BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9366

Length=666
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009802964.1|  PREDICTED: probable aspartyl aminopeptidase        286   6e-90   Nicotiana sylvestris
ref|XP_006361458.1|  PREDICTED: probable aspartyl aminopeptidase-...    285   1e-89   Solanum tuberosum [potatoes]
ref|XP_009596186.1|  PREDICTED: probable aspartyl aminopeptidase        281   7e-88   Nicotiana tomentosiformis
ref|XP_004249975.1|  PREDICTED: probable aspartyl aminopeptidase        280   2e-87   Solanum lycopersicum
ref|XP_011076919.1|  PREDICTED: probable aspartyl aminopeptidase ...    278   1e-86   Sesamum indicum [beniseed]
ref|XP_008232012.1|  PREDICTED: probable aspartyl aminopeptidase        275   1e-85   Prunus mume [ume]
gb|EYU19780.1|  hypothetical protein MIMGU_mgv1a004147mg                274   4e-85   Erythranthe guttata [common monkey flower]
ref|XP_010088778.1|  Aspartyl aminopeptidase                            270   1e-83   Morus notabilis
ref|XP_009336015.1|  PREDICTED: probable aspartyl aminopeptidase ...    268   4e-83   Pyrus x bretschneideri [bai li]
emb|CAN73045.1|  hypothetical protein VITISV_008667                     259   4e-83   Vitis vinifera
ref|XP_009336013.1|  PREDICTED: probable aspartyl aminopeptidase ...    268   5e-83   Pyrus x bretschneideri [bai li]
ref|XP_008347038.1|  PREDICTED: probable aspartyl aminopeptidase        265   5e-82   
ref|XP_009356123.1|  PREDICTED: probable aspartyl aminopeptidase        265   7e-82   Pyrus x bretschneideri [bai li]
ref|XP_010244537.1|  PREDICTED: probable aspartyl aminopeptidase ...    262   9e-82   Nelumbo nucifera [Indian lotus]
ref|XP_010244532.1|  PREDICTED: probable aspartyl aminopeptidase ...    264   1e-81   Nelumbo nucifera [Indian lotus]
ref|XP_002266672.1|  PREDICTED: probable aspartyl aminopeptidase ...    263   6e-81   Vitis vinifera
emb|CDO99897.1|  unnamed protein product                                261   4e-80   Coffea canephora [robusta coffee]
ref|XP_002524995.1|  Aspartyl aminopeptidase, putative                  260   7e-80   Ricinus communis
ref|XP_012074668.1|  PREDICTED: probable aspartyl aminopeptidase ...    258   4e-79   Jatropha curcas
gb|KHG01889.1|  Aspartyl aminopeptidase                                 258   5e-79   Gossypium arboreum [tree cotton]
gb|KJB78672.1|  hypothetical protein B456_013G012600                    256   1e-78   Gossypium raimondii
ref|XP_007213437.1|  hypothetical protein PRUPE_ppa025466mg             254   4e-78   
ref|XP_011076920.1|  PREDICTED: probable aspartyl aminopeptidase ...    254   7e-78   
ref|XP_010907134.1|  PREDICTED: probable aspartyl aminopeptidase ...    251   2e-77   
gb|KCW51473.1|  hypothetical protein EUGRSUZ_J00993                     252   2e-77   Eucalyptus grandis [rose gum]
ref|XP_002311031.2|  hypothetical protein POPTR_0008s02250g             253   2e-77   
gb|KCW51472.1|  hypothetical protein EUGRSUZ_J00993                     252   2e-77   Eucalyptus grandis [rose gum]
ref|XP_010543610.1|  PREDICTED: probable aspartyl aminopeptidase        253   3e-77   Tarenaya hassleriana [spider flower]
ref|XP_002311016.2|  hypothetical protein POPTR_0008s02250g             253   4e-77   
ref|XP_007010330.1|  Zn-dependent exopeptidases superfamily prote...    251   4e-77   
ref|XP_010032079.1|  PREDICTED: probable aspartyl aminopeptidase ...    252   5e-77   Eucalyptus grandis [rose gum]
ref|XP_007010329.1|  Zn-dependent exopeptidases superfamily prote...    252   7e-77   
ref|XP_008788174.1|  PREDICTED: probable aspartyl aminopeptidase        251   1e-76   Phoenix dactylifera
ref|XP_010907133.1|  PREDICTED: probable aspartyl aminopeptidase ...    251   2e-76   Elaeis guineensis
ref|XP_009390025.1|  PREDICTED: probable aspartyl aminopeptidase        251   2e-76   
ref|XP_008446766.1|  PREDICTED: probable aspartyl aminopeptidase        250   3e-76   Cucumis melo [Oriental melon]
ref|XP_010694702.1|  PREDICTED: probable aspartyl aminopeptidase ...    250   3e-76   
ref|XP_010452373.1|  PREDICTED: probable aspartyl aminopeptidase        250   4e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010694701.1|  PREDICTED: probable aspartyl aminopeptidase ...    250   4e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010694703.1|  PREDICTED: probable aspartyl aminopeptidase ...    249   4e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006398926.1|  hypothetical protein EUTSA_v10013255mg             250   5e-76   Eutrema salsugineum [saltwater cress]
ref|XP_011032849.1|  PREDICTED: probable aspartyl aminopeptidase        250   5e-76   Populus euphratica
ref|XP_010490993.1|  PREDICTED: probable aspartyl aminopeptidase        249   8e-76   Camelina sativa [gold-of-pleasure]
ref|XP_011655834.1|  PREDICTED: probable aspartyl aminopeptidase ...    249   2e-75   Cucumis sativus [cucumbers]
ref|XP_010423546.1|  PREDICTED: probable aspartyl aminopeptidase        249   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_006287486.1|  hypothetical protein CARUB_v10000697mg             248   3e-75   Capsella rubella
ref|NP_196091.1|  Zn-dependent exopeptidases superfamily protein        247   6e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004150844.2|  PREDICTED: probable aspartyl aminopeptidase ...    247   6e-75   Cucumis sativus [cucumbers]
ref|XP_009122574.1|  PREDICTED: probable aspartyl aminopeptidase        246   1e-74   Brassica rapa
dbj|BAC43404.1|  putative aspartyl aminopeptidase                       246   2e-74   Arabidopsis thaliana [mouse-ear cress]
emb|CDY44874.1|  BnaC09g50740D                                          245   3e-74   Brassica napus [oilseed rape]
ref|XP_006485213.1|  PREDICTED: probable aspartyl aminopeptidase-...    244   6e-74   Citrus sinensis [apfelsine]
gb|KFK24913.1|  hypothetical protein AALP_AA8G041200                    244   7e-74   Arabis alpina [alpine rockcress]
gb|KDO42029.1|  hypothetical protein CISIN_1g009941mg                   244   7e-74   Citrus sinensis [apfelsine]
ref|XP_006436621.1|  hypothetical protein CICLE_v10031166mg             244   8e-74   
ref|XP_004496198.1|  PREDICTED: probable aspartyl aminopeptidase-...    242   5e-73   
gb|AES62027.2|  aspartyl aminopeptidase-like protein, putative          240   2e-72   Medicago truncatula
emb|CDX70207.1|  BnaA10g25560D                                          240   2e-72   
ref|XP_006645339.1|  PREDICTED: probable aspartyl aminopeptidase-...    239   5e-72   Oryza brachyantha
gb|EEC72239.1|  hypothetical protein OsI_05355                          238   6e-72   Oryza sativa Indica Group [Indian rice]
ref|NP_001045513.1|  Os01g0967900                                       239   6e-72   
ref|XP_002873165.1|  hypothetical protein ARALYDRAFT_487250             238   1e-71   
ref|XP_007143804.1|  hypothetical protein PHAVU_007G103100g             237   5e-71   Phaseolus vulgaris [French bean]
gb|ERN13067.1|  hypothetical protein AMTR_s00040p00143220               237   8e-71   Amborella trichopoda
ref|XP_003565148.1|  PREDICTED: probable aspartyl aminopeptidase        236   8e-71   Brachypodium distachyon [annual false brome]
gb|EPS58587.1|  aspartyl aminopeptidase                                 233   4e-70   Genlisea aurea
dbj|BAJ86698.1|  predicted protein                                      231   8e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002457006.1|  hypothetical protein SORBIDRAFT_03g047100          231   1e-68   Sorghum bicolor [broomcorn]
ref|XP_003556268.2|  PREDICTED: probable aspartyl aminopeptidase-...    231   1e-68   Glycine max [soybeans]
gb|KHN00906.1|  Aspartyl aminopeptidase                                 230   1e-68   Glycine soja [wild soybean]
ref|XP_011625955.1|  PREDICTED: probable aspartyl aminopeptidase        229   2e-68   
ref|XP_004971394.1|  PREDICTED: probable aspartyl aminopeptidase-...    229   4e-68   Setaria italica
gb|KHN37829.1|  Aspartyl aminopeptidase                                 227   2e-67   Glycine soja [wild soybean]
ref|XP_003591776.1|  Aspartyl aminopeptidase                            227   4e-67   
ref|XP_004971395.1|  PREDICTED: probable aspartyl aminopeptidase-...    222   3e-65   
ref|XP_001751765.1|  predicted protein                                  213   2e-62   
ref|XP_003055398.1|  predicted protein                                  199   3e-57   Micromonas pusilla CCMP1545
ref|XP_002975004.1|  hypothetical protein SELMODRAFT_442726             199   4e-57   
gb|KHN31910.1|  Aspartyl aminopeptidase                                 192   3e-55   Glycine soja [wild soybean]
ref|XP_003523136.1|  PREDICTED: probable aspartyl aminopeptidase-...    192   2e-54   Glycine max [soybeans]
ref|XP_002507546.1|  aspartyl aminopeptidase                            192   3e-54   Micromonas commoda
ref|XP_003526970.1|  PREDICTED: probable aspartyl aminopeptidase-...    191   4e-54   Glycine max [soybeans]
ref|XP_003578741.1|  PREDICTED: probable aspartyl aminopeptidase        191   7e-54   Brachypodium distachyon [annual false brome]
ref|XP_006664453.1|  PREDICTED: probable aspartyl aminopeptidase-...    190   1e-53   Oryza brachyantha
ref|XP_004960722.1|  PREDICTED: probable aspartyl aminopeptidase-...    190   1e-53   Setaria italica
ref|XP_010674696.1|  PREDICTED: probable aspartyl aminopeptidase        190   2e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008673044.1|  PREDICTED: hypothetical protein isoform X1         189   2e-53   Zea mays [maize]
ref|XP_002949870.1|  hypothetical protein VOLCADRAFT_104511             185   3e-53   Volvox carteri f. nagariensis
ref|XP_009379936.1|  PREDICTED: probable aspartyl aminopeptidase        188   5e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002458215.1|  hypothetical protein SORBIDRAFT_03g029130          188   6e-53   Sorghum bicolor [broomcorn]
ref|XP_006476998.1|  PREDICTED: probable aspartyl aminopeptidase-...    188   8e-53   Citrus sinensis [apfelsine]
ref|XP_002967289.1|  hypothetical protein SELMODRAFT_86972              188   1e-52   
ref|XP_002960428.1|  hypothetical protein SELMODRAFT_164111             188   1e-52   
ref|XP_007209960.1|  hypothetical protein PRUPE_ppa004869mg             187   2e-52   Prunus persica
ref|XP_004236341.1|  PREDICTED: probable aspartyl aminopeptidase        187   2e-52   Solanum lycopersicum
gb|ERM93848.1|  hypothetical protein AMTR_s00138p00076250               180   2e-52   Amborella trichopoda
ref|XP_002950223.1|  hypothetical protein VOLCADRAFT_104613             186   2e-52   Volvox carteri f. nagariensis
ref|XP_009624334.1|  PREDICTED: probable aspartyl aminopeptidase        187   2e-52   Nicotiana tomentosiformis
ref|XP_007137936.1|  hypothetical protein PHAVU_009G167900g             187   2e-52   Phaseolus vulgaris [French bean]
ref|XP_006440072.1|  hypothetical protein CICLE_v10019750mg             187   2e-52   Citrus clementina [clementine]
ref|XP_009404266.1|  PREDICTED: probable aspartyl aminopeptidase        186   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009346502.1|  PREDICTED: probable aspartyl aminopeptidase        187   3e-52   Pyrus x bretschneideri [bai li]
ref|XP_003602076.1|  Aspartyl aminopeptidase                            186   3e-52   Medicago truncatula
gb|KFK26680.1|  hypothetical protein AALP_AA8G278900                    186   3e-52   Arabis alpina [alpine rockcress]
ref|XP_006351481.1|  PREDICTED: probable aspartyl aminopeptidase-...    186   6e-52   Solanum tuberosum [potatoes]
ref|XP_004138058.2|  PREDICTED: probable aspartyl aminopeptidase        186   7e-52   Cucumis sativus [cucumbers]
ref|XP_008807558.1|  PREDICTED: probable aspartyl aminopeptidase ...    185   8e-52   Phoenix dactylifera
ref|XP_009790447.1|  PREDICTED: probable aspartyl aminopeptidase        185   8e-52   Nicotiana sylvestris
ref|XP_008807556.1|  PREDICTED: probable aspartyl aminopeptidase ...    185   1e-51   
ref|XP_009336570.1|  PREDICTED: probable aspartyl aminopeptidase        185   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_008374264.1|  PREDICTED: probable aspartyl aminopeptidase        185   1e-51   Malus domestica [apple tree]
ref|XP_010248918.1|  PREDICTED: probable aspartyl aminopeptidase ...    185   1e-51   Nelumbo nucifera [Indian lotus]
gb|ABR17053.1|  unknown                                                 185   2e-51   Picea sitchensis
ref|XP_010248919.1|  PREDICTED: probable aspartyl aminopeptidase ...    184   2e-51   Nelumbo nucifera [Indian lotus]
ref|XP_009359462.1|  PREDICTED: probable aspartyl aminopeptidase        184   2e-51   Pyrus x bretschneideri [bai li]
emb|CDP05422.1|  unnamed protein product                                184   2e-51   Coffea canephora [robusta coffee]
gb|AFK46082.1|  unknown                                                 184   2e-51   Lotus japonicus
ref|NP_001066463.1|  Os12g0236500                                       184   2e-51   
gb|KJB80475.1|  hypothetical protein B456_013G099300                    175   2e-51   Gossypium raimondii
ref|XP_008239439.1|  PREDICTED: probable aspartyl aminopeptidase        184   3e-51   Prunus mume [ume]
ref|XP_002866374.1|  hypothetical protein ARALYDRAFT_332278             184   3e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_010536640.1|  PREDICTED: probable aspartyl aminopeptidase        184   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_004500663.1|  PREDICTED: probable aspartyl aminopeptidase-...    184   3e-51   Cicer arietinum [garbanzo]
gb|EPS62030.1|  aspartyl aminopeptidase-like protein                    183   4e-51   Genlisea aurea
ref|XP_002321687.1|  aspartyl aminopeptidase family protein             183   4e-51   Populus trichocarpa [western balsam poplar]
ref|XP_011024060.1|  PREDICTED: probable aspartyl aminopeptidase        183   6e-51   Populus euphratica
ref|XP_007037930.1|  Zn-dependent exopeptidases superfamily protein     184   7e-51   
ref|XP_005648131.1|  peptidase M18, aminopeptidase I                    182   7e-51   Coccomyxa subellipsoidea C-169
ref|XP_011620329.1|  PREDICTED: probable aspartyl aminopeptidase        182   2e-50   Amborella trichopoda
ref|XP_006280394.1|  hypothetical protein CARUB_v10026321mg             181   2e-50   Capsella rubella
ref|XP_010930126.1|  PREDICTED: probable aspartyl aminopeptidase        181   2e-50   Elaeis guineensis
ref|XP_010443807.1|  PREDICTED: probable aspartyl aminopeptidase        181   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_001784619.1|  predicted protein                                  181   3e-50   
gb|KDO42027.1|  hypothetical protein CISIN_1g009941mg                   181   3e-50   Citrus sinensis [apfelsine]
ref|XP_002318119.2|  aspartyl aminopeptidase family protein             181   3e-50   
ref|XP_006436620.1|  hypothetical protein CICLE_v10031166mg             182   3e-50   
ref|XP_002283475.1|  PREDICTED: probable aspartyl aminopeptidase        181   3e-50   Vitis vinifera
ref|XP_008464465.1|  PREDICTED: probable aspartyl aminopeptidase ...    181   4e-50   Cucumis melo [Oriental melon]
ref|XP_008464464.1|  PREDICTED: probable aspartyl aminopeptidase ...    181   4e-50   Cucumis melo [Oriental melon]
ref|XP_010483659.1|  PREDICTED: probable aspartyl aminopeptidase        181   4e-50   Camelina sativa [gold-of-pleasure]
ref|XP_004138060.2|  PREDICTED: probable aspartyl aminopeptidase        181   5e-50   Cucumis sativus [cucumbers]
ref|XP_010456062.1|  PREDICTED: probable aspartyl aminopeptidase        180   5e-50   Camelina sativa [gold-of-pleasure]
ref|NP_200824.1|  zn-dependent exopeptidases superfamily protein        180   6e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009134060.1|  PREDICTED: probable aspartyl aminopeptidase        180   6e-50   Brassica rapa
gb|AAM61631.1|  aspartyl aminopeptidase-like protein                    180   6e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDX83160.1|  BnaA03g23460D                                          180   7e-50   
ref|XP_001690598.1|  aspartyl aminopeptidase-like protein               181   7e-50   Chlamydomonas reinhardtii
ref|XP_001773362.1|  predicted protein                                  180   7e-50   
ref|XP_008367478.1|  PREDICTED: probable aspartyl aminopeptidase        180   7e-50   
gb|KHF99832.1|  Aspartyl aminopeptidase                                 179   8e-50   Gossypium arboreum [tree cotton]
gb|KJB27157.1|  hypothetical protein B456_004G282900                    179   9e-50   Gossypium raimondii
gb|KJB27156.1|  hypothetical protein B456_004G282900                    179   1e-49   Gossypium raimondii
gb|KJB27155.1|  hypothetical protein B456_004G282900                    179   1e-49   Gossypium raimondii
ref|XP_011044185.1|  PREDICTED: probable aspartyl aminopeptidase        179   1e-49   Populus euphratica
emb|CDY34036.1|  BnaC03g27790D                                          179   1e-49   Brassica napus [oilseed rape]
gb|KCW83185.1|  hypothetical protein EUGRSUZ_B00132                     176   4e-49   Eucalyptus grandis [rose gum]
ref|XP_012079871.1|  PREDICTED: probable aspartyl aminopeptidase        178   4e-49   Jatropha curcas
gb|EMS55846.1|  Aspartyl aminopeptidase                                 179   7e-49   Triticum urartu
ref|XP_011083884.1|  PREDICTED: probable aspartyl aminopeptidase        177   1e-48   Sesamum indicum [beniseed]
ref|XP_011396821.1|  Aspartyl aminopeptidase                            177   1e-48   Auxenochlorella protothecoides
ref|XP_010026684.1|  PREDICTED: probable aspartyl aminopeptidase        176   1e-48   Eucalyptus grandis [rose gum]
ref|XP_002511215.1|  Aspartyl aminopeptidase, putative                  176   2e-48   
gb|KIY94035.1|  Aminopeptidase I zinc metalloprotease                   175   2e-48   Monoraphidium neglectum
gb|KCW83184.1|  hypothetical protein EUGRSUZ_B00132                     176   2e-48   Eucalyptus grandis [rose gum]
sp|B9RAJ0.2|DNPEP_RICCO  RecName: Full=Probable aspartyl aminopep...    176   3e-48   Ricinus communis
gb|KCW51475.1|  hypothetical protein EUGRSUZ_J00996                     166   3e-48   Eucalyptus grandis [rose gum]
ref|XP_005849269.1|  hypothetical protein CHLNCDRAFT_143544             176   4e-48   Chlorella variabilis
gb|EMT03759.1|  Aspartyl aminopeptidase                                 179   4e-48   
ref|XP_002977420.1|  hypothetical protein SELMODRAFT_176342             174   4e-48   
ref|XP_008392833.1|  PREDICTED: probable aspartyl aminopeptidase        175   7e-48   
gb|EYU43065.1|  hypothetical protein MIMGU_mgv1a005789mg                174   2e-47   Erythranthe guttata [common monkey flower]
ref|XP_002963681.1|  hypothetical protein SELMODRAFT_80579              173   3e-47   
ref|XP_008394651.1|  PREDICTED: aspartyl aminopeptidase isoform X2      164   7e-47   
ref|XP_001756754.1|  predicted protein                                  172   7e-47   
ref|XP_008394645.1|  PREDICTED: aspartyl aminopeptidase isoform X1      164   7e-47   
ref|XP_009025082.1|  hypothetical protein HELRODRAFT_187369             171   1e-46   Helobdella robusta
ref|XP_011463290.1|  PREDICTED: probable aspartyl aminopeptidase        168   1e-45   Fragaria vesca subsp. vesca
ref|XP_010102886.1|  Aspartyl aminopeptidase                            169   1e-45   
ref|XP_003082377.1|  aspartyl aminopeptidase (ISS)                      169   2e-45   
emb|CEF99925.1|  Peptidase M18                                          169   2e-45   Ostreococcus tauri
ref|XP_001420830.1|  predicted protein                                  167   3e-45   Ostreococcus lucimarinus CCE9901
ref|XP_005814088.1|  PREDICTED: aspartyl aminopeptidase-like            166   8e-45   
ref|XP_007575369.1|  PREDICTED: aspartyl aminopeptidase isoform X2      166   2e-44   Poecilia formosa
ref|XP_007575368.1|  PREDICTED: aspartyl aminopeptidase isoform X1      165   2e-44   Poecilia formosa
gb|EIE78284.1|  hypothetical protein RO3G_02988                         165   3e-44   Rhizopus delemar RA 99-880
gb|EFB19842.1|  hypothetical protein PANDA_014251                       163   4e-44   Ailuropoda melanoleuca
ref|XP_004662959.1|  PREDICTED: aspartyl aminopeptidase                 164   4e-44   Jaculus jaculus
ref|XP_007519740.1|  PREDICTED: aspartyl aminopeptidase                 164   5e-44   
gb|ACC64563.1|  aspartyl aminopeptidase (predicted)                     164   6e-44   Rhinolophus ferrumequinum
ref|XP_008323213.1|  PREDICTED: aspartyl aminopeptidase isoform X3      164   7e-44   
ref|XP_008323212.1|  PREDICTED: aspartyl aminopeptidase isoform X2      164   7e-44   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008323211.1|  PREDICTED: aspartyl aminopeptidase isoform X1      164   7e-44   
ref|XP_004325560.1|  PREDICTED: aspartyl aminopeptidase isoform 3       164   9e-44   
ref|XP_004262732.1|  PREDICTED: aspartyl aminopeptidase isoform 2       164   9e-44   Orcinus orca [Orca]
ref|XP_004262731.1|  PREDICTED: aspartyl aminopeptidase isoform 1       164   1e-43   
gb|EPZ34400.1|  Peptidase M18 2 domain-containing protein               162   1e-43   Rozella allomycis CSF55
ref|XP_002592514.1|  hypothetical protein BRAFLDRAFT_69005              163   1e-43   Branchiostoma floridae
ref|XP_004325559.1|  PREDICTED: aspartyl aminopeptidase isoform 2       164   1e-43   
ref|XP_006906751.1|  PREDICTED: aspartyl aminopeptidase                 163   1e-43   Pteropus alecto
gb|KFH62765.1|  aspartyl aminopeptidase                                 161   1e-43   Mortierella verticillata NRRL 6337
ref|XP_007122487.1|  PREDICTED: aspartyl aminopeptidase                 163   1e-43   
ref|XP_005202875.1|  PREDICTED: aspartyl aminopeptidase isoform X5      163   1e-43   Bos taurus [bovine]
ref|XP_004762907.1|  PREDICTED: aspartyl aminopeptidase isoform X6      163   1e-43   Mustela putorius furo [black ferret]
ref|XP_005676645.1|  PREDICTED: aspartyl aminopeptidase isoform X1      163   1e-43   
ref|XP_003784969.1|  PREDICTED: aspartyl aminopeptidase                 163   1e-43   Otolemur garnettii
gb|ELR60782.1|  Aspartyl aminopeptidase                                 163   1e-43   Bos mutus
ref|NP_001039417.1|  aspartyl aminopeptidase                            163   1e-43   Bos taurus [bovine]
ref|XP_004005000.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    163   1e-43   
ref|XP_005676646.1|  PREDICTED: aspartyl aminopeptidase isoform X2      163   1e-43   
ref|XP_010765443.1|  PREDICTED: aspartyl aminopeptidase isoform X1      159   1e-43   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010765444.1|  PREDICTED: aspartyl aminopeptidase isoform X2      159   2e-43   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_004762903.1|  PREDICTED: aspartyl aminopeptidase isoform X2      163   2e-43   Mustela putorius furo [black ferret]
ref|XP_004325558.1|  PREDICTED: aspartyl aminopeptidase isoform 1       163   2e-43   
ref|XP_006935664.1|  PREDICTED: aspartyl aminopeptidase isoform X2      163   2e-43   Felis catus [cat]
ref|XP_006739743.1|  PREDICTED: aspartyl aminopeptidase                 163   2e-43   Leptonychotes weddellii
ref|XP_007445869.1|  PREDICTED: aspartyl aminopeptidase                 163   2e-43   Lipotes vexillifer [baiji]
gb|ELK17177.1|  Aspartyl aminopeptidase                                 163   2e-43   Pteropus alecto
ref|XP_006935665.1|  PREDICTED: aspartyl aminopeptidase isoform X3      163   2e-43   Felis catus [cat]
ref|XP_003446617.1|  PREDICTED: aspartyl aminopeptidase-like isof...    163   2e-43   Oreochromis niloticus
ref|XP_005452349.1|  PREDICTED: aspartyl aminopeptidase-like isof...    162   2e-43   Oreochromis niloticus
ref|XP_004402809.1|  PREDICTED: aspartyl aminopeptidase isoform 2       163   2e-43   Odobenus rosmarus divergens
ref|XP_004563350.1|  PREDICTED: aspartyl aminopeptidase-like isof...    162   2e-43   Maylandia zebra
ref|XP_004563349.1|  PREDICTED: aspartyl aminopeptidase-like isof...    163   2e-43   Maylandia zebra
ref|XP_002712541.1|  PREDICTED: aspartyl aminopeptidase isoform X2      162   2e-43   Oryctolagus cuniculus [domestic rabbit]
pdb|3VAR|A  Chain A, Crystal Structure Of Dnpep, Znzn Form              163   2e-43   Bos taurus [bovine]
ref|XP_010800626.1|  PREDICTED: aspartyl aminopeptidase isoform X4      163   2e-43   
ref|XP_010800625.1|  PREDICTED: aspartyl aminopeptidase isoform X3      163   2e-43   
gb|EWM25484.1|  aspartyl aminopeptidase                                 164   2e-43   Nannochloropsis gaditana
ref|XP_006402123.1|  hypothetical protein EUTSA_v10015798mg             162   2e-43   
