BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9381

Length=676
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771645.1|  PREDICTED: nucleobase-ascorbate transporter 1      297   4e-94   Nicotiana sylvestris
ref|XP_009592403.1|  PREDICTED: nucleobase-ascorbate transporter 1      295   3e-93   Nicotiana tomentosiformis
emb|CDP11315.1|  unnamed protein product                                294   4e-93   Coffea canephora [robusta coffee]
ref|XP_006357961.1|  PREDICTED: nucleobase-ascorbate transporter ...    293   2e-92   Solanum tuberosum [potatoes]
ref|XP_004243518.1|  PREDICTED: nucleobase-ascorbate transporter 1      293   2e-92   Solanum lycopersicum
ref|XP_010110631.1|  Nucleobase-ascorbate transporter 1                 291   9e-92   
ref|XP_011086376.1|  PREDICTED: nucleobase-ascorbate transporter 1      290   2e-91   Sesamum indicum [beniseed]
ref|XP_002274603.1|  PREDICTED: nucleobase-ascorbate transporter ...    288   9e-91   Vitis vinifera
emb|CAN70193.1|  hypothetical protein VITISV_004001                     286   2e-90   Vitis vinifera
ref|XP_010252545.1|  PREDICTED: nucleobase-ascorbate transporter 1      284   3e-89   Nelumbo nucifera [Indian lotus]
gb|EYU43133.1|  hypothetical protein MIMGU_mgv1a004837mg                283   7e-89   Erythranthe guttata [common monkey flower]
ref|XP_002883707.1|  xanthine/uracil permease family protein            283   1e-88   
ref|XP_010691486.1|  PREDICTED: nucleobase-ascorbate transporter ...    280   1e-88   
ref|XP_012080636.1|  PREDICTED: nucleobase-ascorbate transporter 1      283   1e-88   Jatropha curcas
ref|XP_008379668.1|  PREDICTED: nucleobase-ascorbate transporter 1      282   2e-88   
ref|XP_003555666.1|  PREDICTED: nucleobase-ascorbate transporter ...    281   4e-88   Glycine max [soybeans]
gb|KHN41326.1|  Nucleobase-ascorbate transporter 1                      281   4e-88   Glycine soja [wild soybean]
ref|XP_010035524.1|  PREDICTED: nucleobase-ascorbate transporter 1      281   5e-88   Eucalyptus grandis [rose gum]
ref|XP_009365106.1|  PREDICTED: nucleobase-ascorbate transporter 1      281   6e-88   Pyrus x bretschneideri [bai li]
ref|XP_006396141.1|  hypothetical protein EUTSA_v10002485mg             281   7e-88   Eutrema salsugineum [saltwater cress]
ref|XP_010467086.1|  PREDICTED: nucleobase-ascorbate transporter 1      281   7e-88   Camelina sativa [gold-of-pleasure]
ref|NP_178636.1|  nucleobase-ascorbate transporter 1                    280   8e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010691484.1|  PREDICTED: nucleobase-ascorbate transporter ...    280   1e-87   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007215477.1|  hypothetical protein PRUPE_ppa006581mg             276   1e-87   
gb|AES71659.2|  nucleobase-ascorbate transporter-like protein           280   1e-87   Medicago truncatula
ref|XP_007146103.1|  hypothetical protein PHAVU_006G012700g             280   1e-87   Phaseolus vulgaris [French bean]
emb|CDY18053.1|  BnaC07g04170D                                          280   1e-87   Brassica napus [oilseed rape]
ref|XP_003601408.1|  Nucleobase ascorbate transporter                   280   2e-87   
ref|XP_004502044.1|  PREDICTED: nucleobase-ascorbate transporter ...    280   2e-87   Cicer arietinum [garbanzo]
ref|XP_007049166.1|  Xanthine/uracil permease family protein isof...    279   3e-87   Theobroma cacao [chocolate]
ref|XP_006447639.1|  hypothetical protein CICLE_v10014919mg             279   4e-87   Citrus clementina [clementine]
emb|CDX93090.1|  BnaA03g38120D                                          279   4e-87   
ref|XP_006469618.1|  PREDICTED: nucleobase-ascorbate transporter ...    278   4e-87   
ref|XP_009136180.1|  PREDICTED: nucleobase-ascorbate transporter 1      278   4e-87   Brassica rapa
emb|CDY50943.1|  BnaC03g74430D                                          278   5e-87   Brassica napus [oilseed rape]
ref|XP_003542318.1|  PREDICTED: nucleobase-ascorbate transporter ...    278   7e-87   Glycine max [soybeans]
gb|KFK39879.1|  hypothetical protein AALP_AA3G300500                    277   1e-86   Arabis alpina [alpine rockcress]
ref|XP_008456413.1|  PREDICTED: nucleobase-ascorbate transporter ...    275   2e-86   Cucumis melo [Oriental melon]
ref|XP_008230014.1|  PREDICTED: nucleobase-ascorbate transporter 1      276   5e-86   Prunus mume [ume]
ref|XP_006297434.1|  hypothetical protein CARUB_v10013457mg             275   1e-85   Capsella rubella
ref|XP_008456412.1|  PREDICTED: nucleobase-ascorbate transporter ...    275   1e-85   Cucumis melo [Oriental melon]
ref|XP_004149274.1|  PREDICTED: nucleobase-ascorbate transporter 1      274   2e-85   Cucumis sativus [cucumbers]
ref|XP_004304090.1|  PREDICTED: nucleobase-ascorbate transporter ...    273   4e-85   Fragaria vesca subsp. vesca
ref|XP_008799349.1|  PREDICTED: nucleobase-ascorbate transporter ...    273   7e-85   Phoenix dactylifera
ref|XP_010533013.1|  PREDICTED: nucleobase-ascorbate transporter 1      273   7e-85   Tarenaya hassleriana [spider flower]
ref|XP_002320481.1|  xanthine/uracil permease family protein            272   1e-84   Populus trichocarpa [western balsam poplar]
gb|EYU34044.1|  hypothetical protein MIMGU_mgv1a004592mg                271   4e-84   Erythranthe guttata [common monkey flower]
ref|XP_011047203.1|  PREDICTED: nucleobase-ascorbate transporter 1      271   5e-84   Populus euphratica
gb|KJB08649.1|  hypothetical protein B456_001G095500                    270   7e-84   Gossypium raimondii
ref|XP_011626932.1|  PREDICTED: nucleobase-ascorbate transporter ...    268   8e-84   Amborella trichopoda
ref|XP_009395859.1|  PREDICTED: nucleobase-ascorbate transporter ...    270   1e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006828104.1|  PREDICTED: nucleobase-ascorbate transporter ...    268   4e-83   Amborella trichopoda
ref|XP_009415455.1|  PREDICTED: nucleobase-ascorbate transporter ...    268   8e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010943259.1|  PREDICTED: nucleobase-ascorbate transporter 1      265   6e-82   Elaeis guineensis
gb|KJB42851.1|  hypothetical protein B456_007G170500                    263   2e-81   Gossypium raimondii
gb|KJB42850.1|  hypothetical protein B456_007G170500                    263   6e-81   Gossypium raimondii
ref|XP_008803524.1|  PREDICTED: nucleobase-ascorbate transporter ...    257   8e-79   Phoenix dactylifera
ref|XP_007141636.1|  hypothetical protein PHAVU_008G212800g             253   3e-77   Phaseolus vulgaris [French bean]
ref|XP_003545573.2|  PREDICTED: nucleobase-ascorbate transporter ...    254   4e-77   Glycine max [soybeans]
ref|XP_006595823.1|  PREDICTED: nucleobase-ascorbate transporter ...    254   6e-77   Glycine max [soybeans]
ref|XP_003519453.2|  PREDICTED: nucleobase-ascorbate transporter ...    252   2e-76   Glycine max [soybeans]
gb|AFW85020.1|  hypothetical protein ZEAMMB73_943324                    240   7e-76   
ref|XP_010920310.1|  PREDICTED: nucleobase-ascorbate transporter ...    248   2e-75   Elaeis guineensis
gb|KDO77882.1|  hypothetical protein CISIN_1g0098372mg                  237   6e-75   Citrus sinensis [apfelsine]
gb|ABR17751.1|  unknown                                                 246   1e-74   Picea sitchensis
gb|EEC71519.1|  hypothetical protein OsI_03815                          245   2e-74   Oryza sativa Indica Group [Indian rice]
ref|XP_004970033.1|  PREDICTED: nucleobase-ascorbate transporter ...    245   3e-74   Setaria italica
gb|AFW85021.1|  hypothetical protein ZEAMMB73_943324                    240   4e-74   
ref|XP_006644739.1|  PREDICTED: nucleobase-ascorbate transporter ...    245   4e-74   Oryza brachyantha
ref|XP_003522486.1|  PREDICTED: nucleobase-ascorbate transporter ...    244   6e-74   Glycine max [soybeans]
ref|XP_010245958.1|  PREDICTED: nucleobase-ascorbate transporter ...    244   1e-73   Nelumbo nucifera [Indian lotus]
gb|ACN25841.1|  unknown                                                 241   1e-73   Zea mays [maize]
ref|XP_009394827.1|  PREDICTED: nucleobase-ascorbate transporter ...    244   1e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004233030.1|  PREDICTED: nucleobase-ascorbate transporter 2      243   2e-73   Solanum lycopersicum
gb|AFW85022.1|  hypothetical protein ZEAMMB73_943324                    241   2e-73   
ref|XP_008789343.1|  PREDICTED: nucleobase-ascorbate transporter ...    243   4e-73   Phoenix dactylifera
dbj|BAB61205.1|  putative permease 1                                    243   4e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006358126.1|  PREDICTED: nucleobase-ascorbate transporter ...    242   4e-73   Solanum tuberosum [potatoes]
gb|KFK36325.1|  hypothetical protein AALP_AA4G108100                    241   1e-72   Arabis alpina [alpine rockcress]
ref|XP_011101410.1|  PREDICTED: nucleobase-ascorbate transporter 2      241   1e-72   Sesamum indicum [beniseed]
ref|XP_008443418.1|  PREDICTED: nucleobase-ascorbate transporter 2      241   1e-72   Cucumis melo [Oriental melon]
ref|XP_003526259.1|  PREDICTED: nucleobase-ascorbate transporter ...    241   1e-72   Glycine max [soybeans]
gb|KHN07045.1|  Nucleobase-ascorbate transporter 2                      241   1e-72   Glycine soja [wild soybean]
ref|NP_001152037.1|  solute carrier family 23 member 2                  241   1e-72   Zea mays [maize]
ref|XP_004150216.1|  PREDICTED: nucleobase-ascorbate transporter 2      241   1e-72   Cucumis sativus [cucumbers]
ref|XP_006294014.1|  hypothetical protein CARUB_v10023002mg             241   2e-72   Capsella rubella
ref|XP_004293963.1|  PREDICTED: nucleobase-ascorbate transporter 2      241   2e-72   Fragaria vesca subsp. vesca
ref|XP_007136977.1|  hypothetical protein PHAVU_009G089800g             240   3e-72   Phaseolus vulgaris [French bean]
ref|XP_010686222.1|  PREDICTED: nucleobase-ascorbate transporter 2      240   3e-72   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAJ85393.1|  predicted protein                                      239   5e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ94155.1|  predicted protein                                      239   6e-72   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006410561.1|  hypothetical protein EUTSA_v10016514mg             239   6e-72   Eutrema salsugineum [saltwater cress]
ref|XP_003569860.1|  PREDICTED: nucleobase-ascorbate transporter ...    239   9e-72   Brachypodium distachyon [annual false brome]
ref|XP_002456385.1|  hypothetical protein SORBIDRAFT_03g035190          238   1e-71   Sorghum bicolor [broomcorn]
ref|XP_009799751.1|  PREDICTED: nucleobase-ascorbate transporter 2      238   1e-71   Nicotiana sylvestris
ref|XP_010089683.1|  Nucleobase-ascorbate transporter 2                 238   1e-71   Morus notabilis
ref|XP_009410926.1|  PREDICTED: nucleobase-ascorbate transporter ...    238   2e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006449522.1|  hypothetical protein CICLE_v10014896mg             238   2e-71   Citrus clementina [clementine]
ref|XP_006467632.1|  PREDICTED: nucleobase-ascorbate transporter ...    238   3e-71   Citrus sinensis [apfelsine]
ref|XP_009604294.1|  PREDICTED: nucleobase-ascorbate transporter 2      238   3e-71   Nicotiana tomentosiformis
ref|XP_009143796.1|  PREDICTED: nucleobase-ascorbate transporter 2      237   3e-71   Brassica rapa
emb|CAN66345.1|  hypothetical protein VITISV_040228                     237   3e-71   Vitis vinifera
ref|XP_002265912.2|  PREDICTED: nucleobase-ascorbate transporter ...    237   4e-71   Vitis vinifera
ref|XP_010052181.1|  PREDICTED: nucleobase-ascorbate transporter 2      237   5e-71   Eucalyptus grandis [rose gum]
ref|XP_010509786.1|  PREDICTED: nucleobase-ascorbate transporter 2      237   5e-71   Camelina sativa [gold-of-pleasure]
emb|CDY52234.1|  BnaC04g54110D                                          237   5e-71   Brassica napus [oilseed rape]
ref|XP_006830254.1|  PREDICTED: nucleobase-ascorbate transporter 2      236   7e-71   Amborella trichopoda
ref|XP_002879482.1|  xanthine/uracil permease family protein            236   7e-71   
ref|XP_010413769.1|  PREDICTED: nucleobase-ascorbate transporter ...    236   8e-71   Camelina sativa [gold-of-pleasure]
ref|XP_002317408.2|  hypothetical protein POPTR_0011s07170g             233   9e-71   
ref|XP_010246467.1|  PREDICTED: nucleobase-ascorbate transporter 2      236   9e-71   Nelumbo nucifera [Indian lotus]
ref|XP_008225311.1|  PREDICTED: nucleobase-ascorbate transporter 2      236   1e-70   Prunus mume [ume]
ref|XP_007211779.1|  hypothetical protein PRUPE_ppa004190mg             236   1e-70   Prunus persica
ref|XP_010469386.1|  PREDICTED: nucleobase-ascorbate transporter ...    236   1e-70   Camelina sativa [gold-of-pleasure]
ref|NP_180966.1|  nucleobase-ascorbate transporter 2                    235   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59632.1|  putative membrane transporter protein                   235   2e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KHN48003.1|  Nucleobase-ascorbate transporter 2                      235   2e-70   Glycine soja [wild soybean]
emb|CDO96816.1|  unnamed protein product                                235   3e-70   Coffea canephora [robusta coffee]
emb|CDM84318.1|  unnamed protein product                                242   3e-70   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007159460.1|  hypothetical protein PHAVU_002G239500g             235   3e-70   Phaseolus vulgaris [French bean]
ref|XP_004485911.1|  PREDICTED: nucleobase-ascorbate transporter ...    234   4e-70   Cicer arietinum [garbanzo]
ref|XP_009396520.1|  PREDICTED: nucleobase-ascorbate transporter ...    234   5e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007025347.1|  Xanthine/uracil permease family protein            234   9e-70   Theobroma cacao [chocolate]
ref|XP_002305737.1|  xanthine/uracil permease family protein            233   1e-69   Populus trichocarpa [western balsam poplar]
dbj|BAD03486.1|  putative permease 1                                    233   1e-69   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006659347.1|  PREDICTED: nucleobase-ascorbate transporter ...    233   2e-69   
gb|KHG19625.1|  Nucleobase-ascorbate transporter 2 -like protein        233   2e-69   Gossypium arboreum [tree cotton]
gb|KJB57395.1|  hypothetical protein B456_009G161500                    233   2e-69   Gossypium raimondii
ref|XP_011039417.1|  PREDICTED: nucleobase-ascorbate transporter ...    233   2e-69   Populus euphratica
gb|EYU28101.1|  hypothetical protein MIMGU_mgv1a004500mg                233   2e-69   Erythranthe guttata [common monkey flower]
ref|XP_009394193.1|  PREDICTED: nucleobase-ascorbate transporter ...    233   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004504292.1|  PREDICTED: nucleobase-ascorbate transporter ...    233   3e-69   Cicer arietinum [garbanzo]
ref|XP_010274460.1|  PREDICTED: nucleobase-ascorbate transporter ...    232   3e-69   Nelumbo nucifera [Indian lotus]
ref|XP_008349204.1|  PREDICTED: LOW QUALITY PROTEIN: nucleobase-a...    232   4e-69   
ref|XP_010999757.1|  PREDICTED: nucleobase-ascorbate transporter 2      232   4e-69   Populus euphratica
gb|KHN29605.1|  Nucleobase-ascorbate transporter 2                      232   4e-69   Glycine soja [wild soybean]
ref|XP_008371490.1|  PREDICTED: nucleobase-ascorbate transporter 2      232   4e-69   
ref|XP_009351319.1|  PREDICTED: nucleobase-ascorbate transporter 2      232   4e-69   Pyrus x bretschneideri [bai li]
ref|XP_010540522.1|  PREDICTED: nucleobase-ascorbate transporter ...    231   8e-69   Tarenaya hassleriana [spider flower]
gb|AAT64019.1|  putative permease                                       231   9e-69   Gossypium hirsutum [American cotton]
gb|KHG23953.1|  Nucleobase-ascorbate transporter 2 -like protein        231   1e-68   Gossypium arboreum [tree cotton]
ref|XP_010540521.1|  PREDICTED: nucleobase-ascorbate transporter ...    231   1e-68   Tarenaya hassleriana [spider flower]
gb|AAT64034.1|  putative permease                                       231   1e-68   Gossypium hirsutum [American cotton]
ref|XP_012091799.1|  PREDICTED: nucleobase-ascorbate transporter 2      230   2e-68   Jatropha curcas
ref|XP_009352749.1|  PREDICTED: nucleobase-ascorbate transporter ...    230   2e-68   
gb|EEC83487.1|  hypothetical protein OsI_29016                          234   3e-68   Oryza sativa Indica Group [Indian rice]
ref|XP_010911658.1|  PREDICTED: nucleobase-ascorbate transporter ...    219   3e-68   
gb|ACD56652.1|  putative permease                                       229   3e-68   Gossypioides kirkii
gb|KJB69715.1|  hypothetical protein B456_011G038600                    229   5e-68   Gossypium raimondii
gb|KJB69714.1|  hypothetical protein B456_011G038600                    229   5e-68   Gossypium raimondii
ref|NP_001145705.1|  uncharacterized protein LOC100279209               226   6e-68   
ref|XP_010924597.1|  PREDICTED: nucleobase-ascorbate transporter ...    229   8e-68   Elaeis guineensis
gb|KEH20677.1|  nucleobase-ascorbate transporter-like protein           225   8e-68   Medicago truncatula
gb|KEH36620.1|  nucleobase-ascorbate transporter-like protein           228   9e-68   Medicago truncatula
ref|XP_003574409.1|  PREDICTED: nucleobase-ascorbate transporter ...    228   9e-68   Brachypodium distachyon [annual false brome]
tpg|DAA39900.1|  TPA: hypothetical protein ZEAMMB73_374827              227   1e-67   
gb|EAZ08590.1|  hypothetical protein OsI_30859                          228   1e-67   Oryza sativa Indica Group [Indian rice]
dbj|BAJ95647.1|  predicted protein                                      228   2e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS56362.1|  Nucleobase-ascorbate transporter 2                      228   2e-67   Triticum urartu
ref|XP_002525330.1|  purine permease, putative                          226   3e-67   
ref|XP_003629786.1|  Nucleobase ascorbate transporter                   226   3e-67   
ref|XP_008793044.1|  PREDICTED: nucleobase-ascorbate transporter ...    226   8e-67   Phoenix dactylifera
ref|XP_008667761.1|  PREDICTED: uncharacterized protein LOC100279...    226   9e-67   
ref|XP_003629785.1|  Nucleobase ascorbate transporter                   225   1e-66   Medicago truncatula
gb|KDO54300.1|  hypothetical protein CISIN_1g009755mg                   225   2e-66   Citrus sinensis [apfelsine]
gb|ACG43417.1|  permease                                                225   2e-66   Zea mays [maize]
ref|XP_003577983.1|  PREDICTED: nucleobase-ascorbate transporter ...    225   2e-66   Brachypodium distachyon [annual false brome]
ref|XP_010490176.1|  PREDICTED: nucleobase-ascorbate transporter ...    223   5e-66   Camelina sativa [gold-of-pleasure]
gb|KHN08000.1|  Nucleobase-ascorbate transporter 1                      211   8e-66   Glycine soja [wild soybean]
ref|XP_004956567.1|  PREDICTED: nucleobase-ascorbate transporter ...    222   2e-65   Setaria italica
ref|XP_006660533.1|  PREDICTED: nucleobase-ascorbate transporter ...    222   2e-65   Oryza brachyantha
ref|XP_002445381.1|  hypothetical protein SORBIDRAFT_07g014930          219   3e-64   
ref|XP_004973341.1|  PREDICTED: nucleobase-ascorbate transporter ...    219   5e-64   Setaria italica
ref|XP_008678172.1|  PREDICTED: nucleobase-ascorbate transporter ...    218   6e-64   Zea mays [maize]
ref|XP_010655537.1|  PREDICTED: nucleobase-ascorbate transporter ...    218   9e-64   
ref|XP_002441746.1|  hypothetical protein SORBIDRAFT_08g001650          214   4e-62   
ref|XP_006852960.1|  PREDICTED: nucleobase-ascorbate transporter 3      212   3e-61   Amborella trichopoda
ref|XP_004981566.1|  PREDICTED: nucleobase-ascorbate transporter ...    205   1e-58   
ref|XP_006469619.1|  PREDICTED: nucleobase-ascorbate transporter ...    202   5e-58   
ref|XP_001766884.1|  predicted protein                                  201   3e-57   
ref|XP_008792697.1|  PREDICTED: nucleobase-ascorbate transporter 3      201   3e-57   Phoenix dactylifera
ref|XP_011467773.1|  PREDICTED: nucleobase-ascorbate transporter ...    199   7e-57   Fragaria vesca subsp. vesca
ref|XP_006354927.1|  PREDICTED: nucleobase-ascorbate transporter ...    196   2e-55   Solanum tuberosum [potatoes]
ref|XP_009386652.1|  PREDICTED: nucleobase-ascorbate transporter ...    194   9e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009625821.1|  PREDICTED: nucleobase-ascorbate transporter 3      194   1e-54   Nicotiana tomentosiformis
ref|XP_009777178.1|  PREDICTED: nucleobase-ascorbate transporter 3      194   2e-54   Nicotiana sylvestris
ref|XP_004238190.1|  PREDICTED: nucleobase-ascorbate transporter 3      193   2e-54   Solanum lycopersicum
ref|XP_010255123.1|  PREDICTED: nucleobase-ascorbate transporter 3      192   7e-54   Nelumbo nucifera [Indian lotus]
ref|XP_002282229.1|  PREDICTED: nucleobase-ascorbate transporter 3      192   8e-54   Vitis vinifera
gb|KDO84357.1|  hypothetical protein CISIN_1g009118mg                   187   1e-53   Citrus sinensis [apfelsine]
gb|KDO84359.1|  hypothetical protein CISIN_1g009118mg                   187   1e-53   Citrus sinensis [apfelsine]
gb|EYU25379.1|  hypothetical protein MIMGU_mgv1a004067mg                191   2e-53   Erythranthe guttata [common monkey flower]
emb|CAN78223.1|  hypothetical protein VITISV_006254                     189   4e-53   Vitis vinifera
ref|XP_010939008.1|  PREDICTED: nucleobase-ascorbate transporter ...    190   4e-53   Elaeis guineensis
gb|EMT06104.1|  Nucleobase-ascorbate transporter 2                      188   7e-53   
ref|XP_010913510.1|  PREDICTED: LOW QUALITY PROTEIN: nucleobase-a...    189   1e-52   Elaeis guineensis
ref|XP_008806500.1|  PREDICTED: nucleobase-ascorbate transporter ...    189   1e-52   
gb|KDO84356.1|  hypothetical protein CISIN_1g009118mg                   187   2e-52   Citrus sinensis [apfelsine]
ref|XP_004499100.1|  PREDICTED: nucleobase-ascorbate transporter ...    188   2e-52   Cicer arietinum [garbanzo]
ref|XP_010929097.1|  PREDICTED: nucleobase-ascorbate transporter ...    187   3e-52   
ref|XP_010059774.1|  PREDICTED: nucleobase-ascorbate transporter 3      187   6e-52   Eucalyptus grandis [rose gum]
ref|XP_006473388.1|  PREDICTED: nucleobase-ascorbate transporter ...    187   6e-52   
ref|XP_006434867.1|  hypothetical protein CICLE_v10000779mg             187   7e-52   Citrus clementina [clementine]
ref|XP_009385304.1|  PREDICTED: nucleobase-ascorbate transporter ...    186   7e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO84353.1|  hypothetical protein CISIN_1g009118mg                   187   7e-52   Citrus sinensis [apfelsine]
gb|KHM99089.1|  Nucleobase-ascorbate transporter 1                      185   8e-52   Glycine soja [wild soybean]
ref|XP_006595824.1|  PREDICTED: nucleobase-ascorbate transporter ...    186   1e-51   
gb|KJB58396.1|  hypothetical protein B456_009G208500                    186   1e-51   Gossypium raimondii
ref|XP_010941850.1|  PREDICTED: LOW QUALITY PROTEIN: nucleobase-a...    186   1e-51   
ref|XP_007049167.1|  Xanthine/uracil permease family protein isof...    185   1e-51   
ref|XP_008452493.1|  PREDICTED: nucleobase-ascorbate transporter 3      186   1e-51   Cucumis melo [Oriental melon]
gb|KJB53220.1|  hypothetical protein B456_008G297500                    181   1e-51   Gossypium raimondii
gb|KJB58395.1|  hypothetical protein B456_009G208500                    186   1e-51   Gossypium raimondii
ref|XP_011654085.1|  PREDICTED: nucleobase-ascorbate transporter 3      186   1e-51   Cucumis sativus [cucumbers]
ref|XP_007141637.1|  hypothetical protein PHAVU_008G212800g             185   1e-51   Phaseolus vulgaris [French bean]
ref|XP_008810107.1|  PREDICTED: nucleobase-ascorbate transporter ...    186   2e-51   Phoenix dactylifera
gb|KJB63783.1|  hypothetical protein B456_010G016200                    182   2e-51   Gossypium raimondii
gb|ACD56666.1|  putative permease                                       184   2e-51   Gossypium arboreum [tree cotton]
ref|XP_006386511.1|  PIGMENT DEFECTIVE EMBRYO 135 family protein        186   2e-51   
ref|XP_011017252.1|  PREDICTED: nucleobase-ascorbate transporter ...    185   3e-51   Populus euphratica
emb|CDP07610.1|  unnamed protein product                                185   4e-51   Coffea canephora [robusta coffee]
gb|KJB53224.1|  hypothetical protein B456_008G297500                    181   5e-51   Gossypium raimondii
ref|XP_006398035.1|  hypothetical protein EUTSA_v10001247mg             181   5e-51   
ref|XP_007017372.1|  Xanthine/uracil permease family protein isof...    184   5e-51   
gb|KJB53222.1|  hypothetical protein B456_008G297500                    181   6e-51   Gossypium raimondii
ref|XP_007017371.1|  Xanthine/uracil permease family protein isof...    184   6e-51   
ref|XP_002511446.1|  purine permease, putative                          184   7e-51   Ricinus communis
ref|XP_009417550.1|  PREDICTED: nucleobase-ascorbate transporter ...    184   7e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO69755.1|  hypothetical protein CISIN_1g009582mg                   179   7e-51   Citrus sinensis [apfelsine]
ref|XP_009391237.1|  PREDICTED: nucleobase-ascorbate transporter ...    184   7e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO69756.1|  hypothetical protein CISIN_1g009582mg                   179   8e-51   Citrus sinensis [apfelsine]
ref|XP_009415384.1|  PREDICTED: nucleobase-ascorbate transporter ...    183   1e-50   
gb|KHG06073.1|  Nucleobase-ascorbate transporter 3 -like protein        183   1e-50   Gossypium arboreum [tree cotton]
ref|XP_009415380.1|  PREDICTED: nucleobase-ascorbate transporter ...    183   1e-50   
gb|KDO69754.1|  hypothetical protein CISIN_1g009582mg                   179   1e-50   Citrus sinensis [apfelsine]
gb|EYU29931.1|  hypothetical protein MIMGU_mgv1a026566mg                179   1e-50   Erythranthe guttata [common monkey flower]
gb|KJB53226.1|  hypothetical protein B456_008G297500                    181   2e-50   Gossypium raimondii
ref|XP_010942184.1|  PREDICTED: nucleobase-ascorbate transporter ...    183   2e-50   Elaeis guineensis
ref|XP_007225743.1|  hypothetical protein PRUPE_ppa003778mg             183   2e-50   Prunus persica
ref|XP_002452570.1|  hypothetical protein SORBIDRAFT_04g028300          182   2e-50   Sorghum bicolor [broomcorn]
ref|XP_008220714.1|  PREDICTED: nucleobase-ascorbate transporter ...    183   2e-50   Prunus mume [ume]
gb|KJB53225.1|  hypothetical protein B456_008G297500                    181   2e-50   Gossypium raimondii
gb|KJB63780.1|  hypothetical protein B456_010G016200                    182   3e-50   Gossypium raimondii
ref|XP_011087158.1|  PREDICTED: nucleobase-ascorbate transporter 6      182   3e-50   Sesamum indicum [beniseed]
gb|KHN48615.1|  Nucleobase-ascorbate transporter 6                      182   3e-50   Glycine soja [wild soybean]
ref|XP_003549636.1|  PREDICTED: nucleobase-ascorbate transporter ...    182   3e-50   Glycine max [soybeans]
gb|KJB63781.1|  hypothetical protein B456_010G016200                    182   3e-50   Gossypium raimondii
ref|XP_008779515.1|  PREDICTED: nucleobase-ascorbate transporter ...    182   3e-50   Phoenix dactylifera
ref|XP_006579556.1|  PREDICTED: nucleobase-ascorbate transporter ...    182   3e-50   Glycine max [soybeans]
ref|XP_009399656.1|  PREDICTED: nucleobase-ascorbate transporter ...    182   3e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009359013.1|  PREDICTED: nucleobase-ascorbate transporter ...    182   3e-50   Pyrus x bretschneideri [bai li]
ref|XP_007036127.1|  Xanthine/uracil permease family protein isof...    182   3e-50   Theobroma cacao [chocolate]
gb|KJB19550.1|  hypothetical protein B456_003G109900                    179   4e-50   Gossypium raimondii
ref|XP_010254659.1|  PREDICTED: nucleobase-ascorbate transporter ...    182   4e-50   Nelumbo nucifera [Indian lotus]
gb|KJB19551.1|  hypothetical protein B456_003G109900                    179   4e-50   Gossypium raimondii
ref|XP_009391740.1|  PREDICTED: nucleobase-ascorbate transporter ...    182   4e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB31305.1|  hypothetical protein B456_005G185300                    176   4e-50   Gossypium raimondii
ref|XP_007155396.1|  hypothetical protein PHAVU_003G197800g             182   4e-50   Phaseolus vulgaris [French bean]
gb|KJB63778.1|  hypothetical protein B456_010G016200                    182   4e-50   Gossypium raimondii
ref|XP_006375006.1|  hypothetical protein POPTR_0014s03510g             181   5e-50   
gb|AGV54390.1|  nucleobase-ascorbate transporter 6-like protein         182   5e-50   Phaseolus vulgaris [French bean]
gb|KDO69753.1|  hypothetical protein CISIN_1g009582mg                   179   5e-50   Citrus sinensis [apfelsine]
ref|XP_009399654.1|  PREDICTED: nucleobase-ascorbate transporter ...    182   5e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS60200.1|  hypothetical protein M569_14604                         175   5e-50   Genlisea aurea
ref|XP_010546016.1|  PREDICTED: nucleobase-ascorbate transporter ...    181   6e-50   Tarenaya hassleriana [spider flower]
gb|EMT25940.1|  Nucleobase-ascorbate transporter 6                      181   6e-50   
ref|XP_003544440.1|  PREDICTED: nucleobase-ascorbate transporter ...    181   7e-50   Glycine max [soybeans]
gb|KHN45346.1|  Nucleobase-ascorbate transporter 3                      181   7e-50   Glycine soja [wild soybean]
ref|XP_009391739.1|  PREDICTED: nucleobase-ascorbate transporter ...    181   7e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009411043.1|  PREDICTED: nucleobase-ascorbate transporter ...    181   7e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB53217.1|  hypothetical protein B456_008G297500                    181   7e-50   Gossypium raimondii
gb|KHG14639.1|  Nucleobase-ascorbate transporter 6 -like protein        181   7e-50   Gossypium arboreum [tree cotton]
ref|XP_002510280.1|  purine permease, putative                          181   7e-50   Ricinus communis
gb|EPS73073.1|  hypothetical protein M569_01684                         174   8e-50   Genlisea aurea
ref|XP_007160814.1|  hypothetical protein PHAVU_001G018700g             181   8e-50   Phaseolus vulgaris [French bean]
ref|XP_010519558.1|  PREDICTED: nucleobase-ascorbate transporter ...    181   8e-50   Tarenaya hassleriana [spider flower]
gb|ABF99620.1|  Permease I, putative, expressed                         178   9e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010684514.1|  PREDICTED: nucleobase-ascorbate transporter 3      181   9e-50   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006375005.1|  PIGMENT DEFECTIVE EMBRYO 135 family protein        181   9e-50   Populus trichocarpa [western balsam poplar]
dbj|BAJ85445.1|  predicted protein                                      181   9e-50   
ref|XP_010272020.1|  PREDICTED: nucleobase-ascorbate transporter 6      181   1e-49   
ref|XP_006660592.1|  PREDICTED: nucleobase-ascorbate transporter ...    181   1e-49   
gb|EMS61607.1|  Nucleobase-ascorbate transporter 6                      181   1e-49   
gb|KJB19549.1|  hypothetical protein B456_003G109900                    180   1e-49   
ref|XP_011083792.1|  PREDICTED: nucleobase-ascorbate transporter 3      181   1e-49   
ref|NP_001078782.1|  Xanthine/uracil permease family protein            179   1e-49   
gb|EMT04471.1|  Nucleobase-ascorbate transporter 6                      181   1e-49   
ref|XP_004508844.1|  PREDICTED: nucleobase-ascorbate transporter ...    180   2e-49   
ref|XP_002322154.1|  xanthine/uracil permease family protein            180   2e-49   
ref|XP_010657232.1|  PREDICTED: nucleobase-ascorbate transporter ...    180   2e-49   
ref|XP_010526007.1|  PREDICTED: nucleobase-ascorbate transporter 3      180   2e-49   
ref|XP_009118902.1|  PREDICTED: nucleobase-ascorbate transporter 5      180   2e-49   
emb|CDY37762.1|  BnaA10g05590D                                          180   2e-49   
ref|XP_002444345.1|  hypothetical protein SORBIDRAFT_07g020510          180   2e-49   
gb|KHG10671.1|  Nucleobase-ascorbate transporter 3 -like protein        180   2e-49   
ref|XP_004238558.1|  PREDICTED: putative nucleobase-ascorbate tra...    180   2e-49   
ref|XP_004953888.1|  PREDICTED: nucleobase-ascorbate transporter ...    180   2e-49   
ref|XP_006398034.1|  hypothetical protein EUTSA_v10001247mg             180   2e-49   
emb|CAJ84113.1|  root uracil permease 1                                 180   2e-49   
ref|XP_006647871.1|  PREDICTED: nucleobase-ascorbate transporter ...    180   2e-49   
ref|XP_010678709.1|  PREDICTED: nucleobase-ascorbate transporter 6      180   2e-49   
gb|KJB19546.1|  hypothetical protein B456_003G109900                    180   2e-49   
ref|XP_004299577.1|  PREDICTED: nucleobase-ascorbate transporter 6      179   2e-49   
ref|NP_001048084.1|  Os02g0741800                                       180   2e-49   
ref|XP_008239723.1|  PREDICTED: nucleobase-ascorbate transporter 6      180   3e-49   
ref|XP_007209884.1|  hypothetical protein PRUPE_ppa003999mg             180   3e-49   
ref|XP_008393716.1|  PREDICTED: putative nucleobase-ascorbate tra...    174   3e-49   
ref|XP_009402190.1|  PREDICTED: nucleobase-ascorbate transporter ...    181   3e-49   
ref|XP_006356853.1|  PREDICTED: putative nucleobase-ascorbate tra...    179   3e-49   
ref|NP_201094.1|  Xanthine/uracil permease family protein               179   3e-49   
ref|XP_004508843.1|  PREDICTED: nucleobase-ascorbate transporter ...    180   3e-49   
ref|XP_004973451.1|  PREDICTED: nucleobase-ascorbate transporter ...    179   3e-49   
emb|CDX71592.1|  BnaC09g26330D                                          179   3e-49   
ref|XP_010429674.1|  PREDICTED: nucleobase-ascorbate transporter ...    177   3e-49   
ref|XP_008453115.1|  PREDICTED: nucleobase-ascorbate transporter 6      179   3e-49   
ref|XP_002878973.1|  PDE135                                             179   4e-49   
ref|XP_003608951.1|  Nucleobase ascorbate transporter                   179   4e-49   
ref|XP_009418014.1|  PREDICTED: nucleobase-ascorbate transporter ...    179   4e-49   
ref|NP_001189609.1|  nucleobase-ascorbate transporter 3                 177   4e-49   
ref|XP_004501951.1|  PREDICTED: nucleobase-ascorbate transporter ...    179   4e-49   
ref|XP_008377388.1|  PREDICTED: nucleobase-ascorbate transporter ...    179   4e-49   
ref|XP_006402200.1|  hypothetical protein EUTSA_v10013227mg             179   4e-49   
ref|XP_011028608.1|  PREDICTED: nucleobase-ascorbate transporter 6      179   4e-49   
gb|KDO69748.1|  hypothetical protein CISIN_1g009582mg                   179   5e-49   
ref|XP_006376839.1|  hypothetical protein POPTR_0012s07890g             177   5e-49   
ref|XP_008806323.1|  PREDICTED: nucleobase-ascorbate transporter ...    179   5e-49   
ref|XP_010928566.1|  PREDICTED: nucleobase-ascorbate transporter ...    179   5e-49   
ref|XP_006439755.1|  hypothetical protein CICLE_v10019673mg             179   5e-49   
ref|XP_010459419.1|  PREDICTED: nucleobase-ascorbate transporter ...    179   5e-49   
ref|XP_006476733.1|  PREDICTED: nucleobase-ascorbate transporter ...    179   5e-49   
tpg|DAA52242.1|  TPA: hypothetical protein ZEAMMB73_533196              176   5e-49   
ref|XP_010417444.1|  PREDICTED: nucleobase-ascorbate transporter ...    178   6e-49   
ref|XP_004138122.1|  PREDICTED: nucleobase-ascorbate transporter 6      179   6e-49   
gb|EMS47148.1|  Nucleobase-ascorbate transporter 6                      179   6e-49   
ref|XP_012080118.1|  PREDICTED: nucleobase-ascorbate transporter 6      179   7e-49   
dbj|BAJ89101.1|  predicted protein                                      178   7e-49   
ref|XP_008374469.1|  PREDICTED: nucleobase-ascorbate transporter ...    178   7e-49   
gb|KHN12750.1|  Nucleobase-ascorbate transporter 3                      178   8e-49   
gb|KEH35060.1|  nucleobase-ascorbate transporter-like protein           178   8e-49   
tpg|DAA61283.1|  TPA: hypothetical protein ZEAMMB73_927741              176   8e-49   
ref|XP_010444153.1|  PREDICTED: nucleobase-ascorbate transporter ...    178   8e-49   
ref|XP_009151410.1|  PREDICTED: nucleobase-ascorbate transporter 6      178   8e-49   
gb|EMT02255.1|  Nucleobase-ascorbate transporter 6                      178   9e-49   
ref|XP_006650817.1|  PREDICTED: nucleobase-ascorbate transporter ...    178   9e-49   
ref|XP_011070150.1|  PREDICTED: putative nucleobase-ascorbate tra...    178   9e-49   
gb|KFK32504.1|  hypothetical protein AALP_AA6G251200                    178   9e-49   
ref|XP_006659402.1|  PREDICTED: nucleobase-ascorbate transporter ...    178   1e-48   
ref|XP_008453072.1|  PREDICTED: putative nucleobase-ascorbate tra...    177   1e-48   
ref|XP_003550352.1|  PREDICTED: nucleobase-ascorbate transporter ...    178   1e-48   
ref|XP_010037590.1|  PREDICTED: nucleobase-ascorbate transporter ...    178   1e-48   
ref|XP_009610578.1|  PREDICTED: nucleobase-ascorbate transporter ...    178   1e-48   
gb|ACN28348.1|  unknown                                                 178   1e-48   
ref|NP_001148488.1|  LOC100282103                                       178   1e-48   
gb|ACN34480.1|  unknown                                                 178   1e-48   
ref|XP_003563486.1|  PREDICTED: nucleobase-ascorbate transporter ...    178   1e-48   
ref|XP_003527028.1|  PREDICTED: nucleobase-ascorbate transporter ...    178   1e-48   
ref|XP_003523067.1|  PREDICTED: nucleobase-ascorbate transporter ...    178   1e-48   
gb|ACF80267.1|  unknown                                                 174   1e-48   
ref|XP_011030643.1|  PREDICTED: nucleobase-ascorbate transporter ...    178   1e-48   
ref|XP_011071803.1|  PREDICTED: nucleobase-ascorbate transporter ...    177   2e-48   
ref|XP_006836697.1|  PREDICTED: nucleobase-ascorbate transporter 6      177   2e-48   
ref|XP_003573107.1|  PREDICTED: nucleobase-ascorbate transporter ...    177   2e-48   
ref|XP_007200240.1|  hypothetical protein PRUPE_ppa015287mg             177   2e-48   
ref|XP_009614129.1|  PREDICTED: nucleobase-ascorbate transporter ...    175   2e-48   
ref|XP_002961825.1|  hypothetical protein SELMODRAFT_76475              177   2e-48   
ref|XP_010550666.1|  PREDICTED: nucleobase-ascorbate transporter 6      177   2e-48   
ref|XP_004956720.1|  PREDICTED: nucleobase-ascorbate transporter ...    177   2e-48   
ref|XP_011044342.1|  PREDICTED: nucleobase-ascorbate transporter ...    177   2e-48   
ref|NP_001063058.1|  Os09g0381100                                       177   2e-48   
ref|XP_002510081.1|  purine permease, putative                          177   2e-48   
ref|XP_002864824.1|  hypothetical protein ARALYDRAFT_496474             177   2e-48   
ref|NP_001051745.1|  Os03g0823800                                       177   2e-48   
gb|KJB31304.1|  hypothetical protein B456_005G185300                    171   2e-48   
ref|XP_009784935.1|  PREDICTED: nucleobase-ascorbate transporter ...    177   2e-48   
ref|XP_006394340.1|  hypothetical protein EUTSA_v10003977mg             177   2e-48   
gb|EAY92392.1|  hypothetical protein OsI_14125                          177   3e-48   
ref|XP_009784934.1|  PREDICTED: nucleobase-ascorbate transporter ...    177   3e-48   
gb|KFK26633.1|  hypothetical protein AALP_AA8G273900                    177   3e-48   
emb|CDX84363.1|  BnaC03g51370D                                          177   3e-48   
gb|ACN28996.1|  unknown                                                 174   3e-48   
ref|XP_010429673.1|  PREDICTED: nucleobase-ascorbate transporter ...    177   3e-48   
ref|XP_006280290.1|  hypothetical protein CARUB_v10026214mg             177   3e-48   
ref|XP_009608483.1|  PREDICTED: nucleobase-ascorbate transporter ...    176   4e-48   
gb|AFW67120.1|  hypothetical protein ZEAMMB73_915261                    173   4e-48   
gb|ACF83380.1|  unknown                                                 174   4e-48   
ref|XP_004981228.1|  PREDICTED: nucleobase-ascorbate transporter ...    176   4e-48   
gb|EAZ29114.1|  hypothetical protein OsJ_13173                          177   4e-48   
ref|XP_006293946.1|  hypothetical protein CARUB_v10022938mg             177   4e-48   
ref|NP_180219.1|  nucleobase-ascorbate transporter 3                    177   4e-48   
ref|XP_009112041.1|  PREDICTED: nucleobase-ascorbate transporter 6      176   4e-48   
ref|NP_001140868.1|  uncharacterized protein LOC100272944               176   5e-48   
ref|XP_012068203.1|  PREDICTED: putative nucleobase-ascorbate tra...    176   5e-48   
ref|XP_009608481.1|  PREDICTED: nucleobase-ascorbate transporter ...    177   5e-48   
ref|XP_010472295.1|  PREDICTED: nucleobase-ascorbate transporter ...    176   5e-48   
ref|XP_012071717.1|  PREDICTED: nucleobase-ascorbate transporter 3      176   6e-48   
ref|XP_008393061.1|  PREDICTED: nucleobase-ascorbate transporter 6      176   6e-48   
ref|XP_006280300.1|  hypothetical protein CARUB_v10026223mg             176   7e-48   
ref|XP_003574490.1|  PREDICTED: nucleobase-ascorbate transporter ...    176   7e-48   
gb|AFK46481.1|  unknown                                                 176   7e-48   
ref|XP_003589253.1|  Nucleobase-ascorbate transporter                   176   8e-48   
ref|XP_009782990.1|  PREDICTED: nucleobase-ascorbate transporter 6      176   8e-48   
ref|XP_002268811.1|  PREDICTED: nucleobase-ascorbate transporter 6      176   8e-48   
tpg|DAA52241.1|  TPA: permease I                                        176   8e-48   
ref|XP_009364045.1|  PREDICTED: nucleobase-ascorbate transporter ...    176   8e-48   
ref|XP_010442477.1|  PREDICTED: nucleobase-ascorbate transporter ...    176   8e-48   
ref|XP_007138109.1|  hypothetical protein PHAVU_009G181000g             176   8e-48   
ref|XP_010532270.1|  PREDICTED: nucleobase-ascorbate transporter ...    175   9e-48   
ref|NP_001061818.1|  Os08g0420600                                       176   9e-48   
ref|XP_010482302.1|  PREDICTED: nucleobase-ascorbate transporter ...    176   9e-48   
ref|XP_009614128.1|  PREDICTED: nucleobase-ascorbate transporter ...    175   9e-48   
ref|XP_004141407.2|  PREDICTED: putative nucleobase-ascorbate tra...    175   9e-48   
ref|NP_001141421.1|  uncharacterized protein LOC100273531               175   1e-47   
ref|XP_002865770.1|  xanthine/uracil permease family protein            175   1e-47   
gb|EEC83594.1|  hypothetical protein OsI_29273                          176   1e-47   
emb|CDY56736.1|  BnaC09g50870D                                          175   1e-47   
ref|XP_006355947.1|  PREDICTED: nucleobase-ascorbate transporter ...    175   1e-47   
ref|XP_002991240.1|  hypothetical protein SELMODRAFT_133226             175   1e-47   
ref|XP_002991180.1|  hypothetical protein SELMODRAFT_133065             175   1e-47   
ref|XP_008236299.1|  PREDICTED: nucleobase-ascorbate transporter 4      175   1e-47   
ref|NP_001150400.1|  permease I                                         175   1e-47   
ref|XP_007157491.1|  hypothetical protein PHAVU_002G074100g             175   2e-47   
ref|XP_004248777.1|  PREDICTED: nucleobase-ascorbate transporter ...    175   2e-47   
ref|NP_199810.2|  xanthine/uracil permease family protein               175   2e-47   
ref|XP_008378546.1|  PREDICTED: nucleobase-ascorbate transporter ...    175   2e-47   
ref|XP_010532269.1|  PREDICTED: nucleobase-ascorbate transporter ...    175   2e-47   
ref|XP_006393199.1|  hypothetical protein EUTSA_v10011388mg             174   2e-47   
ref|XP_002283469.1|  PREDICTED: nucleobase-ascorbate transporter 6      174   2e-47   
gb|ACG35525.1|  permease I                                              174   2e-47   
ref|XP_008446242.1|  PREDICTED: nucleobase-ascorbate transporter 7      174   2e-47   
ref|XP_004135225.1|  PREDICTED: nucleobase-ascorbate transporter 7      174   2e-47   
ref|XP_002891544.1|  xanthine/uracil permease family protein            174   3e-47   
ref|XP_004292763.1|  PREDICTED: putative nucleobase-ascorbate tra...    174   3e-47   
ref|XP_003578065.1|  PREDICTED: nucleobase-ascorbate transporter ...    174   3e-47   
ref|XP_009619816.1|  PREDICTED: nucleobase-ascorbate transporter ...    174   3e-47   
ref|XP_004496870.1|  PREDICTED: nucleobase-ascorbate transporter ...    174   3e-47   
ref|XP_007224177.1|  hypothetical protein PRUPE_ppa016541mg             175   3e-47   
ref|XP_009799732.1|  PREDICTED: nucleobase-ascorbate transporter ...    174   3e-47   
ref|XP_009757662.1|  PREDICTED: nucleobase-ascorbate transporter ...    174   4e-47   
ref|XP_006857136.1|  PREDICTED: nucleobase-ascorbate transporter 7      174   4e-47   
ref|XP_007143130.1|  hypothetical protein PHAVU_007G046400g             174   4e-47   
gb|AIS71908.1|  nucleobase-ascorbate transporter 6-like isoform 1       174   4e-47   
ref|XP_008220535.1|  PREDICTED: putative nucleobase-ascorbate tra...    175   4e-47   
ref|XP_008360971.1|  PREDICTED: putative nucleobase-ascorbate tra...    174   5e-47   
ref|XP_006306250.1|  hypothetical protein CARUB_v10012085mg             173   6e-47   
ref|XP_004236131.1|  PREDICTED: nucleobase-ascorbate transporter 6      173   6e-47   
ref|XP_007044538.1|  Nucleobase-ascorbate transporter 7                 173   6e-47   
ref|XP_004241491.1|  PREDICTED: nucleobase-ascorbate transporter 6      173   6e-47   
ref|NP_001288584.1|  uncharacterized protein LOC103625746               173   7e-47   
ref|XP_010479410.1|  PREDICTED: nucleobase-ascorbate transporter ...    172   7e-47   
ref|XP_009595521.1|  PREDICTED: nucleobase-ascorbate transporter ...    173   7e-47   
ref|XP_009803945.1|  PREDICTED: nucleobase-ascorbate transporter ...    173   7e-47   
ref|NP_001149779.1|  permease I                                         173   8e-47   
ref|XP_010691485.1|  PREDICTED: nucleobase-ascorbate transporter ...    172   8e-47   
ref|XP_011021644.1|  PREDICTED: nucleobase-ascorbate transporter 7      173   8e-47   
emb|CDP17001.1|  unnamed protein product                                173   8e-47   
gb|AET03140.2|  nucleobase-ascorbate transporter-like protein           173   9e-47   
ref|XP_004509863.1|  PREDICTED: nucleobase-ascorbate transporter ...    173   9e-47   
gb|EYU36390.1|  hypothetical protein MIMGU_mgv1a024802mg                173   1e-46   
ref|XP_002315809.1|  xanthine/uracil permease family protein            172   1e-46   
ref|XP_008339995.1|  PREDICTED: nucleobase-ascorbate transporter ...    172   1e-46   
gb|AAO13361.1|  putative transporter                                    173   1e-46   
emb|CDP00202.1|  unnamed protein product                                172   1e-46   
ref|XP_010682619.1|  PREDICTED: nucleobase-ascorbate transporter ...    172   1e-46   
ref|XP_003628664.1|  Nucleobase ascorbate transporter                   172   1e-46   
ref|XP_010500549.1|  PREDICTED: nucleobase-ascorbate transporter ...    172   1e-46   
gb|KHN45288.1|  Nucleobase-ascorbate transporter 6                      172   1e-46   
ref|XP_010479409.1|  PREDICTED: nucleobase-ascorbate transporter ...    172   1e-46   
ref|XP_004489879.1|  PREDICTED: nucleobase-ascorbate transporter ...    172   1e-46   
ref|XP_012092049.1|  PREDICTED: nucleobase-ascorbate transporter 7      172   1e-46   
ref|NP_175418.1|  nucleobase-ascorbate transporter 4                    172   1e-46   
gb|KEH35829.1|  nucleobase-ascorbate transporter-like protein           172   2e-46   
ref|XP_004238704.1|  PREDICTED: nucleobase-ascorbate transporter 7      172   2e-46   
ref|XP_004291935.1|  PREDICTED: nucleobase-ascorbate transporter 3      172   2e-46   
ref|XP_010028015.1|  PREDICTED: nucleobase-ascorbate transporter 6      172   2e-46   
ref|XP_003517836.1|  PREDICTED: nucleobase-ascorbate transporter ...    172   2e-46   
ref|XP_003527738.1|  PREDICTED: putative nucleobase-ascorbate tra...    172   2e-46   
ref|XP_009365373.1|  PREDICTED: putative nucleobase-ascorbate tra...    173   2e-46   
ref|XP_007042668.1|  Xanthine/uracil permease family protein isof...    169   2e-46   
ref|XP_009797567.1|  PREDICTED: putative nucleobase-ascorbate tra...    172   2e-46   
ref|XP_006353973.1|  PREDICTED: nucleobase-ascorbate transporter ...    172   2e-46   
ref|XP_010541828.1|  PREDICTED: nucleobase-ascorbate transporter 4      172   2e-46   
gb|KHN45138.1|  Putative nucleobase-ascorbate transporter 10            172   2e-46   
ref|XP_010273036.1|  PREDICTED: nucleobase-ascorbate transporter ...    171   2e-46   
ref|XP_010273034.1|  PREDICTED: nucleobase-ascorbate transporter ...    171   3e-46   
ref|XP_006345027.1|  PREDICTED: nucleobase-ascorbate transporter ...    171   3e-46   
ref|XP_007221801.1|  hypothetical protein PRUPE_ppa004044mg             171   3e-46   
ref|XP_010273019.1|  PREDICTED: nucleobase-ascorbate transporter ...    171   3e-46   
ref|XP_006573063.1|  PREDICTED: nucleobase-ascorbate transporter ...    172   3e-46   
emb|CDX83233.1|  BnaA03g22730D                                          172   3e-46   
emb|CDY59368.1|  BnaA08g29610D                                          171   3e-46   
emb|CDY03581.1|  BnaC03g68400D                                          171   3e-46   
ref|XP_009133945.1|  PREDICTED: nucleobase-ascorbate transporter ...    171   3e-46   
ref|XP_009107246.1|  PREDICTED: nucleobase-ascorbate transporter 4      171   3e-46   
ref|XP_008337251.1|  PREDICTED: putative nucleobase-ascorbate tra...    171   3e-46   
gb|EYU37564.1|  hypothetical protein MIMGU_mgv1a004336mg                171   4e-46   
ref|XP_006438462.1|  hypothetical protein CICLE_v10031192mg             171   4e-46   
ref|XP_011088159.1|  PREDICTED: nucleobase-ascorbate transporter ...    171   4e-46   
ref|XP_010461847.1|  PREDICTED: nucleobase-ascorbate transporter ...    171   5e-46   
ref|XP_010999881.1|  PREDICTED: putative nucleobase-ascorbate tra...    171   5e-46   
ref|XP_009613909.1|  PREDICTED: putative nucleobase-ascorbate tra...    171   5e-46   



