame = +2

Query  479  EWFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVD  658
             W + F  LG           SA LSP GVN+EV AL+ IK  L DP+ VL NWD +SVD
Sbjct  22   HWVVFFWTLGFA---------SALLSPKGVNFEVQALMDIKASLKDPHGVLGNWDRDSVD  72

Query  659  PCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKL  838
            PCSW MV+CSP+  V  L  PSQ++SGTLSP IGNLTNL+ VLLQNN ISG IP EIGKL
Sbjct  73   PCSWSMVSCSPENLVIGLETPSQNMSGTLSPSIGNLTNLEFVLLQNNYISGSIPPEIGKL  132

Query  839  XRLXTLDLSNNKFNGDIPS  895
             +L  LDLS+N F+G+IP+
Sbjct  133  SKLHKLDLSSNHFHGEIPA  151



>emb|CDO96836.1| unnamed protein product [Coffea canephora]
Length=617

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 97/127 (76%), Gaps = 0/127 (0%)
 Frame = +2

Query  515  IWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPD  694
             W    +  ++ LSP GVNYEV AL++IK  + D  +VL+ WD+NSVDPC+W MV CSP+
Sbjct  13   FWTARVSVSTSLLSPKGVNYEVAALMSIKGKMRDDNHVLDGWDINSVDPCTWNMVGCSPE  72

Query  695  GYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNK  874
            G+V +L + S  LSGTLSP IGNL++LQ++LLQNN +SG+IPAEIGKL  L TLDLS N+
Sbjct  73   GFVVSLEMVSVGLSGTLSPSIGNLSHLQTMLLQNNHLSGYIPAEIGKLSELQTLDLSANQ  132

Query  875  FNGDIPS  895
            F GDIPS
Sbjct  133  FVGDIPS  139



>ref|XP_008389350.1| PREDICTED: LOW QUALITY PROTEIN: protein NSP-INTERACTING KINASE 
2-like [Malus domestica]
Length=621

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 94/133 (71%), Gaps = 0/133 (0%)
 Frame = +2

Query  497  KVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRM  676
            K L    +  + +  +  LSP GVNYEV AL+AIK  L DP  VL NWD  SVDPC W M
Sbjct  4    KALCFVAFFCLWSCATGLLSPKGVNYEVQALVAIKGALEDPRGVLRNWDETSVDPCIWNM  63

Query  677  VTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTL  856
            VTCS DG V  LG PSQ+LSGTLSP IGNLTNLQ V  Q+N I+G IPAE+G+L +L TL
Sbjct  64   VTCSLDGLVIGLGTPSQNLSGTLSPSIGNLTNLQLVTFQDNHITGTIPAELGRLQKLQTL  123

Query  857  DLSNNKFNGDIPS  895
            DLS+N  NG+IPS
Sbjct  124  DLSSNLLNGEIPS  136



>ref|XP_008230341.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Prunus mume]
Length=623

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +2

Query  551  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQS  730
            LSP GVN+EV AL+ IK  L DP+ VL+NWD +SVDPCSW MVTCSP+  V  LG PSQS
Sbjct  26   LSPKGVNFEVQALMDIKESLVDPHGVLDNWDDDSVDPCSWTMVTCSPESLVIGLGTPSQS  85

Query  731  LSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LSGTLSP IGNLTNLQ VLLQNN I+G IP +I +L +L TLD+SNN F G+IPS
Sbjct  86   LSGTLSPSIGNLTNLQIVLLQNNNITGAIPRDIERLSKLHTLDISNNFFTGEIPS  140



>ref|XP_007221991.1| hypothetical protein PRUPE_ppa002873mg [Prunus persica]
 gb|EMJ23190.1| hypothetical protein PRUPE_ppa002873mg [Prunus persica]
Length=625

 Score =   159 bits (402),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 97/136 (71%), Gaps = 4/136 (3%)
 Frame = +2

Query  488  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCS  667
            L F VL L +W    TS +  LSP GVN EV AL+AIK  L DP  VL+NWD  SVDPC 
Sbjct  10   LCFVVL-LCLW---TTSVTGLLSPKGVNPEVQALMAIKEALKDPRGVLKNWDETSVDPCI  65