ref|XP_005956749.1|  PREDICTED: aspartyl aminopeptidase isoform X2      163   2e-43   Pantholops hodgsonii [Tibetan antelope]
ref|XP_006890316.1|  PREDICTED: aspartyl aminopeptidase                 162   2e-43   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005640751.1|  PREDICTED: aspartyl aminopeptidase isoform X4      163   2e-43   
ref|XP_004402808.1|  PREDICTED: aspartyl aminopeptidase isoform 1       163   2e-43   Odobenus rosmarus divergens
ref|XP_004427652.1|  PREDICTED: aspartyl aminopeptidase                 163   2e-43   
ref|XP_004762902.1|  PREDICTED: aspartyl aminopeptidase isoform X1      163   3e-43   Mustela putorius furo [black ferret]
ref|XP_006935663.1|  PREDICTED: aspartyl aminopeptidase isoform X1      163   3e-43   Felis catus [cat]
ref|XP_005202874.1|  PREDICTED: aspartyl aminopeptidase isoform X2      163   3e-43   
ref|XP_005956748.1|  PREDICTED: aspartyl aminopeptidase isoform X1      163   3e-43   Pantholops hodgsonii [Tibetan antelope]
ref|XP_008257444.1|  PREDICTED: aspartyl aminopeptidase isoform X1      162   3e-43   Oryctolagus cuniculus [domestic rabbit]
ref|XP_007956515.1|  PREDICTED: aspartyl aminopeptidase                 162   3e-43   Orycteropus afer afer
ref|XP_006792993.1|  PREDICTED: aspartyl aminopeptidase-like            162   4e-43   Neolamprologus brichardi [lyretail cichlid]
ref|XP_010748612.1|  PREDICTED: aspartyl aminopeptidase isoform X1      162   4e-43   
ref|XP_011230094.1|  PREDICTED: aspartyl aminopeptidase                 162   4e-43   
ref|XP_004876190.1|  PREDICTED: aspartyl aminopeptidase isoform X2      162   4e-43   
ref|XP_010748613.1|  PREDICTED: aspartyl aminopeptidase isoform X2      162   4e-43   
dbj|BAB13923.1|  unnamed protein product                                157   5e-43   Homo sapiens [man]
ref|XP_004576859.1|  PREDICTED: aspartyl aminopeptidase                 161   5e-43   Ochotona princeps [southern American pika]
ref|XP_011404738.1|  PREDICTED: aspartyl aminopeptidase-like            161   5e-43   
gb|ELK30546.1|  Aspartyl aminopeptidase                                 161   5e-43   Myotis davidii
ref|XP_006763438.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    161   5e-43   Myotis davidii
gb|EHA97554.1|  Aspartyl aminopeptidase                                 162   6e-43   Heterocephalus glaber [naked mole rat]
dbj|BAH13808.1|  unnamed protein product                                157   6e-43   Homo sapiens [man]
ref|XP_005001095.1|  PREDICTED: aspartyl aminopeptidase isoform X2      161   7e-43   Cavia porcellus [guinea pig]
ref|XP_006082618.1|  PREDICTED: aspartyl aminopeptidase isoform X1      161   7e-43   Myotis lucifugus
ref|XP_005883531.1|  PREDICTED: aspartyl aminopeptidase isoform X1      161   7e-43   Myotis brandtii
ref|XP_006082619.1|  PREDICTED: aspartyl aminopeptidase isoform X2      161   7e-43   
ref|XP_008143354.1|  PREDICTED: aspartyl aminopeptidase                 161   7e-43   Eptesicus fuscus
ref|XP_005610687.1|  PREDICTED: aspartyl aminopeptidase isoform X4      161   7e-43   Equus caballus [domestic horse]
ref|XP_005883532.1|  PREDICTED: aspartyl aminopeptidase isoform X2      161   7e-43   Myotis brandtii
ref|XP_006082620.1|  PREDICTED: aspartyl aminopeptidase isoform X3      161   7e-43   
ref|XP_005610686.1|  PREDICTED: aspartyl aminopeptidase isoform X3      161   7e-43   Equus caballus [domestic horse]
ref|XP_003464074.1|  PREDICTED: aspartyl aminopeptidase isoform X1      161   9e-43   Cavia porcellus [guinea pig]
ref|XP_004876189.1|  PREDICTED: aspartyl aminopeptidase isoform X1      161   9e-43   
ref|NP_001172115.1|  aspartyl aminopeptidase                            161   9e-43   Sus scrofa [pigs]
ref|XP_001492028.3|  PREDICTED: aspartyl aminopeptidase isoform X1      161   9e-43   
ref|XP_004638242.1|  PREDICTED: aspartyl aminopeptidase                 160   1e-42   
ref|XP_008823997.1|  PREDICTED: aspartyl aminopeptidase isoform X2      160   1e-42   Nannospalax galili
ref|XP_008823998.1|  PREDICTED: aspartyl aminopeptidase isoform X3      160   1e-42   Nannospalax galili
ref|XP_008823992.1|  PREDICTED: aspartyl aminopeptidase isoform X1      160   1e-42   Nannospalax galili
gb|EDL75433.1|  aspartyl aminopeptidase, isoform CRA_f                  152   1e-42   Rattus norvegicus [brown rat]
gb|EDL75431.1|  aspartyl aminopeptidase, isoform CRA_e                  152   1e-42   Rattus norvegicus [brown rat]
ref|XP_008578710.1|  PREDICTED: aspartyl aminopeptidase                 160   1e-42   Galeopterus variegatus [Malayan flying lemur]
ref|XP_005610685.1|  PREDICTED: aspartyl aminopeptidase isoform X2      161   1e-42   Equus caballus [domestic horse]
gb|EDL75429.1|  aspartyl aminopeptidase, isoform CRA_d                  152   1e-42   Rattus norvegicus [brown rat]
emb|CEG81490.1|  Putative Aspartyl aminopeptidase                       160   1e-42   Rhizopus microsporus
emb|CEP14293.1|  hypothetical protein                                   160   1e-42   Parasitella parasitica
ref|XP_010859552.1|  PREDICTED: aspartyl aminopeptidase isoform X2      159   2e-42   Bison bison bison
dbj|GAN09714.1|  aspartyl aminopeptidase                                160   2e-42   Mucor ambiguus
ref|XP_010947125.1|  PREDICTED: aspartyl aminopeptidase                 160   2e-42   Camelus bactrianus [camel]
ref|XP_006207284.1|  PREDICTED: aspartyl aminopeptidase isoform X2      160   2e-42   
ref|XP_010986678.1|  PREDICTED: aspartyl aminopeptidase                 160   2e-42   
ref|XP_005330568.1|  PREDICTED: aspartyl aminopeptidase                 160   2e-42   
ref|XP_006186935.1|  PREDICTED: aspartyl aminopeptidase                 160   3e-42   
ref|XP_004701682.1|  PREDICTED: aspartyl aminopeptidase isoform X1      160   3e-42   
ref|XP_010859551.1|  PREDICTED: aspartyl aminopeptidase isoform X1      159   3e-42   
ref|XP_006207283.1|  PREDICTED: aspartyl aminopeptidase isoform X1      160   3e-42   
ref|XP_008057077.1|  PREDICTED: aspartyl aminopeptidase                 159   3e-42   
ref|XP_008293068.1|  PREDICTED: aspartyl aminopeptidase isoform X2      159   3e-42   
ref|XP_008293067.1|  PREDICTED: aspartyl aminopeptidase isoform X1      159   3e-42   
ref|XP_008970257.1|  PREDICTED: aspartyl aminopeptidase isoform X2      159   4e-42   
ref|XP_004467839.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    159   4e-42   
ref|XP_001163232.1|  PREDICTED: aspartyl aminopeptidase isoform X1      159   4e-42   
ref|XP_008528206.1|  PREDICTED: LOW QUALITY PROTEIN: aspartyl ami...    160   4e-42   
ref|XP_009062504.1|  hypothetical protein LOTGIDRAFT_220342             159   5e-42   
ref|XP_009236412.1|  PREDICTED: aspartyl aminopeptidase isoform X1      159   5e-42   
ref|NP_956447.1|  aspartyl aminopeptidase                               159   5e-42   
ref|XP_009236415.1|  PREDICTED: aspartyl aminopeptidase isoform X3      158   5e-42   
ref|XP_005165919.1|  PREDICTED: aspartyl aminopeptidase isoform X1      159   5e-42   
ref|XP_009236411.1|  PREDICTED: aspartyl aminopeptidase isoform X2      159   6e-42   
ref|XP_011787585.1|  PREDICTED: aspartyl aminopeptidase                 159   6e-42   
ref|XP_006168733.1|  PREDICTED: aspartyl aminopeptidase                 158   6e-42   
ref|XP_005395587.1|  PREDICTED: aspartyl aminopeptidase isoform X3      158   7e-42   
ref|XP_011820054.1|  PREDICTED: aspartyl aminopeptidase isoform X2      158   8e-42   
ref|XP_005395588.1|  PREDICTED: aspartyl aminopeptidase isoform X4      158   8e-42   
ref|XP_003406097.1|  PREDICTED: aspartyl aminopeptidase                 158   8e-42   
ref|XP_004674317.1|  PREDICTED: aspartyl aminopeptidase                 158   8e-42   
gb|EPB92944.1|  aspartyl aminopeptidase                                 158   8e-42   
gb|EAW70735.1|  aspartyl aminopeptidase, isoform CRA_f                  158   8e-42   
gb|EHH55189.1|  hypothetical protein EGM_04343                          158   8e-42   
ref|XP_005574437.1|  PREDICTED: aspartyl aminopeptidase isoform X3      158   9e-42   
ref|XP_006867902.1|  PREDICTED: aspartyl aminopeptidase                 158   9e-42   
sp|Q9ULA0.1|DNPEP_HUMAN  RecName: Full=Aspartyl aminopeptidase          158   9e-42   
ref|XP_007964572.1|  PREDICTED: aspartyl aminopeptidase isoform X3      158   9e-42   
ref|XP_010358610.1|  PREDICTED: aspartyl aminopeptidase isoform X2      158   1e-41   
ref|XP_010890470.1|  PREDICTED: aspartyl aminopeptidase isoform X1      158   1e-41   
ref|XP_010890471.1|  PREDICTED: aspartyl aminopeptidase isoform X2      158   1e-41   
ref|XP_010358609.1|  PREDICTED: aspartyl aminopeptidase isoform X1      158   1e-41   
ref|XP_003895756.1|  PREDICTED: aspartyl aminopeptidase                 158   1e-41   
ref|XP_011739054.1|  PREDICTED: aspartyl aminopeptidase isoform X2      158   1e-41   
pdb|4DYO|A  Chain A, Crystal Structure Of Human Aspartyl Aminopep...    158   1e-41   
ref|XP_004033307.1|  PREDICTED: aspartyl aminopeptidase                 158   1e-41   
emb|CDS03243.1|  hypothetical protein LRAMOSA00645                      158   1e-41   
ref|XP_006818200.1|  PREDICTED: aspartyl aminopeptidase-like            151   1e-41   
ref|XP_007964571.1|  PREDICTED: aspartyl aminopeptidase isoform X2      158   1e-41   
ref|XP_005574436.1|  PREDICTED: aspartyl aminopeptidase isoform X2      158   1e-41   
ref|XP_005246487.2|  PREDICTED: aspartyl aminopeptidase isoform X2      158   1e-41   
ref|XP_003272451.1|  PREDICTED: aspartyl aminopeptidase isoform 1       158   1e-41   
ref|XP_010610129.1|  PREDICTED: aspartyl aminopeptidase                 158   1e-41   
ref|XP_002796805.1|  aspartyl aminopeptidase                            159   1e-41   
ref|XP_011918191.1|  PREDICTED: aspartyl aminopeptidase isoform X1      158   1e-41   
gb|AAY15050.1|  unknown                                                 158   1e-41   
ref|NP_036232.2|  aspartyl aminopeptidase                               158   1e-41   
ref|NP_001162487.1|  aspartyl aminopeptidase                            158   1e-41   
gb|ACA64864.1|  aspartyl aminopeptidase (predicted)                     158   1e-41   
ref|XP_005395585.1|  PREDICTED: aspartyl aminopeptidase isoform X1      158   1e-41   
ref|XP_005395586.1|  PREDICTED: aspartyl aminopeptidase isoform X2      158   1e-41   
ref|XP_001103498.1|  PREDICTED: aspartyl aminopeptidase isoform 7       158   1e-41   
ref|XP_011820053.1|  PREDICTED: aspartyl aminopeptidase isoform X1      158   1e-41   
dbj|BAA91903.1|  unnamed protein product                                157   1e-41   
ref|XP_011604595.1|  PREDICTED: aspartyl aminopeptidase isoform X1      157   1e-41   
ref|NP_001133447.1|  aspartyl aminopeptidase                            157   1e-41   
gb|EHH21700.1|  hypothetical protein EGK_04825                          158   1e-41   
ref|NP_001271904.1|  uncharacterized protein LOC101867207               158   1e-41   
ref|XP_007964570.1|  PREDICTED: aspartyl aminopeptidase isoform X1      158   1e-41   
ref|XP_008997791.1|  PREDICTED: aspartyl aminopeptidase isoform X1      157   1e-41   
gb|ABY89804.1|  aspartyl aminopeptidase (predicted)                     157   2e-41   
dbj|BAH13586.1|  unnamed protein product                                158   2e-41   
ref|XP_008997792.1|  PREDICTED: aspartyl aminopeptidase isoform X2      157   2e-41   
ref|XP_003966622.1|  PREDICTED: aspartyl aminopeptidase isoform X2      157   2e-41   
ref|XP_011509185.1|  PREDICTED: aspartyl aminopeptidase isoform X1      157   2e-41   
ref|XP_005520045.1|  PREDICTED: aspartyl aminopeptidase                 157   2e-41   
ref|XP_010759752.1|  hypothetical protein PADG_04167                    158   2e-41   
ref|XP_010334576.1|  PREDICTED: aspartyl aminopeptidase isoform X3      157   2e-41   
ref|NP_001125438.1|  aspartyl aminopeptidase                            157   2e-41   
ref|NP_001279935.1|  aspartyl aminopeptidase                            157   2e-41   
ref|XP_010334575.1|  PREDICTED: aspartyl aminopeptidase isoform X2      157   2e-41   
ref|XP_003925541.1|  PREDICTED: aspartyl aminopeptidase isoform X1      157   2e-41   
ref|XP_010334577.1|  PREDICTED: aspartyl aminopeptidase isoform X4      157   2e-41   
gb|AFK11572.1|  aspartyl aminopeptidase                                 157   2e-41   
ref|NP_001088602.1|  uncharacterized protein LOC495491                  157   2e-41   
emb|CDH60153.1|  aspartyl aminopeptidase                                158   2e-41   
ref|XP_008688803.1|  PREDICTED: aspartyl aminopeptidase                 157   3e-41   
ref|NP_001085525.1|  aspartyl aminopeptidase                            157   3e-41   
ref|XP_007743164.1|  aspartyl aminopeptidase                            157   3e-41   
emb|CEJ04001.1|  Putative Aspartyl aminopeptidase                       157   3e-41   
gb|EPY79425.1|  receptor-type tyrosine-protein phosphatase-like N...    161   3e-41   
ref|XP_009086531.1|  PREDICTED: aspartyl aminopeptidase                 156   3e-41   
gb|KIW96803.1|  aspartyl aminopeptidase                                 157   4e-41   
ref|XP_005049624.1|  PREDICTED: aspartyl aminopeptidase                 156   4e-41   
dbj|BAA92014.1|  unnamed protein product                                156   4e-41   
ref|XP_008863481.1|  hypothetical protein H310_01914                    156   4e-41   
ref|NP_001016026.1|  aspartyl aminopeptidase                            156   4e-41   
dbj|BAC34830.1|  unnamed protein product                                156   5e-41   
gb|EDL00399.1|  aspartyl aminopeptidase, isoform CRA_c                  156   5e-41   
ref|NP_058574.3|  aspartyl aminopeptidase isoform b                     156   5e-41   
emb|CEI95696.1|  Putative Aspartyl aminopeptidase                       156   5e-41   
dbj|BAC30079.1|  unnamed protein product                                156   6e-41   
ref|XP_006972210.1|  PREDICTED: aspartyl aminopeptidase isoform X1      156   6e-41   
ref|NP_001104301.1|  aspartyl aminopeptidase isoform a                  156   6e-41   
emb|CEG69346.1|  Putative Aspartyl aminopeptidase                       156   6e-41   
ref|XP_005101285.1|  PREDICTED: aspartyl aminopeptidase-like            156   7e-41   
gb|EDL00397.1|  aspartyl aminopeptidase, isoform CRA_b                  156   7e-41   
ref|XP_006972211.1|  PREDICTED: aspartyl aminopeptidase isoform X2      155   7e-41   
gb|KFY30391.1|  hypothetical protein V493_01948                         155   7e-41   
ref|XP_007883309.1|  PREDICTED: aspartyl aminopeptidase                 157   8e-41   
dbj|GAC99602.1|  aspartyl aminopeptidase                                156   8e-41   
emb|CEG81693.1|  Putative Aspartyl aminopeptidase                       156   8e-41   
ref|XP_004376401.1|  PREDICTED: aspartyl aminopeptidase                 155   9e-41   
ref|XP_003510642.1|  PREDICTED: aspartyl aminopeptidase                 155   9e-41   
ref|XP_009519985.1|  hypothetical protein PHYSODRAFT_539739             155   9e-41   
ref|XP_007188042.1|  PREDICTED: aspartyl aminopeptidase                 155   1e-40   
ref|XP_005070528.1|  PREDICTED: aspartyl aminopeptidase                 155   1e-40   
gb|KFY13166.1|  hypothetical protein V492_03441                         156   1e-40   
ref|XP_007234617.1|  PREDICTED: aspartyl aminopeptidase                 155   1e-40   
dbj|BAE32800.1|  unnamed protein product                                155   1e-40   
ref|XP_002505350.1|  predicted protein                                  155   1e-40   
ref|XP_007501721.1|  PREDICTED: aspartyl aminopeptidase                 155   1e-40   
gb|ELU07857.1|  hypothetical protein CAPTEDRAFT_158105                  155   1e-40   
gb|KFY42594.1|  hypothetical protein V494_02343                         155   1e-40   
gb|AAD01212.1|  aspartyl aminopeptidase                                 155   1e-40   
gb|EKG17055.1|  Peptidase M18                                           155   2e-40   
ref|XP_005361637.1|  PREDICTED: aspartyl aminopeptidase isoform X2      155   2e-40   
gb|KEF61787.1|  aspartyl aminopeptidase                                 155   2e-40   
ref|XP_005361636.1|  PREDICTED: aspartyl aminopeptidase isoform X1      155   2e-40   
ref|XP_011578729.1|  PREDICTED: aspartyl aminopeptidase                 155   2e-40   
ref|XP_007580092.1|  putative aspartyl aminopeptidase protein           155   2e-40   
ref|XP_010567906.1|  PREDICTED: aspartyl aminopeptidase                 155   2e-40   
ref|NP_001012937.1|  aspartyl aminopeptidase                            154   2e-40   
gb|KFY79508.1|  hypothetical protein V499_01520                         155   2e-40   
ref|XP_001641062.1|  predicted protein                                  154   2e-40   
gb|KFY92019.1|  hypothetical protein V500_04378                         155   2e-40   
gb|ETE70732.1|  Aspartyl aminopeptidase                                 154   3e-40   
ref|NP_001020050.1|  aspartyl aminopeptidase                            154   3e-40   
ref|XP_006245246.1|  PREDICTED: aspartyl aminopeptidase isoform X1      154   3e-40   
ref|XP_006245247.1|  PREDICTED: aspartyl aminopeptidase isoform X2      154   3e-40   
ref|XP_003729436.1|  PREDICTED: aspartyl aminopeptidase                 155   3e-40   
gb|KIW71613.1|  aspartyl aminopeptidase                                 154   3e-40   
ref|XP_002974770.1|  hypothetical protein SELMODRAFT_101663             154   3e-40   
ref|XP_002668236.1|  predicted protein                                  149   3e-40   
ref|XP_005279931.1|  PREDICTED: aspartyl aminopeptidase                 154   4e-40   
gb|ELR06737.1|  hypothetical protein GMDG_00354                         154   4e-40   
ref|XP_008110204.1|  PREDICTED: aspartyl aminopeptidase                 154   4e-40   
ref|XP_006636850.1|  PREDICTED: aspartyl aminopeptidase-like            153   4e-40   
emb|CCF51316.1|  probable aspartyl aminopeptidase                       154   5e-40   
gb|KIW02677.1|  hypothetical protein PV09_06114                         154   5e-40   
ref|XP_004994670.1|  aspartyl aminopeptidase                            153   5e-40   
ref|XP_005485343.1|  PREDICTED: aspartyl aminopeptidase                 154   6e-40   
ref|XP_007778599.1|  aspartyl aminopeptidase                            153   7e-40   
gb|EPB84012.1|  aspartyl aminopeptidase                                 153   8e-40   
ref|XP_009909456.1|  PREDICTED: aspartyl aminopeptidase                 154   8e-40   
emb|CBQ68247.1|  probable aspartyl aminopeptidase                       153   8e-40   
ref|XP_007419855.1|  PREDICTED: aspartyl aminopeptidase                 153   8e-40   
ref|XP_002155387.2|  PREDICTED: aspartyl aminopeptidase-like            152   9e-40   
ref|XP_003655852.1|  hypothetical protein THITE_2120008                 153   1e-39   
gb|EUC66389.1|  aspartyl aminopeptidase                                 152   1e-39   
gb|KIW57576.1|  aspartyl aminopeptidase                                 153   1e-39   
dbj|GAN06933.1|  aspartyl aminopeptidase                                153   1e-39   
ref|XP_007755763.1|  aspartyl aminopeptidase                            152   1e-39   
gb|KIW26829.1|  aspartyl aminopeptidase                                 153   1e-39   
gb|KFZ06387.1|  hypothetical protein V501_07458                         153   1e-39   
ref|XP_003333509.2|  hypothetical protein PGTG_14931                    152   2e-39   
ref|XP_006272731.1|  PREDICTED: aspartyl aminopeptidase                 152   2e-39   
ref|XP_008727381.1|  aspartyl aminopeptidase                            152   2e-39   
ref|XP_002907085.1|  aspartyl aminopeptidase, putative                  152   2e-39   
ref|XP_002109666.1|  hypothetical protein TRIADDRAFT_37272              152   2e-39   
emb|CCE31713.1|  probable aspartyl aminopeptidase                       152   2e-39   
ref|XP_007655567.1|  PREDICTED: aspartyl aminopeptidase                 145   2e-39   
gb|EKC33057.1|  Aspartyl aminopeptidase                                 151   2e-39   
emb|CDI51753.1|  probable aspartyl aminopeptidase                       152   2e-39   
gb|KIW75583.1|  aspartyl aminopeptidase                                 152   2e-39   
ref|XP_003006452.1|  aspartyl aminopeptidase                            152   2e-39   
emb|CCG83236.1|  Aspartyl aminopeptidase                                151   2e-39   
ref|XP_011442611.1|  PREDICTED: aspartyl aminopeptidase-like            151   3e-39   
ref|XP_009652940.1|  aspartyl aminopeptidase                            152   3e-39   
ref|XP_007411864.1|  hypothetical protein MELLADRAFT_123262             152   3e-39   
ref|XP_009825683.1|  hypothetical protein H257_03355                    151   3e-39   
gb|KJX97626.1|  aspartyl aminopeptidase like protein                    152   3e-39   
gb|KIX93688.1|  aspartyl aminopeptidase                                 152   3e-39   
gb|KIV85113.1|  aspartyl aminopeptidase                                 152   3e-39   
gb|KJE94975.1|  aspartyl aminopeptidase                                 151   3e-39   
ref|XP_004346183.2|  aspartyl aminopeptidase                            151   3e-39   
ref|XP_001937243.1|  aspartyl aminopeptidase                            151   4e-39   
ref|XP_003111055.1|  hypothetical protein CRE_04518                     151   4e-39   
ref|XP_008909814.1|  hypothetical protein PPTG_14635                    150   4e-39   
gb|EHK15593.1|  hypothetical protein TRIVIDRAFT_82549                   151   4e-39   
ref|XP_009217911.1|  aspartyl aminopeptidase                            151   4e-39   
gb|EMD89639.1|  hypothetical protein COCHEDRAFT_1021930                 151   5e-39   
ref|XP_003297234.1|  hypothetical protein PTT_07560                     151   5e-39   
ref|XP_007686414.1|  hypothetical protein COCMIDRAFT_35352              151   5e-39   
ref|XP_003850739.1|  hypothetical protein MYCGRDRAFT_60951              151   5e-39   
ref|XP_007912218.1|  putative aspartyl aminopeptidase protein           151   5e-39   
emb|CEG01789.1|  Peptidase M18                                          151   5e-39   
ref|XP_007711530.1|  hypothetical protein COCCADRAFT_36117              151   5e-39   
gb|EUN29634.1|  hypothetical protein COCVIDRAFT_35507                   151   5e-39   
ref|XP_007698413.1|  hypothetical protein COCSADRAFT_35844              151   6e-39   
gb|KFY64115.1|  hypothetical protein V497_01817                         151   6e-39   
gb|EFX00349.1|  aspartyl aminopeptidase                                 150   6e-39   
ref|XP_011386806.1|  putative aspartyl aminopeptidase                   150   7e-39   
gb|KDO32253.1|  hypothetical protein SPRG_02733                         150   8e-39   
gb|KFA70034.1|  hypothetical protein S40285_02036                       150   8e-39   
gb|KIW47212.1|  aspartyl aminopeptidase                                 150   8e-39   
gb|KJH53012.1|  putative aspartyl aminopeptidase                        150   8e-39   
gb|KFA55851.1|  hypothetical protein S40293_01900                       150   8e-39   
gb|EGE77302.1|  aspartyl aminopeptidase                                 151   8e-39   
gb|KIM25890.1|  hypothetical protein M408DRAFT_17117                    150   8e-39   
gb|KEY64841.1|  hypothetical protein S7711_08849                        150   9e-39   
ref|XP_007512692.1|  predicted protein                                  151   9e-39   
ref|NP_594745.1|  aspartyl aminopeptidase Aap1                          150   9e-39   
ref|XP_008620058.1|  aspartyl aminopeptidase                            150   9e-39   
ref|XP_002678138.1|  predicted protein                                  150   9e-39   
gb|KFX49953.1|  Aspartyl aminopeptidase                                 150   1e-38   
ref|XP_001421486.1|  predicted protein                                  150   1e-38   
emb|CCV00565.1|  unnamed protein product                                150   1e-38   
ref|XP_003838183.1|  hypothetical protein LEMA_P117070.1                150   1e-38   
gb|EPE06234.1|  aspartyl aminopeptidase                                 150   1e-38   
ref|XP_007681528.1|  hypothetical protein BAUCODRAFT_80469              150   1e-38   
gb|EGT44396.1|  CBN-DNPP-1 protein                                      149   1e-38   
ref|XP_007600979.1|  aminopeptidase I zinc metalloprotease              150   1e-38   
ref|XP_002641207.1|  Hypothetical protein CBG09068                      149   2e-38   
dbj|GAM41037.1|  aspartyl aminopeptidase                                149   2e-38   