>ref|XP_009771645.1| PREDICTED: nucleobase-ascorbate transporter 1 [Nicotiana sylvestris]
Length=520

 Score =   297 bits (760),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+IAHPPMEQLQDLEYCIDSNPPWPET+LLAFQNYILVLGTS MIP+ LVPLMGGSDGD
Sbjct  1    MADIAHPPMEQLQDLEYCIDSNPPWPETVLLAFQNYILVLGTSVMIPSWLVPLMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDS LQRISEPH+RF+
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSHLQRISEPHVRFV  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQI+LGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIVLGYSQVWGLFSRFFS  154



>ref|XP_009592403.1| PREDICTED: nucleobase-ascorbate transporter 1 [Nicotiana tomentosiformis]
Length=520

 Score =   295 bits (754),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 150/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+IAHPPMEQLQDLEYCIDSNPPWPET+LLAFQNYIL+LGTS MIP+ LVPLMGGSDGD
Sbjct  1    MADIAHPPMEQLQDLEYCIDSNPPWPETVLLAFQNYILMLGTSVMIPSWLVPLMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYV+PIVYIISDS LQRISEPH+RF+
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVVPIVYIISDSHLQRISEPHVRFV  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVA+SIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVAASIQIILGYSQVWGLFSRFFS  154



>emb|CDP11315.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   294 bits (753),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 143/153 (93%), Positives = 149/153 (97%), Gaps = 0/153 (0%)
 Frame = +2

Query  218  AEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDK  397
            A+I+HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTS MIPT LVPLMGGSDGDK
Sbjct  3    ADISHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSVMIPTALVPLMGGSDGDK  62

Query  398  ARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQ  577
            ARVIQTLLFVAGINTLLQALFGTRLPA+VGGSFAYVIP++YIISDSSLQRI EPH RFIQ
Sbjct  63   ARVIQTLLFVAGINTLLQALFGTRLPAIVGGSFAYVIPVIYIISDSSLQRIEEPHARFIQ  122

Query  578  TMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            TMRAIQGALIVA+SIQIILGYSQVWGLFSRFFS
Sbjct  123  TMRAIQGALIVAASIQIILGYSQVWGLFSRFFS  155



>ref|XP_006357961.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Solanum tuberosum]
Length=522

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  209  MAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSD  388
            M MA+I+HPPMEQLQDLEYCIDSNPPW ETILLAFQNYILVLGTS MIP+ LVPLMGGSD
Sbjct  1    MTMADISHPPMEQLQDLEYCIDSNPPWVETILLAFQNYILVLGTSVMIPSALVPLMGGSD  60

Query  389  GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIR  568
            GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDS LQRIS+PH+R
Sbjct  61   GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSHLQRISDPHVR  120

Query  569  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            F+ TMRAIQGALIVA+SIQIILGYSQVWGLFSRFFS
Sbjct  121  FVHTMRAIQGALIVAASIQIILGYSQVWGLFSRFFS  156



>ref|XP_004243518.1| PREDICTED: nucleobase-ascorbate transporter 1 [Solanum lycopersicum]
Length=522

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  209  MAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSD  388
            M MA+I+HPPMEQLQDLEYCIDSNPPW ETILLAFQNYILVLGTS MIP+ LVPLMGGSD
Sbjct  1    MTMADISHPPMEQLQDLEYCIDSNPPWVETILLAFQNYILVLGTSVMIPSALVPLMGGSD  60

Query  389  GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIR  568
            GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDS LQRIS+PH+R
Sbjct  61   GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSHLQRISDPHVR  120

Query  569  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            F+ TMRAIQGALIVA+SIQIILGYSQVWGLFSRFFS
Sbjct  121  FVHTMRAIQGALIVAASIQIILGYSQVWGLFSRFFS  156



>ref|XP_010110631.1| Nucleobase-ascorbate transporter 1 [Morus notabilis]
 gb|EXC27253.1| Nucleobase-ascorbate transporter 1 [Morus notabilis]
Length=540

 Score =   291 bits (745),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I+HPPMEQLQDLEYCIDSNPPWPETILLAFQNYIL+LGTS MIP++LVP MGGSDGD
Sbjct  1    MADISHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILMLGTSVMIPSMLVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPI YI+ DSSLQRIS+PH RF+
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIAYIVGDSSLQRISDPHERFV  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_011086376.1| PREDICTED: nucleobase-ascorbate transporter 1 [Sesamum indicum]
Length=520

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/154 (91%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            M +IAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTS MIPT+LVP MGGSDGD
Sbjct  1    MGDIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSVMIPTVLVPTMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAY++PI YII+DS LQRI EPH+RF 
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYLVPIAYIINDSQLQRIDEPHVRFT  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVA+SIQIILGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVAASIQIILGYSQVWGLFSRFFS  154



>ref|XP_002274603.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X2 [Vitis 
vinifera]
 emb|CBI28858.3| unnamed protein product [Vitis vinifera]
Length=520

 Score =   288 bits (737),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 148/154 (96%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I H PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTS MIP+LLVP+MGG+DGD
Sbjct  1    MADITHLPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSVMIPSLLVPVMGGNDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            K RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAY+IPIVYIISDSSLQRISEPH RFI
Sbjct  61   KIRVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYIIPIVYIISDSSLQRISEPHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVA+SIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVAASIQIILGYSQVWGLFSRFFS  154



>emb|CAN70193.1| hypothetical protein VITISV_004001 [Vitis vinifera]
Length=507

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I H PMEQLQDLEYCIDSNPPWPET LLAFQNYILVLGTS MIP+LLVP+MGG+DGD
Sbjct  1    MADITHLPMEQLQDLEYCIDSNPPWPETXLLAFQNYILVLGTSVMIPSLLVPVMGGNDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            K RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAY+IPIVYIISDSSLQRISEPH RFI
Sbjct  61   KIRVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYIIPIVYIISDSSLQRISEPHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVA+SIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVAASIQIILGYSQVWGLFSRFFS  154



>ref|XP_010252545.1| PREDICTED: nucleobase-ascorbate transporter 1 [Nelumbo nucifera]
Length=520

 Score =   284 bits (727),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I+HPPMEQLQDLEYCIDSNPPW ETILLAFQNYIL LGTS MIP+LLVP+MGG+DGD
Sbjct  1    MADISHPPMEQLQDLEYCIDSNPPWAETILLAFQNYILTLGTSVMIPSLLVPVMGGTDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            K RVIQTLLFV+GI TLLQALFGTRLPAVVGGSFAYVIPI+YII DSSLQRISEPH RFI
Sbjct  61   KIRVIQTLLFVSGIKTLLQALFGTRLPAVVGGSFAYVIPILYIIGDSSLQRISEPHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQIILGYSQ+WGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIILGYSQIWGLFSRFFS  154



>gb|EYU43133.1| hypothetical protein MIMGU_mgv1a004837mg [Erythranthe guttata]
Length=508

 Score =   283 bits (723),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            M +I HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILV+GTS MIPTLLVP+MGGSDGD
Sbjct  1    MGDILHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVVGTSVMIPTLLVPMMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGI TLLQ LFGTRLPAVVGGSFAYV+PI YII+DSSL RI +PH+RF+
Sbjct  61   KARVIQTLLFVAGIKTLLQTLFGTRLPAVVGGSFAYVVPIAYIINDSSLLRIHDPHLRFM  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_002883707.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59966.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=520

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAEI+HPPMEQLQDLEYCIDSNPPWPET+LLAFQNYIL+LGTSA IP LLVP MGGSDGD
Sbjct  1    MAEISHPPMEQLQDLEYCIDSNPPWPETVLLAFQNYILMLGTSAFIPALLVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            +ARVIQTLLFVAGI TLLQALFGTRLPAVVGGSFAYV+PI YII+DSSLQ+IS  H RFI
Sbjct  61   RARVIQTLLFVAGIKTLLQALFGTRLPAVVGGSFAYVVPIAYIINDSSLQKISNDHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_010691486.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=454

 Score =   280 bits (717),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I+HPPMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIPT++VP MGGSDGD
Sbjct  1    MADISHPPMEQLQDLEYCIDSNPPWVETILLAFQNYILMLGTSVMIPTIIVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAY+IP+ YII+DSSLQRI + H RFI
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYIIPVAYIINDSSLQRIPDSHDRFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIV+SSIQIILGYSQ+WGLFSRFFS
Sbjct  121  QTMRAIQGALIVSSSIQIILGYSQLWGLFSRFFS  154



>ref|XP_012080636.1| PREDICTED: nucleobase-ascorbate transporter 1 [Jatropha curcas]
 gb|KDP30803.1| hypothetical protein JCGZ_13746 [Jatropha curcas]
Length=522

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 148/156 (95%), Gaps = 0/156 (0%)
 Frame = +2

Query  209  MAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSD  388
            MA+ +I HPPMEQLQDLEYCIDSNPPW ETI+LAFQNYIL+LGTS MIP+LLVP MGGSD
Sbjct  1    MAVTDITHPPMEQLQDLEYCIDSNPPWAETIILAFQNYILMLGTSVMIPSLLVPAMGGSD  60

Query  389  GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIR  568
            GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIP+ YII+DSSLQ+I++ H R
Sbjct  61   GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPVAYIINDSSLQQITDHHER  120

Query  569  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  156



>ref|XP_008379668.1| PREDICTED: nucleobase-ascorbate transporter 1 [Malus domestica]
Length=520

 Score =   282 bits (721),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I HPPM+QLQDLEYCIDSNPPW ETILLAFQNYI++LGTS MIP+ LVP MGGSDGD
Sbjct  1    MADITHPPMDQLQDLEYCIDSNPPWAETILLAFQNYIMMLGTSVMIPSALVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSF+YVIPI YI+SD  LQRI+EPH RFI
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFSYVIPIAYIVSDHKLQRIAEPHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_003555666.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Glycine max]
Length=520