Query  668  WRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRL  847
            W MVTCS DG V  LG PSQ+LSGTLSP IGNLTNLQ V  Q+N I+G IP E+GKL +L
Sbjct  66   WNMVTCSLDGLVIGLGTPSQNLSGTLSPSIGNLTNLQLVTFQDNHITGSIPTELGKLQKL  125

Query  848  XTLDLSNNKFNGDIPS  895
             TLDLS+N FNG IPS
Sbjct  126  QTLDLSSNLFNGQIPS  141



>emb|CBI16897.3| unnamed protein product [Vitis vinifera]
Length=622

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 99/138 (72%), Gaps = 8/138 (6%)
 Frame = +2

Query  482  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDP  661
            WF+ F    L  W    TS +  LSP GVN+EV AL+ IK  L DP+ VL+NWD ++VDP
Sbjct  9    WFVPF----LWFW----TSANGLLSPKGVNFEVQALMGIKAFLVDPHGVLDNWDGDAVDP  60

Query  662  CSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLX  841
            CSW MVTCS D  V  LG PSQ+LSGTLSP IGNLTNLQ VLLQNN I+G IP E+G+L 
Sbjct  61   CSWTMVTCSTDSLVVGLGTPSQNLSGTLSPSIGNLTNLQIVLLQNNNITGPIPQELGRLS  120

Query  842  RLXTLDLSNNKFNGDIPS  895
            +L TLDLSNN F  ++PS
Sbjct  121  KLHTLDLSNNFFTDEVPS  138



>ref|XP_002278965.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
Length=624

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 99/138 (72%), Gaps = 8/138 (6%)
 Frame = +2

Query  482  WFLLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDP  661
            WF+ F    L  W    TS +  LSP GVN+EV AL+ IK  L DP+ VL+NWD ++VDP
Sbjct  11   WFVPF----LWFW----TSANGLLSPKGVNFEVQALMGIKAFLVDPHGVLDNWDGDAVDP  62

Query  662  CSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLX  841
            CSW MVTCS D  V  LG PSQ+LSGTLSP IGNLTNLQ VLLQNN I+G IP E+G+L 
Sbjct  63   CSWTMVTCSTDSLVVGLGTPSQNLSGTLSPSIGNLTNLQIVLLQNNNITGPIPQELGRLS  122

Query  842  RLXTLDLSNNKFNGDIPS  895
            +L TLDLSNN F  ++PS
Sbjct  123  KLHTLDLSNNFFTDEVPS  140



>ref|XP_008341829.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Malus domestica]
Length=636

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +2

Query  551  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQS  730
            LSP GVN+EV AL+ +K  L DP+ VL+NWD +SVDPCSW MVTCSP+  V  LG PSQS
Sbjct  39   LSPKGVNFEVQALMGLKNSLVDPHGVLDNWDDDSVDPCSWTMVTCSPESLVIGLGTPSQS  98

Query  731  LSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LSGTLSP IGNLTNLQ VLLQNN I+G IP EI +L +L TLD+SNN F G IPS
Sbjct  99   LSGTLSPSIGNLTNLQIVLLQNNNITGPIPREIERLSKLRTLDISNNFFTGAIPS  153



>gb|KFK39862.1| hypothetical protein AALP_AA3G298400 [Arabis alpina]
Length=631

 Score =   158 bits (400),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +2

Query  545  ATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPS  724
            A L+  GVNYEV+ALI IK+ L DP+ VL NWD  +VDPCSW M+ C+ DG+V +LG PS
Sbjct  28   AELTDKGVNYEVLALIGIKSSLIDPHGVLMNWDDTAVDPCSWNMIGCTSDGFVLSLGAPS  87

Query  725  QSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            Q+LSGTL+  IGNLT LQSVLLQNN I+GHIP EIGKL +L TLDLS N F G IP
Sbjct  88   QNLSGTLASSIGNLTYLQSVLLQNNYITGHIPNEIGKLRKLKTLDLSTNNFTGQIP  143



>gb|KHN13790.1| Protein NSP-INTERACTING KINASE 1 [Glycine soja]
Length=623

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  557  PSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQSLS  736
            P GVN+EV AL+ IK  L DP+ VL+NWD ++VDPCSW MVTCS +  V  LG PSQSLS
Sbjct  27   PKGVNFEVQALMGIKDSLEDPHGVLDNWDGDAVDPCSWTMVTCSSENLVIGLGTPSQSLS  86