>ref|XP_009802964.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana sylvestris]
Length=542

 Score =   286 bits (733),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 152/199 (76%), Positives = 167/199 (84%), Gaps = 7/199 (4%)
 Frame = +2

Query  86   FHLLYA-PPLSKSSVLLSRFPHSLRP-FSAANANLRTS---HLRNFSA-TPPLCSSSSDA  247
            FH L   P   K SVLLS+FPHS  P FS    N+      H R FS+ T PLCS+S  +
Sbjct  9    FHFLQPYPVFPKPSVLLSKFPHSSSPPFSINVHNINNPCRIHFRKFSSVTSPLCSTSG-S  67

Query  248  VPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGR  427
            +PE+  +SESS+SIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLL ENE+WDL+PGGR
Sbjct  68   IPESAETSESSTSIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLKENEKWDLQPGGR  127

Query  428  YFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGG  607
            YFFTRNMSSLVAFAIGKKYSIGNGFH+IAAHTDSPC+KLKP+SAS KSGYLMVNVQ YGG
Sbjct  128  YFFTRNMSSLVAFAIGKKYSIGNGFHVIAAHTDSPCLKLKPKSASTKSGYLMVNVQLYGG  187

Query  608  GLWHTWFDRDLTVAGRVIL  664
            GLWHTWFDRDL+VAGRVIL
Sbjct  188  GLWHTWFDRDLSVAGRVIL  206



>ref|XP_006361458.1| PREDICTED: probable aspartyl aminopeptidase-like [Solanum tuberosum]
Length=535

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 150/194 (77%), Positives = 164/194 (85%), Gaps = 2/194 (1%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTS-HLRNFSATPPLCSSSSDAVPEAF  262
            F  L   P+SK SV  S+F  S   FS+ ++      H RNFS T PLCSSS  ++PE  
Sbjct  7    FQFLQPYPISKPSVFFSKFLQSSPSFSSFSSIKPCRIHFRNFSVTLPLCSSSG-SIPECP  65

Query  263  VssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTR  442
             SSESS+SIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLL ENE+WDL+PGGRYFFTR
Sbjct  66   ESSESSTSIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLKENEKWDLQPGGRYFFTR  125

Query  443  NMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHT  622
            NMSSLVAFAIGKKYSIGNGFH+IAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHT
Sbjct  126  NMSSLVAFAIGKKYSIGNGFHVIAAHTDSPCLKLKPKSASTKSGYLMVNVQTYGGGLWHT  185

Query  623  WFDRDLTVAGRVIL  664
            WFDRDL+VAGRVIL
Sbjct  186  WFDRDLSVAGRVIL  199



>ref|XP_009596186.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana tomentosiformis]
Length=541

 Score =   281 bits (719),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 164/198 (83%), Gaps = 6/198 (3%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANA----NLRTSHLRNFSA-TPPLCSSSSDAV  250
            F  L   P  K SVLLS+ PHS  P  + N     N    H R FSA T PLCS+S  ++
Sbjct  9    FQFLQPYPFPKPSVLLSKVPHSSSPRFSINVPNVNNPYRIHFRKFSAVTSPLCSTSG-SI  67

Query  251  PEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRY  430
            PE+  SSESS+SIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLL ENE+WDL+PGGRY
Sbjct  68   PESAESSESSTSIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLKENEKWDLQPGGRY  127

Query  431  FFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGG  610
            FFTRNMSSLVAFAIGKKYSIGNGFH+IAAHTDSPC+KLKP+SAS KSGYLMVNVQ YGGG
Sbjct  128  FFTRNMSSLVAFAIGKKYSIGNGFHVIAAHTDSPCLKLKPKSASTKSGYLMVNVQLYGGG  187

Query  611  LWHTWFDRDLTVAGRVIL  664
            LWHTWFDRDL+VAGRVIL
Sbjct  188  LWHTWFDRDLSVAGRVIL  205



>ref|XP_004249975.1| PREDICTED: probable aspartyl aminopeptidase [Solanum lycopersicum]
Length=535

 Score =   280 bits (715),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/194 (75%), Positives = 161/194 (83%), Gaps = 2/194 (1%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTS-HLRNFSATPPLCSSSSDAVPEAF  262
            F  L   P+SK S   S+   +   FS+ ++      H R FS T PLCSSS  ++PE  
Sbjct  7    FQFLQPYPISKPSAFFSKIRQTSPSFSSFSSTKPCRIHFRKFSVTSPLCSSSG-SIPEFP  65

Query  263  VssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTR  442
             SSESS+SIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLL ENE+WDL+PGGRYFFTR
Sbjct  66   ESSESSTSIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLKENEKWDLQPGGRYFFTR  125

Query  443  NMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHT  622
            NMSSLVAFAIGKKYSIG+GFH+IAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHT
Sbjct  126  NMSSLVAFAIGKKYSIGDGFHVIAAHTDSPCLKLKPKSASTKSGYLMVNVQTYGGGLWHT  185

Query  623  WFDRDLTVAGRVIL  664
            WFDRDL+VAGRVIL
Sbjct  186  WFDRDLSVAGRVIL  199



>ref|XP_011076919.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Sesamum 
indicum]
Length=539

 Score =   278 bits (710),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 163/200 (82%), Gaps = 11/200 (6%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFS---AANANLRT----SHLRNFSATPPLCSSSSD  244
            FHLL   P+ + S LL +FPH+ R  +   + + NLR     S  R  S TPPLCS S  
Sbjct  7    FHLLQPSPILRPSALLPKFPHASRLLTIHTSYSTNLRRNGAGSGGRKLSITPPLCSKSE-  65

Query  245  AVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGG  424
                +  ++ESS SIVGDLLDYLNESWTQFHATAEAKRQL+AAGFHLLNENEEW+LKPGG
Sbjct  66   ---NSSSNTESSQSIVGDLLDYLNESWTQFHATAEAKRQLLAAGFHLLNENEEWELKPGG  122

Query  425  RYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYG  604
             YFFTRNMSSLVAFAIG+KYS+GNGFH+IAAHTDSPC+KLKP+SAS KSGYLMVNVQTYG
Sbjct  123  CYFFTRNMSSLVAFAIGEKYSLGNGFHVIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYG  182

Query  605  GGLWHTWFDRDLTVAGRVIL  664
            GGLWHTWFDRDL++AGRVI+
Sbjct  183  GGLWHTWFDRDLSLAGRVIV  202



>ref|XP_008232012.1| PREDICTED: probable aspartyl aminopeptidase [Prunus mume]
Length=530

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 156/194 (80%), Gaps = 11/194 (6%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  265
              LL+ PPL+    LL   P            L  S  R+FS +P LCS++S   PE+  
Sbjct  10   LQLLHPPPLTLRRSLLFHKP----------KQLTRSRPRSFSTSPILCSNNSHNTPESSA  59

Query  266  sse-ssssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTR  442
            S+  +++SIVGDLLDYLNESWT FHATAEAKRQLIAAGFHLLNEN+EWDLKPGGRYFFTR
Sbjct  60   STVGANASIVGDLLDYLNESWTHFHATAEAKRQLIAAGFHLLNENDEWDLKPGGRYFFTR  119

Query  443  NMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHT  622
            NMS LVAF++G+KY++GNGFH+IAAHTDSPC+KLKPRSAS KSGYLM+NVQTYGGGLWHT
Sbjct  120  NMSCLVAFSVGEKYTVGNGFHVIAAHTDSPCLKLKPRSASSKSGYLMINVQTYGGGLWHT  179

Query  623  WFDRDLTVAGRVIL  664
            WFDRDL+VAGRVIL
Sbjct  180  WFDRDLSVAGRVIL  193



>gb|EYU19780.1| hypothetical protein MIMGU_mgv1a004147mg [Erythranthe guttata]
Length=542

 Score =   274 bits (700),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 158/204 (77%), Gaps = 16/204 (8%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPF----SAANANLR-------TSHLRNFSATPPLCS  232
            FHL    PL K S +L  +P +  PF    +  N+NLR           R  S TPPL S
Sbjct  7    FHLFQPSPLLKPSAILYNYPLA-SPFFTTRANDNSNLRHNIGGGGGGGRRKLSTTPPLRS  65

Query  233  SSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDL  412
            +S   +       +SS SIVGDLLDYLNESWTQFHATAEAKRQL+AAGFHLLNENEEW L
Sbjct  66   NSEGGISST----QSSMSIVGDLLDYLNESWTQFHATAEAKRQLVAAGFHLLNENEEWKL  121

Query  413  KPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNV  592
            KPGGRYFFTRNMSSLVAFAIG+KYSIGNGFH+IAAHTDSPC+KLKP+SAS KSGYLMVNV
Sbjct  122  KPGGRYFFTRNMSSLVAFAIGEKYSIGNGFHVIAAHTDSPCLKLKPKSASSKSGYLMVNV  181

Query  593  QTYGGGLWHTWFDRDLTVAGRVIL  664
            QTYGGGLWHTWFDRDL++AGRVI+
Sbjct  182  QTYGGGLWHTWFDRDLSLAGRVIV  205



>ref|XP_010088778.1| Aspartyl aminopeptidase [Morus notabilis]
 gb|EXB36961.1| Aspartyl aminopeptidase [Morus notabilis]
Length=532

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 157/189 (83%), Gaps = 8/189 (4%)
 Frame = +2

Query  98   YAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVsses  277
            + P   K S+LL   P      S ++ N +++  R+FS TP LCS S D VPE+   + +
Sbjct  15   HTPATLKPSILLPNVPR----LSPSSFNFKST--RSFSTTPLLCSVS-DHVPES-SGNGA  66

Query  278  sssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSL  457
            S+SIVGDLLDYLNESWTQFHATAEAKR L+AAGFHLLNEN+EWDLKPGGRYFFTRNMSSL
Sbjct  67   SASIVGDLLDYLNESWTQFHATAEAKRHLVAAGFHLLNENDEWDLKPGGRYFFTRNMSSL  126

Query  458  VAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRD  637
            +AFA+G KY +GNGFH+IAAHTDSPC+KLKP+SAS K+GYLMVNVQTYGGGLW+TWFDRD
Sbjct  127  IAFAVGDKYVVGNGFHVIAAHTDSPCLKLKPKSASSKAGYLMVNVQTYGGGLWYTWFDRD  186

Query  638  LTVAGRVIL  664
            LTVAGRVI+
Sbjct  187  LTVAGRVIV  195



>ref|XP_009336015.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336016.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Pyrus 
x bretschneideri]
Length=529

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 146/163 (90%), Gaps = 1/163 (1%)
 Frame = +2

Query  179  NLRTSHLRNFSATPPLCSSSSDAVPEAFVsse-ssssIVGDLLDYLNESWTQFHATAEAK  355
             LR S  R FS  P LCSS+S  +P++ VS+  +++SIVGDLLDYLNESWT FHATAEAK
Sbjct  30   QLRRSRPRTFSTGPILCSSNSPHLPQSSVSAAGANTSIVGDLLDYLNESWTHFHATAEAK  89

Query  356  RQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPC  535
            RQLIAAGFHLL+EN+EWDLKPGGRYFFTRNMS LVAFA+G+KYS+G+GFH+IAAHTDSPC
Sbjct  90   RQLIAAGFHLLSENDEWDLKPGGRYFFTRNMSCLVAFAVGEKYSVGSGFHVIAAHTDSPC  149

Query  536  MKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            +KLKPRSAS KSGY M+NVQTYGGGLWHTWFDRDL+VAGRVIL
Sbjct  150  LKLKPRSASSKSGYQMINVQTYGGGLWHTWFDRDLSVAGRVIL  192



>emb|CAN73045.1| hypothetical protein VITISV_008667 [Vitis vinifera]
Length=250

 Score =   259 bits (663),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 139/161 (86%), Gaps = 2/161 (1%)
 Frame = +2

Query  179  NLRTSHLRNFSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKR  358
            N   + LR FS +P LCS S   +  +  S   S SIVGDLLDYLNESWTQFHATAEAKR
Sbjct  40   NFHFTPLRKFSLSPLLCSISDQPLQSS--SGAGSPSIVGDLLDYLNESWTQFHATAEAKR  97