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I HPPMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIP++LVP MGGS GD
Sbjct  1    MADITHPPMEQLQDLEYCIDSNPPWAETILLAFQNYILMLGTSVMIPSMLVPAMGGSSGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KA+VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPI +IISDSSLQRI++PH RF+
Sbjct  61   KAQVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIAHIISDSSLQRINDPHERFL  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQI+LGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIVLGYSQVWGLFSRFFS  154



>gb|KHN41326.1| Nucleobase-ascorbate transporter 1 [Glycine soja]
Length=520

 Score =   281 bits (719),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I HPPMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIP++LVP MGGS GD
Sbjct  1    MADITHPPMEQLQDLEYCIDSNPPWAETILLAFQNYILMLGTSVMIPSMLVPAMGGSSGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KA+VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPI +IISDSSLQRI++PH RF+
Sbjct  61   KAQVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIAHIISDSSLQRINDPHERFL  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQI+LGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIVLGYSQVWGLFSRFFS  154



>ref|XP_010035524.1| PREDICTED: nucleobase-ascorbate transporter 1 [Eucalyptus grandis]
Length=520

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+IAHPPM+QLQDLEYCIDSNPPW ET+LLAFQNYIL+LGTS MIP++LVP+MGGSDGD
Sbjct  1    MADIAHPPMDQLQDLEYCIDSNPPWAETVLLAFQNYILMLGTSVMIPSMLVPMMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYII DS LQ+I +P  RF+
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIIGDSRLQKIDDPQERFL  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVA+SIQI+LGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVAASIQIVLGYSQVWGLFSRFFS  154



>ref|XP_009365106.1| PREDICTED: nucleobase-ascorbate transporter 1 [Pyrus x bretschneideri]
Length=520

 Score =   281 bits (718),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I HPPM+QLQDLEYCIDSNPPW ETI+LAFQNYI++LGTS MIP+ LVP MGGSDGD
Sbjct  1    MADITHPPMDQLQDLEYCIDSNPPWAETIVLAFQNYIMMLGTSVMIPSALVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSF+YVIPI YI+SD  LQRI+EPH RFI
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFSYVIPIAYIVSDHKLQRIAEPHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_006396141.1| hypothetical protein EUTSA_v10002485mg [Eutrema salsugineum]
 gb|ESQ36920.1| hypothetical protein EUTSA_v10002485mg [Eutrema salsugineum]
Length=520

 Score =   281 bits (718),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAEI+HPPMEQLQDLEYCIDSNPPWPET+LLAFQNYIL+LGTSA IP LLVP MGG+DGD
Sbjct  1    MAEISHPPMEQLQDLEYCIDSNPPWPETVLLAFQNYILMLGTSAFIPALLVPAMGGTDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARV+QTLLFVAGI T LQ+LFGTRLPAVVGGSFAYV+PI YII+DSSLQRIS  H RFI
Sbjct  61   KARVMQTLLFVAGIKTFLQSLFGTRLPAVVGGSFAYVVPIAYIINDSSLQRISNDHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_010467086.1| PREDICTED: nucleobase-ascorbate transporter 1 [Camelina sativa]
Length=520

 Score =   281 bits (718),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAEI HPPMEQLQDLEYCIDSNPPWPET+LLAFQNYIL+LG+SA IP LLVP MGGSDGD
Sbjct  1    MAEITHPPMEQLQDLEYCIDSNPPWPETVLLAFQNYILMLGSSAFIPALLVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            +ARVIQTLLFVAGI TLLQALFGTRLPAVVGGSFA+V+PI YIISDSSLQ+IS  H RFI
Sbjct  61   RARVIQTLLFVAGIKTLLQALFGTRLPAVVGGSFAFVVPIAYIISDSSLQKISNDHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|NP_178636.1| nucleobase-ascorbate transporter 1 [Arabidopsis thaliana]
 sp|Q9SHZ3.1|NAT1_ARATH RecName: Full=Nucleobase-ascorbate transporter 1; Short=AtNAT1 
[Arabidopsis thaliana]
 gb|AAD26910.1| putative membrane transporter [Arabidopsis thaliana]
 gb|AAY56427.1| At2g05760 [Arabidopsis thaliana]
 gb|AEC05969.1| nucleobase-ascorbate transporter 1 [Arabidopsis thaliana]
Length=520

 Score =   280 bits (717),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAEI+HPPMEQLQDLEYCIDSNPPWPET+LLAFQNYIL+LGTSA IP LLVP MGGSDGD
Sbjct  1    MAEISHPPMEQLQDLEYCIDSNPPWPETVLLAFQNYILMLGTSAFIPALLVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            +ARVIQTLLFVAGI TLLQALFGTRLPAVVGGS AYV+PI YII+DSSLQ+IS  H RFI
Sbjct  61   RARVIQTLLFVAGIKTLLQALFGTRLPAVVGGSLAYVVPIAYIINDSSLQKISNDHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_010691484.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=518

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I+HPPMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIPT++VP MGGSDGD
Sbjct  1    MADISHPPMEQLQDLEYCIDSNPPWVETILLAFQNYILMLGTSVMIPTIIVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAY+IP+ YII+DSSLQRI + H RFI
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYIIPVAYIINDSSLQRIPDSHDRFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIV+SSIQIILGYSQ+WGLFSRFFS
Sbjct  121  QTMRAIQGALIVSSSIQIILGYSQLWGLFSRFFS  154



>ref|XP_007215477.1| hypothetical protein PRUPE_ppa006581mg [Prunus persica]
 gb|EMJ16676.1| hypothetical protein PRUPE_ppa006581mg [Prunus persica]
Length=404

 Score =   276 bits (707),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I H PMEQLQDLEYCIDSNPPW ETI+LAFQNYI++LGTS MIP+ LVP MGGSDGD
Sbjct  1    MADITHLPMEQLQDLEYCIDSNPPWVETIVLAFQNYIMMLGTSVMIPSALVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLP VVGGSF+YVIPI YI+SDS LQRI EPH RFI
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPTVVGGSFSYVIPIAYIVSDSKLQRIIEPHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>gb|AES71659.2| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=520

 Score =   280 bits (717),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I HPPMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIP+ LVP MGG+ GD
Sbjct  1    MADITHPPMEQLQDLEYCIDSNPPWAETILLAFQNYILMLGTSVMIPSFLVPAMGGNPGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIP+ YII+DSSLQRI++PH RFI
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPVAYIINDSSLQRINDPHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQI+LGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIVLGYSQVWGLFSRFFS  154



>ref|XP_007146103.1| hypothetical protein PHAVU_006G012700g [Phaseolus vulgaris]
 gb|ESW18097.1| hypothetical protein PHAVU_006G012700g [Phaseolus vulgaris]
Length=520

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I HPPMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIP++LVP MGGS GD
Sbjct  1    MADITHPPMEQLQDLEYCIDSNPPWVETILLAFQNYILMLGTSVMIPSMLVPAMGGSSGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KA+VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPI YIISDSSLQRI++PH RF+
Sbjct  61   KAQVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIAYIISDSSLQRINDPHERFL  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQI+LGYSQ+WGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIVLGYSQIWGLFSRFFS  154



>emb|CDY18053.1| BnaC07g04170D [Brassica napus]
Length=520

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAEI+HPPMEQLQDLEYCIDSNPPWPET+LLAFQNYIL+LG+SA IP LLVP MGG+DGD
Sbjct  1    MAEISHPPMEQLQDLEYCIDSNPPWPETVLLAFQNYILMLGSSAFIPALLVPAMGGTDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARV+QTLLFVAGI TL+QALFGTRLPAVVGGSFAYV+PI YII+DSSLQRIS  H RFI
Sbjct  61   KARVMQTLLFVAGIKTLVQALFGTRLPAVVGGSFAYVVPIAYIINDSSLQRISSDHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_003601408.1| Nucleobase ascorbate transporter [Medicago truncatula]
Length=550

 Score =   280 bits (717),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I HPPMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIP+ LVP MGG+ GD
Sbjct  1    MADITHPPMEQLQDLEYCIDSNPPWAETILLAFQNYILMLGTSVMIPSFLVPAMGGNPGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIP+ YII+DSSLQRI++PH RFI
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPVAYIINDSSLQRINDPHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQI+LGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIVLGYSQVWGLFSRFFS  154



>ref|XP_004502044.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Cicer arietinum]
Length=520

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I HPPMEQLQDLEYCIDSNPPW ET+LLAFQNYIL+LGTS MIP+LLVP MGGS GD
Sbjct  1    MADITHPPMEQLQDLEYCIDSNPPWVETVLLAFQNYILMLGTSVMIPSLLVPAMGGSSGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIP+ YII DSSLQ+I++PH RFI
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPVAYIIGDSSLQQINDPHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQI+LGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIVLGYSQVWGLFSRFFS  154



>ref|XP_007049166.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX93323.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
Length=520

 Score =   279 bits (714),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 137/154 (89%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAE+ HPPM+QLQDLEYCIDSNPPW ETILLAFQNYI +LGTS MIP+LLVP MGGSDGD
Sbjct  1    MAEMIHPPMDQLQDLEYCIDSNPPWAETILLAFQNYIQLLGTSVMIPSLLVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPA++GGS+AYVIPI YII+DSSLQRIS+ H RFI
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAILGGSYAYVIPIAYIINDSSLQRISDRHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_006447639.1| hypothetical protein CICLE_v10014919mg [Citrus clementina]
 ref|XP_006469617.1| PREDICTED: nucleobase-ascorbate transporter 1-like isoform X1 
[Citrus sinensis]
 gb|ESR60879.1| hypothetical protein CICLE_v10014919mg [Citrus clementina]
 gb|KDO54299.1| hypothetical protein CISIN_1g009755mg [Citrus sinensis]
Length=520

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAE +HPPM+QLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIPTLLV  MGGS+GD
Sbjct  1    MAEYSHPPMDQLQDLEYCIDSNPPWAETILLAFQNYILMLGTSVMIPTLLVHAMGGSNGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFV+GINTLLQALFGTRLPAVVGGSFAYVIPI YII+DSSLQRI++ H RFI
Sbjct  61   KARVIQTLLFVSGINTLLQALFGTRLPAVVGGSFAYVIPIAYIINDSSLQRITDDHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>emb|CDX93090.1| BnaA03g38120D [Brassica napus]
Length=521

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAEI+HPPMEQLQDLEYCIDSNPPWPET+LLAFQNYIL+LG+SA IP LLVP MGG+DGD
Sbjct  1    MAEISHPPMEQLQDLEYCIDSNPPWPETVLLAFQNYILMLGSSAFIPALLVPAMGGTDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARV+QTLLFVAGI TL+Q+LFGTRLPAVVGGSFAYVIPI YII+DSSLQ+IS  H RFI
Sbjct  61   KARVMQTLLFVAGIKTLVQSLFGTRLPAVVGGSFAYVIPIAYIINDSSLQKISNDHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_006469618.1| PREDICTED: nucleobase-ascorbate transporter 1-like isoform X2 
[Citrus sinensis]
Length=518

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAE +HPPM+QLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIPTLLV  MGGS+GD
Sbjct  1    MAEYSHPPMDQLQDLEYCIDSNPPWAETILLAFQNYILMLGTSVMIPTLLVHAMGGSNGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFV+GINTLLQALFGTRLPAVVGGSFAYVIPI YII+DSSLQRI++ H RFI
Sbjct  61   KARVIQTLLFVSGINTLLQALFGTRLPAVVGGSFAYVIPIAYIINDSSLQRITDDHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_009136180.1| PREDICTED: nucleobase-ascorbate transporter 1 [Brassica rapa]
Length=520

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAEI+HPPMEQLQDLEYCIDSNPPWPET+LLAFQNYIL+LG+SA IP LLVP MGG+DGD
Sbjct  1    MAEISHPPMEQLQDLEYCIDSNPPWPETVLLAFQNYILMLGSSAFIPALLVPAMGGTDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARV+QTLLFVAGI TL+Q+LFGTRLPAVVGGSFAYVIPI YII+DSSLQ+IS  H RFI
Sbjct  61   KARVMQTLLFVAGIKTLVQSLFGTRLPAVVGGSFAYVIPIAYIINDSSLQKISNDHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>emb|CDY50943.1| BnaC03g74430D [Brassica napus]
Length=520

 Score =   278 bits (712),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 145/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAEI+HPPMEQLQDLEYCIDSNPPWPET+LLAFQNYIL+LG+SA IP LLVP MGG+DGD
Sbjct  1    MAEISHPPMEQLQDLEYCIDSNPPWPETVLLAFQNYILMLGSSAFIPALLVPAMGGTDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARV+QTLLFVAGI TL+Q+LFGTRLPAVVGGSFAYVIPI YII+DSSLQ+IS  H RFI
Sbjct  61   KARVMQTLLFVAGIKTLVQSLFGTRLPAVVGGSFAYVIPIAYIINDSSLQKISNDHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_003542318.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Glycine max]
Length=520

 Score =   278 bits (711),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I H PMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIP++LVP MGGS GD
Sbjct  1    MADITHQPMEQLQDLEYCIDSNPPWAETILLAFQNYILMLGTSVMIPSMLVPAMGGSSGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KA+VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPI +IISDSSLQRI++PH RF+
Sbjct  61   KAQVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIAHIISDSSLQRINDPHERFL  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQI+LGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIVLGYSQVWGLFSRFFS  154



>gb|KFK39879.1| hypothetical protein AALP_AA3G300500 [Arabis alpina]
Length=520

 Score =   277 bits (709),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 135/154 (88%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAEI+HPPMEQLQDLEYCIDSNPPWPET+LLAFQNYI++LGTS  IP LLVP MGGSDGD
Sbjct  1    MAEISHPPMEQLQDLEYCIDSNPPWPETVLLAFQNYIVMLGTSTFIPALLVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARV+QTLLFVAGI T+LQ+LFGTRLPAVVGGSFA+VIPI YII DSSLQRIS  H RFI
Sbjct  61   KARVMQTLLFVAGIKTILQSLFGTRLPAVVGGSFAFVIPIAYIIHDSSLQRISNDHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_008456413.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X2 [Cucumis 
melo]
Length=453

 Score =   275 bits (702),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I HPPMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGT+ MIP+L+VP MGG +GD
Sbjct  1    MADITHPPMEQLQDLEYCIDSNPPWAETILLAFQNYILMLGTNVMIPSLIVPAMGGDNGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAG+NTLLQALFGTRLPAVVGGSFAYVIPI YI+ DSSLQRIS+ H RF+
Sbjct  61   KARVIQTLLFVAGLNTLLQALFGTRLPAVVGGSFAYVIPIAYIVGDSSLQRISDSHERFL  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQIILGYSQVWGL SRFFS
Sbjct  121  HTMRAIQGALIVASSIQIILGYSQVWGLLSRFFS  154



>ref|XP_008230014.1| PREDICTED: nucleobase-ascorbate transporter 1 [Prunus mume]
Length=520

 Score =   276 bits (705),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I H PMEQLQDLEYCIDSNPPW ETI+LAFQNYI++LGTS MIP+ LVP MGGSDGD
Sbjct  1    MADITHLPMEQLQDLEYCIDSNPPWVETIVLAFQNYIMMLGTSVMIPSALVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLP VVGGSF+YVIPI YI+SDS LQRI EPH RFI
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPTVVGGSFSYVIPIAYIVSDSKLQRIIEPHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_006297434.1| hypothetical protein CARUB_v10013457mg [Capsella rubella]
 gb|EOA30332.1| hypothetical protein CARUB_v10013457mg [Capsella rubella]
Length=520

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 136/154 (88%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAEI HPPMEQLQDLEYCIDSNP WPET+LLAFQNYIL+LG+S  IPTLLV  MGGS+GD
Sbjct  1    MAEITHPPMEQLQDLEYCIDSNPSWPETVLLAFQNYILMLGSSVFIPTLLVHAMGGSNGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGI TLLQALFGTRLPAVVGGSFAYV+PI YIISDSSLQ+IS  H RFI
Sbjct  61   KARVIQTLLFVAGIKTLLQALFGTRLPAVVGGSFAYVVPIAYIISDSSLQKISSDHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_008456412.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X1 [Cucumis 
melo]
Length=520

 Score =   275 bits (703),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I HPPMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGT+ MIP+L+VP MGG +GD
Sbjct  1    MADITHPPMEQLQDLEYCIDSNPPWAETILLAFQNYILMLGTNVMIPSLIVPAMGGDNGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAG+NTLLQALFGTRLPAVVGGSFAYVIPI YI+ DSSLQRIS+ H RF+
Sbjct  61   KARVIQTLLFVAGLNTLLQALFGTRLPAVVGGSFAYVIPIAYIVGDSSLQRISDSHERFL  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQIILGYSQVWGL SRFFS
Sbjct  121  HTMRAIQGALIVASSIQIILGYSQVWGLLSRFFS  154



>ref|XP_004149274.1| PREDICTED: nucleobase-ascorbate transporter 1 [Cucumis sativus]
 gb|KGN46982.1| hypothetical protein Csa_6G157080 [Cucumis sativus]
Length=520

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I HPPMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGT+ MIP+L+VP MGG +GD
Sbjct  1    MADITHPPMEQLQDLEYCIDSNPPWAETILLAFQNYILMLGTNVMIPSLIVPAMGGDNGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAG+NTLLQALFGTRLPAVVGGSFAYVIPI YI+ DSSLQRIS+ H RF+
Sbjct  61   KARVIQTLLFVAGLNTLLQALFGTRLPAVVGGSFAYVIPIAYIVGDSSLQRISDSHERFL  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQIILGYSQ+WGL SRFFS
Sbjct  121  HTMRAIQGALIVASSIQIILGYSQIWGLLSRFFS  154



>ref|XP_004304090.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=520

 Score =   273 bits (699),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 131/154 (85%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I HPPM+QLQDLEYCIDSNPPW ETI+LAFQNYI++LGTS M+P+LLVP MGGSDGD
Sbjct  1    MADITHPPMDQLQDLEYCIDSNPPWAETIVLAFQNYIVMLGTSVMVPSLLVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGI TLLQALFGTRLPAVVGGSFAYV+PI YII+DS   RI++ H RF+
Sbjct  61   KARVIQTLLFVAGIKTLLQALFGTRLPAVVGGSFAYVVPIAYIINDSKFHRITDNHERFL  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_008799349.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Phoenix dactylifera]
Length=520

 Score =   273 bits (698),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 147/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I+HPPMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGT+ MIP++LVPLMGGSDGD
Sbjct  1    MADISHPPMEQLQDLEYCIDSNPPWIETILLAFQNYILMLGTTVMIPSILVPLMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            K RVIQT LFV+GINTLLQALFGTRLPAVVGGSFAY+IPI+YII DS+LQRI +PH RF+
Sbjct  61   KIRVIQTSLFVSGINTLLQALFGTRLPAVVGGSFAYIIPILYIIRDSALQRIPDPHERFL  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALI+ASS+QII+GYSQ+WG+FSRFFS
Sbjct  121  QTMRAIQGALIIASSLQIIVGYSQLWGIFSRFFS  154



>ref|XP_010533013.1| PREDICTED: nucleobase-ascorbate transporter 1 [Tarenaya hassleriana]
Length=520

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I HPPMEQLQDLEYCIDSNPPWPET++LAFQNYIL+LG+S  IP++LVP MGG+DGD
Sbjct  1    MADITHPPMEQLQDLEYCIDSNPPWPETVILAFQNYILMLGSSVFIPSMLVPAMGGTDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGI TLLQALFGTRLPA+VGGS+AY++ IVYII+DSSLQRIS  H RFI
Sbjct  61   KARVIQTLLFVAGIKTLLQALFGTRLPAIVGGSYAYIVVIVYIINDSSLQRISNDHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGA+IVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGAMIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_002320481.1| xanthine/uracil permease family protein [Populus trichocarpa]
 gb|EEE98796.1| xanthine/uracil permease family protein [Populus trichocarpa]
Length=521

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 147/155 (95%), Gaps = 1/155 (1%)
 Frame = +2

Query  215  MAEI-AHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDG  391
            MA+I +HPPM+QLQDLEYCIDSNPPW ETI+LAFQNYI++LGTS MIP++LVP MGG+DG
Sbjct  1    MADIISHPPMDQLQDLEYCIDSNPPWAETIILAFQNYIVMLGTSVMIPSVLVPAMGGTDG  60

Query  392  DKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRF  571
            DKARVIQTLLFVAGINTLLQALFGTRLPAVVGGS+AYV+PI YII D+SLQRI++ H RF
Sbjct  61   DKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSYAYVVPIAYIIRDTSLQRITDGHERF  120

Query  572  IQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            IQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  IQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  155



>gb|EYU34044.1| hypothetical protein MIMGU_mgv1a004592mg [Erythranthe guttata]
Length=519

 Score =   271 bits (692),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            M +I HPPMEQLQDLEYCIDSNPPWPE I+LAFQNYI+VLGTS MIPT+LVP+MGGSD D
Sbjct  1    MGDITHPPMEQLQDLEYCIDSNPPWPEIIVLAFQNYIVVLGTSVMIPTMLVPVMGGSDED  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARV+QTLLFVAG NTLLQ+LFGTRLP VVGGS  YVI I YII+DSSLQRI +PH RFI
Sbjct  61   KARVVQTLLFVAGFNTLLQSLFGTRLPTVVGGSLTYVISIAYIINDSSLQRIEDPHSRFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALIVASSIQII+GYSQVWGLFSRFFS
Sbjct  121  HTMRAIQGALIVASSIQIIIGYSQVWGLFSRFFS  154



>ref|XP_011047203.1| PREDICTED: nucleobase-ascorbate transporter 1 [Populus euphratica]
Length=521

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 146/155 (94%), Gaps = 1/155 (1%)
 Frame = +2

Query  215  MAEIA-HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDG  391
            MA+I  HPPM+QLQDLEYCIDSNPPW ETI+LAFQNYI++LGTS MIP++LVP MGG+DG
Sbjct  1    MADIIIHPPMDQLQDLEYCIDSNPPWAETIILAFQNYIVMLGTSVMIPSVLVPAMGGTDG  60

Query  392  DKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRF  571
            DKARVIQTLLFVAGINTLLQALFGTRLPAVVGGS+AYV+PI YII D+SLQRI++ H RF
Sbjct  61   DKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSYAYVVPIAYIIRDTSLQRITDGHERF  120

Query  572  IQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            IQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  IQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  155



>gb|KJB08649.1| hypothetical protein B456_001G095500 [Gossypium raimondii]
Length=520

 Score =   270 bits (691),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 132/154 (86%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAEI HPPM+QLQDLEYCIDSNP W ETILLAFQNYIL+LGTS MIPTLLVP MGG+D D
Sbjct  1    MAEITHPPMDQLQDLEYCIDSNPSWAETILLAFQNYILMLGTSVMIPTLLVPAMGGTDRD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KA VIQTLLFVAGINT+LQALFGTRLPAV+GGS+AYVIP+ YII+D SLQRIS+ H RFI
Sbjct  61   KALVIQTLLFVAGINTVLQALFGTRLPAVIGGSYAYVIPVAYIINDPSLQRISDRHDRFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGAL++ASSIQIILGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALVIASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_011626932.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X2 [Amborella 
trichopoda]
Length=454

 Score =   268 bits (685),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  209  MAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSD  388
            MA+A+I+HPPM+QL DL+YCIDSNPPWPETI+LAFQNYI++LGTS +IPT+LVPLMGG+ 
Sbjct  1    MAVADISHPPMDQLHDLDYCIDSNPPWPETIILAFQNYIVMLGTSVIIPTMLVPLMGGTY  60

Query  389  GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIR  568
             DKARVIQTLLFVAGINTLLQALFGTRLPAVVGGS+A+VIPI+YII DSS QRI + H R
Sbjct  61   EDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSYAFVIPILYIIGDSSFQRIPDNHER  120

Query  569  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            FIQTMRAIQGALIVASS+QII+GYSQ+WG+FSRFFS
Sbjct  121  FIQTMRAIQGALIVASSLQIIIGYSQLWGIFSRFFS  156



>ref|XP_009395859.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=520

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 143/154 (93%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            M  I+HPPMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIP+LLVPLMGG+D D
Sbjct  1    MENISHPPMEQLQDLEYCIDSNPPWVETILLAFQNYILMLGTSVMIPSLLVPLMGGTDAD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            K RVIQTLLFV+GINTLLQALFGTRLP VVGGSFAYVIPI+YII DSSLQRI + H RF+
Sbjct  61   KVRVIQTLLFVSGINTLLQALFGTRLPTVVGGSFAYVIPILYIIRDSSLQRIPDQHERFL  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALI+ASS+QIILGYSQ+WG+F+RFFS
Sbjct  121  QTMRAIQGALIIASSLQIILGYSQLWGIFTRFFS  154



>ref|XP_006828104.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X1 [Amborella 
trichopoda]
 gb|ERM95520.1| hypothetical protein AMTR_s00151p00089770 [Amborella trichopoda]
Length=522

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  209  MAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSD  388
            MA+A+I+HPPM+QL DL+YCIDSNPPWPETI+LAFQNYI++LGTS +IPT+LVPLMGG+ 
Sbjct  1    MAVADISHPPMDQLHDLDYCIDSNPPWPETIILAFQNYIVMLGTSVIIPTMLVPLMGGTY  60

Query  389  GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIR  568
             DKARVIQTLLFVAGINTLLQALFGTRLPAVVGGS+A+VIPI+YII DSS QRI + H R
Sbjct  61   EDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSYAFVIPILYIIGDSSFQRIPDNHER  120

Query  569  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            FIQTMRAIQGALIVASS+QII+GYSQ+WG+FSRFFS
Sbjct  121  FIQTMRAIQGALIVASSLQIIIGYSQLWGIFSRFFS  156



>ref|XP_009415455.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Musa acuminata 
subsp. malaccensis]
Length=520

 Score =   268 bits (684),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            M  I+HPPMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIP++LVPLMGG+D D
Sbjct  1    MENISHPPMEQLQDLEYCIDSNPPWVETILLAFQNYILMLGTSVMIPSMLVPLMGGTDAD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            K RVIQTLLFV+GINTLLQALFGTRLP +VGGSF+YVIPI+YII DSSLQ+I +PH RF+
Sbjct  61   KIRVIQTLLFVSGINTLLQALFGTRLPTIVGGSFSYVIPILYIIRDSSLQQIPDPHERFL  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALI+ASS+QII+GYSQ+WG+FSRFFS
Sbjct  121  QTMRAIQGALIIASSLQIIIGYSQLWGIFSRFFS  154



>ref|XP_010943259.1| PREDICTED: nucleobase-ascorbate transporter 1 [Elaeis guineensis]
Length=520

 Score =   265 bits (678),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 144/154 (94%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I+HPPMEQLQDLEYCIDSNPPW ETILL FQNYIL+LGT+ MIP+LLVPLMGGSDGD
Sbjct  1    MADISHPPMEQLQDLEYCIDSNPPWIETILLGFQNYILMLGTTVMIPSLLVPLMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            K  VIQT LFV+GINTLLQ+LFGTRLPAV+GGSFAYVIPI+YI+ DSSL RI +PH RF+
Sbjct  61   KIWVIQTSLFVSGINTLLQSLFGTRLPAVMGGSFAYVIPILYIMRDSSLLRIPDPHERFL  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALI+ASS+Q+ILGYSQ+WG+FSRFFS
Sbjct  121  QTMRAIQGALIIASSLQVILGYSQLWGIFSRFFS  154



>gb|KJB42851.1| hypothetical protein B456_007G170500 [Gossypium raimondii]
Length=491

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAEI HPPM+QLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIP++LVP MGGSDGD
Sbjct  1    MAEIIHPPMDQLQDLEYCIDSNPPWAETILLAFQNYILMLGTSVMIPSVLVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPA+VGGSFAY+IPI YII+DSSLQRIS  H RFI
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAIVGGSFAYIIPIAYIINDSSLQRISNRHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>gb|KJB42850.1| hypothetical protein B456_007G170500 [Gossypium raimondii]
Length=520

 Score =   263 bits (671),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 139/154 (90%), Positives = 146/154 (95%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MAEI HPPM+QLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIP++LVP MGGSDGD
Sbjct  1    MAEIIHPPMDQLQDLEYCIDSNPPWAETILLAFQNYILMLGTSVMIPSVLVPAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGINTLLQALFGTRLPA+VGGSFAY+IPI YII+DSSLQRIS  H RFI
Sbjct  61   KARVIQTLLFVAGINTLLQALFGTRLPAIVGGSFAYIIPIAYIINDSSLQRISNRHERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  121  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  154



>ref|XP_008803524.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Phoenix dactylifera]
Length=520

 Score =   257 bits (657),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 142/154 (92%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I+H PMEQLQDLEYCIDSNPPW ETILL FQNY+L+LGT+ MIP+LLVPLMGG+DGD
Sbjct  1    MADISHLPMEQLQDLEYCIDSNPPWIETILLGFQNYVLMLGTTVMIPSLLVPLMGGNDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            +  VIQT LFV+GINTLLQ+LFGTRLP V+GGSFAYV+PI+YI+ DSSLQRI +PH RF+
Sbjct  61   RIWVIQTSLFVSGINTLLQSLFGTRLPTVMGGSFAYVMPILYIMRDSSLQRIPDPHERFL  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALI+AS++QIILGYSQ+WGLFSRFFS
Sbjct  121  HTMRAIQGALILASTLQIILGYSQLWGLFSRFFS  154



>ref|XP_007141636.1| hypothetical protein PHAVU_008G212800g [Phaseolus vulgaris]
 gb|ESW13630.1| hypothetical protein PHAVU_008G212800g [Phaseolus vulgaris]
Length=521

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 139/155 (90%), Gaps = 1/155 (1%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I H PMEQLQDLE C+DSNPPW E ILLAFQNYIL+LGTS MIP+ +V  MGGSDGD
Sbjct  1    MADITHLPMEQLQDLECCLDSNPPWAEAILLAFQNYILMLGTSVMIPSWIVHAMGGSDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVV-GGSFAYVIPIVYIISDSSLQRISEPHIRF  571
            KARVIQTLLFVAG+NTLLQ LFGTRLP VV GGS AY+ PI YII+DSSLQ+IS+P+ RF
Sbjct  61   KARVIQTLLFVAGVNTLLQTLFGTRLPTVVGGGSSAYIYPIAYIITDSSLQQISDPNERF  120

Query  572  IQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            IQTMRAIQGALIVASSIQIILGYSQ+WGLFSRFFS
Sbjct  121  IQTMRAIQGALIVASSIQIILGYSQIWGLFSRFFS  155



>ref|XP_003545573.2| PREDICTED: nucleobase-ascorbate transporter 1-like isoform X1 
[Glycine max]
Length=562

 Score =   254 bits (648),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 138/156 (88%), Gaps = 1/156 (1%)
 Frame = +2

Query  212  AMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDG  391
             MA+I H PMEQLQDLE C+DSNPPW E ILLAFQNYIL+LGTS MIP+ +V  MGGSDG
Sbjct  41   TMADITHLPMEQLQDLECCLDSNPPWAEAILLAFQNYILMLGTSVMIPSWIVHAMGGSDG  100

Query  392  DKARVIQTLLFVAGINTLLQALFGTRLPAVV-GGSFAYVIPIVYIISDSSLQRISEPHIR  568
            DKARVIQTLLFVAGINTLLQ LFGTRLP VV GGS AY+ PI YII+DSSLQ+IS+ H R
Sbjct  101  DKARVIQTLLFVAGINTLLQTLFGTRLPTVVGGGSSAYIYPIAYIITDSSLQQISDSHER  160

Query  569  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  161  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  196



>ref|XP_006595823.1| PREDICTED: nucleobase-ascorbate transporter 1-like isoform X2 
[Glycine max]
Length=589

 Score =   254 bits (649),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I H PMEQLQDLE C+DSNPPW E ILLAFQNYIL+LGTS MIP+ +V  MGGSDGD
Sbjct  42   MADITHLPMEQLQDLECCLDSNPPWAEAILLAFQNYILMLGTSVMIPSWIVHAMGGSDGD  101

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVV-GGSFAYVIPIVYIISDSSLQRISEPHIRF  571
            KARVIQTLLFVAGINTLLQ LFGTRLP VV GGS AY+ PI YII+DSSLQ+IS+ H RF
Sbjct  102  KARVIQTLLFVAGINTLLQTLFGTRLPTVVGGGSSAYIYPIAYIITDSSLQQISDSHERF  161

Query  572  IQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            IQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  162  IQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  196



>ref|XP_003519453.2| PREDICTED: nucleobase-ascorbate transporter 1-like [Glycine max]
Length=557

 Score =   252 bits (644),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 137/156 (88%), Gaps = 1/156 (1%)
 Frame = +2