Query  737  GTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            GTLSP IGNLTNLQ VLLQNN ISG IP+E+GKL RL TLDLSNN F+G IP
Sbjct  87   GTLSPSIGNLTNLQIVLLQNNNISGPIPSELGKLSRLQTLDLSNNFFSGGIP  138



>gb|EEC73926.1| hypothetical protein OsI_08784 [Oryza sativa Indica Group]
Length=627

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +2

Query  539  CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGL  718
             SA LSP GVNYEV AL+ IKT L DP+ VL+NWD +SVDPCSW MVTCSP+  V+ L  
Sbjct  25   ASALLSPKGVNYEVQALMMIKTSLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTGLEA  84

Query  719  PSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            PSQ+LSG LS  IGNLTNL+ VLLQNN I+G IP EIG+L +L TLDLS+N F+G IP+
Sbjct  85   PSQNLSGLLSASIGNLTNLEIVLLQNNNINGPIPEEIGRLTKLKTLDLSSNHFSGGIPN  143



>ref|XP_009373732.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Pyrus x bretschneideri]
Length=636

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 102/149 (68%), Gaps = 15/149 (10%)
 Frame = +2

Query  494  FKVLGLGIWMLIATSCSAT---------------LSPSGVNYEVVALIAIKTGLHDPYNV  628
            F+ +G+GI M +  + +A                LSP GVN+EV AL+ ++  L DP+ V
Sbjct  5    FESMGIGIGMGVRGAKAALCFMAFLWSWICGNGLLSPKGVNFEVQALMGMRNSLVDPHGV  64

Query  629  LENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAIS  808
            L+NWD +SVDPCSW MVTCSP+  V  LG PSQSLSGTLSP IGNLTNLQ VLLQNN I+
Sbjct  65   LDNWDDDSVDPCSWTMVTCSPESLVIGLGTPSQSLSGTLSPSIGNLTNLQIVLLQNNNIT  124

Query  809  GHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            G IP EI +L +L TLD+SNN F G IPS
Sbjct  125  GPIPREIERLSKLRTLDISNNFFTGAIPS  153



>gb|EEE57731.1| hypothetical protein OsJ_08242 [Oryza sativa Japonica Group]
Length=627

 Score =   158 bits (399),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/119 (66%), Positives = 93/119 (78%), Gaps = 0/119 (0%)
 Frame = +2

Query  539  CSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGL  718
             SA LSP GVNYEV AL+ IKT L DP+ VL+NWD +SVDPCSW MVTCSP+  V+ L  
Sbjct  25   ASALLSPKGVNYEVQALMMIKTSLKDPHGVLKNWDQDSVDPCSWTMVTCSPENLVTGLEA  84

Query  719  PSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            PSQ+LSG LS  IGNLTNL+ VLLQNN I+G IP EIG+L +L TLDLS+N F+G IP+
Sbjct  85   PSQNLSGLLSASIGNLTNLEIVLLQNNNINGPIPEEIGRLTKLKTLDLSSNHFSGGIPN  143



>ref|XP_009131513.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Brassica rapa]
Length=636

 Score =   158 bits (399),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  518  WMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDG  697
            ++ + TS +  LS +GVN+EV AL+ IK  LHDP+ VL++WD ++VDPCSW MVTCS + 
Sbjct  20   FLYLLTSVNGLLSSNGVNFEVQALMDIKASLHDPHGVLDSWDRDAVDPCSWTMVTCSSEN  79

Query  698  YVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKF  877
            +V  LG PSQ+LSGTLSP I NLTNL+ VLLQNN I+G IP+E G+L RL TLDLS+N F
Sbjct  80   FVIGLGTPSQNLSGTLSPSITNLTNLRIVLLQNNNITGKIPSEFGRLTRLETLDLSDNFF  139

Query  878  NGDIP  892
             G++P
Sbjct  140  LGEVP  144



>ref|XP_011099082.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Sesamum 
indicum]
Length=627

 Score =   157 bits (398),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +2

Query  533  TSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSAL  712
            +S    LSP GVN+EV AL+ IK GL DP+ VL+NWD ++VDPCSW MVTCS +  V  L
Sbjct  22   SSAIGLLSPKGVNFEVQALMGIKAGLRDPHGVLDNWDGDAVDPCSWTMVTCSSESLVIGL  81