Query  359  QLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCM  538
            QLIAAGF LLNEN+EWDL+PGGRY FTRNMSSLVAFAIG+KYS+GNGFH+IAAHTDSPC+
Sbjct  98   QLIAAGFQLLNENDEWDLRPGGRYLFTRNMSSLVAFAIGEKYSVGNGFHVIAAHTDSPCL  157

Query  539  KLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVI  661
            KLKP+SA+ KSGYLMVNVQTYGGGLWHTWFDRDL+VAGRVI
Sbjct  158  KLKPKSAASKSGYLMVNVQTYGGGLWHTWFDRDLSVAGRVI  198



>ref|XP_009336013.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009336014.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Pyrus 
x bretschneideri]
Length=529

 Score =   268 bits (685),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/163 (79%), Positives = 144/163 (88%), Gaps = 1/163 (1%)
 Frame = +2

Query  179  NLRTSHLRNFSATPPLCSSSSDAVPEAFVsses-sssIVGDLLDYLNESWTQFHATAEAK  355
             LR S  R FS  P LCSS+S  +P++ VS+    +SIVGDLLDYLNESWT FHATAEAK
Sbjct  30   QLRRSRPRTFSTGPILCSSNSPHLPQSSVSAAGGDTSIVGDLLDYLNESWTHFHATAEAK  89

Query  356  RQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPC  535
            RQLIAAGFHLL+EN+EWDLKPGGRYFFTRNMS LVAFA+G+KYS+G+GFH+IAAHTDSPC
Sbjct  90   RQLIAAGFHLLSENDEWDLKPGGRYFFTRNMSCLVAFAVGEKYSVGSGFHVIAAHTDSPC  149

Query  536  MKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            +KLKPRSAS KSGY M+NVQTYGGGLWHTWFDRDL+VAGRVIL
Sbjct  150  LKLKPRSASSKSGYQMINVQTYGGGLWHTWFDRDLSVAGRVIL  192



>ref|XP_008347038.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=529

 Score =   265 bits (678),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 153/183 (84%), Gaps = 8/183 (4%)
 Frame = +2

Query  137  RFPHS---LRP---FSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVsse-ssssIVG  295
            + PHS   L+P   F   N  LR S  R FS  P LCSS+S  +P++ VS+  +++SI+G
Sbjct  11   QLPHSPLTLKPSVLFPNPN-QLRRSRPRTFSTGPILCSSNSPHLPQSSVSAAGANTSIIG  69

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            DLLDYLNESWT FHATAEAKRQLIAAGFHLL+EN+EWDLKPGGRYFFTRNMS LVAFA+G
Sbjct  70   DLLDYLNESWTHFHATAEAKRQLIAAGFHLLSENDEWDLKPGGRYFFTRNMSCLVAFAVG  129

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
            +KYS+G+GFH IAAHTDSPC+KLKPR AS KSGY M+NVQTYGGGLWHTWFDRDL+VAGR
Sbjct  130  EKYSVGSGFHAIAAHTDSPCLKLKPRXASSKSGYQMINVQTYGGGLWHTWFDRDLSVAGR  189

Query  656  VIL  664
            VIL
Sbjct  190  VIL  192



>ref|XP_009356123.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=531

 Score =   265 bits (678),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 135/194 (70%), Positives = 155/194 (80%), Gaps = 10/194 (5%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  265
               L++P   K SVL   FP   +P+      LR S    FS  P LCSS+S  +P+  V
Sbjct  10   MQFLHSPLTLKPSVL---FP---KPYPN---QLRRSCPHTFSTAPILCSSNSPHLPQCSV  60

Query  266  sse-ssssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTR  442
            S+  +++SIVGDLLDYLNESWT FHATAEAKRQLIA GF LL+EN+EWDLKPGGRYFFTR
Sbjct  61   SAAGANASIVGDLLDYLNESWTHFHATAEAKRQLIATGFQLLSENDEWDLKPGGRYFFTR  120

Query  443  NMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHT  622
            NMS LVAFA+G+KYS+GNGFH+IAAHTDSPC+KLKPRSAS KSGY M+NVQTYGGGLWHT
Sbjct  121  NMSCLVAFAVGEKYSVGNGFHVIAAHTDSPCLKLKPRSASSKSGYQMINVQTYGGGLWHT  180

Query  623  WFDRDLTVAGRVIL  664
            WFDRDL+VAGRVIL
Sbjct  181  WFDRDLSVAGRVIL  194



>ref|XP_010244537.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Nelumbo 
nucifera]
Length=434

 Score =   262 bits (670),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 150/193 (78%), Gaps = 13/193 (7%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  265
              LL  PP+ KSS+L  ++ +S    S +   L    LR FS  P LCS   D +PE+  
Sbjct  8    LQLLKPPPVVKSSIL-PKYSYS----SFSTPTLHGKRLRKFSTVPHLCSKL-DQLPES--  59

Query  266  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  445
                  SIVGDLLDYLNESWTQFHATAEAKRQLI AGFHLLNEN+EWDLKPG RYFFTRN
Sbjct  60   -----PSIVGDLLDYLNESWTQFHATAEAKRQLIDAGFHLLNENDEWDLKPGRRYFFTRN  114

Query  446  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  625
            MS LVAFAIG+KY++GNGFH+IAAHTDSPC+KLKP+SAS K GYLMVNVQTYG GLWHTW
Sbjct  115  MSCLVAFAIGEKYNVGNGFHVIAAHTDSPCLKLKPKSASSKCGYLMVNVQTYGAGLWHTW  174

Query  626  FDRDLTVAGRVIL  664
            FDRDL++AGR I+
Sbjct  175  FDRDLSLAGRAIV  187



>ref|XP_010244532.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Nelumbo 
nucifera]
Length=519

 Score =   264 bits (675),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 132/193 (68%), Positives = 150/193 (78%), Gaps = 13/193 (7%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  265
              LL  PP+ KSS+L  ++ +S    S +   L    LR FS  P LCS   D +PE+  
Sbjct  8    LQLLKPPPVVKSSIL-PKYSYS----SFSTPTLHGKRLRKFSTVPHLCSKL-DQLPES--  59

Query  266  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  445
                  SIVGDLLDYLNESWTQFHATAEAKRQLI AGFHLLNEN+EWDLKPG RYFFTRN
Sbjct  60   -----PSIVGDLLDYLNESWTQFHATAEAKRQLIDAGFHLLNENDEWDLKPGRRYFFTRN  114

Query  446  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  625
            MS LVAFAIG+KY++GNGFH+IAAHTDSPC+KLKP+SAS K GYLMVNVQTYG GLWHTW
Sbjct  115  MSCLVAFAIGEKYNVGNGFHVIAAHTDSPCLKLKPKSASSKCGYLMVNVQTYGAGLWHTW  174

Query  626  FDRDLTVAGRVIL  664
            FDRDL++AGR I+
Sbjct  175  FDRDLSLAGRAIV  187



>ref|XP_002266672.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Vitis 
vinifera]
 ref|XP_010658775.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Vitis 
vinifera]
 ref|XP_010658776.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Vitis 
vinifera]
 ref|XP_010658777.1| PREDICTED: probable aspartyl aminopeptidase isoform X4 [Vitis 
vinifera]
 emb|CBI35256.3| unnamed protein product [Vitis vinifera]
Length=535

 Score =   263 bits (671),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 139/162 (86%), Gaps = 2/162 (1%)
 Frame = +2

Query  179  NLRTSHLRNFSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKR  358
            N   + LR FS +P LCS S    P    S   S SIVGDLLDYLNESWTQFHATAEAKR
Sbjct  40   NFHFTPLRKFSLSPLLCSISDQ--PLQSSSGAGSPSIVGDLLDYLNESWTQFHATAEAKR  97

Query  359  QLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCM  538
            QLIAAGF LLNEN+EWDL+PGGRY FTRNMSSLVAFAIG+KYS+GNGFH+IAAHTDSPC+
Sbjct  98   QLIAAGFQLLNENDEWDLRPGGRYLFTRNMSSLVAFAIGEKYSVGNGFHVIAAHTDSPCL  157

Query  539  KLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            KLKP+SA+ KSGYLMVNVQTYGGGLWHTWFDRDL+VAGRVIL
Sbjct  158  KLKPKSAASKSGYLMVNVQTYGGGLWHTWFDRDLSVAGRVIL  199



>emb|CDO99897.1| unnamed protein product [Coffea canephora]
Length=546

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 150/197 (76%), Gaps = 5/197 (3%)
 Frame = +2

Query  89   HLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVs  268
             +L+  P  K S L S+FP S  P  +      T   R  S TPPLCSSSS +       
Sbjct  13   QVLHPSPFFKPSTLFSKFPRSSLPIPSTLKRSNTRFRRLSSLTPPLCSSSSHSSSAGGSL  72

Query  269  sessssIVG-----DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYF  433
               SSS  G     DLLDYLNESWTQFHATAEAKRQL+AAGFHLLNEN+EWDLKPGGRYF
Sbjct  73   ESHSSSESGGSVVGDLLDYLNESWTQFHATAEAKRQLLAAGFHLLNENDEWDLKPGGRYF  132

Query  434  FTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGL  613
            FTRNMSSLVAFAIG+KYS GNGFHIIAAHTDSPC+KLKP SAS KSGYLMVNVQTYG GL
Sbjct  133  FTRNMSSLVAFAIGEKYSNGNGFHIIAAHTDSPCLKLKPNSASSKSGYLMVNVQTYGSGL  192

Query  614  WHTWFDRDLTVAGRVIL  664
            WHTWFDRDL+VAGRVI+
Sbjct  193  WHTWFDRDLSVAGRVIV  209



>ref|XP_002524995.1| Aspartyl aminopeptidase, putative [Ricinus communis]
 gb|EEF37402.1| Aspartyl aminopeptidase, putative [Ricinus communis]
Length=526

 Score =   260 bits (664),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 151/191 (79%), Gaps = 18/191 (9%)
 Frame = +2

Query  92   LLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVss  271
            ++  PP    S+ LS+  HS  P  A    LR S  RNFS+T   CS+S+    +     
Sbjct  18   IINKPP----SLFLSKLSHS--PLYA----LRPS--RNFSSTR--CSTSNQTQTQE----  59

Query  272  essssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMS  451
                SIVGDLLDYLNESWTQFHATAEAKRQLI AGFHLLNEN+EWDLKPGGRYFFTRNMS
Sbjct  60   SCDGSIVGDLLDYLNESWTQFHATAEAKRQLIDAGFHLLNENDEWDLKPGGRYFFTRNMS  119

Query  452  SLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFD  631
             LVAFA+G+KY++GNGFH+IAAHTDSPC+KLKP+SAS KS YLMVNVQTYGGGLWHTWFD
Sbjct  120  CLVAFAVGEKYTVGNGFHVIAAHTDSPCLKLKPKSASSKSNYLMVNVQTYGGGLWHTWFD  179

Query  632  RDLTVAGRVIL  664
            RDL+VAGRVI+
Sbjct  180  RDLSVAGRVIV  190



>ref|XP_012074668.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Jatropha 
curcas]
 gb|KDP35783.1| hypothetical protein JCGZ_10419 [Jatropha curcas]
Length=526

 Score =   258 bits (659),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 147/191 (77%), Gaps = 22/191 (12%)
 Frame = +2

Query  107  PLSKSSVLLSRF----PHSLRPFSAANANLRTSHLRNFSATPPL-CSSSSDAVPEAFVss  271
            P+ K S+LL +      H+LRP             R FS T    CS+S+ +  +     
Sbjct  17   PIIKPSMLLLKLGNSPSHALRP-------------RKFSVTTTTPCSASNHSQTQE----  59

Query  272  essssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMS  451
                SIVGDLLDYLNESWTQFHATAEAKRQL AAGFHLLNEN+EWDLKPGGRYFFTRNMS
Sbjct  60   SCDGSIVGDLLDYLNESWTQFHATAEAKRQLTAAGFHLLNENDEWDLKPGGRYFFTRNMS  119

Query  452  SLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFD  631
             LVAFA+G+KY++GNGFH+IAAHTDSPC+KLKP+SAS KS YLMVNVQTYGGGLWHTWFD
Sbjct  120  CLVAFAVGEKYTVGNGFHVIAAHTDSPCLKLKPKSASSKSNYLMVNVQTYGGGLWHTWFD  179

Query  632  RDLTVAGRVIL  664
            RDL+VAGRVI+
Sbjct  180  RDLSVAGRVIV  190



>gb|KHG01889.1| Aspartyl aminopeptidase [Gossypium arboreum]
Length=549

 Score =   258 bits (660),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 132/185 (71%), Positives = 148/185 (80%), Gaps = 12/185 (6%)
 Frame = +2

Query  110  LSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVssessssI  289
            L   S   SR PHS   FS    N R    R FS TPPL  SSS +       + ++ SI
Sbjct  10   LHHPSAYFSRLPHSHSSFSI---NFRR---RKFSVTPPLLCSSSSSS------ASTNPSI  57

Query  290  VGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFA  469
            VGDLL+YLNESWTQFHATAEAKRQLIAAGFHLLNEN+EWDL+PGGRYFFTRNMS LVAFA
Sbjct  58   VGDLLNYLNESWTQFHATAEAKRQLIAAGFHLLNENDEWDLRPGGRYFFTRNMSCLVAFA  117

Query  470  IGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVA  649
            +G+KY +GNGFH+IAAHTDSPC+KLKP+SAS KS YLM+NVQTYGGGLWHTWFDRDL+VA
Sbjct  118  VGEKYIVGNGFHVIAAHTDSPCLKLKPKSASSKSNYLMLNVQTYGGGLWHTWFDRDLSVA  177

Query  650  GRVIL  664
            GRVI+
Sbjct  178  GRVIV  182



>gb|KJB78672.1| hypothetical protein B456_013G012600 [Gossypium raimondii]
 gb|KJB78673.1| hypothetical protein B456_013G012600 [Gossypium raimondii]
Length=521

 Score =   256 bits (655),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 150/188 (80%), Gaps = 8/188 (4%)
 Frame = +2

Query  101  APPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVssess  280
            A  L   S   SR PHS   FS    N R    R FS TPPL  SSS +   +  S+ ++
Sbjct  7    AQLLHHPSAYFSRLPHSHSSFSI---NFRR---RKFSVTPPLLCSSSSSSSSS--SASTN  58

Query  281  ssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLV  460
             SIVGDLL+YLNESWTQFHATAEAKRQLIAAGFHLLNEN+EWDL+PGGRYFFTRNMS LV
Sbjct  59   PSIVGDLLNYLNESWTQFHATAEAKRQLIAAGFHLLNENDEWDLRPGGRYFFTRNMSCLV  118

Query  461  AFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDL  640
            AFA+G+KY  GNGFH+IAAHTDSPC+KLKP+SAS KS YLM+NVQTYGGGLWHTWFDRDL
Sbjct  119  AFAVGEKYISGNGFHVIAAHTDSPCLKLKPKSASSKSNYLMLNVQTYGGGLWHTWFDRDL  178

Query  641  TVAGRVIL  664
            +VAGRVI+
Sbjct  179  SVAGRVIV  186



>ref|XP_007213437.1| hypothetical protein PRUPE_ppa025466mg, partial [Prunus persica]
 gb|EMJ14636.1| hypothetical protein PRUPE_ppa025466mg, partial [Prunus persica]
Length=474

 Score =   254 bits (648),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IVGDLLDYLNESWT FHATAEAKRQLIAAGFHLLNEN+EWDLKPGGRYFFTRNMS LVAF
Sbjct  12   IVGDLLDYLNESWTHFHATAEAKRQLIAAGFHLLNENDEWDLKPGGRYFFTRNMSCLVAF  71

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            ++G+KY++GNGFH+IAAHTDSPC+KLKPRSAS KSGYLM+NVQTYG GLWHTWFDRDL+V
Sbjct  72   SVGEKYTVGNGFHVIAAHTDSPCLKLKPRSASSKSGYLMINVQTYGSGLWHTWFDRDLSV  131

Query  647  AGRVIL  664
            AGRVIL
Sbjct  132  AGRVIL  137



>ref|XP_011076920.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Sesamum 
indicum]
Length=493

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 124/126 (98%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IVGDLLDYLNESWTQFHATAEAKRQL+AAGFHLLNENEEW+LKPGG YFFTRNMSSLVAF
Sbjct  31   IVGDLLDYLNESWTQFHATAEAKRQLLAAGFHLLNENEEWELKPGGCYFFTRNMSSLVAF  90

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG+KYS+GNGFH+IAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL++
Sbjct  91   AIGEKYSLGNGFHVIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSL  150

Query  647  AGRVIL  664
            AGRVI+
Sbjct  151  AGRVIV  156



>ref|XP_010907134.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Elaeis 
guineensis]
Length=448

 Score =   251 bits (642),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = +2

Query  200  RNFSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGF  379
            + FS     CS S D   E   + ESS SIVGDLLDYLNESWTQFHATAEAKRQLIAAGF
Sbjct  37   KGFSTRRLFCSQS-DGSLEDSGAGESSPSIVGDLLDYLNESWTQFHATAEAKRQLIAAGF  95

Query  380  HLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSA  559
             LLNEN++WDL+PGGRYFFTRNMSSLVAFA+G+KY++G+GFH+IAAHTDSPC+KLKPRSA
Sbjct  96   RLLNENDDWDLQPGGRYFFTRNMSSLVAFAVGEKYNVGSGFHVIAAHTDSPCLKLKPRSA  155

Query  560  SCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVI  661
            S KSG+LMVNVQTYGGGLWHTWFDRDL+VAGRVI
Sbjct  156  SSKSGFLMVNVQTYGGGLWHTWFDRDLSVAGRVI  189



>gb|KCW51473.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=459

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 150/193 (78%), Gaps = 10/193 (5%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  265
             HLL+ P +S+ S L       L+P    + +  +S +R  S  P LCS +  +   A  
Sbjct  8    LHLLHPPTVSRPSFLF------LKP----SPSPLSSRIRKVSTFPRLCSGADQSPQSASS  57

Query  266  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  445
            S+ S  SIVG LLDYLNESWTQFHATAEAKRQLI AGFHLLNEN+EW+LKPGGRYFFTRN
Sbjct  58   SAASGGSIVGGLLDYLNESWTQFHATAEAKRQLIDAGFHLLNENDEWNLKPGGRYFFTRN  117

Query  446  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  625
            MS L+AFA+G++Y +G+GF +IAAHTDSPC+KLKP+SAS KS YLMVNVQTYGGGLWHTW
Sbjct  118  MSCLIAFAVGERYDVGSGFQVIAAHTDSPCLKLKPKSASTKSNYLMVNVQTYGGGLWHTW  177

Query  626  FDRDLTVAGRVIL  664
            FDRDL+VAGRVI+
Sbjct  178  FDRDLSVAGRVIV  190



>ref|XP_002311031.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
 gb|EEE88398.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
Length=496

 Score =   253 bits (645),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IVGDLLDYLNESWTQFHATAEAKRQLI AGF LLNENEEW+LKPGGRYFFTRNMS LVAF
Sbjct  66   IVGDLLDYLNESWTQFHATAEAKRQLIDAGFDLLNENEEWELKPGGRYFFTRNMSCLVAF  125

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG+KYS+GNGFH+IAAHTDSPC+KLKPRSAS KS YLMVNVQTYGGGLWHTWFDRDL+V
Sbjct  126  AIGEKYSVGNGFHVIAAHTDSPCLKLKPRSASSKSSYLMVNVQTYGGGLWHTWFDRDLSV  185

Query  647  AGRVIL  664
            AGRVI+
Sbjct  186  AGRVIV  191



>gb|KCW51472.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=489

 Score =   252 bits (644),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 150/193 (78%), Gaps = 10/193 (5%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  265
             HLL+ P +S+ S L       L+P    + +  +S +R  S  P LCS +  +   A  
Sbjct  8    LHLLHPPTVSRPSFLF------LKP----SPSPLSSRIRKVSTFPRLCSGADQSPQSASS  57

Query  266  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  445
            S+ S  SIVG LLDYLNESWTQFHATAEAKRQLI AGFHLLNEN+EW+LKPGGRYFFTRN
Sbjct  58   SAASGGSIVGGLLDYLNESWTQFHATAEAKRQLIDAGFHLLNENDEWNLKPGGRYFFTRN  117

Query  446  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  625
            MS L+AFA+G++Y +G+GF +IAAHTDSPC+KLKP+SAS KS YLMVNVQTYGGGLWHTW
Sbjct  118  MSCLIAFAVGERYDVGSGFQVIAAHTDSPCLKLKPKSASTKSNYLMVNVQTYGGGLWHTW  177

Query  626  FDRDLTVAGRVIL  664
            FDRDL+VAGRVI+
Sbjct  178  FDRDLSVAGRVIV  190



>ref|XP_010543610.1| PREDICTED: probable aspartyl aminopeptidase [Tarenaya hassleriana]
Length=533

 Score =   253 bits (647),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 150/188 (80%), Gaps = 5/188 (3%)
 Frame = +2

Query  104  PPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVssesss  283
            P + K S+ L    H L    A+  N+  S LR+ S +P LCS    + P+   +   S+
Sbjct  14   PTIFKPSLFLR---HHLSRSLASPCNIHGSRLRSLSVSPVLCSQPHHS-PQGESNKPLSA  69

Query  284  sIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVA  463
            SIVGDLLDYLNESWTQFHATAEAKRQL+AAGF LL+ENE+W L+PGGRYFFTRNMS LVA
Sbjct  70   SIVGDLLDYLNESWTQFHATAEAKRQLLAAGFDLLSENEQWKLRPGGRYFFTRNMSCLVA  129

Query  464  FAIGKKYSI-GNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDL  640
            FA+G+KYS+ GNGFH+IAAHTDSPC+KLKP+SAS KSGYLMV+VQTYGGGLWHTWFDRDL
Sbjct  130  FAVGEKYSVAGNGFHVIAAHTDSPCLKLKPKSASSKSGYLMVSVQTYGGGLWHTWFDRDL  189

Query  641  TVAGRVIL  664
            +VAGR IL
Sbjct  190  SVAGRAIL  197



>ref|XP_002311016.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
 gb|EEE88383.2| hypothetical protein POPTR_0008s02250g [Populus trichocarpa]
Length=526