Query  212  AMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDG  391
             MA+I H PMEQLQDLE C+DSNPPW E ILLAFQNYIL+LGTS MIP+ +V  MGGSDG
Sbjct  36   TMADITHLPMEQLQDLECCLDSNPPWAEAILLAFQNYILMLGTSVMIPSWIVHAMGGSDG  95

Query  392  DKARVIQTLLFVAGINTLLQALFGTRLPAVV-GGSFAYVIPIVYIISDSSLQRISEPHIR  568
            DKARVIQ LLFVAGINTLLQ LFGTRLP VV GGS AY+ PI YII+DSSLQ+IS+ H R
Sbjct  96   DKARVIQALLFVAGINTLLQTLFGTRLPTVVGGGSSAYIYPIAYIITDSSLQQISDSHER  155

Query  569  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  156  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  191



>gb|AFW85020.1| hypothetical protein ZEAMMB73_943324 [Zea mays]
Length=226

 Score =   240 bits (613),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPMEQLQ  EYCIDSNPPW E I+L FQ+YIL LGT+ MIPT+LVP+MGG DGD+ 
Sbjct  8    EISHPPMEQLQGFEYCIDSNPPWGEAIILGFQHYILALGTAVMIPTVLVPMMGGDDGDRV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ+LFGTRLP V+GGS+A+VIPI+ II D SL  I + H RF++T
Sbjct  68   RVVQTLLFVTGINTLLQSLFGTRLPTVIGGSYAFVIPIMAIIQDPSLSGIPDGHERFLET  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            M+AIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MKAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>ref|XP_010920310.1| PREDICTED: nucleobase-ascorbate transporter 2-like isoform X1 
[Elaeis guineensis]
Length=524

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI HPPM+QLQ  EYCIDSNP W E I L FQ+YIL LGT+ MIPTLLVPLMGG+DGDK 
Sbjct  8    EITHPPMDQLQGFEYCIDSNPSWGEAIALGFQHYILALGTAVMIPTLLVPLMGGTDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP VVGGS+A+V+PI+ II DSSL RIS+ H RF+QT
Sbjct  68   RVVQTLLFVTGINTLLQTLFGTRLPTVVGGSYAFVVPIISIIHDSSLTRISDDHERFLQT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MRAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>gb|KDO77882.1| hypothetical protein CISIN_1g0098372mg, partial [Citrus sinensis]
Length=201

 Score =   237 bits (605),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            + EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGGSDGD
Sbjct  6    LEEISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGSDGD  65

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            K RV+QTLLFV GINTLLQ LFGTRLP VVGGS+A+++PI+ II D SL  I + H+RF+
Sbjct  66   KVRVVQTLLFVEGINTLLQTLFGTRLPTVVGGSYAFMVPIISIIHDPSLASIEDNHVRFL  125

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRA+QGALIVASSIQIILGYSQ+W + SRFFS
Sbjct  126  NTMRAVQGALIVASSIQIILGYSQLWAICSRFFS  159



>gb|ABR17751.1| unknown [Picea sitchensis]
Length=524

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 135/154 (88%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            + +I HPPMEQL  LEYCIDSNPPWPETI+L FQ+YIL+LGT+ M+PT LVP MGG+D D
Sbjct  6    LEDITHPPMEQLPGLEYCIDSNPPWPETIILGFQHYILMLGTTVMVPTFLVPAMGGNDHD  65

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            K RVIQTLLFVAGINTLLQ+LFGTRLP VVGGSFA++IPI  II+DSSL+ I + H RF+
Sbjct  66   KVRVIQTLLFVAGINTLLQSLFGTRLPTVVGGSFAFIIPITSIINDSSLRSIPDDHQRFL  125

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRAIQGALI +SS+QIILGYSQ+WG+FSRFFS
Sbjct  126  HTMRAIQGALIASSSLQIILGYSQLWGIFSRFFS  159



>gb|EEC71519.1| hypothetical protein OsI_03815 [Oryza sativa Indica Group]
Length=497

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPMEQLQ  EYCIDSNPPW E I+L FQ+YIL LGT+ MIP +LVP+MGGSDGD+ 
Sbjct  8    EISHPPMEQLQGFEYCIDSNPPWGEAIILGFQHYILALGTAVMIPAVLVPMMGGSDGDRV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ+LFGTRLP V+GGS+A+V+PI+ II DSSL  I + H RF+QT
Sbjct  68   RVVQTLLFVTGINTLLQSLFGTRLPTVIGGSYAFVVPIMAIIQDSSLAAIPDDHERFLQT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MRAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>ref|XP_004970033.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Setaria italica]
Length=524

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPMEQLQ  EYCIDSNPPW E I+LAFQ+YIL LGT+ MIP +LVP+MGG DGD+ 
Sbjct  8    EISHPPMEQLQGFEYCIDSNPPWGEAIILAFQHYILALGTAVMIPAVLVPMMGGDDGDRV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ+LFGTRLP V+GGS+A+VIPIV II DSSL  I + H RF++T
Sbjct  68   RVVQTLLFVTGINTLLQSLFGTRLPTVIGGSYAFVIPIVAIIQDSSLAAIPDGHERFLET  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MRAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>gb|AFW85021.1| hypothetical protein ZEAMMB73_943324 [Zea mays]
Length=359

 Score =   240 bits (613),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPMEQLQ  EYCIDSNPPW E I+L FQ+YIL LGT+ MIPT+LVP+MGG DGD+ 
Sbjct  8    EISHPPMEQLQGFEYCIDSNPPWGEAIILGFQHYILALGTAVMIPTVLVPMMGGDDGDRV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ+LFGTRLP V+GGS+A+VIPI+ II D SL  I + H RF++T
Sbjct  68   RVVQTLLFVTGINTLLQSLFGTRLPTVIGGSYAFVIPIMAIIQDPSLSGIPDGHERFLET  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            M+AIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MKAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>ref|XP_006644739.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Oryza brachyantha]
Length=524

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPMEQLQ  EYCIDSNPPW E I+L FQ+YIL LGT+ MIP +LVP+MGGSDGD+ 
Sbjct  8    EISHPPMEQLQGFEYCIDSNPPWGEAIILGFQHYILALGTAVMIPAVLVPMMGGSDGDRV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ+LFGTRLP V+GGS+A+V+PI+ II DSSL  I + H RF+QT
Sbjct  68   RVVQTLLFVTGINTLLQSLFGTRLPTVIGGSYAFVVPIMAIIQDSSLAAIPDDHERFLQT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MRAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>ref|XP_003522486.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Glycine max]
Length=524

 Score =   244 bits (624),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 135/152 (89%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W ETI+L FQ+YIL LGT+ MIP+ LVPLMGGSD DK 
Sbjct  8    EISHPPMDQLQGLEYCIDSNPSWVETIVLGFQHYILALGTAVMIPSFLVPLMGGSDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL+RI +PH+RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLKRIEDPHLRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGA+IVASSIQ+ILG+SQ+WG+ SRFFS
Sbjct  128  MRAIQGAMIVASSIQVILGFSQLWGICSRFFS  159



>ref|XP_010245958.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Nelumbo nucifera]
 ref|XP_010245959.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Nelumbo nucifera]
Length=520

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/154 (73%), Positives = 136/154 (88%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            M +I HPP EQ+QDL+YCIDSNPP  +TILLAFQNYI++LGTS MIP+ LVPLMGG+DGD
Sbjct  1    MGDINHPPKEQMQDLDYCIDSNPPLDQTILLAFQNYIVILGTSVMIPSFLVPLMGGTDGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            KARVIQTLLFVAGI TLLQ LFGTRLP +VGGS+++V+P++ II D  LQRI + + RFI
Sbjct  61   KARVIQTLLFVAGIKTLLQTLFGTRLPVIVGGSYSFVVPVLSIIGDPKLQRIPDSNERFI  120

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            QTMRAIQGA+I+ SS+QI+LGYSQ+WG+FSRFFS
Sbjct  121  QTMRAIQGAIIIGSSLQIVLGYSQLWGIFSRFFS  154



>gb|ACN25841.1| unknown [Zea mays]
Length=422

 Score =   241 bits (615),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPMEQLQ  EYCIDSNPPW E I+L FQ+YIL LGT+ MIPT+LVP+MGG DGD+ 
Sbjct  8    EISHPPMEQLQGFEYCIDSNPPWGEAIILGFQHYILALGTAVMIPTVLVPMMGGDDGDRV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ+LFGTRLP V+GGS+A+VIPI+ II D SL  I + H RF++T
Sbjct  68   RVVQTLLFVTGINTLLQSLFGTRLPTVIGGSYAFVIPIMAIIQDPSLSGIPDGHERFLET  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            M+AIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MKAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>ref|XP_009394827.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   244 bits (622),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI HPPM+QLQ  EYCIDSNP W E I+L FQ+YIL LGT+ MIPTLLVPLMGGS+ DK 
Sbjct  8    EITHPPMDQLQGFEYCIDSNPSWGEAIVLGFQHYILALGTAVMIPTLLVPLMGGSNDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV G+NTLLQ LFGTRLP VVGGS+A+V+PI+ II DSSL RI + H RF+QT
Sbjct  68   RVVQTLLFVTGVNTLLQTLFGTRLPTVVGGSYAFVVPIISIIHDSSLTRIVDDHERFLQT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MRAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>ref|XP_004233030.1| PREDICTED: nucleobase-ascorbate transporter 2 [Solanum lycopersicum]
Length=525

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 133/160 (83%), Gaps = 3/160 (2%)
 Frame = +2

Query  197  PPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLM  376
            PP P    EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLM
Sbjct  4    PPKP---EEISHPPMDQLQGLEYCIDSNPAWGEAIALGFQHYILALGTAVMIPSFLVPLM  60

Query  377  GGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISE  556
            GG DGDK RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+V+PI+ II DSSL RI+ 
Sbjct  61   GGDDGDKVRVVQTLLFVEGINTLLQTLFGTRLPTVIGGSWAFVVPIISIIHDSSLTRIAN  120

Query  557  PHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            PH RF+ TMRAIQGALIVASS+QIILGYSQ+W + SRFFS
Sbjct  121  PHDRFLSTMRAIQGALIVASSVQIILGYSQLWAICSRFFS  160



>gb|AFW85022.1| hypothetical protein ZEAMMB73_943324 [Zea mays]
Length=449

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPMEQLQ  EYCIDSNPPW E I+L FQ+YIL LGT+ MIPT+LVP+MGG DGD+ 
Sbjct  8    EISHPPMEQLQGFEYCIDSNPPWGEAIILGFQHYILALGTAVMIPTVLVPMMGGDDGDRV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ+LFGTRLP V+GGS+A+VIPI+ II D SL  I + H RF++T
Sbjct  68   RVVQTLLFVTGINTLLQSLFGTRLPTVIGGSYAFVIPIMAIIQDPSLSGIPDGHERFLET  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            M+AIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MKAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>ref|XP_008789343.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Phoenix dactylifera]
Length=524

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ  EYCIDSNP W E I L FQ+YIL LGT+ MIPTLLVPLMGG+D DK 
Sbjct  8    EISHPPMDQLQGFEYCIDSNPSWGEAIALGFQHYILALGTAVMIPTLLVPLMGGTDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+V+PI+ II DSSL +IS+ H RF++T
Sbjct  68   RVVQTLLFVTGINTLLQTLFGTRLPTVIGGSYAFVVPIISIIHDSSLTQISDDHERFLET  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MRAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>dbj|BAB61205.1| putative permease 1 [Oryza sativa Japonica Group]
 dbj|BAB92350.1| putative permease 1 [Oryza sativa Japonica Group]
Length=524

 Score =   243 bits (619),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI++PPMEQLQ  EYCIDSNPPW E I+L FQ+YIL LGT+ MIP +LVP+MGGSDGD+ 
Sbjct  8    EISYPPMEQLQGFEYCIDSNPPWGEAIILGFQHYILALGTAVMIPAVLVPMMGGSDGDRV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ+LFGTRLP V+GGS+A+V+PI+ II DSSL  I + H RF+QT
Sbjct  68   RVVQTLLFVTGINTLLQSLFGTRLPTVIGGSYAFVVPIMAIIQDSSLAAIPDDHERFLQT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MRAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>ref|XP_006358126.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Solanum tuberosum]
Length=525

 Score =   242 bits (618),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 134/160 (84%), Gaps = 3/160 (2%)
 Frame = +2

Query  197  PPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLM  376
            PP P    EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLM
Sbjct  4    PPKP---EEISHPPMDQLQGLEYCIDSNPAWGEAIALGFQHYILALGTAVMIPSFLVPLM  60

Query  377  GGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISE  556
            GG+DGDK RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+ +PI+ II DSSL RI++
Sbjct  61   GGTDGDKVRVVQTLLFVEGINTLLQTLFGTRLPTVIGGSWAFAVPIISIIHDSSLTRITD  120

Query  557  PHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            PH RF+ TMRAIQGALIVASS+QIILGYSQ+W + SRFFS
Sbjct  121  PHERFLGTMRAIQGALIVASSVQIILGYSQLWAICSRFFS  160



>gb|KFK36325.1| hypothetical protein AALP_AA4G108100 [Arabis alpina]
Length=524

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  203  SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGG  382
             P+   EI+HPPM+QLQ LEYCIDSNPPW E I L F++YIL LGT+ MIP+ LVP+MGG
Sbjct  2    DPVKPEEISHPPMDQLQGLEYCIDSNPPWGEAIALGFEHYILALGTAVMIPSFLVPMMGG  61

Query  383  SDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPH  562
             DGDK RV+QTLLF+ G+NTLLQ LFGTRLP V+GGS+A+++PI+ II+DSSL RI +PH
Sbjct  62   DDGDKVRVVQTLLFIQGVNTLLQTLFGTRLPTVIGGSYAFMVPIISIINDSSLTRIEDPH  121

Query  563  IRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +RF+ TMRA+QGA+IVASS+QIILG+SQ+W + SRFFS
Sbjct  122  LRFLSTMRAVQGAIIVASSVQIILGFSQIWSICSRFFS  159



>ref|XP_011101410.1| PREDICTED: nucleobase-ascorbate transporter 2 [Sesamum indicum]
Length=524

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG+D DK 
Sbjct  8    EISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGTDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II DSSLQRI +PH+RF+ T
Sbjct  68   RVVQTLLFVGGINTLLQTLFGTRLPTVIGGSWAFMVPIISIIHDSSLQRIPDPHMRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIVASS+QIILGYSQ+W + SRFFS
Sbjct  128  MRAIQGALIVASSVQIILGYSQLWAICSRFFS  159



>ref|XP_008443418.1| PREDICTED: nucleobase-ascorbate transporter 2 [Cucumis melo]
Length=524

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG DGDK 
Sbjct  8    EISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGDDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL RI +PH+RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLSRIEDPHLRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIV+SSIQIILGYSQ+W + SRFFS
Sbjct  128  MRAVQGALIVSSSIQIILGYSQLWAICSRFFS  159



>ref|XP_003526259.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Glycine max]
Length=524

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W ETI+L FQ+YIL LGT+ MIP+ LVPLMGGSD DK 
Sbjct  8    EISHPPMDQLQGLEYCIDSNPSWVETIVLGFQHYILALGTAVMIPSFLVPLMGGSDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL RI +PH+RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLTRIEDPHLRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGA+IVASSIQIILG+SQ+W + SRFFS
Sbjct  128  MRAVQGAMIVASSIQIILGFSQLWAICSRFFS  159



>gb|KHN07045.1| Nucleobase-ascorbate transporter 2 [Glycine soja]
Length=544

 Score =   241 bits (616),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W ETI+L FQ+YIL LGT+ MIP+ LVPLMGGSD DK 
Sbjct  8    EISHPPMDQLQGLEYCIDSNPSWVETIVLGFQHYILALGTAVMIPSFLVPLMGGSDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL RI +PH+RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLTRIEDPHLRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGA+IVASSIQIILG+SQ+W + SRFFS
Sbjct  128  MRAVQGAMIVASSIQIILGFSQLWAICSRFFS  159



>ref|NP_001152037.1| solute carrier family 23 member 2 [Zea mays]
 gb|ACG45503.1| solute carrier family 23 member 2 [Zea mays]
 gb|AFW85023.1| solute carrier family 23 member 2 [Zea mays]
Length=524

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPMEQLQ  EYCIDSNPPW E I+L FQ+YIL LGT+ MIPT+LVP+MGG DGD+ 
Sbjct  8    EISHPPMEQLQGFEYCIDSNPPWGEAIILGFQHYILALGTAVMIPTVLVPMMGGDDGDRV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ+LFGTRLP V+GGS+A+VIPI+ II D SL  I + H RF++T
Sbjct  68   RVVQTLLFVTGINTLLQSLFGTRLPTVIGGSYAFVIPIMAIIQDPSLSGIPDGHERFLET  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            M+AIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MKAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>ref|XP_004150216.1| PREDICTED: nucleobase-ascorbate transporter 2 [Cucumis sativus]
 gb|KGN65623.1| hypothetical protein Csa_1G470390 [Cucumis sativus]
Length=524

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG DGDK 
Sbjct  8    EITHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGDDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL RI +PH+RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLSRIEDPHLRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIV+SSIQIILGYSQ+W + SRFFS
Sbjct  128  MRAVQGALIVSSSIQIILGYSQLWAICSRFFS  159



>ref|XP_006294014.1| hypothetical protein CARUB_v10023002mg [Capsella rubella]
 gb|EOA26912.1| hypothetical protein CARUB_v10023002mg [Capsella rubella]
Length=524

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 136/158 (86%), Gaps = 0/158 (0%)
 Frame = +2

Query  203  SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGG  382
             P+   EI+HPPM+QLQ LEYCIDSNPPW E I L F++YIL LGT+ MIP++LVP+MGG
Sbjct  2    DPVKPEEISHPPMDQLQGLEYCIDSNPPWGEAIALGFEHYILALGTAVMIPSILVPMMGG  61

Query  383  SDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPH  562
             DGDK RV+QTLLF+ G+NTLLQ LFGTRLPAV+GGS+A+++PI+ II DSSL RI +P 
Sbjct  62   DDGDKVRVVQTLLFLQGVNTLLQTLFGTRLPAVIGGSYAFMVPIISIIKDSSLTRIEDPQ  121

Query  563  IRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +RF+ TMRA+QGA+IVASS+QIILG+SQ+WG+ SRFFS
Sbjct  122  MRFLSTMRAVQGAIIVASSVQIILGFSQMWGICSRFFS  159



>ref|XP_004293963.1| PREDICTED: nucleobase-ascorbate transporter 2 [Fragaria vesca 
subsp. vesca]
Length=526

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +2

Query  206  PMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGS  385
            P    EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG+
Sbjct  5    PAKAEEISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGT  64

Query  386  DGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHI  565
            DGDK RVIQTLLF+ GINTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL+ I +PH 
Sbjct  65   DGDKVRVIQTLLFIEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIQDSSLETIIDPHT  124

Query  566  RFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RF+ TMRA+QGALIV+SSIQIILGYSQ+W + SRFFS
Sbjct  125  RFLNTMRAVQGALIVSSSIQIILGYSQIWAICSRFFS  161



>ref|XP_007136977.1| hypothetical protein PHAVU_009G089800g [Phaseolus vulgaris]
 gb|ESW08971.1| hypothetical protein PHAVU_009G089800g [Phaseolus vulgaris]
Length=525

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W ETI+L FQ+YIL LGT+ MIP+ LVPLMGG+D DK 
Sbjct  9    EISHPPMDQLQGLEYCIDSNPSWVETIVLGFQHYILALGTAVMIPSFLVPLMGGTDDDKV  68

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL RI +PH+RF+ T
Sbjct  69   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLTRIEDPHLRFLST  128

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGA+IVASSIQIILG+SQ+W + SRFFS
Sbjct  129  MRAVQGAMIVASSIQIILGFSQLWAICSRFFS  160



>ref|XP_010686222.1| PREDICTED: nucleobase-ascorbate transporter 2 [Beta vulgaris 
subsp. vulgaris]
Length=524

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  209  MAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSD  388
            M   EI+HP M+QLQ LEYCIDSNP W E + L FQ+YIL LGT+ MIPT LVPLMGGSD
Sbjct  4    MKAEEISHPAMDQLQGLEYCIDSNPSWGEAVALGFQHYILSLGTAVMIPTFLVPLMGGSD  63

Query  389  GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIR  568
            GDKARV+QTLLFV GINTLLQ LFGTRLP V+G S+AY++PI+ II DSS  RI +PH+R
Sbjct  64   GDKARVVQTLLFVQGINTLLQTLFGTRLPTVIGASYAYMVPIISIIHDSSFTRIEDPHMR  123

Query  569  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            F  TMRA+QGALIVASS+QIILGYSQ+W + SRFFS
Sbjct  124  FNSTMRAVQGALIVASSLQIILGYSQLWAICSRFFS  159



>dbj|BAJ85393.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93056.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   239 bits (611),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HP MEQLQ  EYCIDSNPPW E I+L FQ+YIL LGT+ MIP +LVP+MGGSDGD+ 
Sbjct  8    EISHPAMEQLQGFEYCIDSNPPWGEAIILGFQHYILALGTAVMIPAVLVPMMGGSDGDRV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ+LFGTRLP V+GGS+A+V+P++ I+ DSSL  I + H RF+Q+
Sbjct  68   RVVQTLLFVTGINTLLQSLFGTRLPTVIGGSYAFVVPVMAIVQDSSLAAIPDDHERFLQS  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MRAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>dbj|BAJ94155.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=524

 Score =   239 bits (611),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HP MEQLQ  EYCIDSNPPW E I+L FQ+YIL LGT+ MIP +LVP+MGGSDGD+ 
Sbjct  8    EISHPAMEQLQGFEYCIDSNPPWGEAIILGFQHYILALGTAVMIPAVLVPMMGGSDGDRV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ+LFGTRLP V+GGS+A+V+P++ I+ DSSL  I + H RF+Q+
Sbjct  68   RVVQTLLFVTGINTLLQSLFGTRLPTVIGGSYAFVVPVMAIVQDSSLAAIPDDHERFLQS  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MRAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>ref|XP_006410561.1| hypothetical protein EUTSA_v10016514mg [Eutrema salsugineum]
 gb|ESQ52014.1| hypothetical protein EUTSA_v10016514mg [Eutrema salsugineum]
Length=524

 Score =   239 bits (610),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  203  SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGG  382
             P+   EI+HPPM+QLQ LEYCIDSNPPW E I L F++YIL LGT+ MIP+ LVP+MGG
Sbjct  2    DPVKPEEISHPPMDQLQGLEYCIDSNPPWGEAIALGFEHYILALGTAVMIPSFLVPMMGG  61

Query  383  SDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPH  562
             DGDK RV+QTLLF+ G+NT LQ LFGTRLP V+GGS+A+++PI+ II DSSL RI +PH
Sbjct  62   DDGDKVRVVQTLLFIQGVNTFLQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLTRIEDPH  121

Query  563  IRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +RF+ TMRA+QGA+IVASS+QIILG+SQ+W + SRFFS
Sbjct  122  LRFLSTMRAVQGAIIVASSVQIILGFSQMWAICSRFFS  159



>ref|XP_003569860.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Brachypodium 
distachyon]
Length=524

 Score =   239 bits (609),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HP MEQLQ  EYCIDSNPPW E I+L FQ+YIL LGT+ MIP +LVP+MGG+DGD+ 
Sbjct  8    EISHPAMEQLQGFEYCIDSNPPWGEAIILGFQHYILALGTAVMIPAVLVPMMGGTDGDRV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ+LFGTRLP V+GGS+A+V+PI+ I+ DSSL  I + H RF+Q+
Sbjct  68   RVVQTLLFVTGINTLLQSLFGTRLPTVIGGSYAFVVPIMAIVQDSSLAGIPDDHERFLQS  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MRAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>ref|XP_002456385.1| hypothetical protein SORBIDRAFT_03g035190 [Sorghum bicolor]
 gb|EES01505.1| hypothetical protein SORBIDRAFT_03g035190 [Sorghum bicolor]
Length=524

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 133/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPMEQLQ  EYCIDSNPPW E I+L FQ+YIL LGT+ MIP +LVP+MGG DGD+ 
Sbjct  8    EISHPPMEQLQGFEYCIDSNPPWGEAIILGFQHYILALGTAVMIPAVLVPMMGGDDGDRV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ+LFGTRLP V+GGS+A+VIPI+ II + SL  I++ H RF++T
Sbjct  68   RVVQTLLFVTGINTLLQSLFGTRLPTVIGGSYAFVIPIMAIIQEPSLSGIADGHQRFLET  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            M+AIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MKAIQGALIVSSSIQIILGYSQLWGIFSRFFS  159



>ref|XP_009799751.1| PREDICTED: nucleobase-ascorbate transporter 2 [Nicotiana sylvestris]
Length=525

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG+DGDK 
Sbjct  9    EISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGTDGDKV  68

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+V+P++ II DSSL RI++P  RF+ T
Sbjct  69   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSWAFVVPVISIIHDSSLTRITDPQERFLST  128

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIVASS+QIILGYSQ+W + SRFFS
Sbjct  129  MRAIQGALIVASSVQIILGYSQLWAICSRFFS  160



>ref|XP_010089683.1| Nucleobase-ascorbate transporter 2 [Morus notabilis]
 gb|EXB38206.1| Nucleobase-ascorbate transporter 2 [Morus notabilis]
Length=524

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG+D DK 
Sbjct  8    EITHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGNDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP VVGGS+A+++PI+ II DSSL RI   HIRF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVVGGSYAFMVPIISIIHDSSLTRIENDHIRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIVASSIQIILGYSQ+W + SRFFS
Sbjct  128  MRAVQGALIVASSIQIILGYSQIWAICSRFFS  159



>ref|XP_009410926.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Musa acuminata 
subsp. malaccensis]
Length=525

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  224  IAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKAR  403
            + HPPM+QLQ  EYCIDSNP W E I L FQNYIL LG + MIPTLLVPLMGGSD DK R
Sbjct  10   VTHPPMDQLQGFEYCIDSNPSWGEAISLGFQNYILALGAAVMIPTLLVPLMGGSDDDKVR  69

Query  404  VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTM  583
            V+QTLLFV GINTLLQ LFGTRLP +VGGS+A+V+PI+ II DSSL RI++ H RF+QTM
Sbjct  70   VVQTLLFVTGINTLLQTLFGTRLPTIVGGSYAFVVPIISIIHDSSLTRITDDHERFLQTM  129

Query  584  RAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RAIQGALIV+S IQI+LGYSQ+W +FSRFFS
Sbjct  130  RAIQGALIVSSCIQIVLGYSQLWSIFSRFFS  160



>ref|XP_006449522.1| hypothetical protein CICLE_v10014896mg [Citrus clementina]
 gb|ESR62762.1| hypothetical protein CICLE_v10014896mg [Citrus clementina]
Length=524

 Score =   238 bits (606),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            + EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGGSDGD
Sbjct  6    LEEISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGSDGD  65

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            K RV+QTLLFV GINTLLQ LFGTRLP VVGGS+A+++PI+ II D SL  I + H+RF+
Sbjct  66   KVRVVQTLLFVEGINTLLQTLFGTRLPTVVGGSYAFMVPIISIIHDPSLASIEDNHVRFL  125

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRA+QGALIVASSIQIILGYSQ+W + SRFFS
Sbjct  126  NTMRAVQGALIVASSIQIILGYSQLWAICSRFFS  159



>ref|XP_006467632.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Citrus sinensis]
Length=524

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 130/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            + EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGGSDGD
Sbjct  6    LEEISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGSDGD  65

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFI  574
            K RV+QTLLFV GINTLLQ LFGTRLP VVGGS+A+++PI+ II D SL  I + H+RF+
Sbjct  66   KVRVVQTLLFVEGINTLLQTLFGTRLPTVVGGSYAFMVPIISIIHDPSLASIEDNHVRFL  125

Query  575  QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             TMRA+QGALIVASSIQIILGYSQ+W + SRFFS
Sbjct  126  NTMRAVQGALIVASSIQIILGYSQLWAICSRFFS  159



>ref|XP_009604294.1| PREDICTED: nucleobase-ascorbate transporter 2 [Nicotiana tomentosiformis]
Length=525

 Score =   238 bits (606),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG+DGDK 
Sbjct  9    EISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGTDGDKV  68

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP ++GGS+A+V+P++ II DSSL RI++P  RF+ T
Sbjct  69   RVVQTLLFVEGINTLLQTLFGTRLPTIIGGSWAFVVPVISIIHDSSLTRITDPQERFLST  128

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIVASS+QIILGYSQ+W + SRFFS
Sbjct  129  MRAIQGALIVASSVQIILGYSQLWAICSRFFS  160



>ref|XP_009143796.1| PREDICTED: nucleobase-ascorbate transporter 2 [Brassica rapa]
 emb|CDY67697.1| BnaAnng25020D [Brassica napus]
Length=524

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  203  SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGG  382
             P+   EI+HPPM+QLQ LEYCIDSNPPW E I L F++YIL LGT+ MIP+ LVP+MGG
Sbjct  2    DPVKPEEISHPPMDQLQGLEYCIDSNPPWGEAIALGFEHYILALGTAVMIPSFLVPMMGG  61

Query  383  SDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPH  562
             DGDK RV+QTLLF+ G+NTLLQ LFGTRLP V+GGS+A++IPI+ II DSSL RI +P 
Sbjct  62   DDGDKVRVVQTLLFIQGVNTLLQTLFGTRLPTVIGGSYAFMIPIISIIHDSSLTRIEDPQ  121

Query  563  IRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +RF+ TMRA+QGA+IVASS+QIILG+SQ+W + SRFFS
Sbjct  122  LRFLSTMRAVQGAVIVASSVQIILGFSQMWAICSRFFS  159



>emb|CAN66345.1| hypothetical protein VITISV_040228 [Vitis vinifera]
Length=524

 Score =   237 bits (605),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+Q Q  EYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG+D DK 
Sbjct  8    EISHPPMDQJQGXEYCIDSNPSWAEAIALGFQHYILALGTAVMIPSFLVPLMGGTDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP VVGGS+A+++P++ II DSSL  IS+PH RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVVGGSYAFMVPVISIIHDSSLMEISDPHQRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIVASSIQIILGYSQ+W + SRFFS
Sbjct  128  MRAIQGALIVASSIQIILGYSQIWAICSRFFS  159



>ref|XP_002265912.2| PREDICTED: nucleobase-ascorbate transporter 2 isoform X1 [Vitis 
vinifera]
 emb|CBI30703.3| unnamed protein product [Vitis vinifera]
Length=524

 Score =   237 bits (605),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+Q+Q  EYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG+D DK 
Sbjct  8    EISHPPMDQIQGFEYCIDSNPSWAEAIALGFQHYILALGTAVMIPSFLVPLMGGTDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP VVGGS+A+++P++ II DSSL  IS+PH RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVVGGSYAFMVPVISIIHDSSLMEISDPHQRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIVASSIQIILGYSQ+W + SRFFS
Sbjct  128  MRAIQGALIVASSIQIILGYSQIWAICSRFFS  159



>ref|XP_010052181.1| PREDICTED: nucleobase-ascorbate transporter 2 [Eucalyptus grandis]
 gb|KCW76100.1| hypothetical protein EUGRSUZ_D00480 [Eucalyptus grandis]
Length=524

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+H PM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGGSDGDK 
Sbjct  8    EISHLPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGSDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+AY++PI+ II DS L RI + H+RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAYMVPIISIIHDSKLTRIEDDHLRFLST  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIVASSIQIILGYSQ+W + SRFFS
Sbjct  128  MRAVQGALIVASSIQIILGYSQMWAICSRFFS  159



>ref|XP_010509786.1| PREDICTED: nucleobase-ascorbate transporter 2 [Camelina sativa]
Length=524

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  203  SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGG  382
             P+   EI+HPPM+QLQ LEYCIDSNPPW E I L F++YIL LGT+ MIP++LVP+MGG
Sbjct  2    DPVKPEEISHPPMDQLQGLEYCIDSNPPWGEAIALGFEHYILALGTAVMIPSVLVPMMGG  61

Query  383  SDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPH  562
             DGDK RV+QTLLF+ G+NTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL RI +P 
Sbjct  62   DDGDKVRVVQTLLFLQGVNTLLQTLFGTRLPTVIGGSYAFMVPIISIIKDSSLTRIEDPQ  121

Query  563  IRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +RF+ TMRA+QGA+IVASS+QIILG+SQ+W + SRFFS
Sbjct  122  LRFLSTMRAVQGAIIVASSVQIILGFSQMWAICSRFFS  159