Query  713  GLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            G PSQ+LSGTLSP IGNLTNLQ +LLQNN I+G IP E+G+L +L TLDLSNN F G IP
Sbjct  82   GSPSQNLSGTLSPSIGNLTNLQIILLQNNNITGPIPVELGRLSKLQTLDLSNNLFIGSIP  141



>ref|XP_011018089.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At4g30520 [Populus euphratica]
Length=637

 Score =   157 bits (398),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 95/136 (70%), Gaps = 2/136 (1%)
 Frame = +2

Query  488  LLFKVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCS  667
            + FK+L L  + L     S +  P   N+EV ALI I+  LHDP+ VL NWD +SVDPCS
Sbjct  1    MAFKLLHLSFFSLFLAKLSLSYEPR--NHEVEALIGIREALHDPHGVLSNWDEDSVDPCS  58

Query  668  WRMVTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRL  847
            W M+TCSP+  V  LG PSQSLSG LS  IGNLTNL+ VLLQNN ISG IP E+G L +L
Sbjct  59   WAMITCSPENLVIGLGAPSQSLSGFLSGTIGNLTNLRQVLLQNNNISGQIPPELGTLSKL  118

Query  848  XTLDLSNNKFNGDIPS  895
             TLDLSNN+F+G +P 
Sbjct  119  QTLDLSNNRFSGGVPE  134



>ref|XP_004304172.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Fragaria vesca subsp. 
vesca]
Length=622

 Score =   157 bits (398),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +2

Query  551  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQS  730
            LSP GVN+EV AL+ IK  L DP+ VL NWD ++VDPCSW MVTCSP+  V  LG+PSQ+
Sbjct  26   LSPKGVNFEVQALMGIKEALEDPHGVLGNWDYDAVDPCSWTMVTCSPENLVVGLGVPSQN  85

Query  731  LSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIPS  895
            LSGTLSP IGNLTNLQ VLLQNN I+G IP EIGKL +L TLD+S+N   G IPS
Sbjct  86   LSGTLSPSIGNLTNLQIVLLQNNNITGPIPQEIGKLSKLKTLDVSSNFLTGGIPS  140



>ref|XP_010268431.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At2g23950 [Nelumbo nucifera]
Length=656

 Score =   157 bits (398),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 99/133 (74%), Gaps = 2/133 (2%)
 Frame = +2

Query  497  KVLGLGIWMLIATSCSATLSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRM  676
            +V+ L I+ L   S S +  P   N+EV ALI+I+  L+DP+ VL NWD +SVDPCSW M
Sbjct  18   RVVVLIIFFLCTASFSLSYEPR--NHEVEALISIRRALNDPHGVLNNWDEDSVDPCSWAM  75

Query  677  VTCSPDGYVSALGLPSQSLSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTL  856
            +TCSP+  V  LG PSQ+LSGTLS  IGNLTNL+ VLLQNN ISG IPAE+G L +L TL
Sbjct  76   ITCSPENLVVGLGAPSQNLSGTLSGRIGNLTNLRQVLLQNNNISGEIPAELGSLAKLQTL  135

Query  857  DLSNNKFNGDIPS  895
            DLSNN+F+G++P 
Sbjct  136  DLSNNRFSGNVPE  148



>gb|EMT30099.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=609

 Score =   157 bits (397),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 91/114 (80%), Gaps = 0/114 (0%)
 Frame = +2

Query  551  LSPSGVNYEVVALIAIKTGLHDPYNVLENWDVNSVDPCSWRMVTCSPDGYVSALGLPSQS  730
            LSP GVNYEV AL+ IK  L DP+ VL+NWD +SVDPCSW MVTCS +  V+ L  PSQ+
Sbjct  28   LSPKGVNYEVQALMTIKNYLKDPHGVLKNWDQDSVDPCSWTMVTCSQENLVTGLEAPSQN  87

Query  731  LSGTLSPGIGNLTNLQSVLLQNNAISGHIPAEIGKLXRLXTLDLSNNKFNGDIP  892
            LSG LSP IGNLTNL+ VLLQNN I+G IPAEIG+L +L TLDLS+N F+G+IP
Sbjct  88   LSGLLSPSIGNLTNLEIVLLQNNNINGRIPAEIGRLTKLRTLDLSSNHFSGEIP  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2059730854950