 Score =   253 bits (645),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IVGDLLDYLNESWTQFHATAEAKRQLI AGF LLNENEEW+LKPGGRYFFTRNMS LVAF
Sbjct  66   IVGDLLDYLNESWTQFHATAEAKRQLIDAGFDLLNENEEWELKPGGRYFFTRNMSCLVAF  125

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG+KYS+GNGFH+IAAHTDSPC+KLKPRSAS KS YLMVNVQTYGGGLWHTWFDRDL+V
Sbjct  126  AIGEKYSVGNGFHVIAAHTDSPCLKLKPRSASSKSSYLMVNVQTYGGGLWHTWFDRDLSV  185

Query  647  AGRVIL  664
            AGRVI+
Sbjct  186  AGRVIV  191



>ref|XP_007010330.1| Zn-dependent exopeptidases superfamily protein isoform 2 [Theobroma 
cacao]
 gb|EOY19140.1| Zn-dependent exopeptidases superfamily protein isoform 2 [Theobroma 
cacao]
Length=452

 Score =   251 bits (640),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNEN+EWDLKPGGRYFFTRNMS LVAF
Sbjct  60   IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENDEWDLKPGGRYFFTRNMSCLVAF  119

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG+KY +GNGFH+IAAHTDSPC+KLKP+SAS KS YLM+NVQTYGGGLWHTWFDRDL+V
Sbjct  120  AIGEKYIVGNGFHVIAAHTDSPCLKLKPKSASSKSNYLMLNVQTYGGGLWHTWFDRDLSV  179

Query  647  AGRVIL  664
            AGRVI+
Sbjct  180  AGRVIV  185



>ref|XP_010032079.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032080.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Eucalyptus 
grandis]
 ref|XP_010032081.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Eucalyptus 
grandis]
 gb|KCW51471.1| hypothetical protein EUGRSUZ_J00993 [Eucalyptus grandis]
Length=522

 Score =   252 bits (644),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 150/193 (78%), Gaps = 10/193 (5%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  265
             HLL+ P +S+ S L       L+P    + +  +S +R  S  P LCS +  +   A  
Sbjct  8    LHLLHPPTVSRPSFLF------LKP----SPSPLSSRIRKVSTFPRLCSGADQSPQSASS  57

Query  266  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  445
            S+ S  SIVG LLDYLNESWTQFHATAEAKRQLI AGFHLLNEN+EW+LKPGGRYFFTRN
Sbjct  58   SAASGGSIVGGLLDYLNESWTQFHATAEAKRQLIDAGFHLLNENDEWNLKPGGRYFFTRN  117

Query  446  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  625
            MS L+AFA+G++Y +G+GF +IAAHTDSPC+KLKP+SAS KS YLMVNVQTYGGGLWHTW
Sbjct  118  MSCLIAFAVGERYDVGSGFQVIAAHTDSPCLKLKPKSASTKSNYLMVNVQTYGGGLWHTW  177

Query  626  FDRDLTVAGRVIL  664
            FDRDL+VAGRVI+
Sbjct  178  FDRDLSVAGRVIV  190



>ref|XP_007010329.1| Zn-dependent exopeptidases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY19139.1| Zn-dependent exopeptidases superfamily protein isoform 1 [Theobroma 
cacao]
Length=520

 Score =   252 bits (643),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNEN+EWDLKPGGRYFFTRNMS LVAF
Sbjct  60   IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENDEWDLKPGGRYFFTRNMSCLVAF  119

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG+KY +GNGFH+IAAHTDSPC+KLKP+SAS KS YLM+NVQTYGGGLWHTWFDRDL+V
Sbjct  120  AIGEKYIVGNGFHVIAAHTDSPCLKLKPKSASSKSNYLMLNVQTYGGGLWHTWFDRDLSV  179

Query  647  AGRVIL  664
            AGRVI+
Sbjct  180  AGRVIV  185



>ref|XP_008788174.1| PREDICTED: probable aspartyl aminopeptidase [Phoenix dactylifera]
Length=533

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 138/155 (89%), Gaps = 1/155 (1%)
 Frame = +2

Query  200  RNFSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGF  379
            ++FSA    CS S D   E   + ESS SIVGDLLDYLNESWTQFHATAEAKRQLIAAGF
Sbjct  43   KSFSARRLFCSKS-DGPLEDSGAGESSPSIVGDLLDYLNESWTQFHATAEAKRQLIAAGF  101

Query  380  HLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSA  559
             LLNEN++WDL+PGGRYFFTRNMSSLVAFA+G+KY++G+GFH+IAAHTDSPC+KLKPRSA
Sbjct  102  RLLNENDDWDLQPGGRYFFTRNMSSLVAFAVGEKYNVGSGFHVIAAHTDSPCLKLKPRSA  161

Query  560  SCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            S KSG+LMVNVQTYG GLWHTWFDRDL+VAGRVIL
Sbjct  162  SSKSGFLMVNVQTYGSGLWHTWFDRDLSVAGRVIL  196



>ref|XP_010907133.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Elaeis 
guineensis]
Length=528

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/154 (79%), Positives = 136/154 (88%), Gaps = 1/154 (1%)
 Frame = +2

Query  200  RNFSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGF  379
            + FS     CS S D   E   + ESS SIVGDLLDYLNESWTQFHATAEAKRQLIAAGF
Sbjct  37   KGFSTRRLFCSQS-DGSLEDSGAGESSPSIVGDLLDYLNESWTQFHATAEAKRQLIAAGF  95

Query  380  HLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSA  559
             LLNEN++WDL+PGGRYFFTRNMSSLVAFA+G+KY++G+GFH+IAAHTDSPC+KLKPRSA
Sbjct  96   RLLNENDDWDLQPGGRYFFTRNMSSLVAFAVGEKYNVGSGFHVIAAHTDSPCLKLKPRSA  155

Query  560  SCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVI  661
            S KSG+LMVNVQTYGGGLWHTWFDRDL+VAGRVI
Sbjct  156  SSKSGFLMVNVQTYGGGLWHTWFDRDLSVAGRVI  189



>ref|XP_009390025.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=536

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 122/126 (97%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IVGDLLDYLNESWTQFHATAEAKRQLI AGFHLLNEN+EWDL+PGGRYFFTRNMS LVAF
Sbjct  73   IVGDLLDYLNESWTQFHATAEAKRQLIEAGFHLLNENDEWDLRPGGRYFFTRNMSCLVAF  132

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
             +G++YS+G+GFH+IAAHTDSPC+KLKPRSAS KSG+LMVNVQTYGGGLWHTWFDRDL+V
Sbjct  133  VVGERYSVGSGFHVIAAHTDSPCLKLKPRSASSKSGFLMVNVQTYGGGLWHTWFDRDLSV  192

Query  647  AGRVIL  664
            AGRVIL
Sbjct  193  AGRVIL  198



>ref|XP_008446766.1| PREDICTED: probable aspartyl aminopeptidase [Cucumis melo]
Length=527

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 143/193 (74%), Gaps = 11/193 (6%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  265
              LL+  P  KS  + SRFPH  R           S  R F     LCS S      +  
Sbjct  9    LQLLHFTPSLKSPSIFSRFPHFSR-----------SSPRKFLPPRLLCSVSDSTPQNSSS  57

Query  266  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  445
               SSSSIVGDLLDYLNESWTQFHATAEAKRQL+AAGFHLLNE+EEWDLKPGG YFFTRN
Sbjct  58   EVGSSSSIVGDLLDYLNESWTQFHATAEAKRQLVAAGFHLLNEDEEWDLKPGGCYFFTRN  117

Query  446  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  625
            MS LVAF+IG+KY  GNGFH+IAAHTDSPC+KLKP+S+S K   LMVNVQTYGGGLWHTW
Sbjct  118  MSCLVAFSIGEKYVPGNGFHVIAAHTDSPCLKLKPKSSSNKCNCLMVNVQTYGGGLWHTW  177

Query  626  FDRDLTVAGRVIL  664
            FDRDL+VAGRVI+
Sbjct  178  FDRDLSVAGRVIV  190



>ref|XP_010694702.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=507

 Score =   250 bits (638),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = +2

Query  206  FSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHL  385
            FS  P L SS++D + E   ++ESS SIVGD L+YLNESWTQFHATAEAKRQL+AAGFHL
Sbjct  42   FSVFPSL-SSNADQIHETSSNAESSGSIVGDFLNYLNESWTQFHATAEAKRQLLAAGFHL  100

Query  386  LNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASC  565
            LNE+EEW+LKPGGRYFFTRNMSSLVAF+IG+KY+ GNGFHIIAAHTDSPC+KLKP SAS 
Sbjct  101  LNESEEWELKPGGRYFFTRNMSSLVAFSIGEKYNAGNGFHIIAAHTDSPCLKLKPISASS  160

Query  566  KSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            K GYLM+NVQTYGGGLWHTWFDRDL+VAGRVI+
Sbjct  161  KPGYLMLNVQTYGGGLWHTWFDRDLSVAGRVIV  193



>ref|XP_010452373.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=530

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 140/161 (87%), Gaps = 4/161 (2%)
 Frame = +2

Query  185  RTSHLRNFSATPP-LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQ  361
            R+  LR+FS+  P LCSS +D+     + S+S++SIVGDLLDYLNESWTQFHATAEAKRQ
Sbjct  36   RSPFLRSFSSVSPILCSSQNDSRS---LGSDSNASIVGDLLDYLNESWTQFHATAEAKRQ  92

Query  362  LIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMK  541
            L+ AGF LL+ENE+W+LKPGGRYFFTRNMS LVAFA+G KY  GNGFH IAAHTDSPC+K
Sbjct  93   LLDAGFDLLSENEDWNLKPGGRYFFTRNMSCLVAFAVGDKYVPGNGFHAIAAHTDSPCLK  152

Query  542  LKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            LKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDLTVAGR I+
Sbjct  153  LKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRAIV  193



>ref|XP_010694701.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=529

 Score =   250 bits (639),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = +2

Query  206  FSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHL  385
            FS  P L SS++D + E   ++ESS SIVGD L+YLNESWTQFHATAEAKRQL+AAGFHL
Sbjct  42   FSVFPSL-SSNADQIHETSSNAESSGSIVGDFLNYLNESWTQFHATAEAKRQLLAAGFHL  100

Query  386  LNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASC  565
            LNE+EEW+LKPGGRYFFTRNMSSLVAF+IG+KY+ GNGFHIIAAHTDSPC+KLKP SAS 
Sbjct  101  LNESEEWELKPGGRYFFTRNMSSLVAFSIGEKYNAGNGFHIIAAHTDSPCLKLKPISASS  160

Query  566  KSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            K GYLM+NVQTYGGGLWHTWFDRDL+VAGRVI+
Sbjct  161  KPGYLMLNVQTYGGGLWHTWFDRDLSVAGRVIV  193



>ref|XP_010694703.1| PREDICTED: probable aspartyl aminopeptidase isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=505

 Score =   249 bits (637),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/153 (80%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = +2

Query  206  FSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHL  385
            FS  P L SS++D + E   ++ESS SIVGD L+YLNESWTQFHATAEAKRQL+AAGFHL
Sbjct  42   FSVFPSL-SSNADQIHETSSNAESSGSIVGDFLNYLNESWTQFHATAEAKRQLLAAGFHL  100

Query  386  LNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASC  565
            LNE+EEW+LKPGGRYFFTRNMSSLVAF+IG+KY+ GNGFHIIAAHTDSPC+KLKP SAS 
Sbjct  101  LNESEEWELKPGGRYFFTRNMSSLVAFSIGEKYNAGNGFHIIAAHTDSPCLKLKPISASS  160

Query  566  KSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            K GYLM+NVQTYGGGLWHTWFDRDL+VAGRVI+
Sbjct  161  KPGYLMLNVQTYGGGLWHTWFDRDLSVAGRVIV  193



>ref|XP_006398926.1| hypothetical protein EUTSA_v10013255mg [Eutrema salsugineum]
 gb|ESQ40379.1| hypothetical protein EUTSA_v10013255mg [Eutrema salsugineum]
Length=523

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 133/162 (82%), Gaps = 9/162 (6%)
 Frame = +2

Query  182  LRTSHLRNFSATPP-LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKR  358
            L  S  R+FS+  P LCSS S     A        SIVGDLLDYLNESWTQFHATAEAKR
Sbjct  33   LHRSPFRSFSSVSPILCSSHSHGDSNA--------SIVGDLLDYLNESWTQFHATAEAKR  84

Query  359  QLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCM  538
            QL+AAGFHLL+ENE+W LKPGGRYFFTRNMS LVAFA+G KY  GNGFH IAAHTDSPC+
Sbjct  85   QLLAAGFHLLSENEDWKLKPGGRYFFTRNMSCLVAFAVGDKYVPGNGFHAIAAHTDSPCL  144

Query  539  KLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            KLKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAGR I+
Sbjct  145  KLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAGRAIV  186



>ref|XP_011032849.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=526

 Score =   250 bits (638),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/126 (90%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IVGDLLDYLNESWTQFHATAEAKRQLI AGF LLNE+EEW+LKPGGRYFFTRNMS LVAF
Sbjct  66   IVGDLLDYLNESWTQFHATAEAKRQLIDAGFDLLNEHEEWELKPGGRYFFTRNMSCLVAF  125

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG+KYS+GNGFH+IAAHTDSPC+KLKPRSAS KS YLMVNVQTYGGGLWHTWFDRDL+V
Sbjct  126  AIGEKYSVGNGFHVIAAHTDSPCLKLKPRSASSKSSYLMVNVQTYGGGLWHTWFDRDLSV  185

Query  647  AGRVIL  664
            AGRVI+
Sbjct  186  AGRVIV  191



>ref|XP_010490993.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=530

 Score =   249 bits (637),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 140/161 (87%), Gaps = 4/161 (2%)
 Frame = +2

Query  185  RTSHLRNFSATPP-LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQ  361
            R+  LR+FS+  P LCSS SD+   +F  S+S+ SIVGDLLDYLNESWTQFHATAEAKRQ
Sbjct  36   RSPFLRSFSSVSPILCSSQSDS--RSF-GSDSNGSIVGDLLDYLNESWTQFHATAEAKRQ  92

Query  362  LIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMK  541
            L+ AGF LL+ENE+W LKPGGRYFFTRNMS LVAFA+GK+Y  GNGFH IAAHTDSPC+K
Sbjct  93   LLDAGFDLLSENEDWKLKPGGRYFFTRNMSCLVAFAVGKEYVSGNGFHAIAAHTDSPCLK  152

Query  542  LKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            LKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAGR I+
Sbjct  153  LKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAGRAIV  193



>ref|XP_011655834.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Cucumis 
sativus]
Length=527

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 144/193 (75%), Gaps = 11/193 (6%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  265
              LL+  P  KS  + SRFPH  R           S  R F     LCS S      +  
Sbjct  9    LQLLHFTPSLKSPSIFSRFPHFSR-----------SSPRKFFPPRLLCSVSDSTPQNSSS  57

Query  266  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  445
             + SSSSIVGDLLDYLNESWTQFHATAEAKRQL+AAGFHLL+E+EEWDLKPGG YFFTRN
Sbjct  58   EAGSSSSIVGDLLDYLNESWTQFHATAEAKRQLVAAGFHLLDEDEEWDLKPGGCYFFTRN  117

Query  446  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  625
            MS LVAF+IG+KY  GNGFH+IAAHTDSPC+KLKP+S+S K   LMVNVQTYGGGLWHTW
Sbjct  118  MSCLVAFSIGEKYVPGNGFHVIAAHTDSPCLKLKPKSSSNKCNCLMVNVQTYGGGLWHTW  177

Query  626  FDRDLTVAGRVIL  664
            FDRDL+VAGRVI+
Sbjct  178  FDRDLSVAGRVIV  190



>ref|XP_010423546.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=536

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 138/161 (86%), Gaps = 4/161 (2%)
 Frame = +2

Query  185  RTSHLRNFSATPP-LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQ  361
            R+  LR+FS+  P LCSS  D+ P   + S+S++SI GDLLDYLNESWTQFHATAEAKRQ
Sbjct  36   RSPFLRSFSSVSPILCSSQGDSRP---LGSDSNASIFGDLLDYLNESWTQFHATAEAKRQ  92

Query  362  LIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMK  541
            L+ AGF LL+ENE+W LKPGGRYFFTRNMS LVAFA+G KY  GNGFH IAAHTDSPC+K
Sbjct  93   LLDAGFDLLSENEDWKLKPGGRYFFTRNMSCLVAFAVGDKYVPGNGFHAIAAHTDSPCLK  152

Query  542  LKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            LKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAGR I+
Sbjct  153  LKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAGRAIV  193



>ref|XP_006287486.1| hypothetical protein CARUB_v10000697mg [Capsella rubella]
 gb|EOA20384.1| hypothetical protein CARUB_v10000697mg [Capsella rubella]
Length=529

 Score =   248 bits (633),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 138/162 (85%), Gaps = 4/162 (2%)
 Frame = +2

Query  182  LRTSHLRNFSATPP-LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKR  358
            L  S  R+FS+  P LCSS  D+     + S+S++SIVGDLLDYLNESWTQFHATAEAKR
Sbjct  34   LHRSPFRSFSSVSPILCSSQDDSRS---LGSDSNASIVGDLLDYLNESWTQFHATAEAKR  90

Query  359  QLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCM  538
            QL+AAGF LL+ENE+W LKPGGRYFFTRNMS LVAFA+G KY  GNGFH IAAHTDSPC+
Sbjct  91   QLLAAGFDLLSENEDWKLKPGGRYFFTRNMSCLVAFAVGDKYVPGNGFHAIAAHTDSPCL  150

Query  539  KLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            KLKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAGR I+
Sbjct  151  KLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAGRAIV  192



>ref|NP_196091.1| Zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
 emb|CAB86013.1| aspartyl aminopeptidase-like protein [Arabidopsis thaliana]
 dbj|BAB08975.1| aspartyl aminopeptidase [Arabidopsis thaliana]
 gb|AED90774.1| Zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
Length=526

 Score =   247 bits (631),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 139/162 (86%), Gaps = 4/162 (2%)
 Frame = +2

Query  182  LRTSHLRNFSATPP-LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKR  358
            L  S  R+FS+  P LC+S  D+       S+S++SIVGDLLDYLNESWTQFHATAEAKR
Sbjct  33   LHRSPFRSFSSVSPILCTSHRDSRSPG---SDSNASIVGDLLDYLNESWTQFHATAEAKR  89

Query  359  QLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCM  538
            QL+AAGF LL+ENE+W+LKPGGRYFFTRNMS LVAFA+G+KY  GNGFH IAAHTDSPC+
Sbjct  90   QLLAAGFDLLSENEDWNLKPGGRYFFTRNMSCLVAFAVGEKYVPGNGFHAIAAHTDSPCL  149

Query  539  KLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            KLKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAGR I+
Sbjct  150  KLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAGRAIV  191



>ref|XP_004150844.2| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Cucumis 
sativus]
 gb|KGN52197.1| hypothetical protein Csa_5G615200 [Cucumis sativus]
Length=527

 Score =   247 bits (631),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 143/193 (74%), Gaps = 11/193 (6%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  265
              LL+  P  KS  + SRFPH  R           S  R F     LCS S      +  
Sbjct  9    LQLLHFTPSLKSPSIFSRFPHFSR-----------SSPRKFFPPRLLCSVSDSTPQNSSS  57

Query  266  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  445
             + SSSSIVGDLLDYLNESWTQFHATAEAKRQL+AAGFHLL+E+EEWDLKPGG YFFTRN
Sbjct  58   EAGSSSSIVGDLLDYLNESWTQFHATAEAKRQLVAAGFHLLDEDEEWDLKPGGCYFFTRN  117

Query  446  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  625
            MS  VAF+IG+KY  GNGFH+IAAHTDSPC+KLKP+S+S K   LMVNVQTYGGGLWHTW
Sbjct  118  MSCFVAFSIGEKYVPGNGFHVIAAHTDSPCLKLKPKSSSNKCNCLMVNVQTYGGGLWHTW  177

Query  626  FDRDLTVAGRVIL  664
            FDRDL+VAGRVI+
Sbjct  178  FDRDLSVAGRVIV  190



>ref|XP_009122574.1| PREDICTED: probable aspartyl aminopeptidase [Brassica rapa]
Length=527

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 111/126 (88%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IVGDLLDYLNESWTQFHATAEAKRQL+AAGFHLLNENE+W+LKPGGRYFFTRNMS LVAF
Sbjct  64   IVGDLLDYLNESWTQFHATAEAKRQLLAAGFHLLNENEDWNLKPGGRYFFTRNMSCLVAF  123

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+G KY  GNGFH IAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+V
Sbjct  124  AVGDKYVPGNGFHAIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSV  183

Query  647  AGRVIL  664
            AGR I+
Sbjct  184  AGRAIV  189



>dbj|BAC43404.1| putative aspartyl aminopeptidase [Arabidopsis thaliana]
Length=526

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 138/162 (85%), Gaps = 4/162 (2%)
 Frame = +2

Query  182  LRTSHLRNFSATPP-LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKR  358
            L  S  R+FS+  P LC+S  D+       S+S++SIVGDLLDYLNESWTQFHATAEAKR
Sbjct  33   LHRSPFRSFSSVSPILCTSHRDSRSPG---SDSNASIVGDLLDYLNESWTQFHATAEAKR  89

Query  359  QLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCM  538
            Q +AAGF LL+ENE+W+LKPGGRYFFTRNMS LVAFA+G+KY  GNGFH IAAHTDSPC+
Sbjct  90   QFLAAGFDLLSENEDWNLKPGGRYFFTRNMSCLVAFAVGEKYVPGNGFHAIAAHTDSPCL  149

Query  539  KLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            KLKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAGR I+
Sbjct  150  KLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAGRAIV  191



>emb|CDY44874.1| BnaC09g50740D [Brassica napus]
Length=517

 Score =   245 bits (625),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 134/161 (83%), Gaps = 14/161 (9%)
 Frame = +2