>emb|CDY52234.1| BnaC04g54110D [Brassica napus]
Length=524

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  203  SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGG  382
             P+   EI+HPPM+QLQ LEYCIDSNPPW E I L F++YIL LGT+ MIP+ LVP+MGG
Sbjct  2    DPVKPEEISHPPMDQLQGLEYCIDSNPPWGEAIALGFEHYILALGTAVMIPSFLVPMMGG  61

Query  383  SDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPH  562
             DGDK RV+QTLLF+ G+NTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL RI +P 
Sbjct  62   DDGDKVRVVQTLLFIQGVNTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLARIEDPQ  121

Query  563  IRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +RF+ TMRA+QGA+IVASS+QIILG+SQ+W + SRFFS
Sbjct  122  LRFLSTMRAVQGAVIVASSVQIILGFSQMWAICSRFFS  159



>ref|XP_006830254.1| PREDICTED: nucleobase-ascorbate transporter 2 [Amborella trichopoda]
 gb|ERM97670.1| hypothetical protein AMTR_s00130p00100230 [Amborella trichopoda]
Length=524

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            +I HPPM+QL   EYCIDSNP W E I+L FQ+YIL LGT+ MIP+ LVP+MGGSD DK 
Sbjct  8    DITHPPMDQLSGFEYCIDSNPSWGEAIVLGFQHYILALGTAVMIPSFLVPMMGGSDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV+GINTLLQ LFGTRLP V+GGS+A+++PI+ II+DSSL +++ PH RF+QT
Sbjct  68   RVVQTLLFVSGINTLLQTLFGTRLPTVIGGSYAFIVPILSIINDSSLTQVTNPHERFLQT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIV+SS+QIILGYSQ+WG+ SRFFS
Sbjct  128  MRAIQGALIVSSSLQIILGYSQIWGICSRFFS  159



>ref|XP_002879482.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55741.1| xanthine/uracil permease family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=524

 Score =   236 bits (603),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  203  SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGG  382
             P+   EI+HPPM+QLQ LEYCIDSNPPW E I L F++YIL LGT+ MIP+ L+P+MGG
Sbjct  2    DPVKPEEISHPPMDQLQGLEYCIDSNPPWGEAIALGFEHYILALGTAVMIPSFLIPMMGG  61

Query  383  SDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPH  562
             DGDK RV+QTLLF+ G+NTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL RI +P 
Sbjct  62   DDGDKVRVVQTLLFLQGVNTLLQTLFGTRLPTVIGGSYAFIVPIISIIHDSSLTRIEDPQ  121

Query  563  IRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +RF+ TMRA+QGA+IVASS+QIILG+SQ+W + SRFFS
Sbjct  122  LRFLSTMRAVQGAIIVASSVQIILGFSQMWAICSRFFS  159



>ref|XP_010413769.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Camelina 
sativa]
Length=524

 Score =   236 bits (603),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  203  SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGG  382
             P+   EI+HPPM+QLQ LEYCIDSNPPW E I L F++YIL LGT+ MIP++LVP+MGG
Sbjct  2    DPVKPEEISHPPMDQLQGLEYCIDSNPPWGEAIALGFEHYILALGTAVMIPSVLVPMMGG  61

Query  383  SDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPH  562
             DGDK RV+QTLLF+ G+NTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL RI +P 
Sbjct  62   DDGDKVRVVQTLLFLQGVNTLLQTLFGTRLPTVIGGSYAFMVPIISIIKDSSLTRIVDPQ  121

Query  563  IRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +RF+ TMRA+QGA+IVASS+QIILG+SQ+W + SRFFS
Sbjct  122  LRFLSTMRAVQGAIIVASSVQIILGFSQMWAICSRFFS  159



>ref|XP_002317408.2| hypothetical protein POPTR_0011s07170g [Populus trichocarpa]
 gb|EEE98020.2| hypothetical protein POPTR_0011s07170g [Populus trichocarpa]
Length=403

 Score =   233 bits (594),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 132/162 (81%), Gaps = 5/162 (3%)
 Frame = +2

Query  191  DPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVP  370
            DP P      EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVP
Sbjct  4    DPKPE-----EISHPPMDQLQGLEYCIDSNPSWGEAIGLGFQHYILALGTAVMIPSFLVP  58

Query  371  LMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRI  550
            LMGG+ GDK RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II D SL RI
Sbjct  59   LMGGNHGDKVRVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDPSLMRI  118

Query  551  SEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             + H+RF+ TMRA+QGALIV+SSIQIILGYSQ+W + SRFFS
Sbjct  119  PDDHLRFLSTMRAVQGALIVSSSIQIILGYSQLWAICSRFFS  160



>ref|XP_010246467.1| PREDICTED: nucleobase-ascorbate transporter 2 [Nelumbo nucifera]
Length=524

 Score =   236 bits (602),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ  EYCIDSNP W E I L FQ+YIL LGT+ MIPTLLV ++GG+D DK 
Sbjct  8    EISHPPMDQLQGFEYCIDSNPSWGEAIALGFQHYILALGTAVMIPTLLVTMIGGTDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            R++QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL +I++PH RF+QT
Sbjct  68   RLVQTLLFVGGINTLLQTLFGTRLPTVIGGSYAFLVPIISIIHDSSLTQIADPHERFLQT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIVASSIQIILGYSQ+WG+ SRFFS
Sbjct  128  MRAIQGALIVASSIQIILGYSQLWGICSRFFS  159



>ref|XP_008225311.1| PREDICTED: nucleobase-ascorbate transporter 2 [Prunus mume]
Length=524

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W E+I L FQ+YIL LGT+ MIP+ LVP MGG+DGDK 
Sbjct  8    EISHPPMDQLQGLEYCIDSNPSWGESIALGFQHYILSLGTAVMIPSFLVPFMGGTDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLF+ GINTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL  I + H+RF+ T
Sbjct  68   RVVQTLLFIQGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLTSIQDDHVRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIVASSIQIILGYSQ+W + SRFFS
Sbjct  128  MRAVQGALIVASSIQIILGYSQIWAICSRFFS  159



>ref|XP_007211779.1| hypothetical protein PRUPE_ppa004190mg [Prunus persica]
 gb|EMJ12978.1| hypothetical protein PRUPE_ppa004190mg [Prunus persica]
Length=524

 Score =   236 bits (602),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W E+I L FQ+YIL LGT+ MIP+ LVP MGG+DGDK 
Sbjct  8    EISHPPMDQLQGLEYCIDSNPSWGESIALGFQHYILSLGTAVMIPSFLVPFMGGTDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLF+ GINTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL  I + H+RF+ T
Sbjct  68   RVVQTLLFIQGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLTSIQDDHVRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIVASSIQIILGYSQ+W + SRFFS
Sbjct  128  MRAVQGALIVASSIQIILGYSQIWAICSRFFS  159



>ref|XP_010469386.1| PREDICTED: nucleobase-ascorbate transporter 2-like isoform X1 
[Camelina sativa]
 ref|XP_010469387.1| PREDICTED: nucleobase-ascorbate transporter 2-like isoform X2 
[Camelina sativa]
Length=524

 Score =   236 bits (601),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 106/158 (67%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  203  SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGG  382
             P+   EI+HPPM+QLQ LEYCIDSNPPW E I L F++YIL LGT+ MIP++LVP+MGG
Sbjct  2    DPIKPEEISHPPMDQLQGLEYCIDSNPPWGEAIALGFEHYILALGTAVMIPSVLVPMMGG  61

Query  383  SDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPH  562
             DGDK RV+QTLLF+ G+NTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL RI +P 
Sbjct  62   DDGDKVRVVQTLLFLQGVNTLLQTLFGTRLPTVIGGSYAFMVPIISIIKDSSLTRIEDPQ  121

Query  563  IRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +RF+ TMRA+QGA+IVASS+QIILG+SQ+W + +RFFS
Sbjct  122  LRFLSTMRAVQGAIIVASSVQIILGFSQMWAICARFFS  159



>ref|NP_180966.1| nucleobase-ascorbate transporter 2 [Arabidopsis thaliana]
 sp|Q94C70.2|NAT2_ARATH RecName: Full=Nucleobase-ascorbate transporter 2; Short=AtNAT2 
[Arabidopsis thaliana]
 gb|AAC27395.1| putative membrane transporter [Arabidopsis thaliana]
 gb|AAN13099.1| putative membrane transporter [Arabidopsis thaliana]
 gb|AEC08934.1| nucleobase-ascorbate transporter 2 [Arabidopsis thaliana]
Length=524

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNPPW E I L F++YIL LGT+ MIP++LVP+MGG DGDK 
Sbjct  8    EISHPPMDQLQGLEYCIDSNPPWGEAIALGFEHYILALGTAVMIPSILVPMMGGDDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLF+ G+NTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL RI +P +RF+ T
Sbjct  68   RVVQTLLFLQGVNTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLTRIEDPQLRFLST  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGA+IVASS+QIILG+SQ+W + SRFFS
Sbjct  128  MRAVQGAIIVASSVQIILGFSQMWAICSRFFS  159



>gb|AAK59632.1| putative membrane transporter protein [Arabidopsis thaliana]
Length=524

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 132/152 (87%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNPPW E I L F++YIL LGT+ MIP++LVP+MGG DGDK 
Sbjct  8    EISHPPMDQLQGLEYCIDSNPPWGEAIALGFEHYILALGTAVMIPSILVPMMGGDDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLF+ G+NTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL RI +P +RF+ T
Sbjct  68   RVVQTLLFLQGVNTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLTRIEDPQLRFLST  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGA+IVASS+QIILG+SQ+W + SRFFS
Sbjct  128  MRAVQGAIIVASSVQIILGFSQMWAICSRFFS  159



>gb|KHN48003.1| Nucleobase-ascorbate transporter 2 [Glycine soja]
Length=524

 Score =   235 bits (600),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W ETI L FQ+YIL LGT+ MIP+ LVP+MGGSD DK 
Sbjct  8    EISHPPMDQLQGLEYCIDSNPSWAETIALGFQHYILALGTAVMIPSFLVPVMGGSDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP VVGGS+A+++P++ II D S   I +PH+RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVVGGSYAFMVPVISIIRDPSFATIEDPHLRFLST  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIVASSIQIILG+SQ+W + SRFFS
Sbjct  128  MRAVQGALIVASSIQIILGFSQIWAICSRFFS  159



>emb|CDO96816.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIPT LVPLMGG+DGDK 
Sbjct  8    EISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPTFLVPLMGGTDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLF  GINTL Q LFGTRLP V+GGS+A+++PI+ II D SL  I++PH RF+ T
Sbjct  68   RVVQTLLFAQGINTLFQTLFGTRLPTVIGGSWAFMVPIISIIHDPSLAAITDPHSRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIVASS+QIILGYSQ+W + SRFFS
Sbjct  128  MRAIQGALIVASSVQIILGYSQLWAICSRFFS  159



>emb|CDM84318.1| unnamed protein product [Triticum aestivum]
Length=1067

 Score =   242 bits (618),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 134/152 (88%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HP MEQLQ  EYCIDSNPPW E I+L FQ+YIL LGT+ MIP +LVP+MGG+DGD+ 
Sbjct  551  EISHPAMEQLQGFEYCIDSNPPWGEAIILGFQHYILALGTAVMIPAVLVPMMGGNDGDRV  610

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ+LFGTRLP V+GGS+A+VIP++ I+ DSSL  IS+ H RF+Q+
Sbjct  611  RVVQTLLFVTGINTLLQSLFGTRLPTVIGGSYAFVIPVMAIVQDSSLAAISDDHERFLQS  670

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  671  MRAIQGALIVSSSIQIILGYSQLWGIFSRFFS  702



>ref|XP_007159460.1| hypothetical protein PHAVU_002G239500g [Phaseolus vulgaris]
 gb|ESW31454.1| hypothetical protein PHAVU_002G239500g [Phaseolus vulgaris]
Length=524

 Score =   235 bits (599),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W ETI L FQ+YIL LGT+ MIP+ LVP+MGGSD DK 
Sbjct  8    EISHPPMDQLQGLEYCIDSNPSWAETIALGFQHYILALGTAVMIPSFLVPVMGGSDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP VVGGS+A+++P++ II D S   I +PH+RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVVGGSYAFMVPVISIIRDPSFAMIEDPHLRFLST  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIVASSIQIILG+SQ+W + SRFFS
Sbjct  128  MRAVQGALIVASSIQIILGFSQIWAICSRFFS  159



>ref|XP_004485911.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Cicer arietinum]
Length=524

 Score =   234 bits (598),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QL  LEYCIDSNP W E+++L FQ+YIL LGT+ MIP+ LVPLMGG+DGDK 
Sbjct  8    EISHPPMDQLHGLEYCIDSNPSWVESVVLGFQHYILALGTAVMIPSFLVPLMGGTDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+Q LLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL  I +PH+RF+ T
Sbjct  68   RVVQILLFVEGINTLLQTLFGTRLPTVMGGSYAFMVPIISIIHDSSLASIQDPHLRFVNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGA+IVASSIQIILG+SQ+W + SRFFS
Sbjct  128  MRAVQGAMIVASSIQIILGFSQLWAICSRFFS  159



>ref|XP_009396520.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Musa acuminata 
subsp. malaccensis]
Length=526

 Score =   234 bits (597),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI HPPM+QL  LEYCIDSNP W E I L FQ+YIL LGT+ MIPTLLV LMGG+D DK 
Sbjct  10   EITHPPMDQLHGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPTLLVHLMGGTDDDKV  69

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            +V+QTLLFV+GINTLLQ LFGTRLP V+GGS+A+V+PI+ II DSSL +I++ H RF+QT
Sbjct  70   KVVQTLLFVSGINTLLQTLFGTRLPIVIGGSYAFVVPIISIIHDSSLAQITDDHERFLQT  129

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIV+SSIQIILGYSQ+WG+ SRFFS
Sbjct  130  MRAIQGALIVSSSIQIILGYSQLWGICSRFFS  161



>ref|XP_007025347.1| Xanthine/uracil permease family protein [Theobroma cacao]
 gb|EOY27969.1| Xanthine/uracil permease family protein [Theobroma cacao]
Length=524

 Score =   234 bits (596),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG+D DK 
Sbjct  8    EISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGTDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II D+SL  I + H+RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDTSLTSIEDNHVRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIVASSIQIILGYSQ+W + SRFFS
Sbjct  128  MRAVQGALIVASSIQIILGYSQMWAICSRFFS  159



>ref|XP_002305737.1| xanthine/uracil permease family protein [Populus trichocarpa]
 gb|EEE86248.1| xanthine/uracil permease family protein [Populus trichocarpa]
Length=525

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 133/162 (82%), Gaps = 5/162 (3%)
 Frame = +2

Query  191  DPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVP  370
            DP P      EI+HPPM+QLQ LEYCIDSNP W E+I L FQ+YIL LGT+ MIP+ LVP
Sbjct  4    DPKPE-----EISHPPMDQLQGLEYCIDSNPSWGESIALGFQHYILALGTAVMIPSFLVP  58

Query  371  LMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRI  550
            LMGG+ GDK RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PIV II D SL +I
Sbjct  59   LMGGNHGDKVRVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIVSIIHDPSLTKI  118

Query  551  SEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             + H+RF+ TMRA+QGALIV+SSIQIILGYSQ+W + SRFFS
Sbjct  119  PDDHLRFLSTMRAVQGALIVSSSIQIILGYSQLWAICSRFFS  160



>dbj|BAD03486.1| putative permease 1 [Oryza sativa Japonica Group]
 dbj|BAD03537.1| putative permease 1 [Oryza sativa Japonica Group]
 gb|EEE68583.1| hypothetical protein OsJ_27086 [Oryza sativa Japonica Group]
Length=524

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +2

Query  209  MAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSD  388
            M   EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIPTLLVPLMGG+ 
Sbjct  4    MKQEEISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILCLGTAVMIPTLLVPLMGGNA  63

Query  389  GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIR  568
             DKA+V+QT+LFV GINT+LQ LFGTRLP ++GGS+A+VIP++ II D SL +I++ H R
Sbjct  64   HDKAKVVQTMLFVTGINTMLQTLFGTRLPTIIGGSYAFVIPVISIIKDPSLAQITDDHTR  123

Query  569  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            FI TMRAIQGALI++S IQIILGYSQ+WG+ SRFFS
Sbjct  124  FIMTMRAIQGALIISSCIQIILGYSQLWGICSRFFS  159



>ref|XP_006659347.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Oryza brachyantha]
Length=524

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +2

Query  209  MAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSD  388
            M   EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIPTLLVPLMGG+ 
Sbjct  4    MKQEEISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILCLGTAVMIPTLLVPLMGGNA  63

Query  389  GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIR  568
             DKA+V+QT+LFV GINTLLQ LFGTRLP ++GGS+A+VIP++ II D SL +I++ H R
Sbjct  64   HDKAKVVQTMLFVTGINTLLQTLFGTRLPTIIGGSYAFVIPVISIIKDPSLTQITDDHTR  123

Query  569  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            FI TMRAIQGALI++S IQII+GYSQ+WG+ SRFFS
Sbjct  124  FIMTMRAIQGALIISSCIQIIVGYSQLWGICSRFFS  159



>gb|KHG19625.1| Nucleobase-ascorbate transporter 2 -like protein [Gossypium arboreum]
Length=524

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+ PPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG+DGDK 
Sbjct  8    EISFPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGTDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II D+SL  I + H+RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDTSLMSIEDNHVRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIVASSIQIILGYSQ+W + SRFFS
Sbjct  128  MRAVQGALIVASSIQIILGYSQMWAICSRFFS  159



>gb|KJB57395.1| hypothetical protein B456_009G161500 [Gossypium raimondii]
Length=524

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+ PPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG+DGDK 
Sbjct  8    EISFPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGTDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II D+SL  I + H+RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDTSLMSIEDNHVRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIVASSIQIILGYSQ+W + SRFFS
Sbjct  128  MRAVQGALIVASSIQIILGYSQMWAICSRFFS  159



>ref|XP_011039417.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Populus euphratica]
Length=525

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 132/162 (81%), Gaps = 5/162 (3%)
 Frame = +2

Query  191  DPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVP  370
            DP P      EI+HPPM+QLQ LEYCIDSNP W E + L FQ+YIL LGT+ MIP+ LVP
Sbjct  4    DPKPE-----EISHPPMDQLQGLEYCIDSNPSWGEAVALGFQHYILALGTAVMIPSFLVP  58

Query  371  LMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRI  550
            LMGG+ GDK RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II D SL RI
Sbjct  59   LMGGNHGDKVRVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDPSLMRI  118

Query  551  SEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             + H+RF+ TMRA+QGALIV+SSIQIILGYSQ+W + SRFFS
Sbjct  119  PDDHLRFLSTMRAVQGALIVSSSIQIILGYSQLWAISSRFFS  160



>gb|EYU28101.1| hypothetical protein MIMGU_mgv1a004500mg [Erythranthe guttata]
Length=524

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+H PM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGGSD DK 
Sbjct  8    EISHAPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGSDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINT+LQ LFGTRLP V+GGS+A+++PI+ II D SL+RI +PH RF+ T
Sbjct  68   RVVQTLLFVGGINTVLQTLFGTRLPTVIGGSWAFLVPIISIIHDPSLERIIDPHQRFLST  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIVASS+QIILGYSQ+W + SRFFS
Sbjct  128  MRAIQGALIVASSVQIILGYSQLWAICSRFFS  159



>ref|XP_009394193.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Musa acuminata 
subsp. malaccensis]
Length=525

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  224  IAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKAR  403
            I HPPM+QLQ  EYCIDSNP W E I L FQ+Y+L LGT+ MIPT LVPLMGGSD DK R
Sbjct  10   ITHPPMDQLQGFEYCIDSNPSWGEAIALGFQHYVLALGTAVMIPTFLVPLMGGSDDDKVR  69

Query  404  VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTM  583
            V+QTLLFV GINTL+Q LFGTRLP V+GGS+A+++PI+ II DSSL +I++ H RF+QTM
Sbjct  70   VVQTLLFVTGINTLIQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLTQITDDHQRFLQTM  129

Query  584  RAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RAIQGALIV+S IQIILGYSQ+WG+ SRFFS
Sbjct  130  RAIQGALIVSSCIQIILGYSQLWGICSRFFS  160



>ref|XP_004504292.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Cicer arietinum]
Length=522

 Score =   233 bits (593),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+H PM+QLQ LEYCIDSNP W ETILL FQ+YIL LGT+ MIP+ LVP MGGSD DK 
Sbjct  8    EISHSPMDQLQGLEYCIDSNPSWVETILLGFQHYILALGTAVMIPSFLVPSMGGSDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTL+Q LFGTRLP V+GGS+A+++PIV II D SL  I +PH+RF+ T
Sbjct  68   RVVQTLLFVEGINTLVQTLFGTRLPTVIGGSYAFMVPIVSIIRDPSLAMIEDPHLRFLST  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIVASSIQIILG+SQ+W + SRFFS
Sbjct  128  MRAVQGALIVASSIQIILGFSQIWAICSRFFS  159



>ref|XP_010274460.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Nelumbo nucifera]
Length=524

 Score =   232 bits (592),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ  EYCIDSNP W E I L FQ+YIL LGT+ MIPT+LV  +GG+D DK 
Sbjct  8    EISHPPMDQLQGFEYCIDSNPSWGEAIALGFQHYILALGTAVMIPTMLVNYIGGTDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS A+++PI+ II DSS  +I +PH RFIQT
Sbjct  68   RVVQTLLFVGGINTLLQTLFGTRLPTVIGGSHAFLVPIISIIHDSSFSQIPDPHERFIQT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRAIQGALIVASSIQI+LGYSQ+WG+ SRFFS
Sbjct  128  MRAIQGALIVASSIQIVLGYSQLWGICSRFFS  159



>ref|XP_008349204.1| PREDICTED: LOW QUALITY PROTEIN: nucleobase-ascorbate transporter 
2-like [Malus domestica]
Length=524

 Score =   232 bits (592),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HP M+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIPT LVP MGG DGDK 
Sbjct  8    EISHPAMDQLQGLEYCIDSNPSWAEAIALGFQHYILALGTAVMIPTFLVPFMGGDDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLF+ GINTLLQ LFGTRLP V+GGS+A+++PI+ II DS L ++ + H RF+ T
Sbjct  68   RVVQTLLFIQGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSRLMKVEDNHARFLDT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIVASSIQIILGYSQ+W + SRFFS
Sbjct  128  MRAVQGALIVASSIQIILGYSQIWAICSRFFS  159



>ref|XP_010999757.1| PREDICTED: nucleobase-ascorbate transporter 2 [Populus euphratica]
Length=525

 Score =   232 bits (592),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 132/162 (81%), Gaps = 5/162 (3%)
 Frame = +2

Query  191  DPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVP  370
            DP P      EI+HPPM+QLQ LEYCIDSNP W E+I L FQ+YIL LGT+ MIP+ LVP
Sbjct  4    DPKPE-----EISHPPMDQLQGLEYCIDSNPSWGESIALGFQHYILALGTAVMIPSFLVP  58

Query  371  LMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRI  550
            LMGG+ GDK RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PIV II D SL  I
Sbjct  59   LMGGNHGDKVRVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIVSIIHDPSLTSI  118

Query  551  SEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             + H+RF+ TMRA+QGALIV+SSIQIILGYSQ+W + SRFFS
Sbjct  119  PDDHLRFLSTMRAVQGALIVSSSIQIILGYSQLWAICSRFFS  160



>gb|KHN29605.1| Nucleobase-ascorbate transporter 2 [Glycine soja]
Length=511

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 129/146 (88%), Gaps = 0/146 (0%)
 Frame = +2

Query  239  MEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQTL  418
            M+QLQ LEYCIDSNP W ETI+L FQ+YIL LGT+ MIP+ LVPLMGGSD DK RV+QTL
Sbjct  1    MDQLQGLEYCIDSNPSWVETIVLGFQHYILALGTAVMIPSFLVPLMGGSDDDKVRVVQTL  60

Query  419  LFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQG  598
            LFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II DSSL+RI +PH+RF+ TMRAIQG
Sbjct  61   LFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSSLKRIEDPHLRFLNTMRAIQG  120

Query  599  ALIVASSIQIILGYSQVWGLFSRFFS  676
            A+IVASSIQ+ILG+SQ+WG+ SRFFS
Sbjct  121  AMIVASSIQVILGFSQLWGICSRFFS  146



>ref|XP_008371490.1| PREDICTED: nucleobase-ascorbate transporter 2 [Malus domestica]
Length=524

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HP M+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG DGDK 
Sbjct  8    EISHPAMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGDDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLF+ GINTLLQ LFGTRLP V+GGS+A+++PI+ II DS L +I + H+RF+ T
Sbjct  68   RVVQTLLFIQGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSRLMKIEDNHVRFLDT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            M+A+QGALIVASSIQI+LGYSQ+W + SRFFS
Sbjct  128  MKAVQGALIVASSIQIVLGYSQIWAICSRFFS  159



>ref|XP_009351319.1| PREDICTED: nucleobase-ascorbate transporter 2 [Pyrus x bretschneideri]
Length=524

 Score =   232 bits (591),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HP M+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG DGDK 
Sbjct  8    EISHPAMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGDDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLF+ GINTLLQ LFGTRLP V+GGS+A+++PI+ II DS L +I + H+RF+ T
Sbjct  68   RVVQTLLFIQGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSRLMKIEDNHVRFLDT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            M+A+QGALIVASSIQI+LGYSQ+W + SRFFS
Sbjct  128  MKAVQGALIVASSIQIVLGYSQIWAICSRFFS  159



>ref|XP_010540522.1| PREDICTED: nucleobase-ascorbate transporter 2 isoform X2 [Tarenaya 
hassleriana]
Length=524

 Score =   231 bits (589),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +2

Query  206  PMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGS  385
            P+   E++HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG 
Sbjct  3    PVKPEEMSHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILSLGTAVMIPSFLVPLMGGD  62

Query  386  DGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHI  565
             GDK RV+QTLLF+ G+NTLLQ LFGTRLP ++GGSFA+++PIV II DS   RI +PH+
Sbjct  63   YGDKVRVVQTLLFLQGVNTLLQTLFGTRLPTIIGGSFAFMVPIVSIIHDSRFTRIEDPHL  122

Query  566  RFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RF+ TMRA+QGA+IVASS+QIILG+SQ+W + SRFFS
Sbjct  123  RFLSTMRAVQGAVIVASSVQIILGFSQMWAICSRFFS  159



>gb|AAT64019.1| putative permease [Gossypium hirsutum]
Length=524

 Score =   231 bits (589),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 133/164 (81%), Gaps = 5/164 (3%)
 Frame = +2

Query  185  LGDPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLL  364
            + +P P      EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ L
Sbjct  1    MAEPKPE-----EISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFL  55

Query  365  VPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQ  544
            VPLMGG+D DK RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II D++L 
Sbjct  56   VPLMGGTDDDKVRVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDTTLL  115

Query  545  RISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             I + H+RF+ TMRA+QGALIVASSIQIILGYSQ+W + +RFFS
Sbjct  116  NIEDNHMRFLYTMRAVQGALIVASSIQIILGYSQMWAICTRFFS  159



>gb|KHG23953.1| Nucleobase-ascorbate transporter 2 -like protein [Gossypium arboreum]
Length=524

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/164 (67%), Positives = 132/164 (80%), Gaps = 5/164 (3%)
 Frame = +2

Query  185  LGDPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLL  364
            + +P P      EI HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ L
Sbjct  1    MAEPKPE-----EITHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFL  55

Query  365  VPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQ  544
            VPLMGG+D DK RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II D++L 
Sbjct  56   VPLMGGTDDDKVRVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDTTLL  115

Query  545  RISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             I + H+RF+ TMRAIQGALIVASSIQIILGYSQ+W + +RFFS
Sbjct  116  SIEDNHMRFLYTMRAIQGALIVASSIQIILGYSQMWAICTRFFS  159



>ref|XP_010540521.1| PREDICTED: nucleobase-ascorbate transporter 2 isoform X1 [Tarenaya 
hassleriana]
Length=555

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +2

Query  206  PMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGS  385
            P+   E++HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG 
Sbjct  3    PVKPEEMSHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILSLGTAVMIPSFLVPLMGGD  62

Query  386  DGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHI  565
             GDK RV+QTLLF+ G+NTLLQ LFGTRLP ++GGSFA+++PIV II DS   RI +PH+
Sbjct  63   YGDKVRVVQTLLFLQGVNTLLQTLFGTRLPTIIGGSFAFMVPIVSIIHDSRFTRIEDPHL  122

Query  566  RFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RF+ TMRA+QGA+IVASS+QIILG+SQ+W + SRFFS
Sbjct  123  RFLSTMRAVQGAVIVASSVQIILGFSQMWAICSRFFS  159



>gb|AAT64034.1| putative permease [Gossypium hirsutum]
Length=524

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 133/164 (81%), Gaps = 5/164 (3%)
 Frame = +2

Query  185  LGDPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLL  364
            + +P P      EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ L
Sbjct  1    MAEPKPE-----EISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFL  55

Query  365  VPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQ  544
            VPLMGG+D DK RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II D++L 
Sbjct  56   VPLMGGTDDDKVRVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDTTLL  115

Query  545  RISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             I + H+RF+ TMRA+QGALIVASSIQIILGYSQ+W + +RFFS
Sbjct  116  SIEDNHMRFLYTMRAVQGALIVASSIQIILGYSQMWAICTRFFS  159



>ref|XP_012091799.1| PREDICTED: nucleobase-ascorbate transporter 2 [Jatropha curcas]
 gb|KDP21113.1| hypothetical protein JCGZ_21584 [Jatropha curcas]
Length=524

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG  GDK 
Sbjct  8    EISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFLVPLMGGDHGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II D SL  I++ H+RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDPSLMGIADNHVRFLNT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIV+SSIQIILGYSQ+W + SRFFS
Sbjct  128  MRAVQGALIVSSSIQIILGYSQLWAICSRFFS  159



>ref|XP_009352749.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Pyrus x bretschneideri]
Length=524

 Score =   230 bits (586),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 125/152 (82%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HP M+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIPT LVP MGG D DK 
Sbjct  8    EISHPAMDQLQGLEYCIDSNPSWAEAIALGFQHYILALGTAVMIPTFLVPFMGGDDSDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLF+ GINTLLQ LFGTRLP V+GGS+A+++PI+ II DS L +I + H RF+ T
Sbjct  68   RVVQTLLFIQGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDSRLMKIEDNHARFLDT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIVASSIQIILGYSQ+W + SRFFS
Sbjct  128  MRAVQGALIVASSIQIILGYSQIWAICSRFFS  159



>gb|EEC83487.1| hypothetical protein OsI_29016 [Oryza sativa Indica Group]
Length=777

 Score =   234 bits (598),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 132/158 (84%), Gaps = 0/158 (0%)
 Frame = +2

Query  203  SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGG  382
            + M   EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIPTLLVPLMGG
Sbjct  255  ADMKQEEISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILCLGTAVMIPTLLVPLMGG  314

Query  383  SDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPH  562
            +  DKA+V+QT+LFV GINT+LQ LFGTRLP ++GGS+A+VIP++ II D SL +I++ H
Sbjct  315  NAHDKAKVVQTMLFVTGINTMLQTLFGTRLPTIIGGSYAFVIPVISIIKDPSLAQITDDH  374

Query  563  IRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             RFI TMRAIQGALI++S IQIILGYSQ+WG+ SRFFS
Sbjct  375  TRFIMTMRAIQGALIISSCIQIILGYSQLWGICSRFFS  412



>ref|XP_010911658.1| PREDICTED: nucleobase-ascorbate transporter 1-like, partial [Elaeis 
guineensis]
Length=173

 Score =   219 bits (558),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 121/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  293  ETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRL  472
            ETILLAFQNYIL+LGT+ MIP++LVPLMGGSDGDK RVIQT LFV+GINTLLQALFGTRL
Sbjct  1    ETILLAFQNYILMLGTTVMIPSILVPLMGGSDGDKIRVIQTSLFVSGINTLLQALFGTRL  60

Query  473  PAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVW  652
            PAVVGGSFAYVIPI+YII DS+LQRI +PH RF+QTMRAIQGALI+ASS+QIILGYSQ+W
Sbjct  61   PAVVGGSFAYVIPILYIIRDSALQRIPDPHERFLQTMRAIQGALIIASSLQIILGYSQLW  120

Query  653  GLFSRFFS  676
            GLFSRF S
Sbjct  121  GLFSRFLS  128



>gb|ACD56652.1| putative permease [Gossypioides kirkii]
Length=524

 Score =   229 bits (585),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 132/164 (80%), Gaps = 5/164 (3%)
 Frame = +2

Query  185  LGDPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLL  364
            + +P P      EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LG + MIP+ L
Sbjct  1    MAEPKPE-----EISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGAAVMIPSFL  55