Query  182  LRTSHLRNFSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQ  361
            L  S  R+FSA     SS SD+          ++SIVGDLLDYLNESWTQFHATAEAKRQ
Sbjct  34   LNRSPFRSFSAV----SSGSDS----------NASIVGDLLDYLNESWTQFHATAEAKRQ  79

Query  362  LIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMK  541
            L+AAGFHLL+ENE+W+LKPGGRYFFTRNMS LVAFA+G KY  GNGFH IAAHTDSPC+K
Sbjct  80   LLAAGFHLLSENEDWNLKPGGRYFFTRNMSCLVAFAVGDKYVPGNGFHAIAAHTDSPCLK  139

Query  542  LKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            LKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAGR I+
Sbjct  140  LKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAGRAIV  180



>ref|XP_006485213.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X1 [Citrus 
sinensis]
 ref|XP_006485214.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X2 [Citrus 
sinensis]
 gb|KDO42026.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=522

 Score =   244 bits (623),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 146/193 (76%), Gaps = 19/193 (10%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  265
            FH  Y     +++V+ S+  HS   F ++N   R   L NFS +                
Sbjct  12   FH--YPSSTVRTTVISSKLHHS---FPSSN-RYRPRTLHNFSTS-------------GIA  52

Query  266  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  445
             S SSSSIVGDLLDYLNESWT FHATAEAKR LI AGF LLNEN+EW+LKPGG YFFTRN
Sbjct  53   QSSSSSSIVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRN  112

Query  446  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  625
            MS LVAFA+G+KYS+GNGFHIIAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHTW
Sbjct  113  MSCLVAFAVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTW  172

Query  626  FDRDLTVAGRVIL  664
            FDRDLTVAGRVI+
Sbjct  173  FDRDLTVAGRVIV  185



>gb|KFK24913.1| hypothetical protein AALP_AA8G041200 [Arabis alpina]
Length=523

 Score =   244 bits (623),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 119/158 (75%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  191  SHLRNFSATPPLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIA  370
            S  R+FS   P+  SSS       + S+S++SIVGDLLDYLNESWTQFHATAEAKRQL+A
Sbjct  29   SRFRSFSTVSPILCSSSSQGDSKSLGSDSNASIVGDLLDYLNESWTQFHATAEAKRQLLA  88

Query  371  AGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKP  550
            AGF L++ENE+W LKPGGRYFFTRNMS LVAFA+G+KY  GNGFH IAAHTDSPC+KLKP
Sbjct  89   AGFDLISENEDWKLKPGGRYFFTRNMSCLVAFAVGEKYVPGNGFHAIAAHTDSPCLKLKP  148

Query  551  RSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            +SAS KSGYLMVNVQTYGGGLWHTWFDRDL+VAGR I+
Sbjct  149  KSASSKSGYLMVNVQTYGGGLWHTWFDRDLSVAGRAIV  186



>gb|KDO42029.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=510

 Score =   244 bits (622),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 146/193 (76%), Gaps = 19/193 (10%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  265
            FH  Y     +++V+ S+  HS   F ++N   R   L NFS +                
Sbjct  12   FH--YPSSTVRTTVISSKLHHS---FPSSN-RYRPRTLHNFSTS-------------GIA  52

Query  266  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  445
             S SSSSIVGDLLDYLNESWT FHATAEAKR LI AGF LLNEN+EW+LKPGG YFFTRN
Sbjct  53   QSSSSSSIVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRN  112

Query  446  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  625
            MS LVAFA+G+KYS+GNGFHIIAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHTW
Sbjct  113  MSCLVAFAVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTW  172

Query  626  FDRDLTVAGRVIL  664
            FDRDLTVAGRVI+
Sbjct  173  FDRDLTVAGRVIV  185



>ref|XP_006436621.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
 gb|ESR49861.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
Length=542

 Score =   244 bits (624),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 130/193 (67%), Positives = 146/193 (76%), Gaps = 19/193 (10%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  265
            FH  Y     +++V+ S+  HS   F ++N   R   L NFS +                
Sbjct  32   FH--YPSSTVRTTVISSKLHHS---FPSSN-RYRPRTLHNFSTS-------------GIA  72

Query  266  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  445
             S SSSSIVGDLLDYLNESWT FHATAEAKR LI AGF LLNEN+EW+LKPGG YFFTRN
Sbjct  73   QSSSSSSIVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRN  132

Query  446  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  625
            MS LVAFA+G+KYS+GNGFHIIAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHTW
Sbjct  133  MSCLVAFAVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTW  192

Query  626  FDRDLTVAGRVIL  664
            FDRDLTVAGRVI+
Sbjct  193  FDRDLTVAGRVIV  205



>ref|XP_004496198.1| PREDICTED: probable aspartyl aminopeptidase-like [Cicer arietinum]
Length=534

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 121/127 (95%), Gaps = 1/127 (1%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IV DLLDYLNESWT FHATAEAKRQLIAAGFHLL+ENEEW+LKPGGRYFFTRNMSSLVAF
Sbjct  71   IVNDLLDYLNESWTHFHATAEAKRQLIAAGFHLLDENEEWNLKPGGRYFFTRNMSSLVAF  130

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCK-SGYLMVNVQTYGGGLWHTWFDRDLT  643
            A+G+KY++G+GFH IAAHTDSPC+KLKP++AS K S YLMVNVQTYGGGLWHTWFDRDL+
Sbjct  131  AVGEKYNVGDGFHAIAAHTDSPCLKLKPKTASLKSSSYLMVNVQTYGGGLWHTWFDRDLS  190

Query  644  VAGRVIL  664
            VAGRVIL
Sbjct  191  VAGRVIL  197



>gb|AES62027.2| aspartyl aminopeptidase-like protein, putative [Medicago truncatula]
Length=526

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 119/127 (94%), Gaps = 1/127 (1%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IV DLLDYLNESWT FHATAEAKRQLIAAGFHLLNENEEW+LKPGGRYFFTRNMS LVAF
Sbjct  63   IVNDLLDYLNESWTHFHATAEAKRQLIAAGFHLLNENEEWNLKPGGRYFFTRNMSCLVAF  122

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCK-SGYLMVNVQTYGGGLWHTWFDRDLT  643
            A+G+KY +GNGF+ IAAHTDSPC+KLKP++AS K S Y+MVNVQTYGGGLWHTWFDRDL+
Sbjct  123  AVGQKYDVGNGFYAIAAHTDSPCLKLKPKTASLKASSYMMVNVQTYGGGLWHTWFDRDLS  182

Query  644  VAGRVIL  664
            VAGRVIL
Sbjct  183  VAGRVIL  189



>emb|CDX70207.1| BnaA10g25560D [Brassica napus]
Length=528

 Score =   240 bits (613),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IV DLLDYLNESWTQFHATAEAKRQL+AAGFHLL+EN++W+LKPGGRYFFTRNMS LVAF
Sbjct  65   IVDDLLDYLNESWTQFHATAEAKRQLLAAGFHLLSENDDWNLKPGGRYFFTRNMSCLVAF  124

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+G KY  GNGFH IAAHTDSPC+KLKP+SAS KSGYLMVNVQTYGGGLWHTWFDRDL+V
Sbjct  125  AVGDKYVPGNGFHAIAAHTDSPCLKLKPKSASSKSGYLMVNVQTYGGGLWHTWFDRDLSV  184

Query  647  AGRVIL  664
            AGR I+
Sbjct  185  AGRAIV  190



>ref|XP_006645339.1| PREDICTED: probable aspartyl aminopeptidase-like [Oryza brachyantha]
Length=525

 Score =   239 bits (611),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 145/188 (77%), Gaps = 12/188 (6%)
 Frame = +2

Query  131  LSRFPHSLRPFSAANA-----NLRTSHLRNFSATPP-----LCSSSSDAVPEAFVssess  280
            L R  H LRP +AA        L TS  R    T       LCS  + + P+A    ++S
Sbjct  3    LLRAHHLLRPRAAARPLSLPPPLSTSPCRRALPTTTSSWRLLCSHRTASPPDA--DGDAS  60

Query  281  ssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLV  460
             SIV DLLDYLNESWTQFHATAEAKRQL+ AGF LL+EN++WDL+PGGRYFFTRNMS L+
Sbjct  61   PSIVADLLDYLNESWTQFHATAEAKRQLLDAGFTLLSENDDWDLQPGGRYFFTRNMSCLI  120

Query  461  AFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDL  640
            AFA+G+KY +GNGF+IIAAHTDSPC+KLKPRSAS KSG+ MVNVQTYGGGLWHTWFDRDL
Sbjct  121  AFAVGEKYKLGNGFNIIAAHTDSPCLKLKPRSASFKSGHQMVNVQTYGGGLWHTWFDRDL  180

Query  641  TVAGRVIL  664
            T+AGRVIL
Sbjct  181  TLAGRVIL  188



>gb|EEC72239.1| hypothetical protein OsI_05355 [Oryza sativa Indica Group]
Length=493

 Score =   238 bits (608),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 130/147 (88%), Gaps = 1/147 (1%)
 Frame = +2

Query  224  LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEE  403
            LCS  + + P+    + +S SIV DLLDYLNESWTQFHATAEAKRQL+ AGF LL+EN++
Sbjct  44   LCSHHASSPPDD-APTSASPSIVADLLDYLNESWTQFHATAEAKRQLLDAGFTLLSENDD  102

Query  404  WDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLM  583
            WDL+PGGRYFFTRNMS L+AFA+G+KY +GNGF+IIAAHTDSPC+KLKPRSAS KSG+ M
Sbjct  103  WDLQPGGRYFFTRNMSCLIAFAVGEKYKLGNGFNIIAAHTDSPCLKLKPRSASFKSGHQM  162

Query  584  VNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            VNVQTYGGGLWHTWFDRDLT+AGRVIL
Sbjct  163  VNVQTYGGGLWHTWFDRDLTLAGRVIL  189



>ref|NP_001045513.1| Os01g0967900 [Oryza sativa Japonica Group]
 dbj|BAB85315.1| putative aspartyl aminopeptidase [Oryza sativa Japonica Group]
 dbj|BAF07427.1| Os01g0967900 [Oryza sativa Japonica Group]
 gb|EEE56077.1| hypothetical protein OsJ_04900 [Oryza sativa Japonica Group]
Length=525

 Score =   239 bits (610),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 131/147 (89%), Gaps = 1/147 (1%)
 Frame = +2

Query  224  LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEE  403
            LCS  + + PE   S+ +S SIV DLLDYLNESWTQFHATAEAKRQL+ AGF LL+EN++
Sbjct  44   LCSHHASSPPED-ASASASPSIVADLLDYLNESWTQFHATAEAKRQLLDAGFTLLSENDD  102

Query  404  WDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLM  583
            WDL+PGGRYFFTRNMS L+AFA+G+KY +GNGF+IIAAHTDSPC+KLKPRSAS KSG+ M
Sbjct  103  WDLQPGGRYFFTRNMSCLIAFAVGEKYKLGNGFNIIAAHTDSPCLKLKPRSASFKSGHQM  162

Query  584  VNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            VNVQTYGGGLWHTWFDRDLT+AGRVIL
Sbjct  163  VNVQTYGGGLWHTWFDRDLTLAGRVIL  189



>ref|XP_002873165.1| hypothetical protein ARALYDRAFT_487250 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49424.1| hypothetical protein ARALYDRAFT_487250 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/126 (86%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IVGDLLDYLNESWTQFHATAEAKRQL+AAGF LL+ENE+W LKPGGRYFFTRNMS LVAF
Sbjct  65   IVGDLLDYLNESWTQFHATAEAKRQLLAAGFDLLSENEDWKLKPGGRYFFTRNMSCLVAF  124

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+G+KY  GNGFH IAAHTDSPC+KLKP+SAS K GYLMVNVQTYGGGLWHTWFDRDL+V
Sbjct  125  AVGEKYVPGNGFHAIAAHTDSPCLKLKPKSASSKFGYLMVNVQTYGGGLWHTWFDRDLSV  184

Query  647  AGRVIL  664
            AGR I+
Sbjct  185  AGRAIV  190



>ref|XP_007143804.1| hypothetical protein PHAVU_007G103100g [Phaseolus vulgaris]
 gb|ESW15798.1| hypothetical protein PHAVU_007G103100g [Phaseolus vulgaris]
Length=527

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IV DLL YLN SWTQFHATAEAKRQL+AAGFH+LNEN++WDLKPGGRYFFTRNMS LVAF
Sbjct  65   IVPDLLQYLNHSWTQFHATAEAKRQLLAAGFHMLNENQDWDLKPGGRYFFTRNMSCLVAF  124

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+G+KY++G+GFH+IAAHTDSPC+KLKP++ASCK  Y MVNVQTYG GLW+TWFDRDL+V
Sbjct  125  AVGEKYNVGDGFHVIAAHTDSPCLKLKPKTASCKCNYSMVNVQTYGAGLWYTWFDRDLSV  184

Query  647  AGRVIL  664
            AGRVIL
Sbjct  185  AGRVIL  190



>gb|ERN13067.1| hypothetical protein AMTR_s00040p00143220 [Amborella trichopoda]
Length=546

 Score =   237 bits (604),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 122/199 (61%), Positives = 151/199 (76%), Gaps = 14/199 (7%)
 Frame = +2

Query  110  LSKSSVLLS-RFPHSLRPFSAA-NANLRTSHLRNFSATPPL--------CSS----SSDA  247
            L+ S ++ S R      PFS   +++ R   L  FSATP +        CS+    SS+ 
Sbjct  9    LNPSPIITSPRICRGRTPFSTILSSDFRGLKLHGFSATPRIPFFLPKLYCSNGELVSSEN  68

Query  248  VPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGR  427
                  SS S  SI+G++LD+LNESWTQFHATAEAKRQL+AAGFH+LNEN+EWD+KPGGR
Sbjct  69   QSFETSSSRSPFSIIGEMLDFLNESWTQFHATAEAKRQLLAAGFHMLNENDEWDIKPGGR  128

Query  428  YFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGG  607
            YFFTRNMS L+AF++G+KY+ G+GFH++AAHTDSPC KLKP +AS KSG+LMVN+QTYG 
Sbjct  129  YFFTRNMSCLIAFSVGEKYNAGSGFHVVAAHTDSPCPKLKPITASSKSGFLMVNIQTYGA  188

Query  608  GLWHTWFDRDLTVAGRVIL  664
            GLWHTWFDRDL+VAGRVIL
Sbjct  189  GLWHTWFDRDLSVAGRVIL  207



>ref|XP_003565148.1| PREDICTED: probable aspartyl aminopeptidase [Brachypodium distachyon]
Length=520

 Score =   236 bits (602),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 119/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IVG LLDYLNESWTQFHATAEAKRQL+ AGF LL+EN++WDL+PGGRYFFTRNMS LVAF
Sbjct  58   IVGGLLDYLNESWTQFHATAEAKRQLLDAGFKLLSENDDWDLQPGGRYFFTRNMSCLVAF  117

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+G+KY +GNGF+IIAAHTDSPC+KLKP+SAS KSG+ MVNVQTYGGGLWHTWFDRDLT+
Sbjct  118  AVGEKYRVGNGFNIIAAHTDSPCLKLKPKSASFKSGHQMVNVQTYGGGLWHTWFDRDLTL  177

Query  647  AGRVIL  664
            AGRVIL
Sbjct  178  AGRVIL  183



>gb|EPS58587.1| aspartyl aminopeptidase, partial [Genlisea aurea]
Length=468

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DLLDYLNESWTQFHATAEAKRQLIA+GFHLL+ENEEW+LK GGRYFFTRNMSSLVAF
Sbjct  6    LVRDLLDYLNESWTQFHATAEAKRQLIASGFHLLDENEEWNLKAGGRYFFTRNMSSLVAF  65

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+G++YS  NGFH+IAAHTDSPC+KLKP+SAS K+GYLMV VQTYG GLWHTWFDRDL++
Sbjct  66   AVGERYSGSNGFHVIAAHTDSPCLKLKPKSASSKAGYLMVGVQTYGAGLWHTWFDRDLSL  125

Query  647  AGRVIL  664
             GRVI+
Sbjct  126  GGRVIV  131



>dbj|BAJ86698.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=513

 Score =   231 bits (588),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IVG LLDYLNESWTQFHATAEAK+QL+ AGF LL+EN++W+L+PGGRYFFTRNMS LVAF
Sbjct  51   IVGGLLDYLNESWTQFHATAEAKKQLLEAGFELLSENDDWNLQPGGRYFFTRNMSCLVAF  110

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+G+KY +GNGF+IIAAHTDSPC+KLKPRS+S KSG+ MV VQTYGGGLWHTWFDRDLT+
Sbjct  111  AVGEKYRVGNGFNIIAAHTDSPCLKLKPRSSSFKSGHQMVGVQTYGGGLWHTWFDRDLTL  170

Query  647  AGRVIL  664
            AGRVIL
Sbjct  171  AGRVIL  176



>ref|XP_002457006.1| hypothetical protein SORBIDRAFT_03g047100 [Sorghum bicolor]
 gb|EES02126.1| hypothetical protein SORBIDRAFT_03g047100 [Sorghum bicolor]
Length=524

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/126 (83%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IV  LLDYLNESWTQFHATAEAKRQL+ AGF LL+E+++WDL+PGGRYFFTRNMS LVAF
Sbjct  63   IVAGLLDYLNESWTQFHATAEAKRQLLDAGFKLLSESDDWDLQPGGRYFFTRNMSCLVAF  122

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG+KY +GNGF+IIAAHTDSPC+KLKPRSA+ KSG+ MVNVQTYG GLWHTWFDRDLT+
Sbjct  123  AIGEKYRVGNGFNIIAAHTDSPCLKLKPRSATIKSGHQMVNVQTYGSGLWHTWFDRDLTL  182

Query  647  AGRVIL  664
            AGRVIL
Sbjct  183  AGRVIL  188



>ref|XP_003556268.2| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=539

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IV DLL YLN SWTQFHATAEAKRQL+AAGFH+L+EN +W LKPGGRYFFTRNMS LVAF
Sbjct  75   IVPDLLHYLNHSWTQFHATAEAKRQLLAAGFHMLDENHDWHLKPGGRYFFTRNMSCLVAF  134

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG KY++G+GFH+IAAHTDSPC+KLKP++ASCK  Y MVNVQTYG GLW+TWFDRDL+V
Sbjct  135  AIGDKYNVGDGFHVIAAHTDSPCLKLKPKTASCKCNYSMVNVQTYGAGLWYTWFDRDLSV  194

Query  647  AGRVIL  664
            AGRVIL
Sbjct  195  AGRVIL  200



>gb|KHN00906.1| Aspartyl aminopeptidase [Glycine soja]
Length=518

 Score =   230 bits (587),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/126 (81%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IV DLL YLN SWTQFHATAEAKRQL+AAGFH+L+EN +W LKPGGRYFFTRNMS LVAF
Sbjct  54   IVPDLLHYLNHSWTQFHATAEAKRQLLAAGFHMLDENHDWHLKPGGRYFFTRNMSCLVAF  113

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG KY++G+GFH+IAAHTDSPC+KLKP++ASCK  Y MVNVQTYG GLW+TWFDRDL+V
Sbjct  114  AIGDKYNVGDGFHVIAAHTDSPCLKLKPKTASCKCNYSMVNVQTYGAGLWYTWFDRDLSV  173

Query  647  AGRVIL  664
            AGRVIL
Sbjct  174  AGRVIL  179



>ref|XP_011625955.1| PREDICTED: probable aspartyl aminopeptidase [Amborella trichopoda]
Length=461

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +2

Query  299  LLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGK  478
            +LD+LNESWTQFHATAEAKRQL+AAGFH+LNEN+EWD+KPGGRYFFTRNMS L+AF++G+
Sbjct  1    MLDFLNESWTQFHATAEAKRQLLAAGFHMLNENDEWDIKPGGRYFFTRNMSCLIAFSVGE  60

Query  479  KYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRV  658
            KY+ G+GFH++AAHTDSPC KLKP +AS KSG+LMVN+QTYG GLWHTWFDRDL+VAGRV
Sbjct  61   KYNAGSGFHVVAAHTDSPCPKLKPITASSKSGFLMVNIQTYGAGLWHTWFDRDLSVAGRV  120

Query  659  IL  664
            IL
Sbjct  121  IL  122



>ref|XP_004971394.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X1 [Setaria 
italica]
Length=525

 Score =   229 bits (584),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/148 (74%), Positives = 124/148 (84%), Gaps = 10/148 (7%)
 Frame = +2

Query  221  PLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENE  400
            PL +SSS A P           IV  LLDYLNESWT FHATAEAKRQL+ AGF LL+E++
Sbjct  52   PLDASSSAAPPS----------IVAGLLDYLNESWTHFHATAEAKRQLLDAGFKLLSESD  101

Query  401  EWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYL  580
            +WDL+PGGRYFFTRNMS LVAFAIG+KY +GNGF+IIAAHTDSPC+KLKPRSA+ KSG+ 
Sbjct  102  DWDLQPGGRYFFTRNMSCLVAFAIGEKYRVGNGFNIIAAHTDSPCLKLKPRSATFKSGHQ  161

Query  581  MVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            MVNVQTYG GLWHTWFDRDLT+AGRVIL
Sbjct  162  MVNVQTYGSGLWHTWFDRDLTLAGRVIL  189



>gb|KHN37829.1| Aspartyl aminopeptidase [Glycine soja]
Length=500

 Score =   227 bits (578),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 125/147 (85%), Gaps = 6/147 (4%)
 Frame = +2

Query  224  LCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEE  403
             CS +S++ P        SSSIV +LL YLN S TQFHATAEAK+QL+AAGFH+LNEN++
Sbjct  43   FCSINSNSAPHG------SSSIVTNLLHYLNHSCTQFHATAEAKQQLLAAGFHMLNENKD  96

Query  404  WDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLM  583
            W LKPGGRYFFTRNMS L+AFAIG KY++G+GFH+IAAHTDSPC+KLKP++ASCK  Y M
Sbjct  97   WHLKPGGRYFFTRNMSCLIAFAIGDKYNVGDGFHVIAAHTDSPCLKLKPKTASCKCNYSM  156

Query  584  VNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            VNVQTYG GLW+TWFDRDL+VAGRVIL
Sbjct  157  VNVQTYGAGLWYTWFDRDLSVAGRVIL  183



>ref|XP_003591776.1| Aspartyl aminopeptidase [Medicago truncatula]
Length=550

 Score =   227 bits (579),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 119/151 (79%), Gaps = 25/151 (17%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHAT------------------------AEAKRQLIAAGFHLLNE  394
            IV DLLDYLNESWT FHAT                        AEAKRQLIAAGFHLLNE
Sbjct  63   IVNDLLDYLNESWTHFHATGTVPSFHSYYSSILPKLTFFISCVAEAKRQLIAAGFHLLNE  122

Query  395  NEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCK-S  571
            NEEW+LKPGGRYFFTRNMS LVAFA+G+KY +GNGF+ IAAHTDSPC+KLKP++AS K S
Sbjct  123  NEEWNLKPGGRYFFTRNMSCLVAFAVGQKYDVGNGFYAIAAHTDSPCLKLKPKTASLKAS  182

Query  572  GYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
             Y+MVNVQTYGGGLWHTWFDRDL+VAGRVIL
Sbjct  183  SYMMVNVQTYGGGLWHTWFDRDLSVAGRVIL  213



>ref|XP_004971395.1| PREDICTED: probable aspartyl aminopeptidase-like isoform X2 [Setaria 
italica]
Length=523

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 123/148 (83%), Gaps = 12/148 (8%)
 Frame = +2

Query  221  PLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENE  400
            PL +SSS A P           IV  LLDYLNESWT FHATAEAKRQL+ AGF LL+E++
Sbjct  52   PLDASSSAAPPS----------IVAGLLDYLNESWTHFHATAEAKRQLLDAGFKLLSESD  101

Query  401  EWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYL  580
            +WDL+PGGRYFFTRNMS LVAFAIG+K  +GNGF+IIAAHTDSPC+KLKPRSA+ KSG+ 
Sbjct  102  DWDLQPGGRYFFTRNMSCLVAFAIGEK--VGNGFNIIAAHTDSPCLKLKPRSATFKSGHQ  159

Query  581  MVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            MVNVQTYG GLWHTWFDRDLT+AGRVIL
Sbjct  160  MVNVQTYGSGLWHTWFDRDLTLAGRVIL  187



>ref|XP_001751765.1| predicted protein [Physcomitrella patens]
 gb|EDQ83200.1| predicted protein, partial [Physcomitrella patens]
Length=471

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 111/126 (88%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IV D+L++LNESWT FHATAEAKRQL+ AGF  LNE +EW ++PGGRYFFTRNMSS+ AF
Sbjct  2    IVTDMLNFLNESWTPFHATAEAKRQLLKAGFQQLNEEQEWTVQPGGRYFFTRNMSSIFAF  61

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG+KY  GNGF+I+AAHTDSPC KLKP SA+ K+G+L V VQTYGGGLWHTWFDRDL+V
Sbjct  62   AIGQKYEAGNGFNIVAAHTDSPCPKLKPVSAASKAGFLNVGVQTYGGGLWHTWFDRDLSV  121

Query  647  AGRVIL  664
            AGRV+L
Sbjct  122  AGRVLL  127



>ref|XP_003055398.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH60650.1| predicted protein [Micromonas pusilla CCMP1545]
Length=476

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 105/126 (83%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            I  +L+DYLN SWT FHAT+E+ R L AAGF  L+E E WDLKPGG+YFFTRNMSS+VAF
Sbjct  12   IATELVDYLNASWTSFHATSESSRMLAAAGFERLSEKESWDLKPGGKYFFTRNMSSIVAF  71

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+G+KY+ GNGF+II AHTDSPC KLKP SA  K G+L V VQTYGGGLWHTWFDRDL+V
Sbjct  72   AVGEKYAPGNGFNIIGAHTDSPCPKLKPVSAIKKGGFLSVGVQTYGGGLWHTWFDRDLSV  131

Query  647  AGRVIL  664
             G+V+L
Sbjct  132  GGKVLL  137



>ref|XP_002975004.1| hypothetical protein SELMODRAFT_442726 [Selaginella moellendorffii]
 gb|EFJ23789.1| hypothetical protein SELMODRAFT_442726 [Selaginella moellendorffii]
Length=477

 Score =   199 bits (506),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +2

Query  248  VPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGR  427
            +PE    +E  +SI+ D L +LN SWT FHAT EAK+ L+ AGF  LNE +EW ++PGGR
Sbjct  1    MPEEPPKTEEDTSILSDFLCFLNASWTPFHATMEAKKLLLDAGFLQLNEEDEWSIEPGGR  60

Query  428  YFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGG  607
            YFFTRNMS+LVAFAIG+KY  GNGFH++AAHTDSPC KLKP SA  KSG+L + VQTYGG
Sbjct  61   YFFTRNMSTLVAFAIGQKYQTGNGFHVVAAHTDSPCPKLKPVSALSKSGFLNLGVQTYGG  120

Query  608  GLWHTWFDRDLTVAGRVIL  664
            GLWHTWFDRDL+VAGR ++
Sbjct  121  GLWHTWFDRDLSVAGRALV  139



>gb|KHN31910.1| Aspartyl aminopeptidase [Glycine soja]
Length=413

 Score =   192 bits (489),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  D++D+LN S T FHA  EAKR+L +AG+H L+E E W L+PG +YFFTRN S++VAF
Sbjct  10   VASDMIDFLNASPTAFHAVDEAKRRLRSAGYHQLSEREPWKLQPGNKYFFTRNHSTIVAF  69

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHII AHTDSPC+KLKP +   K+G L V VQTYGGGLWHTWFDRDLTV
Sbjct  70   AIGKKYVSGNGFHIIGAHTDSPCLKLKPVTKVVKAGILEVGVQTYGGGLWHTWFDRDLTV  129

Query  647  AGRVIL  664
            AGRVI+
Sbjct  130  AGRVIV  135



>ref|XP_003523136.1| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=487

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  D++D+LN S T FHA  EAKR+L +AG+H L+E E W L+PG +YFFTRN S++VAF
Sbjct  10   VASDMIDFLNASPTAFHAVDEAKRRLRSAGYHQLSEREPWKLQPGNKYFFTRNHSTIVAF  69

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHII AHTDSPC+KLKP +   K+G L V VQTYGGGLWHTWFDRDLTV
Sbjct  70   AIGKKYVSGNGFHIIGAHTDSPCLKLKPVTKVVKAGILEVGVQTYGGGLWHTWFDRDLTV  129

Query  647  AGRVIL  664
            AGRVI+
Sbjct  130  AGRVIV  135



>ref|XP_002507546.1| aspartyl aminopeptidase [Micromonas sp. RCC299]
 gb|ACO68804.1| aspartyl aminopeptidase [Micromonas sp. RCC299]
Length=500

 Score =   192 bits (488),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 115/156 (74%), Gaps = 13/156 (8%)
 Frame = +2

Query  206  FSATP---PLCSSSSDAVPEAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAG  376
            F+++P    L S+SS  VP A            +L++++N SWT +HATA   R+L AAG
Sbjct  5    FASSPANRDLLSTSSSRVPPA----------AQELVEFINNSWTSYHATATTARKLEAAG  54

Query  377  FHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRS  556
            F  LNE +EW+L PGG+YFFTRNMSS+VAFA+G KY  GNG HII AHTDSPC KLKP S
Sbjct  55   FVRLNERDEWNLIPGGKYFFTRNMSSIVAFAVGAKYVPGNGIHIIGAHTDSPCPKLKPVS  114

Query  557  ASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            +  KSG+L V VQTYGGGLWHTWFDRDL+VAG+V+L
Sbjct  115  SITKSGFLEVGVQTYGGGLWHTWFDRDLSVAGKVVL  150



>ref|XP_003526970.1| PREDICTED: probable aspartyl aminopeptidase-like [Glycine max]
Length=487

 Score =   191 bits (486),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  DL+D+LN S T FHA  EAKR+L +AG+H L+E E W+L+PG +YFFTRN S++VAF
Sbjct  10   VASDLIDFLNASPTAFHAVDEAKRRLRSAGYHQLSEREVWELQPGNKYFFTRNHSTIVAF  69

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGF+II AHTDSPC+KLKP +   K+G L V VQTYGGGLWHTWFDRDLTV
Sbjct  70   AIGKKYVAGNGFYIIGAHTDSPCLKLKPVTKVVKAGILEVGVQTYGGGLWHTWFDRDLTV  129

Query  647  AGRVIL  664
            AGRVI+
Sbjct  130  AGRVIV  135



>ref|XP_003578741.1| PREDICTED: probable aspartyl aminopeptidase [Brachypodium distachyon]
Length=475

 Score =   191 bits (484),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVA  463
            +V DL+DYLN S T FHA  EAKR+L AAGF  L+E +EW  L+PG +YFFTRN S++VA
Sbjct  8    VVSDLIDYLNASPTAFHAVVEAKRKLKAAGFTQLSERDEWAGLEPGKKYFFTRNHSTIVA  67

Query  464  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  643
            FAIG KY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLW+TWFDRDLT
Sbjct  68   FAIGAKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGYLEVGVQTYGGGLWYTWFDRDLT  127

Query  644  VAGRVIL  664
            +AGRVI+
Sbjct  128  IAGRVIV  134



>ref|XP_006664453.1| PREDICTED: probable aspartyl aminopeptidase-like [Oryza brachyantha]
Length=474

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVA  463
            +V DL+D+LN S T FHA  EAKR+L AAGF  L+E EEW  L+PG +YFFTRN S++VA
Sbjct  7    VVCDLVDFLNASPTAFHAVDEAKRRLKAAGFSQLSEREEWVGLEPGRKYFFTRNHSTIVA  66

Query  464  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  643
            FAIG +Y  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT
Sbjct  67   FAIGAQYVAGNGFHIIGAHTDSPCLKLKPVSMVTKGGYLEVGVQTYGGGLWHTWFDRDLT  126

Query  644  VAGRVIL  664
            VAGRVI+
Sbjct  127  VAGRVIV  133



>ref|XP_004960722.1| PREDICTED: probable aspartyl aminopeptidase-like [Setaria italica]
Length=475

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVA  463
            +V DL+D+LN S T FHA  EAKR+L AAGF  L+E EEW  L+PG +YFFTRN S++VA
Sbjct  7    VVSDLVDFLNASPTAFHAVDEAKRRLKAAGFAQLSEREEWAGLEPGRKYFFTRNYSTIVA  66

Query  464  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  643
            FAIG KY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLW+TWFDRDLT
Sbjct  67   FAIGAKYVAGNGFHIIGAHTDSPCLKLKPVSKVTKGGYLEVGVQTYGGGLWYTWFDRDLT  126

Query  644  VAGRVIL  664
            VAGRVI+
Sbjct  127  VAGRVII  133



>ref|XP_010674696.1| PREDICTED: probable aspartyl aminopeptidase [Beta vulgaris subsp. 
vulgaris]
Length=487

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/126 (67%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  DL+D+LN S T FHA  EAKR+L  AGF  L+E E+W L+ G +YFFTRN S++VAF
Sbjct  10   VASDLIDFLNASPTAFHAVDEAKRRLKDAGFEQLSEREDWSLQAGKKYFFTRNYSTIVAF  69

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDL V
Sbjct  70   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSKVTKGGYLEVGVQTYGGGLWHTWFDRDLAV  129

Query  647  AGRVIL  664
            AGRV++
Sbjct  130  AGRVVV  135



>ref|XP_008673044.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN26704.1| unknown [Zea mays]
 gb|ACN27911.1| unknown [Zea mays]
 tpg|DAA58398.1| TPA: hypothetical protein ZEAMMB73_107325 [Zea mays]
Length=475

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 102/127 (80%), Gaps = 1/127 (1%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVA  463
            +V DL+D+LN S T FHA  EAKR+L AAGF  L+E EEW  L+PG +YFFTRN S++VA
Sbjct  7    VVSDLVDFLNASPTAFHAVDEAKRRLKAAGFVQLSEREEWAGLEPGRKYFFTRNHSTIVA  66

Query  464  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  643
            FAIG KY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLW+TWFDRDLT
Sbjct  67   FAIGAKYVAGNGFHIIGAHTDSPCLKLKPVSKVTKGGYLEVGVQTYGGGLWYTWFDRDLT  126

Query  644  VAGRVIL  664
            VAGRVI+
Sbjct  127  VAGRVII  133



>ref|XP_002949870.1| hypothetical protein VOLCADRAFT_104511 [Volvox carteri f. nagariensis]
 gb|EFJ48973.1| hypothetical protein VOLCADRAFT_104511, partial [Volvox carteri 
f. nagariensis]
Length=320

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 102/123 (83%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +L+D+LN +WT FHA  EA++ L+AAGF  L E + WD+ PGGRYFFTRN +++VAFA+G
Sbjct  10   ELVDFLNAAWTPFHAVDEARKMLLAAGFKHLQEKDAWDINPGGRYFFTRNATTIVAFAVG  69

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
            KKY+ GNGF++I AHTDSPC+KLKP S S KS  LM+NV+TYGGGLW TWFDR+L VAGR
Sbjct  70   KKYAPGNGFYMIGAHTDSPCLKLKPVSKSTKSDCLMLNVETYGGGLWSTWFDRELGVAGR  129

Query  656  VIL  664
            V++
Sbjct  130  VLV  132



>ref|XP_009379936.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=476

 Score =   188 bits (478),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            I  DL+D+LN S T FHA  EAK++L  AGF  L+E E+W L+PGG+YFFTRN S++V F
Sbjct  7    IALDLVDFLNASPTNFHAVDEAKKRLKQAGFVHLSEREDWVLEPGGKYFFTRNHSTVVTF  66

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHII AHTDSPC+K+KP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  67   AIGKKYVAGNGFHIIGAHTDSPCLKVKPVSKVTKGGYLEVGVQTYGGGLWHTWFDRDLTL  126

Query  647  AGRVI  661
            AGRVI
Sbjct  127  AGRVI  131



>ref|XP_002458215.1| hypothetical protein SORBIDRAFT_03g029130 [Sorghum bicolor]
 gb|EES03335.1| hypothetical protein SORBIDRAFT_03g029130 [Sorghum bicolor]
Length=475

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 101/126 (80%), Gaps = 1/126 (1%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVA  463
            +V DL+D+LN S T FHA  EAKR+L AAGF  L+E EEW  L+PG +YFFTRN S++VA
Sbjct  7    VVSDLVDFLNVSPTAFHAVDEAKRRLKAAGFVQLSEREEWAGLEPGRKYFFTRNHSTIVA  66

Query  464  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  643
            FAIG KY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLW+TWFDRDLT
Sbjct  67   FAIGAKYVAGNGFHIIGAHTDSPCLKLKPVSKVTKGGYLEVGVQTYGGGLWYTWFDRDLT  126

Query  644  VAGRVI  661
            VAGRVI
Sbjct  127  VAGRVI  132



>ref|XP_006476998.1| PREDICTED: probable aspartyl aminopeptidase-like [Citrus sinensis]
Length=483

 Score =   188 bits (477),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IV D L +LN S T FHA  EAKR+L   G+  ++E E+W+L+ G RYFFTRN S+++AF
Sbjct  18   IVSDFLHFLNASPTAFHAVDEAKRRLQTVGYQQISEREDWELEAGKRYFFTRNHSTIIAF  77

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+GKKY  GNGFH++ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLTV
Sbjct  78   AVGKKYVAGNGFHVVGAHTDSPCLKLKPVSKVTKGGYLEVGVQTYGGGLWHTWFDRDLTV  137

Query  647  AGRVIL  664
            AGRVI+
Sbjct  138  AGRVII  143



>ref|XP_002967289.1| hypothetical protein SELMODRAFT_86972 [Selaginella moellendorffii]
 gb|EFJ31888.1| hypothetical protein SELMODRAFT_86972 [Selaginella moellendorffii]
Length=519

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V +L+++LN S T FHAT EA+R L+ +GF  LNE EEW+L+PGGRYFFTRNMSS+ AF
Sbjct  52   VVPNLIEFLNNSTTPFHATLEARRHLLESGFQQLNECEEWELQPGGRYFFTRNMSSIFAF  111

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG+KY  G GFH++AAHTDSPC KLKP SA+ K G+L V VQ YG GLW+TWFDRDL+V
Sbjct  112  AIGRKYKPGGGFHVLAAHTDSPCPKLKPVSAATKGGFLRVRVQAYGTGLWNTWFDRDLSV  171

Query  647  AGRVI  661
            AGRV+
Sbjct  172  AGRVL  176



>ref|XP_002960428.1| hypothetical protein SELMODRAFT_164111 [Selaginella moellendorffii]
 gb|EFJ37967.1| hypothetical protein SELMODRAFT_164111 [Selaginella moellendorffii]
Length=516

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V +L+++LN S T FHAT EA+R L+ +GF  LNE EEW+L+PGGRYFFTRNMSS+ AF
Sbjct  52   VVPNLIEFLNNSTTPFHATLEARRHLLESGFQQLNECEEWELQPGGRYFFTRNMSSIFAF  111

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG+KY  G GFH++AAHTDSPC KLKP SA+ K G+L V VQ YG GLW+TWFDRDL+V
Sbjct  112  AIGRKYKPGGGFHVLAAHTDSPCPKLKPVSAATKGGFLRVRVQAYGTGLWNTWFDRDLSV  171

Query  647  AGRVI  661
            AGRV+
Sbjct  172  AGRVL  176



>ref|XP_007209960.1| hypothetical protein PRUPE_ppa004869mg [Prunus persica]
 gb|EMJ11159.1| hypothetical protein PRUPE_ppa004869mg [Prunus persica]
Length=488

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+++LN S T FHA  EAK++L  AG+  ++E E+W L+ G +YFFTRN S++VAF
Sbjct  13   VVSDLINFLNASPTAFHAVDEAKKRLQNAGYEPVSEREDWKLEAGKKYFFTRNYSTIVAF  72

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  73   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSKVVKGGYLEVGVQTYGGGLWHTWFDRDLTI  132

Query  647  AGRVIL  664
            AGRVI+
Sbjct  133  AGRVIV  138



>ref|XP_004236341.1| PREDICTED: probable aspartyl aminopeptidase [Solanum lycopersicum]
Length=482

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  DL+D+LN S T FHA  EAK++L +AG+  ++E  +WDLK G +YFFTRN S++VAF
Sbjct  6    VASDLVDFLNASPTAFHAVDEAKKRLKSAGYVQIDEKLDWDLKAGNKYFFTRNYSTIVAF  65

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHI+ AHTDSPC+KLKP +   KSG+L V VQTYGGGLWHTWFDRDLTV
Sbjct  66   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVTKVIKSGFLEVGVQTYGGGLWHTWFDRDLTV  125

Query  647  AGRVIL  664
            AGR+I+
Sbjct  126  AGRMII  131



>gb|ERM93848.1| hypothetical protein AMTR_s00138p00076250 [Amborella trichopoda]
Length=215

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            I  DL+D+LN S T FHA  EAK+ L   GF  L+E ++W L  GG+YFFTRN S++VAF
Sbjct  9    IASDLIDFLNASPTAFHAVDEAKKLLKEEGFQQLSERDDWSLSAGGKYFFTRNHSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
             IG+ Y  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLTV
Sbjct  69   VIGESYVAGNGFHIIGAHTDSPCLKLKPISKVTKGGYLEVGVQTYGGGLWHTWFDRDLTV  128

Query  647  AGRVIL  664
            AGR+++
Sbjct  129  AGRMLI  134



>ref|XP_002950223.1| hypothetical protein VOLCADRAFT_104613 [Volvox carteri f. nagariensis]
 gb|EFJ48891.1| hypothetical protein VOLCADRAFT_104613 [Volvox carteri f. nagariensis]
Length=430

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = +2

Query  299  LLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGK  478
            LL ++N +WT FHA  EA R+L+AAGF  ++E E W ++PGGRYFFTRNMS++VAFA+G 
Sbjct  61   LLSFINYAWTTFHAVEEAARRLVAAGFTRISEREPWSVQPGGRYFFTRNMSTVVAFAVGT  120

Query  479  KYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRV  658
            K+  GNGF+++ AHTDSPC+KLKP +AS KSGY M+NV+TYGGGLW+TW+DRDL +AGRV
Sbjct  121  KFQPGNGFYMVGAHTDSPCLKLKPVTASNKSGYNMINVETYGGGLWYTWYDRDLGLAGRV  180

Query  659  IL  664
            +L
Sbjct  181  LL  182



>ref|XP_009624334.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana tomentosiformis]
Length=479

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  DL+D+LN S T FHA  EAK++L +AG+  + E E+WDLK G +YFFTRN S++VAF
Sbjct  3    VAADLIDFLNASPTAFHAVEEAKKRLKSAGYVQIFEREDWDLKAGNKYFFTRNHSTIVAF  62

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+GKKY  GNGF+II AHTDSPC+KLKP S   KSG+L V VQTYGGGLWHTWFDRDLTV
Sbjct  63   ALGKKYVAGNGFYIIGAHTDSPCLKLKPVSKVTKSGFLEVGVQTYGGGLWHTWFDRDLTV  122

Query  647  AGRVIL  664
            AGR+I+
Sbjct  123  AGRMII  128



>ref|XP_007137936.1| hypothetical protein PHAVU_009G167900g [Phaseolus vulgaris]
 gb|ESW09930.1| hypothetical protein PHAVU_009G167900g [Phaseolus vulgaris]
Length=481

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+D+LN S T FHA   AK++L +AGF  L+E E W+L+PG +YFFTRN S++VAF
Sbjct  9    VVSDLIDFLNASPTAFHAVDVAKQRLQSAGFQQLSERELWELQPGNKYFFTRNHSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGF+II AHTDSPC+KLKP S   K G L V VQ YGGGLWHTWFDRDLTV
Sbjct  69   AIGKKYVAGNGFYIIGAHTDSPCLKLKPVSKVVKGGILEVGVQIYGGGLWHTWFDRDLTV  128

Query  647  AGRVIL  664
            AGRVIL
Sbjct  129  AGRVIL  134



>ref|XP_006440072.1| hypothetical protein CICLE_v10019750mg [Citrus clementina]
 gb|ESR53312.1| hypothetical protein CICLE_v10019750mg [Citrus clementina]
Length=515