Query  365  VPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQ  544
            VPLMGG+D DK RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II D+SL 
Sbjct  56   VPLMGGTDDDKVRVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDTSLL  115

Query  545  RISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             I + H+RF+ TMRA+QGALIVASSIQIILGYSQ+W + +RFFS
Sbjct  116  SIEDNHMRFLYTMRAVQGALIVASSIQIILGYSQMWAICTRFFS  159



>gb|KJB69715.1| hypothetical protein B456_011G038600 [Gossypium raimondii]
Length=520

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 132/164 (80%), Gaps = 5/164 (3%)
 Frame = +2

Query  185  LGDPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLL  364
            + +P P      EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ L
Sbjct  1    MAEPKPE-----EISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFL  55

Query  365  VPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQ  544
            VPLMGG+D DK RV QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II D++L 
Sbjct  56   VPLMGGTDDDKVRVAQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDTTLL  115

Query  545  RISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             I + H+RF+ TMRA+QGALIVASSIQIILGYSQ+W + +RFFS
Sbjct  116  SIEDNHMRFLYTMRAVQGALIVASSIQIILGYSQMWAICTRFFS  159



>gb|KJB69714.1| hypothetical protein B456_011G038600 [Gossypium raimondii]
Length=524

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 132/164 (80%), Gaps = 5/164 (3%)
 Frame = +2

Query  185  LGDPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLL  364
            + +P P      EI+HPPM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIP+ L
Sbjct  1    MAEPKPE-----EISHPPMDQLQGLEYCIDSNPSWGEAIALGFQHYILALGTAVMIPSFL  55

Query  365  VPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQ  544
            VPLMGG+D DK RV QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PI+ II D++L 
Sbjct  56   VPLMGGTDDDKVRVAQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIISIIHDTTLL  115

Query  545  RISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             I + H+RF+ TMRA+QGALIVASSIQIILGYSQ+W + +RFFS
Sbjct  116  SIEDNHMRFLYTMRAVQGALIVASSIQIILGYSQMWAICTRFFS  159



>ref|NP_001145705.1| uncharacterized protein LOC100279209 [Zea mays]
 gb|ACL52423.1| unknown [Zea mays]
Length=413

 Score =   226 bits (576),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  224  IAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKAR  403
            + H PM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIPTLLVPLMGG+D DKA+
Sbjct  10   VHHLPMDQLQGLEYCIDSNPSWGEGIALGFQHYILSLGTAVMIPTLLVPLMGGNDDDKAK  69

Query  404  VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTM  583
            V+QTLLFV GI TLLQ LFGTRLP V+GGS+AYV+PI+ I+ D S  RI++ H RF+QTM
Sbjct  70   VVQTLLFVTGIKTLLQTLFGTRLPTVMGGSYAYVVPILSIVRDPSFARIADGHTRFLQTM  129

Query  584  RAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RA+QG+LIV+SSIQIILGYSQ+W + SRFFS
Sbjct  130  RAVQGSLIVSSSIQIILGYSQLWAICSRFFS  160



>ref|XP_010924597.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Elaeis guineensis]
Length=524

 Score =   229 bits (583),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 131/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ  EYCIDSNP W E I L FQ+YIL LGT+ MIPTLLVPLMGGSD DK 
Sbjct  8    EISHPPMDQLQGFEYCIDSNPSWGEAIALGFQHYILALGTAVMIPTLLVPLMGGSDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+V+PI+ II DSSL RIS  H RF+QT
Sbjct  68   RVVQTLLFVTGINTLLQTLFGTRLPTVIGGSYAFVVPIISIIQDSSLTRISNDHERFLQT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA QGALI++SSIQIILGYSQ+WG+FSRFFS
Sbjct  128  MRATQGALIISSSIQIILGYSQLWGIFSRFFS  159



>gb|KEH20677.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=404

 Score =   225 bits (574),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            +I+H PM+QLQ LEYCIDSNP W ETILL FQ+YIL LGT+ MIP+ LVP MGG+D DK 
Sbjct  8    DISHSPMDQLQGLEYCIDSNPSWVETILLGFQHYILALGTAVMIPSFLVPSMGGNDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PIV II D S   I +P +RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIVSIIRDPSFAMIDDPQLRFLST  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIV SSIQIILG+SQ+W + SRFFS
Sbjct  128  MRAVQGALIVGSSIQIILGFSQIWAICSRFFS  159



>gb|KEH36620.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=524

 Score =   228 bits (582),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            E+ HPPM+QL  +EYCID+NP W E+I+L FQ+YIL LGT+ MIP+ LVPLMGG+DGDK 
Sbjct  8    EVYHPPMDQLHGIEYCIDANPSWVESIILGFQHYILALGTAVMIPSFLVPLMGGTDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+Q LLFV GINTL Q LFGTRLP V+GGS+A+++PI+ II DS L  I +PH+RF++T
Sbjct  68   RVVQILLFVEGINTLFQTLFGTRLPTVMGGSYAFMVPIISIIHDSKLASIEDPHLRFVKT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGA+I ASSIQIILG+SQ+W + SRFFS
Sbjct  128  MRAVQGAMIAASSIQIILGFSQLWAICSRFFS  159



>ref|XP_003574409.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Brachypodium 
distachyon]
Length=524

 Score =   228 bits (582),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  209  MAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSD  388
            M   E++HPPM+QLQ LEYCIDSNP W E + L FQ+YIL LGT+ MIPT LVPLMGG+ 
Sbjct  4    MKPEEVSHPPMDQLQGLEYCIDSNPSWGEAVALGFQHYILCLGTAVMIPTFLVPLMGGNA  63

Query  389  GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIR  568
             DKA+V+QT+LFV GINTLLQ LFGTRLP ++GGS+A+VIP++ II D SL +I++ H R
Sbjct  64   HDKAKVVQTMLFVTGINTLLQTLFGTRLPTIIGGSYAFVIPVISIIRDPSLTQIADDHTR  123

Query  569  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            FI TMRA QGALI++S IQI+LGYSQ+WG+ SRFFS
Sbjct  124  FIMTMRATQGALIISSCIQIVLGYSQLWGICSRFFS  159



>tpg|DAA39900.1| TPA: hypothetical protein ZEAMMB73_374827 [Zea mays]
Length=484

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  224  IAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKAR  403
            + H PM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIPTLLVPLMGG+D DKA+
Sbjct  10   VHHLPMDQLQGLEYCIDSNPSWGEGIALGFQHYILSLGTAVMIPTLLVPLMGGNDDDKAK  69

Query  404  VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTM  583
            V+QTLLFV GI TLLQ LFGTRLP V+GGS+AYV+PI+ I+ D S  RI++ H RF+QTM
Sbjct  70   VVQTLLFVTGIKTLLQTLFGTRLPTVMGGSYAYVVPILSIVRDPSFARIADGHTRFLQTM  129

Query  584  RAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RA+QG+LIV+SSIQIILGYSQ+W + SRFFS
Sbjct  130  RAVQGSLIVSSSIQIILGYSQLWAICSRFFS  160



>gb|EAZ08590.1| hypothetical protein OsI_30859 [Oryza sativa Indica Group]
 gb|EAZ44233.1| hypothetical protein OsJ_28847 [Oryza sativa Japonica Group]
Length=525

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 128/151 (85%), Gaps = 0/151 (0%)
 Frame = +2

Query  224  IAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKAR  403
            + HPPM+QLQ  EYCIDSNP W E I L FQ+YIL LGT+ MIPT+LVPLMGG+D DKAR
Sbjct  10   VHHPPMDQLQGFEYCIDSNPSWGEAIALGFQHYILSLGTAVMIPTMLVPLMGGNDHDKAR  69

Query  404  VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTM  583
            V+QTLLFV GI TLLQ LFGTRLP ++GGS+A+V+PI+ II D SL +I++ H RF+QTM
Sbjct  70   VVQTLLFVTGIKTLLQTLFGTRLPTIIGGSYAFVVPILSIIRDPSLAQIADGHTRFVQTM  129

Query  584  RAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RAIQG+LIV+SSIQIILGYSQ+W + SRFFS
Sbjct  130  RAIQGSLIVSSSIQIILGYSQLWAICSRFFS  160



>dbj|BAJ95647.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=525

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  224  IAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKAR  403
            + HPPM+QLQ  EYCIDSNP W E I L FQ+YIL LGT+ MIPT+LVPLMGG+D DKA+
Sbjct  10   VHHPPMDQLQGFEYCIDSNPSWGEAIGLGFQHYILSLGTAVMIPTMLVPLMGGNDHDKAK  69

Query  404  VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTM  583
            V+QTLLFV GI TLLQ LFGTRLP V+GGS+AYV+P++ II D SL +I++ H RF+QTM
Sbjct  70   VVQTLLFVTGIKTLLQTLFGTRLPTVIGGSYAYVVPVLSIIHDRSLAQIADGHTRFLQTM  129

Query  584  RAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RA QGALIV+SSIQIILGYSQ+W + SRFFS
Sbjct  130  RATQGALIVSSSIQIILGYSQLWAICSRFFS  160



>gb|EMS56362.1| Nucleobase-ascorbate transporter 2 [Triticum urartu]
Length=552

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  224  IAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKAR  403
            + HPPM+QLQ  EYCIDSNP W E I L FQ+YIL LGT+ MIPT+LVPLMGG+D DKA+
Sbjct  10   VHHPPMDQLQGFEYCIDSNPSWGEAIGLGFQHYILSLGTAVMIPTMLVPLMGGNDHDKAK  69

Query  404  VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTM  583
            V+QTLLFV GI TLLQ LFGTRLP V+GGS+AYV+P++ II D SL +I++ H RF+QTM
Sbjct  70   VVQTLLFVTGIKTLLQTLFGTRLPTVIGGSYAYVVPVLSIIHDRSLAQIADGHTRFLQTM  129

Query  584  RAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RA QGALIV+SSIQIILGYSQ+W + SRFFS
Sbjct  130  RATQGALIVSSSIQIILGYSQLWAICSRFFS  160



>ref|XP_002525330.1| purine permease, putative [Ricinus communis]
 gb|EEF37063.1| purine permease, putative [Ricinus communis]
Length=498

 Score =   226 bits (577),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 123/129 (95%), Gaps = 0/129 (0%)
 Frame = +2

Query  290  PETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTR  469
            PETILLAFQNYIL+LGTS MIP+LLVP MGG+DGDKARVIQTLLFV+G+NTLLQALFGTR
Sbjct  4    PETILLAFQNYILMLGTSVMIPSLLVPAMGGTDGDKARVIQTLLFVSGLNTLLQALFGTR  63

Query  470  LPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQGALIVASSIQIILGYSQV  649
            LPAVVGGSFAYVIPI YIISDSSLQ+I++ H RFI TMRAIQGALIVASSIQIILGYSQV
Sbjct  64   LPAVVGGSFAYVIPIAYIISDSSLQQITDRHERFIHTMRAIQGALIVASSIQIILGYSQV  123

Query  650  WGLFSRFFS  676
            WGLFSRFFS
Sbjct  124  WGLFSRFFS  132



>ref|XP_003629786.1| Nucleobase ascorbate transporter [Medicago truncatula]
 gb|AET04262.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=474

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            +I+H PM+QLQ LEYCIDSNP W ETILL FQ+YIL LGT+ MIP+ LVP MGG+D DK 
Sbjct  8    DISHSPMDQLQGLEYCIDSNPSWVETILLGFQHYILALGTAVMIPSFLVPSMGGNDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PIV II D S   I +P +RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIVSIIRDPSFAMIDDPQLRFLST  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIV SSIQIILG+SQ+W + SRFFS
Sbjct  128  MRAVQGALIVGSSIQIILGFSQIWAICSRFFS  159



>ref|XP_008793044.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Phoenix dactylifera]
Length=524

 Score =   226 bits (576),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 130/152 (86%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+QLQ  EYCIDSNP W E I L FQ+YIL LGT+ MIPTLLVP MGGSDGDK 
Sbjct  8    EISHPPMDQLQGFEYCIDSNPSWGEAIALGFQHYILALGTAVMIPTLLVPWMGGSDGDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+V+PI+ II DSSL RI   H RF+QT
Sbjct  68   RVVQTLLFVTGINTLLQTLFGTRLPTVIGGSYAFVVPIISIIHDSSLTRIPNDHERFVQT  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA QGALI++SSIQIILG+SQ+WG+FSRFFS
Sbjct  128  MRATQGALIISSSIQIILGFSQLWGIFSRFFS  159



>ref|XP_008667761.1| PREDICTED: uncharacterized protein LOC100279209 isoform X1 [Zea 
mays]
 ref|XP_008667762.1| PREDICTED: uncharacterized protein LOC100279209 isoform X1 [Zea 
mays]
 gb|ACN33500.1| unknown [Zea mays]
 tpg|DAA39901.1| TPA: permease isoform 1 [Zea mays]
 tpg|DAA39902.1| TPA: permease isoform 2 [Zea mays]
Length=525

 Score =   226 bits (575),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  224  IAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKAR  403
            + H PM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIPTLLVPLMGG+D DKA+
Sbjct  10   VHHLPMDQLQGLEYCIDSNPSWGEGIALGFQHYILSLGTAVMIPTLLVPLMGGNDDDKAK  69

Query  404  VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTM  583
            V+QTLLFV GI TLLQ LFGTRLP V+GGS+AYV+PI+ I+ D S  RI++ H RF+QTM
Sbjct  70   VVQTLLFVTGIKTLLQTLFGTRLPTVMGGSYAYVVPILSIVRDPSFARIADGHTRFLQTM  129

Query  584  RAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RA+QG+LIV+SSIQIILGYSQ+W + SRFFS
Sbjct  130  RAVQGSLIVSSSIQIILGYSQLWAICSRFFS  160



>ref|XP_003629785.1| Nucleobase ascorbate transporter [Medicago truncatula]
 gb|AET04261.1| nucleobase-ascorbate transporter-like protein [Medicago truncatula]
Length=524

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            +I+H PM+QLQ LEYCIDSNP W ETILL FQ+YIL LGT+ MIP+ LVP MGG+D DK 
Sbjct  8    DISHSPMDQLQGLEYCIDSNPSWVETILLGFQHYILALGTAVMIPSFLVPSMGGNDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP V+GGS+A+++PIV II D S   I +P +RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVIGGSYAFMVPIVSIIRDPSFAMIDDPQLRFLST  127

Query  581  MRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            MRA+QGALIV SSIQIILG+SQ+W + SRFFS
Sbjct  128  MRAVQGALIVGSSIQIILGFSQIWAICSRFFS  159



>gb|KDO54300.1| hypothetical protein CISIN_1g009755mg [Citrus sinensis]
Length=526

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/128 (91%), Positives = 122/128 (95%), Gaps = 0/128 (0%)
 Frame = +2

Query  293  ETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRL  472
            ETILLAFQNYIL+LGTS MIPTLLV  MGGS+GDKARVIQTLLFV+GINTLLQALFGTRL
Sbjct  33   ETILLAFQNYILMLGTSVMIPTLLVHAMGGSNGDKARVIQTLLFVSGINTLLQALFGTRL  92

Query  473  PAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVW  652
            PAVVGGSFAYVIPI YII+DSSLQRI++ H RFIQTMRAIQGALIVASSIQIILGYSQVW
Sbjct  93   PAVVGGSFAYVIPIAYIINDSSLQRITDDHERFIQTMRAIQGALIVASSIQIILGYSQVW  152

Query  653  GLFSRFFS  676
            GLFSRFFS
Sbjct  153  GLFSRFFS  160



>gb|ACG43417.1| permease [Zea mays]
Length=525

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  224  IAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKAR  403
            + H PM+QLQ LEYCIDSNP W E I L FQ+YIL LGT+ MIPTLLVPLMGG+D DKA+
Sbjct  10   VHHLPMDQLQGLEYCIDSNPSWGEGIALGFQHYILSLGTAVMIPTLLVPLMGGNDDDKAK  69

Query  404  VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTM  583
            V+QTLLFV GI TLLQ LFGTRLP ++GGS+AYV+PI+ I+ D S  RI++ H RF+QTM
Sbjct  70   VVQTLLFVTGIKTLLQTLFGTRLPTIMGGSYAYVVPILSIVRDPSFARIADGHTRFLQTM  129

Query  584  RAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RA+QG+LIV+SSIQIILGYSQ+W + SRFFS
Sbjct  130  RAVQGSLIVSSSIQIILGYSQLWAICSRFFS  160



>ref|XP_003577983.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Brachypodium 
distachyon]
 ref|XP_010238058.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Brachypodium 
distachyon]
 ref|XP_010238059.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Brachypodium 
distachyon]
Length=525

 Score =   225 bits (573),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  224  IAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKAR  403
            + HPPM+QLQ  EYCIDSNP W E I L FQ+YIL LGT+ MIPTLLV  MGG+D DKAR
Sbjct  10   VHHPPMDQLQGFEYCIDSNPSWGEAISLGFQHYILSLGTAVMIPTLLVTHMGGNDHDKAR  69

Query  404  VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTM  583
            V+QTLLFV GI TLLQ LFGTRLP V+ GS+A+VIPI+ II+D SL++I++ H RF+QTM
Sbjct  70   VVQTLLFVTGIKTLLQTLFGTRLPTVISGSYAFVIPILSIINDRSLRQIADDHTRFMQTM  129

Query  584  RAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RAIQGALIV+SSIQIILGYSQ+W + SRFFS
Sbjct  130  RAIQGALIVSSSIQIILGYSQLWAICSRFFS  160



>ref|XP_010490176.1| PREDICTED: nucleobase-ascorbate transporter 1-like [Camelina 
sativa]
Length=502

 Score =   223 bits (569),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 121/131 (92%), Gaps = 0/131 (0%)
 Frame = +2

Query  284  PWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQTLLFVAGINTLLQALFG  463
            P+ ET+LLAFQNYIL+LG+SA IP LLVP MGGSDGD+ARVIQTLLFVAGI TLLQALFG
Sbjct  6    PYSETVLLAFQNYILMLGSSAFIPALLVPAMGGSDGDRARVIQTLLFVAGIKTLLQALFG  65

Query  464  TRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQGALIVASSIQIILGYS  643
            TRLPAVVGGSFA+V+PI YIISDSSLQ+IS  H RFI TMRAIQGALIVASSIQIILGYS
Sbjct  66   TRLPAVVGGSFAFVVPIAYIISDSSLQKISNDHERFIHTMRAIQGALIVASSIQIILGYS  125

Query  644  QVWGLFSRFFS  676
            QVWGLFSRFFS
Sbjct  126  QVWGLFSRFFS  136



>gb|KHN08000.1| Nucleobase-ascorbate transporter 1 [Glycine soja]
Length=118

 Score =   211 bits (536),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/116 (87%), Positives = 109/116 (94%), Gaps = 0/116 (0%)
 Frame = +2

Query  215  MAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGD  394
            MA+I H PMEQLQDLEYCIDSNPPW ETILLAFQNYIL+LGTS MIP++LVP MGGS GD
Sbjct  1    MADITHQPMEQLQDLEYCIDSNPPWAETILLAFQNYILMLGTSVMIPSMLVPAMGGSSGD  60

Query  395  KARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPH  562
            KA+VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPI +IISDSSLQRI++PH
Sbjct  61   KAQVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIAHIISDSSLQRINDPH  116



>ref|XP_004956567.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Setaria italica]
Length=525

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +2

Query  224  IAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKAR  403
            + H PM+QLQ  EYCIDSNP W E I L FQ+YIL LGT+ MIPT+LVPLMGG+D DKA+
Sbjct  10   VHHMPMDQLQGFEYCIDSNPSWGEGIALGFQHYILSLGTAVMIPTMLVPLMGGNDHDKAK  69

Query  404  VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTM  583
            V+QTLLFV GI TLLQ LFGTRLP ++GGS+AYV+P++ II D S+ +I++ H RF+QTM
Sbjct  70   VVQTLLFVTGIKTLLQTLFGTRLPTIMGGSYAYVVPVLSIIRDPSIAQIADGHTRFLQTM  129

Query  584  RAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RAIQG+LIV+SSIQIILGYSQ+W + SRFFS
Sbjct  130  RAIQGSLIVSSSIQIILGYSQLWAICSRFFS  160



>ref|XP_006660533.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Oryza brachyantha]
Length=525

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/151 (70%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = +2

Query  224  IAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKAR  403
            + H PM+QLQ  EYCIDSNP W E I L FQ+YIL LGT+ MIPT+LV LMGG+D DKAR
Sbjct  10   VHHTPMDQLQGFEYCIDSNPSWGEAIALGFQHYILSLGTAVMIPTMLVQLMGGNDHDKAR  69

Query  404  VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTM  583
            V+QTLLFV GI TLLQ LFGTRLP ++GGS+A+V+PI+ II D SL +I++ H RF+QTM
Sbjct  70   VVQTLLFVTGIKTLLQTLFGTRLPTIIGGSYAFVVPILSIIRDPSLAQIADGHTRFVQTM  129

Query  584  RAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RAIQG+LIV+SSIQIILGYSQ+W + SRFFS
Sbjct  130  RAIQGSLIVSSSIQIILGYSQLWAICSRFFS  160



>ref|XP_002445381.1| hypothetical protein SORBIDRAFT_07g014930 [Sorghum bicolor]
 gb|EES14876.1| hypothetical protein SORBIDRAFT_07g014930 [Sorghum bicolor]
Length=526

 Score =   219 bits (559),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/156 (66%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  209  MAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSD  388
            M   E++HPPM+QL  +EYCIDSNP W   +LL FQ++IL LGT+ MIPTLLVPLMGG+ 
Sbjct  6    MKPEEMSHPPMDQLLGMEYCIDSNPSWGGAVLLGFQHFILCLGTAVMIPTLLVPLMGGNA  65

Query  389  GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIR  568
             DKA+V+QT+L V GINT+LQ LFGTRLP V+GGS+A++IP++ IISD SL +I++ H R
Sbjct  66   HDKAKVVQTMLLVTGINTMLQTLFGTRLPTVIGGSYAFLIPVISIISDPSLIQITDGHTR  125

Query  569  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            F  TMRAIQGALI++S IQIILGYSQ+WG+ SRFFS
Sbjct  126  FKMTMRAIQGALIISSCIQIILGYSQLWGVCSRFFS  161



>ref|XP_004973341.1| PREDICTED: nucleobase-ascorbate transporter 2-like isoform X1 
[Setaria italica]
 ref|XP_004973342.1| PREDICTED: nucleobase-ascorbate transporter 2-like isoform X2 
[Setaria italica]
Length=526

 Score =   219 bits (557),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 129/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  209  MAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSD  388
            M   E++HPPM+QL  +EYCIDSNP W   ++L FQ++IL LGT+ MIPT+LVPLMGG+ 
Sbjct  6    MKPEEMSHPPMDQLLGMEYCIDSNPSWGGAVVLGFQHFILCLGTAVMIPTMLVPLMGGNA  65

Query  389  GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIR  568
             DKA V+QT+LFV GINT+LQ LFGTRLP ++GGS+A++IP++ IISD SL +I++ H R
Sbjct  66   HDKALVVQTVLFVTGINTMLQTLFGTRLPTIIGGSYAFIIPVISIISDPSLMQIADDHTR  125

Query  569  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            F  TMRAIQGALI++S IQIILGYSQ+WG+ SRFFS
Sbjct  126  FKMTMRAIQGALIISSCIQIILGYSQLWGVCSRFFS  161



>ref|XP_008678172.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Zea mays]
 gb|AFW60917.1| hypothetical protein ZEAMMB73_515028 [Zea mays]
Length=522

 Score =   218 bits (556),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  209  MAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSD  388
            M   E++HPPM+QL  +EYCIDSNP W   +LL FQ++IL LGT+ MIPTLLVPLMGG+ 
Sbjct  6    MKPEEMSHPPMDQLLGMEYCIDSNPSWGGAVLLGFQHFILCLGTAVMIPTLLVPLMGGNA  65

Query  389  GDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIR  568
             DKA+V+QT+LFV GINT+LQ LFGTRLP V+GGS+A+++P++ +ISD SL +I++ H R
Sbjct  66   HDKAKVVQTVLFVTGINTMLQTLFGTRLPTVIGGSYAFLVPVMSVISDHSLIQIADNHTR  125

Query  569  FIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            F  TMRAIQGALI++S IQIILG+SQ+WG+ SRFFS
Sbjct  126  FKMTMRAIQGALIISSCIQIILGFSQLWGVCSRFFS  161



>ref|XP_010655537.1| PREDICTED: nucleobase-ascorbate transporter 2 isoform X2 [Vitis 
vinifera]
Length=514

 Score =   218 bits (554),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HPPM+Q+Q  EYCIDSNP W E I L FQ+YIL LGT+ MIP+ LVPLMGG+D DK 
Sbjct  8    EISHPPMDQIQGFEYCIDSNPSWAEAIALGFQHYILALGTAVMIPSFLVPLMGGTDDDKV  67

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQT  580
            RV+QTLLFV GINTLLQ LFGTRLP VVGGS+A+++P++ II DSSL  IS+PH RF+ T
Sbjct  68   RVVQTLLFVEGINTLLQTLFGTRLPTVVGGSYAFMVPVISIIHDSSLMEISDPHQRFLNT  127

Query  581  MRAIQGALIVASSIQIILGY  640
            MRAIQGALIVASSIQIILG+
Sbjct  128  MRAIQGALIVASSIQIILGF  147



>ref|XP_002441746.1| hypothetical protein SORBIDRAFT_08g001650 [Sorghum bicolor]
 gb|EES15584.1| hypothetical protein SORBIDRAFT_08g001650 [Sorghum bicolor]
Length=527

 Score =   214 bits (544),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/157 (66%), Positives = 125/157 (80%), Gaps = 1/157 (1%)
 Frame = +2

Query  209  MAMAEIAHPP-MEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGS  385
            M   EI HPP M+QL  +EYC+DSNP W   I+L FQ++IL LGT+ MIPTLLVPLMGG+
Sbjct  6    MKPEEITHPPIMDQLAGMEYCVDSNPSWGGCIMLGFQHFILCLGTAVMIPTLLVPLMGGN  65

Query  386  DGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHI  565
              DKA V+QT+LFV GINTLLQ LFGTRLP V+GGS+A+VIP++ IISD SL +IS+ H 
Sbjct  66   AHDKAIVVQTVLFVTGINTLLQTLFGTRLPTVIGGSYAFVIPVISIISDPSLMQISDDHT  125

Query  566  RFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RF   MRAIQGA I++S IQI+LGYSQ+WGL  RFFS
Sbjct  126  RFKVAMRAIQGAQIISSCIQIVLGYSQLWGLCCRFFS  162



>ref|XP_006852960.1| PREDICTED: nucleobase-ascorbate transporter 3 [Amborella trichopoda]
 gb|ERN14427.1| hypothetical protein AMTR_s00033p00243580 [Amborella trichopoda]
Length=536

 Score =   212 bits (539),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/149 (66%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            +PP EQL +LEYCI SNPPWPE I+LAFQ+YI++LGT AMI TLLVP MGG  GDKARVI
Sbjct  21   YPPTEQLHELEYCIHSNPPWPEVIILAFQHYIVMLGTIAMISTLLVPQMGGDHGDKARVI  80

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            QTLLF++G+NTL+Q L GTRLP V+GGSFA+VIP+V II + + +   + H RF+ TMRA
Sbjct  81   QTLLFMSGLNTLIQTLVGTRLPTVMGGSFAFVIPVVSIIDNIASRPFEDGHERFVHTMRA  140

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
            IQGALIV+S + II+GYSQ WG+++R+FS
Sbjct  141  IQGALIVSSFLNIIIGYSQSWGMYTRYFS  169



>ref|XP_004981566.1| PREDICTED: nucleobase-ascorbate transporter 2-like [Setaria italica]
Length=551

 Score =   205 bits (521),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 133/165 (81%), Gaps = 3/165 (2%)
 Frame = +2

Query  191  DPPP---SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTL  361
            + PP   + M + EI HPP++QL  ++YC+DSNP W   ILL FQ++IL LGT+ MIPT+
Sbjct  22   EQPPMEMTDMKLEEITHPPLDQLHHMKYCVDSNPSWGGAILLGFQHFILCLGTAVMIPTI  81

Query  362  LVPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSL  541
            LVPLMGG+  DKA+V+QT+LFV GINT+LQ LFGTRLP ++GGS+A+ IPI+ IISD SL
Sbjct  82   LVPLMGGNAHDKAQVVQTMLFVTGINTMLQTLFGTRLPTIIGGSYAFTIPIISIISDPSL  141

Query  542  QRISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             +I++ H RF  TMRAIQGALI++S +QI+LGYSQ+WG+ SRFFS
Sbjct  142  MQITDDHTRFKMTMRAIQGALIISSCVQIMLGYSQLWGICSRFFS  186



>ref|XP_006469619.1| PREDICTED: nucleobase-ascorbate transporter 1-like isoform X3 
[Citrus sinensis]
Length=482

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/116 (90%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +2

Query  329  VLGTSAMIPTLLVPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVI  508
            +LGTS MIPTLLV  MGGS+GDKARVIQTLLFV+GINTLLQALFGTRLPAVVGGSFAYVI
Sbjct  1    MLGTSVMIPTLLVHAMGGSNGDKARVIQTLLFVSGINTLLQALFGTRLPAVVGGSFAYVI  60

Query  509  PIVYIISDSSLQRISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            PI YII+DSSLQRI++ H RFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  61   PIAYIINDSSLQRITDDHERFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  116



>ref|XP_001766884.1| predicted protein [Physcomitrella patens]
 gb|EDQ68286.1| predicted protein [Physcomitrella patens]
Length=525

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 127/161 (79%), Gaps = 0/161 (0%)
 Frame = +2

Query  194  PPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPL  373
            P P      +++HP  EQL +L+YCI+ NPPWPE I L FQ+Y+++LG+S MIP++LVP+
Sbjct  2    PGPLQSKPEDLSHPCQEQLPELKYCINDNPPWPEAIALGFQHYLVMLGSSIMIPSILVPM  61

Query  374  MGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRIS  553
            MGG+D D++RVIQT+LFV+GINTLLQ  FGTRLP +VGGSFA++IP + II+  +L  I 
Sbjct  62   MGGNDADRSRVIQTILFVSGINTLLQTTFGTRLPTIVGGSFAFIIPTITIINSDNLLSID  121

Query  554  EPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            + + RF++TMRA+QGA+I +S+IQI LG+S +WG+  RF S
Sbjct  122  DDNERFLRTMRAVQGAIIASSTIQIALGFSGLWGILVRFLS  162



>ref|XP_008792697.1| PREDICTED: nucleobase-ascorbate transporter 3 [Phoenix dactylifera]
Length=548

 Score =   201 bits (511),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +2

Query  206  PMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGS  385
            P+  +   HPP EQL  L++C+ SNP W E ++LAFQ+YI++LGT  M+ TLLVPLMGG+
Sbjct  25   PVVGSGAVHPPNEQLPHLQFCVHSNPSWGEALILAFQHYIVMLGTIVMLATLLVPLMGGN  84

Query  386  DGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHI  565
            +GDKAR+IQT LF++GINTLLQ L GTRLP V+  SFA+VIP+  II+D S +   + H 
Sbjct  85   NGDKARIIQTFLFMSGINTLLQTLIGTRLPTVMNASFAFVIPVTSIINDFSSREYDDEHE  144

Query  566  RFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RF+ T+RAIQGALIV+S + II+GYS+ WG FSRFFS
Sbjct  145  RFVHTIRAIQGALIVSSFLNIIIGYSKAWGNFSRFFS  181



>ref|XP_011467773.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011467774.1| PREDICTED: nucleobase-ascorbate transporter 1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=482

 Score =   199 bits (505),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 99/116 (85%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = +2

Query  329  VLGTSAMIPTLLVPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVI  508
            +LGTS M+P+LLVP MGGSDGDKARVIQTLLFVAGI TLLQALFGTRLPAVVGGSFAYV+
Sbjct  1    MLGTSVMVPSLLVPAMGGSDGDKARVIQTLLFVAGIKTLLQALFGTRLPAVVGGSFAYVV  60

Query  509  PIVYIISDSSLQRISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            PI YII+DS   RI++ H RF+QTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  61   PIAYIINDSKFHRITDNHERFLQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  116



>ref|XP_006354927.1| PREDICTED: nucleobase-ascorbate transporter 3-like [Solanum tuberosum]
Length=549

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +2

Query  233  PPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQ  412
            PP EQL  L YCI SNP WP+T+LLAFQ+YI++LGT+ MI T+LVP MGG  GDKARVIQ
Sbjct  35   PPAEQLLQLNYCIHSNPSWPQTVLLAFQHYIVMLGTTVMIATVLVPQMGGGPGDKARVIQ  94

Query  413  TLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAI  592
            +LLF +G+NTLLQ LFGTRLP V+G SFAY+I  + +I+D S       H RF  TMRAI
Sbjct  95   SLLFTSGVNTLLQTLFGTRLPTVMGPSFAYIISALSVINDLSDSTFRSEHQRFEHTMRAI  154

Query  593  QGALIVASSIQIILGYSQVWGLFSRFFS  676
            QG+LIV+S I IILGY QVWG  +RFFS
Sbjct  155  QGSLIVSSIINIILGYGQVWGKLTRFFS  182



>ref|XP_009386652.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009386653.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=537

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            HP  EQL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT+LVP MGG + +KARVI
Sbjct  22   HPVKEQLPNVSYCITSPPPWPEAILLGFQHYLVMLGTTVIIPTVLVPQMGGGNDEKARVI  81

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            QT LFVAG+NTLLQ LFGTRLPAV+GGS+ +V+P + II +     I +PH RF++TMR 
Sbjct  82   QTFLFVAGLNTLLQTLFGTRLPAVIGGSYTFVVPTISIILNDRYNDIIDPHKRFLRTMRG  141

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
             QGALIVAS +QII+G+S +W L +RF S
Sbjct  142  TQGALIVASVVQIIIGFSGLWRLVTRFLS  170



>ref|XP_009625821.1| PREDICTED: nucleobase-ascorbate transporter 3 [Nicotiana tomentosiformis]
Length=549

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = +2

Query  233  PPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQ  412
            PP EQL  L YCI SNP WP+T+LLAFQ+YI++LGT+ MI T+LVP MGG  GDKARVIQ
Sbjct  35   PPAEQLLQLHYCIHSNPSWPQTVLLAFQHYIVMLGTTVMIATVLVPQMGGGPGDKARVIQ  94

Query  413  TLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAI  592
            +LLF +G+NTLLQ LFGTRLP V+G SFAY+I  + +I+D S       H RF  TMRAI
Sbjct  95   SLLFTSGVNTLLQTLFGTRLPTVMGPSFAYIISALSVINDLSDGNFRSEHQRFEHTMRAI  154

Query  593  QGALIVASSIQIILGYSQVWGLFSRFFS  676
            QG+LIV+S I IILGY Q WG  +RFFS
Sbjct  155  QGSLIVSSFINIILGYGQAWGNLTRFFS  182



>ref|XP_009777178.1| PREDICTED: nucleobase-ascorbate transporter 3 [Nicotiana sylvestris]
Length=555

 Score =   194 bits (492),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = +2

Query  233  PPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQ  412
            PP EQL  L YCI SNP WP+T+LLAFQ+YI++LGT+ MI T+LVP MGG  GDKARVIQ
Sbjct  41   PPAEQLLQLHYCIHSNPSWPQTVLLAFQHYIVMLGTTVMIATVLVPQMGGGPGDKARVIQ  100

Query  413  TLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAI  592
            +LLF +G+NTLLQ LFGTRLP V+G SFAY+I  + +I+D S       H RF  TMRAI
Sbjct  101  SLLFTSGVNTLLQTLFGTRLPTVMGPSFAYIISALSVINDLSDGNFRSEHQRFEHTMRAI  160

Query  593  QGALIVASSIQIILGYSQVWGLFSRFFS  676
            QG+LIV+S I IILGY Q WG  +RFFS
Sbjct  161  QGSLIVSSFINIILGYGQAWGNLTRFFS  188



>ref|XP_004238190.1| PREDICTED: nucleobase-ascorbate transporter 3 [Solanum lycopersicum]
Length=549

 Score =   193 bits (491),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 113/148 (76%), Gaps = 0/148 (0%)
 Frame = +2

Query  233  PPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQ  412
            PP EQL  L YCI SNP WP+T+LLAFQ+YI++LGT+ MI T+LVP MGG  GDKA+VIQ
Sbjct  35   PPAEQLLQLHYCIHSNPSWPQTVLLAFQHYIVMLGTTVMIATVLVPQMGGGPGDKAQVIQ  94

Query  413  TLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAI  592
            +LLF +G+NTLLQ LFGTRLP V+G SFAY+I  + +I+D S       H RF  TMRAI
Sbjct  95   SLLFTSGVNTLLQTLFGTRLPTVMGPSFAYIISALSVINDLSDSNFRSEHERFKHTMRAI  154

Query  593  QGALIVASSIQIILGYSQVWGLFSRFFS  676
            QG+LIV+S I IILGY Q WG  +RFFS
Sbjct  155  QGSLIVSSFINIILGYGQAWGNLTRFFS  182



>ref|XP_010255123.1| PREDICTED: nucleobase-ascorbate transporter 3 [Nelumbo nucifera]
Length=545

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 112/148 (76%), Gaps = 0/148 (0%)
 Frame = +2

Query  233  PPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQ  412
            PP EQL  L++CI SNP WPE+ LLAFQ+YI++LGT+ MI + LVP MGGS GDKA VIQ
Sbjct  31   PPQEQLHQLDFCIHSNPSWPESFLLAFQHYIVMLGTTVMIASFLVPQMGGSHGDKAHVIQ  90

Query  413  TLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAI  592
            TLLF+ G+NTLLQ   GTRLP V+G S+++VIP++ II+D +       H RF  TMR I
Sbjct  91   TLLFMGGVNTLLQTFLGTRLPTVMGASYSFVIPVMSIINDFNDSTFQNEHERFTHTMRTI  150

Query  593  QGALIVASSIQIILGYSQVWGLFSRFFS  676
            QG+LI++S   I++GYS+ WG F+RFFS
Sbjct  151  QGSLIISSFFNILIGYSKAWGNFTRFFS  178



>ref|XP_002282229.1| PREDICTED: nucleobase-ascorbate transporter 3 [Vitis vinifera]
 emb|CBI19583.3| unnamed protein product [Vitis vinifera]
Length=545

 Score =   192 bits (488),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 116/148 (78%), Gaps = 0/148 (0%)
 Frame = +2

Query  233  PPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQ  412
            PP EQL  L +CI SNP WP+ I+LAFQ+YI++LG++ +I + LVPLMGG++GDK RVIQ
Sbjct  31   PPNEQLHQLHFCIHSNPAWPQAIILAFQHYIVMLGSTVLIASTLVPLMGGNNGDKGRVIQ  90

Query  413  TLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAI  592
            TLLF+AG+NTLLQ L G RLP V+G SFA+ IP++ I++D + +     H RF+ TMRAI
Sbjct  91   TLLFMAGVNTLLQTLLGARLPTVMGASFAFFIPVMSIVNDFADKTFKSEHERFVYTMRAI  150

Query  593  QGALIVASSIQIILGYSQVWGLFSRFFS  676
            QG+L+V+S I I LGYS+VWG  +RFFS
Sbjct  151  QGSLMVSSIINIFLGYSRVWGNLTRFFS  178



>gb|KDO84357.1| hypothetical protein CISIN_1g009118mg [Citrus sinensis]
 gb|KDO84358.1| hypothetical protein CISIN_1g009118mg [Citrus sinensis]
Length=361

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQLQ L+YCI SNPPWP+ +LLAFQ+YI++LGT+ +I + LVPLMGG  GDK RVIQ+
Sbjct  30   PAEQLQQLQYCIHSNPPWPQALLLAFQHYIVMLGTTVLISSTLVPLMGGGHGDKGRVIQS  89

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++G+NTLLQ LFGTRLP V+G S A+ +P++ II+D +    +  H RF  T+R IQ
Sbjct  90   LLFMSGLNTLLQTLFGTRLPTVMGPSAAFTLPVLSIINDYNDGSFTSEHDRFRHTIRTIQ  149

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIV+S I I+LGYS  WG  +RFFS
Sbjct  150  GSLIVSSFINIVLGYSGAWGNLARFFS  176



>gb|KDO84359.1| hypothetical protein CISIN_1g009118mg [Citrus sinensis]
Length=364

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQLQ L+YCI SNPPWP+ +LLAFQ+YI++LGT+ +I + LVPLMGG  GDK RVIQ+
Sbjct  30   PAEQLQQLQYCIHSNPPWPQALLLAFQHYIVMLGTTVLISSTLVPLMGGGHGDKGRVIQS  89

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++G+NTLLQ LFGTRLP V+G S A+ +P++ II+D +    +  H RF  T+R IQ
Sbjct  90   LLFMSGLNTLLQTLFGTRLPTVMGPSAAFTLPVLSIINDYNDGSFTSEHDRFRHTIRTIQ  149

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIV+S I I+LGYS  WG  +RFFS
Sbjct  150  GSLIVSSFINIVLGYSGAWGNLARFFS  176



>gb|EYU25379.1| hypothetical protein MIMGU_mgv1a004067mg [Erythranthe guttata]
Length=546

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/149 (62%), Positives = 115/149 (77%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            +PP EQL  L YCI SNP W +T++LAFQ+YI++LGT+ MI ++LVP MGG  GDKARVI
Sbjct  31   YPPQEQLLQLHYCIHSNPSWVQTVVLAFQHYIVMLGTTVMIASVLVPRMGGGPGDKARVI  90

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            Q+LLF++GINTLLQ  FGTRLP V+G SFAYVI ++ II+D S    +  H RF  TMRA
Sbjct  91   QSLLFMSGINTLLQTWFGTRLPTVMGPSFAYVISVLSIINDLSDSDFTNEHERFSHTMRA  150

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
            IQG+LI++S + IILGYS  WG  +RFFS
Sbjct  151  IQGSLIISSFVNIILGYSNAWGNLTRFFS  179



>emb|CAN78223.1| hypothetical protein VITISV_006254 [Vitis vinifera]
Length=501

 Score =   189 bits (481),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +2

Query  233  PPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQ  412
            PP EQL  L  CI SNP WP+ I+LAFQ+YI++LG++ +I + LVPLMGG++GDK RVIQ
Sbjct  31   PPNEQLHQLHXCIHSNPXWPQAIILAFQHYIVMLGSTVLIASTLVPLMGGNNGDKGRVIQ  90

Query  413  TLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAI  592
            TLLF+AG+NTLLQ L G RLP V+G SFA+ IP++ I++D + +     H RF+ TMRAI
Sbjct  91   TLLFMAGVNTLLQTLLGARLPTVMGASFAFFIPVMSIVNDFADKTFKSEHERFVYTMRAI  150

Query  593  QGALIVASSIQIILGYSQVWGLFSRFFS  676
            QG+L+V+S I I LGYS+VWG  +RFFS
Sbjct  151  QGSLMVSSIINIFLGYSRVWGNLTRFFS  178



>ref|XP_010939008.1| PREDICTED: nucleobase-ascorbate transporter LPE1-like [Elaeis 
guineensis]
Length=529

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  194  PPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPL  373
            PPP+ +    + HP  EQ   +++CI S PPWPE I+L FQ+Y+++LGT+ +IPT+LVP 
Sbjct  3    PPPAKLD-EFVPHPVKEQFPGIDFCITSPPPWPEAIVLGFQHYLVMLGTTVLIPTILVPQ  61

Query  374  MGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRIS  553
            MGG D +KARVIQTLLFVAGINTLLQ  FGTRLPAV+GGSF Y++P + II       I 
Sbjct  62   MGGGDEEKARVIQTLLFVAGINTLLQGFFGTRLPAVIGGSFTYLLPTISIILSRRFIFII  121

Query  554  EPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +P+ RF+ TMRAIQGALI ASS QII+G+  +W +  RF S
Sbjct  122  DPYERFVHTMRAIQGALIAASSFQIIVGFFGIWRIVIRFLS  162



>gb|EMT06104.1| Nucleobase-ascorbate transporter 2 [Aegilops tauschii]
Length=478

 Score =   188 bits (478),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 114/153 (75%), Gaps = 22/153 (14%)
 Frame = +2

Query  221  EIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKA  400
            EI+HP MEQLQ  EYCIDSNPPW E I+L FQ+YIL LGT+ MIP +LVP+MGGSD    
Sbjct  8    EISHPAMEQLQGFEYCIDSNPPWGEAIILGFQHYILALGTAVMIPAVLVPMMGGSD----  63

Query  401  RVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHI-RFIQ  577
                             +LFGTRLP V+GGS+A+VIP++ I+ DSSL  I + H  RF+Q
Sbjct  64   -----------------SLFGTRLPTVIGGSYAFVIPVMAIVQDSSLAAIPDDHEQRFLQ  106

Query  578  TMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +MRAIQGALIV+SSIQIILGYSQ+WG+FSRFFS
Sbjct  107  SMRAIQGALIVSSSIQIILGYSQLWGIFSRFFS  139



>ref|XP_010913510.1| PREDICTED: LOW QUALITY PROTEIN: nucleobase-ascorbate transporter 
6 [Elaeis guineensis]
Length=533

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 119/163 (73%), Gaps = 0/163 (0%)
 Frame = +2

Query  188  GDPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLV  367
            G   P+P     + HP  +QL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT LV
Sbjct  4    GGAAPAPKPEELVPHPVKDQLPNVSYCITSPPPWPEAILLGFQHYLVMLGTTVIIPTALV  63

Query  368  PLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQR  547
            P MGG + +KARVIQTLLFVAG+NTL Q  FGTRLPAV+GGS+ +V+P + II       
Sbjct  64   PQMGGGNDEKARVIQTLLFVAGLNTLFQTFFGTRLPAVIGGSYTFVLPTISIILAGRYSN  123

Query  548  ISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            I++PH +F++ MR  QGALIVAS++QII+G+S +W   +RF S
Sbjct  124  IADPHEKFLRIMRGTQGALIVASTLQIIVGFSGLWRNVTRFLS  166



>ref|XP_008806500.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Phoenix dactylifera]
Length=533

 Score =   189 bits (479),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 119/163 (73%), Gaps = 0/163 (0%)
 Frame = +2

Query  188  GDPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLV  367
            G   P+P     + HP  +QL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT LV
Sbjct  4    GGAAPAPKQDELVPHPVKDQLPNVSYCITSPPPWPEAILLGFQHYLVMLGTTVIIPTALV  63

Query  368  PLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQR  547
            P MGG + +KARVIQTLLFVAG+NTL Q  FGTRLPAV+GGS+ +V+P + II       
Sbjct  64   PQMGGGNDEKARVIQTLLFVAGLNTLFQTFFGTRLPAVIGGSYTFVLPTISIILAGRYSN  123

Query  548  ISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            I++PH +F++ MR  QGALIVAS++QII+G+S +W   +RF S
Sbjct  124  IADPHEKFLRIMRGTQGALIVASTLQIIVGFSGLWRNVTRFLS  166



>gb|KDO84356.1| hypothetical protein CISIN_1g009118mg [Citrus sinensis]
Length=503

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQLQ L+YCI SNPPWP+ +LLAFQ+YI++LGT+ +I + LVPLMGG  GDK RVIQ+
Sbjct  30   PAEQLQQLQYCIHSNPPWPQALLLAFQHYIVMLGTTVLISSTLVPLMGGGHGDKGRVIQS  89

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++G+NTLLQ LFGTRLP V+G S A+ +P++ II+D +    +  H RF  T+R IQ
Sbjct  90   LLFMSGLNTLLQTLFGTRLPTVMGPSAAFTLPVLSIINDYNDGSFTSEHDRFRHTIRTIQ  149

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIV+S I I+LGYS  WG  +RFFS
Sbjct  150  GSLIVSSFINIVLGYSGAWGNLARFFS  176



>ref|XP_004499100.1| PREDICTED: nucleobase-ascorbate transporter 3-like [Cicer arietinum]
Length=548

 Score =   188 bits (477),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQL  L YCI SNP WPE +LL FQ+YI++LGT+ +I + LVP MGG+ GDKARVIQT
Sbjct  35   PAEQLLQLHYCIHSNPSWPEALLLGFQHYIVMLGTTVLIASNLVPQMGGNHGDKARVIQT  94

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++G+NTLLQ+ FG+RLP V+GGS A+V+P++ II+D + Q  S  H RF  TMR IQ
Sbjct  95   LLFMSGVNTLLQSWFGSRLPVVMGGSLAFVLPVMSIINDYNDQSFSSEHQRFTYTMRTIQ  154

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIV+S I I LGYS+ WG  +R FS
Sbjct  155  GSLIVSSFINIFLGYSRTWGNLTRLFS  181



>ref|XP_010929097.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
 ref|XP_010929098.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
 ref|XP_010929099.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
 ref|XP_010929100.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
Length=531

 Score =   187 bits (476),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/161 (57%), Positives = 119/161 (74%), Gaps = 2/161 (1%)
 Frame = +2

Query  194  PPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPL  373
            PPP    +  + HP  +QL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT LVP 
Sbjct  6    PPPKQEEL--VPHPVKDQLPNVSYCITSPPPWPEAILLGFQHYLVMLGTTVIIPTALVPQ  63

Query  374  MGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRIS  553
            MGG + +KARVIQTLLFVAG+NTLLQ  FGTRLPAV+GGS+++V P + II       I+
Sbjct  64   MGGGNDEKARVIQTLLFVAGLNTLLQTFFGTRLPAVIGGSYSFVPPTISIILAGRYSNIA  123

Query  554  EPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +PH +F+  MR  QGALIVAS++QIILG+S +W   +RF S
Sbjct  124  DPHEKFLHIMRGTQGALIVASTLQIILGFSGLWRNVARFLS  164



>ref|XP_010059774.1| PREDICTED: nucleobase-ascorbate transporter 3 [Eucalyptus grandis]
 gb|KCW66209.1| hypothetical protein EUGRSUZ_F00033 [Eucalyptus grandis]
Length=557

 Score =   187 bits (475),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 89/150 (59%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = +2

Query  227  AHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARV  406
            A PP EQLQ L+YCI SNP W + I+LAFQ+YI++LGT  MI + LVP MGG+ GDKARV
Sbjct  40   AWPPNEQLQHLDYCIHSNPRWYQAIVLAFQHYIVMLGTIVMIASNLVPQMGGNHGDKARV  99

Query  407  IQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMR  586
            IQ+LLF++GINTLLQ L GTRLP V+G S A+ +P++ II+D+  +  +  H RF+ TMR
Sbjct  100  IQSLLFMSGINTLLQTLIGTRLPTVMGASLAFYLPVLSIINDTLDKTFNSDHDRFLYTMR  159

Query  587  AIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             IQG+LIV+S + IILGYS+ WG F+++FS
Sbjct  160  TIQGSLIVSSFVNIILGYSRAWGKFTKYFS  189



>ref|XP_006473388.1| PREDICTED: nucleobase-ascorbate transporter 3-like isoform X1 
[Citrus sinensis]
 ref|XP_006473389.1| PREDICTED: nucleobase-ascorbate transporter 3-like isoform X2 
[Citrus sinensis]
 ref|XP_006473390.1| PREDICTED: nucleobase-ascorbate transporter 3-like isoform X3 
[Citrus sinensis]
 ref|XP_006473391.1| PREDICTED: nucleobase-ascorbate transporter 3-like isoform X4 
[Citrus sinensis]
Length=543

 Score =   187 bits (474),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQLQ L+YCI SNPPWP+ +LLAFQ+YI++LGT+ +I + LVPLMGG  GDK RVIQ+
Sbjct  30   PAEQLQQLQYCIHSNPPWPQALLLAFQHYIVMLGTTVLISSTLVPLMGGGHGDKGRVIQS  89

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++G+NTLLQ LFGTRLP V+G S A+ +P++ II+D +    +  H RF  T+R IQ
Sbjct  90   LLFMSGLNTLLQTLFGTRLPTVMGPSAAFTLPVLSIINDYNDGSFTSEHDRFRHTIRTIQ  149

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIV+S I I+LGYS  WG  +RFFS
Sbjct  150  GSLIVSSFINIVLGYSGAWGNLARFFS  176



>ref|XP_006434867.1| hypothetical protein CICLE_v10000779mg [Citrus clementina]
 ref|XP_006434868.1| hypothetical protein CICLE_v10000779mg [Citrus clementina]
 ref|XP_006434869.1| hypothetical protein CICLE_v10000779mg [Citrus clementina]
 gb|ESR48107.1| hypothetical protein CICLE_v10000779mg [Citrus clementina]
 gb|ESR48108.1| hypothetical protein CICLE_v10000779mg [Citrus clementina]
 gb|ESR48109.1| hypothetical protein CICLE_v10000779mg [Citrus clementina]
Length=543

 Score =   187 bits (474),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQLQ L+YCI SNPPWP+ +LLAFQ+YI++LGT+ +I + LVPLMGG  GDK RVIQ+
Sbjct  30   PAEQLQQLQYCIHSNPPWPQALLLAFQHYIVMLGTTVLISSTLVPLMGGGHGDKGRVIQS  89

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++G+NTLLQ LFGTRLP V+G S A+ +P++ II+D +    +  H RF  T+R IQ
Sbjct  90   LLFMSGLNTLLQTLFGTRLPTVMGPSAAFTLPVLSIINDYNDGSFTSEHDRFRHTIRTIQ  149

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIV+S I I+LGYS  WG  +RFFS
Sbjct  150  GSLIVSSFINIVLGYSGAWGNLARFFS  176



>ref|XP_009385304.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=533

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            HP  +QL D+ YCI S PPWPE +LL FQ+Y+++LGT+ +IPT LVP MGG + +KARVI
Sbjct  18   HPVKDQLPDISYCITSPPPWPEAVLLGFQHYLVMLGTTVIIPTALVPQMGGGNDEKARVI  77

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            QTLLFVAG+NTLLQ  FGTRLPAV+GGS+ +V+P + II  +    I +PH RF+  MR 
Sbjct  78   QTLLFVAGLNTLLQTTFGTRLPAVIGGSYTFVVPTISIILAARYSTIVDPHQRFLHVMRG  137

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
             QGALIV+S+IQIILG+S +W +  R  S
Sbjct  138  TQGALIVSSTIQIILGFSGLWRIVVRLLS  166



>gb|KDO84353.1| hypothetical protein CISIN_1g009118mg [Citrus sinensis]
 gb|KDO84354.1| hypothetical protein CISIN_1g009118mg [Citrus sinensis]
 gb|KDO84355.1| hypothetical protein CISIN_1g009118mg [Citrus sinensis]
Length=543

 Score =   187 bits (474),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQLQ L+YCI SNPPWP+ +LLAFQ+YI++LGT+ +I + LVPLMGG  GDK RVIQ+
Sbjct  30   PAEQLQQLQYCIHSNPPWPQALLLAFQHYIVMLGTTVLISSTLVPLMGGGHGDKGRVIQS  89

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++G+NTLLQ LFGTRLP V+G S A+ +P++ II+D +    +  H RF  T+R IQ
Sbjct  90   LLFMSGLNTLLQTLFGTRLPTVMGPSAAFTLPVLSIINDYNDGSFTSEHDRFRHTIRTIQ  149

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIV+S I I+LGYS  WG  +RFFS
Sbjct  150  GSLIVSSFINIVLGYSGAWGNLARFFS  176



>gb|KHM99089.1| Nucleobase-ascorbate transporter 1 [Glycine soja]
Length=483

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = +2

Query  329  VLGTSAMIPTLLVPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGG-SFAYV  505
            +LGTS MIP+ +V  MGGSDGDKARVIQTLLFVAGINTLLQ LFGTRLP VVGG S AY+
Sbjct  1    MLGTSVMIPSWIVHAMGGSDGDKARVIQTLLFVAGINTLLQTLFGTRLPTVVGGGSSAYI  60

Query  506  IPIVYIISDSSLQRISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             PI YII+DSSLQ+IS+ H RFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  61   YPIAYIITDSSLQQISDSHERFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  117



>ref|XP_006595824.1| PREDICTED: nucleobase-ascorbate transporter 1-like isoform X3 
[Glycine max]
Length=510

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = +2

Query  329  VLGTSAMIPTLLVPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGG-SFAYV  505
            +LGTS MIP+ +V  MGGSDGDKARVIQTLLFVAGINTLLQ LFGTRLP VVGG S AY+
Sbjct  1    MLGTSVMIPSWIVHAMGGSDGDKARVIQTLLFVAGINTLLQTLFGTRLPTVVGGGSSAYI  60

Query  506  IPIVYIISDSSLQRISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             PI YII+DSSLQ+IS+ H RFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  61   YPIAYIITDSSLQQISDSHERFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  117



>gb|KJB58396.1| hypothetical protein B456_009G208500 [Gossypium raimondii]
Length=544

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQL  L+YCI SNP WP+ +LLAFQ+YI+ LGT+ +I + +VPLMGG+ GDKARVIQ 
Sbjct  37   PAEQLHQLQYCIHSNPSWPQALLLAFQHYIVNLGTTVLIASNIVPLMGGTHGDKARVIQV  96

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++GINTLLQ L G+RLP V+G S AY +P+  II+D + +  + PH RF+ +MR IQ
Sbjct  97   LLFMSGINTLLQTLIGSRLPTVMGASIAYTLPLFSIINDYNDEDFASPHDRFVHSMRTIQ  156

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G++IV+S + IILGY + WG  +RFFS
Sbjct  157  GSMIVSSFLNIILGYGRAWGELTRFFS  183



>ref|XP_010941850.1| PREDICTED: LOW QUALITY PROTEIN: nucleobase-ascorbate transporter 
3 [Elaeis guineensis]
Length=563

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 119/165 (72%), Gaps = 8/165 (5%)
 Frame = +2

Query  206  PMAMAEIAHPPMEQLQDLEYCIDSNPPW--------PETILLAFQNYILVLGTSAMIPTL  361
            P+  +   HPP EQL  L++C+ SNPP          E ++LAFQ+YI++LGT  M+ T 
Sbjct  32   PVVGSGAVHPPNEQLPHLQFCVHSNPPMGXALSSPVREAVILAFQHYIVMLGTIVMLATF  91

Query  362  LVPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSL  541
            LVP MGGS+GDKAR+IQT LF++GINTLLQ L GTRLP V+  S A+VIP++ II+D S 
Sbjct  92   LVPKMGGSNGDKARIIQTFLFMSGINTLLQTLIGTRLPTVMNASLAFVIPVLSIINDFSS  151

Query  542  QRISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +     H RF+ T+RAIQGALIV+S + II+GYS+ WG FSRFFS
Sbjct  152  REYENEHERFVHTIRAIQGALIVSSFLNIIIGYSRAWGDFSRFFS  196



>ref|XP_007049167.1| Xanthine/uracil permease family protein isoform 2 [Theobroma 
cacao]
 gb|EOX93324.1| Xanthine/uracil permease family protein isoform 2 [Theobroma 
cacao]
Length=474

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +2

Query  374  MGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRIS  553
            MGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPA++GGS+AYVIPI YII+DSSLQRIS
Sbjct  1    MGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAILGGSYAYVIPIAYIINDSSLQRIS  60

Query  554  EPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            + H RFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS
Sbjct  61   DRHERFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  101



>ref|XP_008452493.1| PREDICTED: nucleobase-ascorbate transporter 3 [Cucumis melo]
Length=548

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 114/161 (71%), Gaps = 0/161 (0%)
 Frame = +2

Query  194  PPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPL  373
            PPP+          P EQLQ L YCI SNP WPE +LLAFQ+YI+VLGT  +I T LVP 
Sbjct  21   PPPNLALSRGPTWTPAEQLQQLHYCIHSNPSWPEAVLLAFQHYIVVLGTIVLIATTLVPR  80

Query  374  MGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRIS  553
            MGGS GDKARVIQTLLF AG+NTLLQ   G+RLP V+  SF +++P++ II+D S +  S
Sbjct  81   MGGSPGDKARVIQTLLFTAGLNTLLQTALGSRLPTVMRSSFVFILPVLSIINDFSDKNFS  140

Query  554  EPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
              H RF  T+R IQG+LIVAS I IILG+S+ WG  +R F+
Sbjct  141  SEHERFTYTVRTIQGSLIVASIINIILGFSRTWGHLTRLFT  181



>gb|KJB53220.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
Length=343

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            HPP EQL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT LVP MGG + +KA+VI
Sbjct  10   HPPKEQLPNISYCITSPPPWPEAILLGFQHYLVMLGTTVIIPTSLVPQMGGGNEEKAKVI  69

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            QTLLFVAG+NTLLQ+LFG+RLPAV+GGS+ +V   + II        S+P  RF + MRA
Sbjct  70   QTLLFVAGLNTLLQSLFGSRLPAVIGGSYTFVPTTISIILAGRFSDSSDPIERFKRIMRA  129

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
             QGALIVAS++QI+LG+S +W   +RF S
Sbjct  130  TQGALIVASTLQIVLGFSGLWRNVARFLS  158



>gb|KJB58395.1| hypothetical protein B456_009G208500 [Gossypium raimondii]
Length=549

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQL  L+YCI SNP WP+ +LLAFQ+YI+ LGT+ +I + +VPLMGG+ GDKARVIQ 
Sbjct  37   PAEQLHQLQYCIHSNPSWPQALLLAFQHYIVNLGTTVLIASNIVPLMGGTHGDKARVIQV  96

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++GINTLLQ L G+RLP V+G S AY +P+  II+D + +  + PH RF+ +MR IQ
Sbjct  97   LLFMSGINTLLQTLIGSRLPTVMGASIAYTLPLFSIINDYNDEDFASPHDRFVHSMRTIQ  156

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G++IV+S + IILGY + WG  +RFFS
Sbjct  157  GSMIVSSFLNIILGYGRAWGELTRFFS  183



>ref|XP_011654085.1| PREDICTED: nucleobase-ascorbate transporter 3 [Cucumis sativus]
 gb|KGN55157.1| hypothetical protein Csa_4G638470 [Cucumis sativus]
Length=548

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 114/161 (71%), Gaps = 0/161 (0%)
 Frame = +2

Query  194  PPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPL  373
            PPP+          P EQLQ L YCI SNP WPE +LLAFQ+YI+VLGT  +I T LVP 
Sbjct  21   PPPNLALSRGPTWTPAEQLQQLHYCIHSNPSWPEAVLLAFQHYIVVLGTIVLIATTLVPR  80

Query  374  MGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRIS  553
            MGGS GDKARVIQTLLF AG+NTLLQ   G+RLP V+  SF +++P++ II+D S +  S
Sbjct  81   MGGSPGDKARVIQTLLFTAGLNTLLQTALGSRLPTVMRSSFVFILPVLSIINDFSDKNFS  140

Query  554  EPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
              H RF  T+R IQG+LIVAS I +ILG+S+ WG  +R F+
Sbjct  141  SEHERFTYTVRTIQGSLIVASIINVILGFSRTWGHLTRLFT  181



>ref|XP_007141637.1| hypothetical protein PHAVU_008G212800g [Phaseolus vulgaris]
 gb|ESW13631.1| hypothetical protein PHAVU_008G212800g [Phaseolus vulgaris]
Length=483

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 106/117 (91%), Gaps = 1/117 (1%)
 Frame = +2

Query  329  VLGTSAMIPTLLVPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGG-SFAYV  505
            +LGTS MIP+ +V  MGGSDGDKARVIQTLLFVAG+NTLLQ LFGTRLP VVGG S AY+
Sbjct  1    MLGTSVMIPSWIVHAMGGSDGDKARVIQTLLFVAGVNTLLQTLFGTRLPTVVGGGSSAYI  60

Query  506  IPIVYIISDSSLQRISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             PI YII+DSSLQ+IS+P+ RFIQTMRAIQGALIVASSIQIILGYSQ+WGLFSRFFS
Sbjct  61   YPIAYIITDSSLQQISDPNERFIQTMRAIQGALIVASSIQIILGYSQIWGLFSRFFS  117



>ref|XP_008810107.1| PREDICTED: nucleobase-ascorbate transporter LPE1-like [Phoenix 
dactylifera]
Length=535

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 115/151 (76%), Gaps = 0/151 (0%)
 Frame = +2

Query  224  IAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKAR  403
            + HP  EQL  +++C+ S PPW E I+L FQ+Y+++LGT+ +IPT+LVP MGG   +KAR
Sbjct  18   VPHPVKEQLPGIDFCLASPPPWAEAIVLGFQHYLVMLGTTVLIPTILVPQMGGGAEEKAR  77

Query  404  VIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTM  583
            VIQTLLFVAGINTLLQA FGTRLPAV+GGSF Y++P + II       I +P+ RF+QTM
Sbjct  78   VIQTLLFVAGINTLLQAYFGTRLPAVIGGSFTYLLPTISIILSRRFVYIIDPYERFVQTM  137

Query  584  RAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            RAIQGALI ASS QII+G+  +W +  RF S
Sbjct  138  RAIQGALIAASSFQIIVGFLGIWRIVMRFLS  168



>gb|KJB63783.1| hypothetical protein B456_010G016200 [Gossypium raimondii]
Length=400

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQL  L+YCI SNP WP+ +LLAFQ++I+ LGT+ +I + +VP MGG+ GDKARVIQ 
Sbjct  38   PAEQLHQLQYCIHSNPSWPQALLLAFQHFIVNLGTTVLIASTMVPRMGGNHGDKARVIQV  97

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++GINTLLQ L G+RLP V+G SFAY +P++ II+D + +     H RF++ +R IQ
Sbjct  98   LLFMSGINTLLQTLIGSRLPTVMGVSFAYTLPLLSIINDYTDEAFGTEHDRFVRGIRTIQ  157

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIVAS + IILGYS+ WG  +RFF+
Sbjct  158  GSLIVASFVNIILGYSRAWGELTRFFT  184



>gb|ACD56666.1| putative permease [Gossypium arboreum]
Length=493

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +2

Query  293  ETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRL  472
            E I L FQ+YIL LGT+ MIP+ LVPLMGG+D DK RV+QTLLFV GINTLLQ LFGTRL
Sbjct  1    EAIALGFQHYILALGTAVMIPSFLVPLMGGTDDDKVRVVQTLLFVEGINTLLQTLFGTRL  60

Query  473  PAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVW  652
            P V+GGS+A+++PI+ II D++L  I + H+RF+ TMRAIQGALIVASSIQIILGYSQ+W
Sbjct  61   PTVIGGSYAFMVPIISIIHDTTLLSIEDNHMRFLYTMRAIQGALIVASSIQIILGYSQMW  120

Query  653  GLFSRFFS  676
             + +RFFS
Sbjct  121  AICTRFFS  128



>ref|XP_006386511.1| PIGMENT DEFECTIVE EMBRYO 135 family protein [Populus trichocarpa]
 ref|XP_006386512.1| hypothetical protein POPTR_0002s13080g [Populus trichocarpa]
 gb|ERP64308.1| PIGMENT DEFECTIVE EMBRYO 135 family protein [Populus trichocarpa]
 gb|ERP64309.1| hypothetical protein POPTR_0002s13080g [Populus trichocarpa]
Length=550

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQLQ L YCI SNP WPET LLAF++YI++LGT+ +I   LVP MGG  GD ARVIQT
Sbjct  38   PAEQLQQLHYCIHSNPSWPETCLLAFEHYIVMLGTTVLIARNLVPRMGGDPGDTARVIQT  97

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++GINTLLQ + GTRLP V+G S+A+V+P++ I+ D + +  S  H RF+ TMR IQ
Sbjct  98   LLFMSGINTLLQTIIGTRLPTVMGPSYAFVLPVLSIMRDYNNETFSNEHDRFVDTMRTIQ  157

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIV+S   IILG+S+ WG  +RFFS
Sbjct  158  GSLIVSSFANIILGFSKAWGNLTRFFS  184



>ref|XP_011017252.1| PREDICTED: nucleobase-ascorbate transporter 3-like [Populus euphratica]
Length=550

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQLQ L+YCI SNP WPET LLAF++YI++LGT+ +I   +VP MGG  GD ARVIQT
Sbjct  38   PAEQLQQLQYCIHSNPSWPETCLLAFEHYIVMLGTTVLIARNIVPRMGGDPGDTARVIQT  97

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF+AGINTLLQ + G RLP V+G S+A+V+P++ I+ D + +  S  H RF+ TMR IQ
Sbjct  98   LLFMAGINTLLQTIIGARLPTVMGPSYAFVLPVLSIMRDYNNETFSNEHDRFVDTMRTIQ  157

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIV+S + IILG+S+ WG  +RFFS
Sbjct  158  GSLIVSSFVNIILGFSKAWGNLTRFFS  184



>emb|CDP07610.1| unnamed protein product [Coffea canephora]
Length=547

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            +PP EQL  L YCI SNP W +T+LLAFQ+YI++LGT+ MI T+LVP MGG  GDKARVI
Sbjct  32   YPPAEQLLQLHYCIHSNPSWHQTVLLAFQHYIVMLGTAVMIATVLVPRMGGGHGDKARVI  91

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            Q++LF++GINTLLQ LFG+RLP V+G S+AY I ++  I+D +    +  H RF   MRA
Sbjct  92   QSMLFMSGINTLLQTLFGSRLPTVMGPSYAYFISVLLAINDFNDSNFTTEHERFTHIMRA  151

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +QG+LIV+S + II+GY + WG  +RFFS
Sbjct  152  VQGSLIVSSILNIIIGYGKAWGNLTRFFS  180



>gb|KJB53224.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
 gb|KJB53227.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
Length=401

 Score =   181 bits (460),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            HPP EQL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT LVP MGG + +KA+VI
Sbjct  10   HPPKEQLPNISYCITSPPPWPEAILLGFQHYLVMLGTTVIIPTSLVPQMGGGNEEKAKVI  69

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            QTLLFVAG+NTLLQ+LFG+RLPAV+GGS+ +V   + II        S+P  RF + MRA
Sbjct  70   QTLLFVAGLNTLLQSLFGSRLPAVIGGSYTFVPTTISIILAGRFSDSSDPIERFKRIMRA  129

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
             QGALIVAS++QI+LG+S +W   +RF S
Sbjct  130  TQGALIVASTLQIVLGFSGLWRNVARFLS  158



>ref|XP_006398035.1| hypothetical protein EUTSA_v10001247mg [Eutrema salsugineum]
 gb|ESQ39488.1| hypothetical protein EUTSA_v10001247mg [Eutrema salsugineum]
Length=366

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 109/148 (74%), Gaps = 0/148 (0%)
 Frame = +2

Query  233  PPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQ  412
            PP EQL  L+YCI SNP W ET++LAFQ+YI++LGT+ +I   LVP MGG  GDKARVIQ
Sbjct  34   PPAEQLHHLQYCIHSNPSWHETVVLAFQHYIVMLGTTVLIANTLVPQMGGDPGDKARVIQ  93

Query  413  TLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAI  592
            T+LF++GINTLLQ L GTRLP V+G SFAYV+P++ II D +  +      RF  TMR +
Sbjct  94   TILFMSGINTLLQTLIGTRLPTVMGVSFAYVLPVLSIIRDYNDGQFDTEKQRFRHTMRTV  153

Query  593  QGALIVASSIQIILGYSQVWGLFSRFFS  676
            QG+LI++S + II+GY Q WG   R FS
Sbjct  154  QGSLIISSFVNIIIGYGQAWGNLIRIFS  181



>ref|XP_007017372.1| Xanthine/uracil permease family protein isoform 2 [Theobroma 
cacao]
 gb|EOY14597.1| Xanthine/uracil permease family protein isoform 2 [Theobroma 
cacao]
Length=549

 Score =   184 bits (468),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQL  L+YCI SNP WP+ +LLAFQ+YI+ LGT+ +I + +VP MGG  GDKARVIQ 
Sbjct  36   PAEQLHQLQYCIHSNPSWPQALLLAFQHYIVNLGTTVLIASTIVPRMGGDHGDKARVIQA  95

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++GINTLLQ L G+RLP V+G SFAY +P++ II+D + +  +  H RF++ MR IQ
Sbjct  96   LLFMSGINTLLQTLIGSRLPTVMGASFAYTLPLLSIINDYTDEAFTSEHDRFVRGMRTIQ  155

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIV+S + IILGYS+ WG  +R FS
Sbjct  156  GSLIVSSFVNIILGYSRAWGEMTRLFS  182



>gb|KJB53222.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
Length=405

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            HPP EQL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT LVP MGG + +KA+VI
Sbjct  10   HPPKEQLPNISYCITSPPPWPEAILLGFQHYLVMLGTTVIIPTSLVPQMGGGNEEKAKVI  69

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            QTLLFVAG+NTLLQ+LFG+RLPAV+GGS+ +V   + II        S+P  RF + MRA
Sbjct  70   QTLLFVAGLNTLLQSLFGSRLPAVIGGSYTFVPTTISIILAGRFSDSSDPIERFKRIMRA  129

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
             QGALIVAS++QI+LG+S +W   +RF S
Sbjct  130  TQGALIVASTLQIVLGFSGLWRNVARFLS  158



>ref|XP_007017371.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
 gb|EOY14596.1| Xanthine/uracil permease family protein isoform 1 [Theobroma 
cacao]
Length=548

 Score =   184 bits (468),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQL  L+YCI SNP WP+ +LLAFQ+YI+ LGT+ +I + +VP MGG  GDKARVIQ 
Sbjct  36   PAEQLHQLQYCIHSNPSWPQALLLAFQHYIVNLGTTVLIASTIVPRMGGDHGDKARVIQA  95

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++GINTLLQ L G+RLP V+G SFAY +P++ II+D + +  +  H RF++ MR IQ
Sbjct  96   LLFMSGINTLLQTLIGSRLPTVMGASFAYTLPLLSIINDYTDEAFTSEHDRFVRGMRTIQ  155

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIV+S + IILGYS+ WG  +R FS
Sbjct  156  GSLIVSSFVNIILGYSRAWGEMTRLFS  182



>ref|XP_002511446.1| purine permease, putative [Ricinus communis]
 gb|EEF52048.1| purine permease, putative [Ricinus communis]
Length=531

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            HPP EQL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT LVP MGG + +KA+VI
Sbjct  16   HPPKEQLPNISYCITSPPPWPEAILLGFQHYLVMLGTTVLIPTALVPQMGGGNKEKAQVI  75

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            QTLLFVAG+NTLLQ+LFGTRLPAV+GGS+ +V   + II        ++P  RF   MRA
Sbjct  76   QTLLFVAGLNTLLQSLFGTRLPAVIGGSYTFVPTTISIILAGRFSDATDPEERFKSIMRA  135

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
            IQG+LIVAS++QI+LG+S +W   +RF S
Sbjct  136  IQGSLIVASTLQIVLGFSGLWRNVTRFLS  164



>ref|XP_009417550.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=534

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            HP  +QL ++ YCI S PPWPE ILL FQ+++++LGT+ +IPT LVP MGG + +KARV+
Sbjct  19   HPVKDQLPNVSYCITSPPPWPEAILLGFQHFLVMLGTTVIIPTALVPQMGGGNDEKARVV  78

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            QTLLFVAGINTL Q LFGTRLPAV+GGS+ +V+P + II       I +PH +F++ MR 
Sbjct  79   QTLLFVAGINTLFQTLFGTRLPAVIGGSYTFVVPTISIILAGRYSDIVDPHEKFLRIMRG  138

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
             QGALIVAS++QII+G+S +W   +RF S
Sbjct  139  TQGALIVASTLQIIIGFSGLWRNVTRFLS  167



>gb|KDO69755.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
Length=331

 Score =   179 bits (455),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 118/159 (74%), Gaps = 1/159 (1%)
 Frame = +2

Query  203  SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGG  382
            +P A   + HP  +QL  + YCI S PPWPE ILL FQ+YI++LGT+ +IPT LVP MGG
Sbjct  6    APKADEPLPHPAKDQLPSISYCITSPPPWPEAILLGFQHYIVMLGTTVLIPTSLVPQMGG  65

Query  383  SDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRIS-EP  559
             + +KA+VIQTLLFVAG+NTLLQ+LFGTRLPAV+GGS+ +V   + II        S +P
Sbjct  66   GNEEKAKVIQTLLFVAGLNTLLQSLFGTRLPAVMGGSYTFVPSTISIILAGRFSNYSGDP  125

Query  560  HIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
              +F +TMRAIQG+LIVAS++QI+LG+S +W   +RF S
Sbjct  126  VEKFKRTMRAIQGSLIVASTLQIVLGFSGLWRNVTRFLS  164



>ref|XP_009391237.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391238.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Musa acuminata 
subsp. malaccensis]
Length=535

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            HP  +QL ++ YCI S PPWPE ILL FQ+++++LGT+ +IPT LVP MGG + +KARV+
Sbjct  20   HPVKDQLPNVSYCITSPPPWPEAILLGFQHFLVMLGTTVIIPTALVPQMGGGNDEKARVV  79

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            QTLLFVAGINTL Q LFGTRLPAV+GGS+ +V+P + II       I +PH +F++ MR 
Sbjct  80   QTLLFVAGINTLFQTLFGTRLPAVIGGSYTFVVPTISIILAGRYSNIVDPHEKFLRIMRG  139

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
             QGALIVAS++QII+G+S +W   +RF S
Sbjct  140  TQGALIVASTLQIIVGFSGLWRNVARFLS  168



>gb|KDO69756.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
Length=314

 Score =   179 bits (453),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 118/159 (74%), Gaps = 1/159 (1%)
 Frame = +2

Query  203  SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGG  382
            +P A   + HP  +QL  + YCI S PPWPE ILL FQ+YI++LGT+ +IPT LVP MGG
Sbjct  6    APKADEPLPHPAKDQLPSISYCITSPPPWPEAILLGFQHYIVMLGTTVLIPTSLVPQMGG  65

Query  383  SDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRIS-EP  559
             + +KA+VIQTLLFVAG+NTLLQ+LFGTRLPAV+GGS+ +V   + II        S +P
Sbjct  66   GNEEKAKVIQTLLFVAGLNTLLQSLFGTRLPAVMGGSYTFVPSTISIILAGRFSNYSGDP  125

Query  560  HIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
              +F +TMRAIQG+LIVAS++QI+LG+S +W   +RF S
Sbjct  126  VEKFKRTMRAIQGSLIVASTLQIVLGFSGLWRNVTRFLS  164



>ref|XP_009415384.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=528

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +2

Query  194  PPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPL  373
            PPP    +  + HP  +QL ++ +CI S PPWPE ILL FQ+Y+++LGT+ +IPT LVP 
Sbjct  6    PPPKQDEL--VPHPVKDQLPNVSFCITSPPPWPEAILLGFQHYLVMLGTTVIIPTALVPQ  63

Query  374  MGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRIS  553
            MGG + +KARVIQTLLFVAGINTL Q  FGTRLPAV+GGS+ +V+P + II       I 
Sbjct  64   MGGGNDEKARVIQTLLFVAGINTLFQTFFGTRLPAVMGGSYTFVMPTISIILAGRYSDIV  123

Query  554  EPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +PH +F++ MR  QGALIVAS++QII+G+S +W   +RF S
Sbjct  124  DPHEKFLRIMRGTQGALIVASTLQIIIGFSGLWRNVTRFLS  164



>gb|KHG06073.1| Nucleobase-ascorbate transporter 3 -like protein [Gossypium arboreum]
Length=531

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/147 (58%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQL  L+YCI SNP WP+ +LLAFQ++I+ LGT+ +I + +VP MGG+ GDKARVIQ 
Sbjct  39   PAEQLHQLQYCIHSNPSWPQALLLAFQHFIVNLGTTVLIASTMVPRMGGNHGDKARVIQV  98

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++GINTLLQ L G+RLP V+G SFAY +P++ II+D + +  +  H RFI+ +R IQ
Sbjct  99   LLFMSGINTLLQTLIGSRLPTVMGVSFAYTLPLLSIINDYTDETFATEHDRFIRGIRTIQ  158

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIVAS + IILGYS+ WG  +RFF+
Sbjct  159  GSLIVASFVNIILGYSRAWGELTRFFT  185



>ref|XP_009415380.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415381.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415382.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009415383.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=531

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 118/161 (73%), Gaps = 2/161 (1%)
 Frame = +2

Query  194  PPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPL  373
            PPP    +  + HP  +QL ++ +CI S PPWPE ILL FQ+Y+++LGT+ +IPT LVP 
Sbjct  6    PPPKQDEL--VPHPVKDQLPNVSFCITSPPPWPEAILLGFQHYLVMLGTTVIIPTALVPQ  63

Query  374  MGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRIS  553
            MGG + +KARVIQTLLFVAGINTL Q  FGTRLPAV+GGS+ +V+P + II       I 
Sbjct  64   MGGGNDEKARVIQTLLFVAGINTLFQTFFGTRLPAVMGGSYTFVMPTISIILAGRYSDIV  123

Query  554  EPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            +PH +F++ MR  QGALIVAS++QII+G+S +W   +RF S
Sbjct  124  DPHEKFLRIMRGTQGALIVASTLQIIIGFSGLWRNVTRFLS  164



>gb|KDO69754.1| hypothetical protein CISIN_1g009582mg [Citrus sinensis]
Length=349

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 118/159 (74%), Gaps = 1/159 (1%)
 Frame = +2

Query  203  SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGG  382
            +P A   + HP  +QL  + YCI S PPWPE ILL FQ+YI++LGT+ +IPT LVP MGG
Sbjct  6    APKADEPLPHPAKDQLPSISYCITSPPPWPEAILLGFQHYIVMLGTTVLIPTSLVPQMGG  65

Query  383  SDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRIS-EP  559
             + +KA+VIQTLLFVAG+NTLLQ+LFGTRLPAV+GGS+ +V   + II        S +P
Sbjct  66   GNEEKAKVIQTLLFVAGLNTLLQSLFGTRLPAVMGGSYTFVPSTISIILAGRFSNYSGDP  125

Query  560  HIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
              +F +TMRAIQG+LIVAS++QI+LG+S +W   +RF S
Sbjct  126  VEKFKRTMRAIQGSLIVASTLQIVLGFSGLWRNVTRFLS  164



>gb|EYU29931.1| hypothetical protein MIMGU_mgv1a026566mg, partial [Erythranthe 
guttata]
Length=363

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 114/158 (72%), Gaps = 1/158 (1%)
 Frame = +2

Query  203  SPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGG  382
            +P A     HPP +QL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT LVP MGG
Sbjct  6    APKADEPSPHPPKDQLPNVSYCITSPPPWPEAILLGFQHYLVMLGTTVIIPTALVPQMGG  65

Query  383  SDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPH  562
             + +KA+VIQTLLFVAG+NTLLQ  FGTRLP V+GGS+ +V P + II         +P 
Sbjct  66   GNEEKAKVIQTLLFVAGLNTLLQTWFGTRLPVVIGGSYTFVAPTISIILSGRWND-PDPV  124

Query  563  IRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             RF + MRA QGALIVAS+IQI+LG+S +W   +RF S
Sbjct  125  SRFKKIMRATQGALIVASTIQIVLGFSGLWRNVTRFLS  162



>gb|KJB53226.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
Length=455

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            HPP EQL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT LVP MGG + +KA+VI
Sbjct  10   HPPKEQLPNISYCITSPPPWPEAILLGFQHYLVMLGTTVIIPTSLVPQMGGGNEEKAKVI  69

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            QTLLFVAG+NTLLQ+LFG+RLPAV+GGS+ +V   + II        S+P  RF + MRA
Sbjct  70   QTLLFVAGLNTLLQSLFGSRLPAVIGGSYTFVPTTISIILAGRFSDSSDPIERFKRIMRA  129

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
             QGALIVAS++QI+LG+S +W   +RF S
Sbjct  130  TQGALIVASTLQIVLGFSGLWRNVARFLS  158



>ref|XP_010942184.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
 ref|XP_010942185.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Elaeis guineensis]
Length=546

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = +2

Query  200  PSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMG  379
            P+P     + HP  EQL ++ YCI S PP PE ILL FQ+Y+++LGT+ +IPT LVP MG
Sbjct  21   PAPKQDELVPHPVREQLPNISYCITSPPPLPEAILLGFQHYLVMLGTTVIIPTALVPQMG  80

Query  380  GSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEP  559
            G + +KARVIQTLLFVAGINTLLQ   GTRLPAV+GGS+ +V+P + II  S    I++P
Sbjct  81   GGNEEKARVIQTLLFVAGINTLLQTFVGTRLPAVIGGSYTFVVPTISIILASRYSNIADP  140

Query  560  HIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            H +F + MR  QGALIVAS++QIILG+S +W   +R+ S
Sbjct  141  HEKFKRIMRGTQGALIVASALQIILGFSGLWRNVARYLS  179



>ref|XP_007225743.1| hypothetical protein PRUPE_ppa003778mg [Prunus persica]
 gb|EMJ26942.1| hypothetical protein PRUPE_ppa003778mg [Prunus persica]
Length=549

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 117/168 (70%), Gaps = 3/168 (2%)
 Frame = +2

Query  182  VLGDPPPSPMAMAEIAHP---PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMI  352
            VL  PP S M +     P   P EQL  L++CI SNP WPET LLAFQ+YI++LG+  +I
Sbjct  15   VLVAPPRSQMPLGAARGPIWTPTEQLHQLQFCIHSNPSWPETFLLAFQHYIVMLGSIVII  74

Query  353  PTLLVPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISD  532
             +  VP MGG  GDKARVIQT+LF+A INTLLQ + GTRLP V+  SFA+ +P++ II+D
Sbjct  75   ASTFVPRMGGDHGDKARVIQTMLFMAAINTLLQTILGTRLPTVMTASFAFTLPVLSIIND  134

Query  533  SSLQRISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             S +     H RF  TMR IQG+LIV+S + I +G+S+ WG F+RFFS
Sbjct  135  YSDRTFRSEHERFEVTMRTIQGSLIVSSFVNIFIGFSKAWGNFTRFFS  182



>ref|XP_002452570.1| hypothetical protein SORBIDRAFT_04g028300 [Sorghum bicolor]
 gb|EES05546.1| hypothetical protein SORBIDRAFT_04g028300 [Sorghum bicolor]
Length=537

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            HP  +QL  + YCI S PPWPE +LL FQ+Y+++LGTS +IPT LVP MGG++ DKA VI
Sbjct  22   HPVKDQLPGVSYCITSPPPWPEAVLLGFQHYLVMLGTSVIIPTALVPQMGGNNEDKAVVI  81

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            QTLLFVAGINTLLQ+ FGTRLPAVVGGS+ +V+P + II          PHI+F++ MR 
Sbjct  82   QTLLFVAGINTLLQSFFGTRLPAVVGGSYTFVLPTISIILAGRYANEPNPHIKFLRIMRG  141

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
             QGALIVAS++QII+G+S +W   +R+ S
Sbjct  142  TQGALIVASALQIIVGFSGLWRNVARYLS  170



>ref|XP_008220714.1| PREDICTED: nucleobase-ascorbate transporter 3 isoform X2 [Prunus 
mume]
Length=549

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 117/168 (70%), Gaps = 3/168 (2%)
 Frame = +2

Query  182  VLGDPPPSPMAMAEIAHP---PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMI  352
            VL  PP S M +     P   P EQL  L++CI SNP WPET LLAFQ+YI++LG+  +I
Sbjct  15   VLVAPPRSQMPLGAARGPIWTPTEQLHQLQFCIHSNPSWPETFLLAFQHYIVMLGSIVII  74

Query  353  PTLLVPLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISD  532
             +  VP MGG  GDKARVIQT+LF+A INTLLQ + GTRLP V+  SFA+ +P++ II+D
Sbjct  75   ASTFVPRMGGDHGDKARVIQTMLFMAAINTLLQTILGTRLPTVMTASFAFTLPVLSIIND  134

Query  533  SSLQRISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             S +     H RF  TMR IQG+LIV+S + I +G+S+ WG F+RFFS
Sbjct  135  YSDRTFRSEHERFEVTMRTIQGSLIVSSFVNIFIGFSKAWGNFTRFFS  182



>gb|KJB53225.1| hypothetical protein B456_008G297500 [Gossypium raimondii]
Length=473

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/149 (59%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            HPP EQL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT LVP MGG + +KA+VI
Sbjct  10   HPPKEQLPNISYCITSPPPWPEAILLGFQHYLVMLGTTVIIPTSLVPQMGGGNEEKAKVI  69

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            QTLLFVAG+NTLLQ+LFG+RLPAV+GGS+ +V   + II        S+P  RF + MRA
Sbjct  70   QTLLFVAGLNTLLQSLFGSRLPAVIGGSYTFVPTTISIILAGRFSDSSDPIERFKRIMRA  129

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
             QGALIVAS++QI+LG+S +W   +RF S
Sbjct  130  TQGALIVASTLQIVLGFSGLWRNVARFLS  158



>gb|KJB63780.1| hypothetical protein B456_010G016200 [Gossypium raimondii]
Length=524

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQL  L+YCI SNP WP+ +LLAFQ++I+ LGT+ +I + +VP MGG+ GDKARVIQ 
Sbjct  38   PAEQLHQLQYCIHSNPSWPQALLLAFQHFIVNLGTTVLIASTMVPRMGGNHGDKARVIQV  97

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++GINTLLQ L G+RLP V+G SFAY +P++ II+D + +     H RF++ +R IQ
Sbjct  98   LLFMSGINTLLQTLIGSRLPTVMGVSFAYTLPLLSIINDYTDEAFGTEHDRFVRGIRTIQ  157

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIVAS + IILGYS+ WG  +RFF+
Sbjct  158  GSLIVASFVNIILGYSRAWGELTRFFT  184



>ref|XP_011087158.1| PREDICTED: nucleobase-ascorbate transporter 6 [Sesamum indicum]
 ref|XP_011087159.1| PREDICTED: nucleobase-ascorbate transporter 6 [Sesamum indicum]
 ref|XP_011087161.1| PREDICTED: nucleobase-ascorbate transporter 6 [Sesamum indicum]
 ref|XP_011087162.1| PREDICTED: nucleobase-ascorbate transporter 6 [Sesamum indicum]
Length=531

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 94/165 (57%), Positives = 119/165 (72%), Gaps = 5/165 (3%)
 Frame = +2

Query  188  GDPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLV  367
            G   P+P A     HPP +QL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT LV
Sbjct  3    GGGAPAPKADEPAPHPPKDQLPNVSYCITSPPPWPEAILLGFQHYLVMLGTTVIIPTALV  62

Query  368  PLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQR  547
            P MGG + +KA+VIQTLLFVAG+NTLLQ  FGTRLPAV+GGS+ +V P + II      R
Sbjct  63   PQMGGGNEEKAKVIQTLLFVAGLNTLLQTWFGTRLPAVIGGSYTFVAPTISIILSG---R  119

Query  548  ISEPH--IRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
             S+P    RF + MRA QGALIVAS+IQI+LG+S +W   +RF S
Sbjct  120  WSDPDPVSRFKKIMRATQGALIVASTIQIVLGFSGLWRNVARFLS  164



>gb|KHN48615.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=533

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 116/163 (71%), Gaps = 0/163 (0%)
 Frame = +2

Query  188  GDPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLV  367
            G   P+P       HPP +QL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT LV
Sbjct  4    GGGAPAPKIDEPQPHPPKDQLPNVSYCITSPPPWPEAILLGFQHYLVMLGTTVLIPTALV  63

Query  368  PLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQR  547
            P MGG + +KA+VIQTLLFVAGINTLLQ LFGTRLPAV+GGS+ YV   + II       
Sbjct  64   PQMGGGNEEKAKVIQTLLFVAGINTLLQTLFGTRLPAVIGGSYTYVATTISIILSGRFSD  123

Query  548  ISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
              +P  +F + MRA QGALIVAS++QI+LG+S +W   +RF S
Sbjct  124  EPDPIEKFKRIMRATQGALIVASTLQIVLGFSGLWRNVARFLS  166



>ref|XP_003549636.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Glycine max]
 ref|XP_006600655.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Glycine max]
 gb|KHN18481.1| Nucleobase-ascorbate transporter 6 [Glycine soja]
Length=533

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 116/163 (71%), Gaps = 0/163 (0%)
 Frame = +2

Query  188  GDPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLV  367
            G   P+P       HPP +QL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT LV
Sbjct  4    GGGAPAPKIDEPQPHPPKDQLPNVSYCITSPPPWPEAILLGFQHYLVMLGTTVLIPTALV  63

Query  368  PLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQR  547
            P MGG + +KA+VIQTLLFVAGINTLLQ LFGTRLPAV+GGS+ YV   + II       
Sbjct  64   PQMGGGNEEKAKVIQTLLFVAGINTLLQTLFGTRLPAVIGGSYTYVATTISIILSGRFSD  123

Query  548  ISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
              +P  +F + MRA QGALIVAS++QI+LG+S +W   +RF S
Sbjct  124  EPDPIEKFKRIMRATQGALIVASTLQIVLGFSGLWRNVARFLS  166



>gb|KJB63781.1| hypothetical protein B456_010G016200 [Gossypium raimondii]
Length=530

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/147 (57%), Positives = 113/147 (77%), Gaps = 0/147 (0%)
 Frame = +2

Query  236  PMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVIQT  415
            P EQL  L+YCI SNP WP+ +LLAFQ++I+ LGT+ +I + +VP MGG+ GDKARVIQ 
Sbjct  38   PAEQLHQLQYCIHSNPSWPQALLLAFQHFIVNLGTTVLIASTMVPRMGGNHGDKARVIQV  97

Query  416  LLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRAIQ  595
            LLF++GINTLLQ L G+RLP V+G SFAY +P++ II+D + +     H RF++ +R IQ
Sbjct  98   LLFMSGINTLLQTLIGSRLPTVMGVSFAYTLPLLSIINDYTDEAFGTEHDRFVRGIRTIQ  157

Query  596  GALIVASSIQIILGYSQVWGLFSRFFS  676
            G+LIVAS + IILGYS+ WG  +RFF+
Sbjct  158  GSLIVASFVNIILGYSRAWGELTRFFT  184



>ref|XP_008779515.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Phoenix dactylifera]
 ref|XP_008779520.1| PREDICTED: nucleobase-ascorbate transporter 6-like [Phoenix dactylifera]
Length=544

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 117/159 (74%), Gaps = 0/159 (0%)
 Frame = +2

Query  200  PSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMG  379
            P+P     + HP  EQL ++ YCI S PP PE +LL FQ+Y+++LGT+ +IPT LVP MG
Sbjct  19   PAPKQDELVPHPVKEQLPNIAYCITSPPPLPEAMLLGFQHYLVMLGTTVIIPTALVPQMG  78

Query  380  GSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEP  559
            G + +KARVIQTLLFVAG+NTLLQ  FGTRLPAVVGGS+ +V+P + II       I++P
Sbjct  79   GGNDEKARVIQTLLFVAGLNTLLQTFFGTRLPAVVGGSYTFVVPTISIILAGRYSGIADP  138

Query  560  HIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
            H +F + MR  QGALIVAS++QIILG+S +W   +R+ S
Sbjct  139  HEKFRRIMRGTQGALIVASTLQIILGFSGLWRNVARYLS  177



>ref|XP_006579556.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X1 
[Glycine max]
 ref|XP_006579557.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Glycine max]
Length=533

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 116/163 (71%), Gaps = 0/163 (0%)
 Frame = +2

Query  188  GDPPPSPMAMAEIAHPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLV  367
            G   P+P       HPP +QL ++ YCI S PPWPE ILL FQ+Y+++LGT+ +IPT LV
Sbjct  4    GGGAPAPKIDEPQPHPPKDQLPNVSYCITSPPPWPEAILLGFQHYLVMLGTTVLIPTALV  63

Query  368  PLMGGSDGDKARVIQTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQR  547
            P MGG + +KA+VIQTLLFVAGINTLLQ LFGTRLPAV+GGS+ YV   + II       
Sbjct  64   PQMGGGNEEKAKVIQTLLFVAGINTLLQTLFGTRLPAVIGGSYTYVATTISIILSGRFSD  123

Query  548  ISEPHIRFIQTMRAIQGALIVASSIQIILGYSQVWGLFSRFFS  676
              +P  +F + MRA QGALIVAS++QI+LG+S +W   +RF S
Sbjct  124  EPDPIEKFKRIMRATQGALIVASTLQIVLGFSGLWRNVARFLS  166



>ref|XP_009399656.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
 ref|XP_009399657.1| PREDICTED: nucleobase-ascorbate transporter 6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=536

 Score =   182 bits (462),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = +2

Query  230  HPPMEQLQDLEYCIDSNPPWPETILLAFQNYILVLGTSAMIPTLLVPLMGGSDGDKARVI  409
            HP  +QL ++ YCI S PPWPE ILL FQ+++++LGT+ +IPT LVP MGG + +KARV+
Sbjct  21   HPVKDQLPNVSYCITSPPPWPEAILLGFQHFLVMLGTTVIIPTALVPQMGGGNDEKARVV  80

Query  410  QTLLFVAGINTLLQALFGTRLPAVVGGSFAYVIPIVYIISDSSLQRISEPHIRFIQTMRA  589
            QTLLFVAGINTL Q LFGTRLPAV+GGS+ +V P V I+       I +PH +F++ MR 
Sbjct  81   QTLLFVAGINTLFQTLFGTRLPAVIGGSYTFVAPTVSIVLAGRYSDIVDPHEKFLRVMRG  140

Query  590  IQGALIVASSIQIILGYSQVWGLFSRFFS  676
             QGALIVAS++QII+G+S +W   +RF S
Sbjct  141  TQGALIVASTLQIIVGFSGLWRNVARFLS  169



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1133412046677