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IV D L +LN S T FHA  EAKR+L   G+  ++E E+W+L+ G RYFFTRN S+++AF
Sbjct  50   IVSDFLHFLNASPTAFHAVDEAKRRLQTVGYQQISEREDWELEVGKRYFFTRNHSTIIAF  109

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+GKKY  GNGFH++ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLTV
Sbjct  110  AVGKKYVAGNGFHVVGAHTDSPCLKLKPVSKVTKGGYLEVGVQTYGGGLWHTWFDRDLTV  169

Query  647  AGRVIL  664
            AGRVI+
Sbjct  170  AGRVII  175



>ref|XP_009404266.1| PREDICTED: probable aspartyl aminopeptidase [Musa acuminata subsp. 
malaccensis]
Length=476

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 100/125 (80%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            I  DL+D+LN S T FHA  EAK++L  AGF  L+E E+W L+ GG+YFFTRN S+++AF
Sbjct  7    IALDLVDFLNASPTNFHAVDEAKKRLKQAGFAHLSEREDWVLESGGKYFFTRNHSTIIAF  66

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHI+ AHTDSPC+K+KP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  67   AIGKKYVAGNGFHIVGAHTDSPCLKVKPVSKVTKGGYLEVGVQTYGGGLWHTWFDRDLTL  126

Query  647  AGRVI  661
            AGRVI
Sbjct  127  AGRVI  131



>ref|XP_009346502.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+ +LN + T FHA  EAK++L +AG+  ++E E+W L+ G +YFFTRN S++VAF
Sbjct  9    VVSDLIGFLNAAPTAFHAVDEAKKRLRSAGYEQVSEREDWKLEAGKKYFFTRNYSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  69   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSKVAKGGYLEVGVQTYGGGLWHTWFDRDLTI  128

Query  647  AGRVIL  664
            AGRVI+
Sbjct  129  AGRVIV  134



>ref|XP_003602076.1| Aspartyl aminopeptidase [Medicago truncatula]
 gb|AES72327.1| aspartyl aminopeptidase-like protein, putative [Medicago truncatula]
Length=482

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+++LN S T FHA  +AK++L +AG+H ++E E W+LK G +YFFTRN S++VAF
Sbjct  10   VVSDLINFLNASPTAFHAVDDAKKRLQSAGYHQISEKETWELKAGHKYFFTRNHSTIVAF  69

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGK++  GNGFHI+ AHTDSPC+KLKP S   K G L V VQTYGGGLWHTWFDRDLTV
Sbjct  70   AIGKRFVGGNGFHIVGAHTDSPCLKLKPVSKVVKGGILEVGVQTYGGGLWHTWFDRDLTV  129

Query  647  AGRVIL  664
            AGRVIL
Sbjct  130  AGRVIL  135



>gb|KFK26680.1| hypothetical protein AALP_AA8G278900 [Arabis alpina]
Length=477

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            ++ D L +LN S T FHA  E+KR+L  AG+  L+E ++W L+ G +YFFTRN S++VAF
Sbjct  6    VISDFLSFLNASPTAFHAVDESKRRLRKAGYEQLSEKDDWKLEAGNKYFFTRNYSTIVAF  65

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHII AHTDSPC+KLKP S   K G+L V VQTYGGGLWHTWFDRDLTV
Sbjct  66   AIGKKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGFLEVGVQTYGGGLWHTWFDRDLTV  125

Query  647  AGRVIL  664
            AGRVIL
Sbjct  126  AGRVIL  131



>ref|XP_006351481.1| PREDICTED: probable aspartyl aminopeptidase-like [Solanum tuberosum]
Length=483

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  DL+D+LN S T FHA  EAK++L +AG+  ++E ++W LK G +YFFTRN S++VAF
Sbjct  6    VAADLVDFLNASPTAFHAVDEAKKRLKSAGYVQIDEKQDWVLKAGNKYFFTRNYSTIVAF  65

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   KSG+L V VQTYGGGLWHTWFDRDLTV
Sbjct  66   AIGKKYVGGNGFHIVGAHTDSPCLKLKPVSKVIKSGFLEVGVQTYGGGLWHTWFDRDLTV  125

Query  647  AGRVIL  664
            AGR+I+
Sbjct  126  AGRMII  131



>ref|XP_004138058.2| PREDICTED: probable aspartyl aminopeptidase [Cucumis sativus]
 gb|KGN63496.1| hypothetical protein Csa_1G002160 [Cucumis sativus]
Length=512

 Score =   186 bits (472),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D L +LN S T FHA  EAK++LI+ G+  ++E  +W L+ G +YFFTRN S++VAF
Sbjct  41   VVTDFLQFLNASPTAFHAVEEAKKRLISVGYEQVSEKADWKLEAGKKYFFTRNHSTIVAF  100

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  101  AIGKKYVAGNGFHIIGAHTDSPCVKLKPVSKVTKGGYLEVGVQTYGGGLWHTWFDRDLTI  160

Query  647  AGRVIL  664
            AGRVI+
Sbjct  161  AGRVII  166



>ref|XP_008807558.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Phoenix 
dactylifera]
Length=476

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  DL+D+LN S T FHA  EAKR+L  AGF  ++E E+W L  G +YFFTRN S+++AF
Sbjct  7    VASDLVDFLNASPTAFHAVDEAKRRLKQAGFKQISEREDWVLDSGKKYFFTRNYSTIIAF  66

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHI+ AHTDSPC+K+KP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  67   AIGKKYVAGNGFHIVGAHTDSPCLKVKPISKVTKGGYLEVGVQTYGGGLWHTWFDRDLTL  126

Query  647  AGRVIL  664
            AGRV++
Sbjct  127  AGRVMI  132



>ref|XP_009790447.1| PREDICTED: probable aspartyl aminopeptidase [Nicotiana sylvestris]
Length=479

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  DL+D+LN S T FHA  EAK++L +AG+  + E E+WDLK G +YFFTRN S++VAF
Sbjct  3    VAADLIDFLNASPTAFHAVEEAKKRLKSAGYVQIFEREDWDLKAGNKYFFTRNHSTIVAF  62

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+GKKY  GNGF+II AHTDSPC+KLKP S   K+G+L V VQTYGGGLWHTWFDRDLTV
Sbjct  63   ALGKKYVAGNGFYIIGAHTDSPCLKLKPVSKVTKNGFLEVGVQTYGGGLWHTWFDRDLTV  122

Query  647  AGRVIL  664
            AGR+I+
Sbjct  123  AGRMII  128



>ref|XP_008807556.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Phoenix 
dactylifera]
 ref|XP_008807557.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Phoenix 
dactylifera]
Length=487

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  DL+D+LN S T FHA  EAKR+L  AGF  ++E E+W L  G +YFFTRN S+++AF
Sbjct  7    VASDLVDFLNASPTAFHAVDEAKRRLKQAGFKQISEREDWVLDSGKKYFFTRNYSTIIAF  66

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHI+ AHTDSPC+K+KP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  67   AIGKKYVAGNGFHIVGAHTDSPCLKVKPISKVTKGGYLEVGVQTYGGGLWHTWFDRDLTL  126

Query  647  AGRVIL  664
            AGRV++
Sbjct  127  AGRVMI  132



>ref|XP_009336570.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   185 bits (470),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+ +LN + T FHA  EAK++L +AG+  + E E+W L+ G +YFFTRN S++VAF
Sbjct  9    VVSDLIGFLNAAPTAFHAVDEAKKRLRSAGYEQVLEREDWKLEAGKKYFFTRNYSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  69   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSKVAKGGYLEVGVQTYGGGLWHTWFDRDLTI  128

Query  647  AGRVIL  664
            AGRVI+
Sbjct  129  AGRVIV  134



>ref|XP_008374264.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+ +LN + T FHA  EAK++L +AG+  + E E+W L+ G +YFFTRN S++VAF
Sbjct  9    VVSDLIGFLNAAPTAFHAVDEAKKRLRSAGYEQVLEREDWKLEAGKKYFFTRNYSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  69   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSKVAKGGYLEVGVQTYGGGLWHTWFDRDLTI  128

Query  647  AGRVIL  664
            AGRVI+
Sbjct  129  AGRVIV  134



>ref|XP_010248918.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Nelumbo 
nucifera]
Length=490

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+++LN S T FHA  EAK++L  AGF  ++E E+W+L+ G +YFFTRN S++VAF
Sbjct  12   VVSDLINFLNASPTAFHAVDEAKKRLKNAGFEQISEREDWELQVGKKYFFTRNHSTIVAF  71

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+G+KY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLW+TWFDRDLTV
Sbjct  72   AVGRKYVAGNGFHIIGAHTDSPCLKLKPVSKVAKGGYLEVGVQTYGGGLWNTWFDRDLTV  131

Query  647  AGRVIL  664
            AGR+I+
Sbjct  132  AGRLII  137



>gb|ABR17053.1| unknown [Picea sitchensis]
Length=502

 Score =   185 bits (469),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  + +D+LN S T FHA  EAKRQL  AG+  ++E E+W L+PGG+YFFTRN S++VAF
Sbjct  12   VAAEFIDFLNASPTAFHAVGEAKRQLKQAGYEQISEREDWTLEPGGKYFFTRNHSTIVAF  71

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG KY+ GNGF I+ AHTDSPC+KLKP S   K G+L + VQ YGGGLWHTWFDRDLTV
Sbjct  72   AIGHKYTAGNGFGIVCAHTDSPCLKLKPSSKVTKGGFLEIGVQPYGGGLWHTWFDRDLTV  131

Query  647  AGRVIL  664
            AGRV++
Sbjct  132  AGRVMV  137



>ref|XP_010248919.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Nelumbo 
nucifera]
Length=481

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 102/126 (81%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+++LN S T FHA  EAK++L  AGF  ++E E+W+L+ G +YFFTRN S++VAF
Sbjct  12   VVSDLINFLNASPTAFHAVDEAKKRLKNAGFEQISEREDWELQVGKKYFFTRNHSTIVAF  71

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+G+KY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLW+TWFDRDLTV
Sbjct  72   AVGRKYVAGNGFHIIGAHTDSPCLKLKPVSKVAKGGYLEVGVQTYGGGLWNTWFDRDLTV  131

Query  647  AGRVIL  664
            AGR+I+
Sbjct  132  AGRLII  137



>ref|XP_009359462.1| PREDICTED: probable aspartyl aminopeptidase [Pyrus x bretschneideri]
Length=486

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+ +LN + T FHA  EAK+QL +AG+  + E E+W L+ G +YFFTRN S++VAF
Sbjct  9    VVSDLISFLNAAPTAFHAVDEAKKQLRSAGYVQVLEREDWRLEAGKKYFFTRNYSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K G+L V VQTYGGGLWHTWFDRDLT+
Sbjct  69   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSKVAKGGFLEVGVQTYGGGLWHTWFDRDLTI  128

Query  647  AGRVIL  664
            AGRVI+
Sbjct  129  AGRVIV  134



>emb|CDP05422.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  DL+D+LN S T FHA  EAKR+L +AG+  + E E+W L+ G +Y+FTRN S++VAF
Sbjct  5    VAADLVDFLNASPTAFHAVEEAKRRLKSAGYEQILEREDWKLEAGKKYYFTRNYSTIVAF  64

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGF I+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLTV
Sbjct  65   AIGKKYVAGNGFQIVGAHTDSPCLKLKPVSKVSKGGYLEVGVQTYGGGLWHTWFDRDLTV  124

Query  647  AGRVIL  664
            AGR+I+
Sbjct  125  AGRMII  130



>gb|AFK46082.1| unknown [Lotus japonicus]
Length=479

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IV D +D+LN S T FHA  EAK++L   G+  L+E E W+LKPG +YFFTRN S++VAF
Sbjct  9    IVSDFIDFLNASPTAFHAVDEAKKRLRNTGYEHLSEKEVWELKPGSKYFFTRNHSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGK+Y  GNGFH+I AHTDSPC+KLKP S   K   L V VQTYGGGLWHTWFDRDLTV
Sbjct  69   AIGKRYVAGNGFHLIGAHTDSPCLKLKPVSKVVKGEILEVGVQTYGGGLWHTWFDRDLTV  128

Query  647  AGRVIL  664
            AGRVI+
Sbjct  129  AGRVIV  134



>ref|NP_001066463.1| Os12g0236500 [Oryza sativa Japonica Group]
 gb|ABA96906.1| Aspartyl aminopeptidase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF29482.1| Os12g0236500 [Oryza sativa Japonica Group]
 gb|EAY82691.1| hypothetical protein OsI_37907 [Oryza sativa Indica Group]
 gb|EAZ20072.1| hypothetical protein OsJ_35672 [Oryza sativa Japonica Group]
Length=478

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 100/124 (81%), Gaps = 1/124 (1%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVAFAI  472
            DL+D+LN S T FHA  EAKR+L AAGF  L+E EEW  L+PG +YFFTRN S++VAFAI
Sbjct  14   DLVDFLNASPTAFHAVDEAKRRLKAAGFSQLSEREEWAGLQPGRKYFFTRNHSTIVAFAI  73

Query  473  GKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  652
            G KY+ GNGFHII AHTDSP +KLKP S   K GYL V VQTYGGGLW+TWFDRDLTVAG
Sbjct  74   GAKYAAGNGFHIIGAHTDSPSLKLKPVSKVTKGGYLEVGVQTYGGGLWYTWFDRDLTVAG  133

Query  653  RVIL  664
            RVI+
Sbjct  134  RVIV  137



>gb|KJB80475.1| hypothetical protein B456_013G099300 [Gossypium raimondii]
Length=156

 Score =   175 bits (444),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/148 (67%), Positives = 111/148 (75%), Gaps = 11/148 (7%)
 Frame = +2

Query  101  APPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFVssess  280
            A  L   S   SR PHS   FS    N R    R FS TPPL  SSS +   +     ++
Sbjct  7    AQLLHHPSAYFSRLPHSHSSFSI---NFRR---RKFSVTPPLLCSSSSSPSAS-----TN  55

Query  281  ssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLV  460
             SIVGDLL+YLNESWTQFHATAEAKRQLIAAGFHLLNEN+EWDL+PGGRYFFTRNMS LV
Sbjct  56   PSIVGDLLNYLNESWTQFHATAEAKRQLIAAGFHLLNENDEWDLRPGGRYFFTRNMSCLV  115

Query  461  AFAIGKKYSIGNGFHIIAAHTDSPCMKL  544
            AFA+G+KY +GNGFH+IAAHTDSPC+KL
Sbjct  116  AFAVGEKYIVGNGFHVIAAHTDSPCLKL  143



>ref|XP_008239439.1| PREDICTED: probable aspartyl aminopeptidase [Prunus mume]
Length=490

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+++LN S T FHA   AK++L  AG+  ++E E+W L+ G +YFFTRN S++VAF
Sbjct  13   VVSDLINFLNASPTAFHAVDGAKKRLQNAGYEPVSEREDWKLEAGKKYFFTRNYSTIVAF  72

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLT+
Sbjct  73   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSMVAKGGYLEVGVQTYGGGLWHTWFDRDLTI  132

Query  647  AGRVIL  664
            AGRVI+
Sbjct  133  AGRVIV  138



>ref|XP_002866374.1| hypothetical protein ARALYDRAFT_332278 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42633.1| hypothetical protein ARALYDRAFT_332278 [Arabidopsis lyrata subsp. 
lyrata]
Length=477

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D L +LN S T FHA  E+KRQL+ AG+  ++E ++W L+ G +YFFTRN S++VAF
Sbjct  6    LVSDFLSFLNASPTAFHAVDESKRQLVKAGYEQISERDDWKLEAGKKYFFTRNYSTIVAF  65

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG+KY  GNGFHII AHTDSPC+KLKP S   K G L V VQTYGGGLW+TWFDRDLTV
Sbjct  66   AIGQKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGCLEVGVQTYGGGLWYTWFDRDLTV  125

Query  647  AGRVIL  664
            AGRVIL
Sbjct  126  AGRVIL  131



>ref|XP_010536640.1| PREDICTED: probable aspartyl aminopeptidase [Tarenaya hassleriana]
Length=489

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IV D L +LN S T FHA  EAKR+L  AG+  ++E ++W L+ G +YFFTRN S++VAF
Sbjct  13   IVSDFLSFLNASPTAFHAVDEAKRRLQKAGYEQVSERDDWKLEAGKKYFFTRNFSTVVAF  72

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  G+GFHI+ AHTDSPC+KLKP S   K G+L V VQTYGGGLWHTWFDRDLTV
Sbjct  73   AIGKKYVAGSGFHIVGAHTDSPCLKLKPVSKVVKGGFLEVGVQTYGGGLWHTWFDRDLTV  132

Query  647  AGRVIL  664
            AGRVI+
Sbjct  133  AGRVIV  138



>ref|XP_004500663.1| PREDICTED: probable aspartyl aminopeptidase-like [Cicer arietinum]
Length=482

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+++LN S T FHA  +AK++L  AG+  L+E E+W+LK G +YFFTRN S++VAF
Sbjct  10   VVSDLINFLNASPTAFHAVDDAKKRLQTAGYQQLSEKEDWELKAGHKYFFTRNYSTIVAF  69

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+GK++  GNGF+I+ AHTDSPC+KLKP S   K G L V VQTYGGGLWHTWFDRDLTV
Sbjct  70   AVGKRFVAGNGFYIVGAHTDSPCLKLKPVSKVVKGGILEVGVQTYGGGLWHTWFDRDLTV  129

Query  647  AGRVIL  664
            AGRVIL
Sbjct  130  AGRVIL  135



>gb|EPS62030.1| aspartyl aminopeptidase-like protein, partial [Genlisea aurea]
Length=475

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 101/123 (82%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            DL+++LN S T FHA  E+K++L+++G+  L+E E+W L+ GG+YFFTRN S++VAFAIG
Sbjct  6    DLVEFLNASPTAFHAVDESKKRLVSSGYTYLSEREDWKLEAGGKYFFTRNHSTIVAFAIG  65

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
            KKY  GNG +II AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDL+VAGR
Sbjct  66   KKYVAGNGIYIIGAHTDSPCLKLKPVSKLSKGGYLEVGVQTYGGGLWHTWFDRDLSVAGR  125

Query  656  VIL  664
            VI+
Sbjct  126  VIV  128



>ref|XP_002321687.1| aspartyl aminopeptidase family protein [Populus trichocarpa]
 gb|EEF05814.1| aspartyl aminopeptidase family protein [Populus trichocarpa]
Length=489

 Score =   183 bits (465),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  DL+D+LN S T FHA  EAKR+L  AG+  ++E  +W L+ G RYFFTRN S+++AF
Sbjct  12   VASDLIDFLNASPTAFHAVEEAKRRLKNAGYEQVSERHDWKLEAGKRYFFTRNHSTILAF  71

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGF+I+ AHTDSPC+KLKP S   K G+L V VQTYGGGLWHTWFDRDLTV
Sbjct  72   AIGKKYVAGNGFYIVGAHTDSPCLKLKPVSKVTKGGFLEVGVQTYGGGLWHTWFDRDLTV  131

Query  647  AGRVIL  664
            AGRVI+
Sbjct  132  AGRVIV  137



>ref|XP_011024060.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=489

 Score =   183 bits (464),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  DL+D+LN S T FHA  EAKR+L  AG+  ++E  +W L+ G RYFFTRN S+++AF
Sbjct  12   VASDLIDFLNASPTAFHAVEEAKRRLKNAGYEQVSERHDWKLEAGKRYFFTRNHSTILAF  71

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGF+I+ AHTDSPC+KLKP S   K G+L V VQTYGGGLWHTWFDRDLTV
Sbjct  72   AIGKKYVAGNGFYIVGAHTDSPCLKLKPVSKVTKGGFLEVGVQTYGGGLWHTWFDRDLTV  131

Query  647  AGRVIL  664
            AGRVI+
Sbjct  132  AGRVIV  137



>ref|XP_007037930.1| Zn-dependent exopeptidases superfamily protein [Theobroma cacao]
 gb|EOY22431.1| Zn-dependent exopeptidases superfamily protein [Theobroma cacao]
Length=520

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+++LN S T FHA AEA+++L   G+  + E E+W L+ G RYFFTRN S++VAF
Sbjct  56   VVSDLINFLNASPTAFHAVAEARKRLEEVGYEQVFEREDWKLEVGKRYFFTRNHSTIVAF  115

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K GYL V VQTYG GLWHTWFDRDLTV
Sbjct  116  AIGKKYVAGNGFHIVGAHTDSPCLKLKPISKVTKGGYLEVGVQTYGSGLWHTWFDRDLTV  175

Query  647  AGRVI  661
            AGRVI
Sbjct  176  AGRVI  180



>ref|XP_005648131.1| peptidase M18, aminopeptidase I [Coccomyxa subellipsoidea C-169]
 gb|EIE23587.1| peptidase M18, aminopeptidase I [Coccomyxa subellipsoidea C-169]
Length=482

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 100/127 (79%), Gaps = 1/127 (1%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVA  463
            I   LLDY+N SWT +HA  EA R+L AAGF  L+E + W  LK GGRY+FTRN S++VA
Sbjct  13   IAKALLDYINASWTPYHAVEEASRRLHAAGFEKLSERQPWHGLKKGGRYYFTRNASTIVA  72

Query  464  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  643
            FA+G KY  GNGFH++ AHTDSPC+KLKP S   K+G+L VNV+ YGGGLWHTWFDRDL+
Sbjct  73   FAVGGKYEAGNGFHMVGAHTDSPCLKLKPHSKGVKAGFLTVNVEPYGGGLWHTWFDRDLS  132

Query  644  VAGRVIL  664
            VAGRV++
Sbjct  133  VAGRVLV  139



>ref|XP_011620329.1| PREDICTED: probable aspartyl aminopeptidase [Amborella trichopoda]
Length=486

 Score =   182 bits (461),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            I  DL+D+LN S T FHA  EAK+ L   GF  L+E ++W L  GG+YFFTRN S++VAF
Sbjct  9    IASDLIDFLNASPTAFHAVDEAKKLLKEEGFQQLSERDDWSLSAGGKYFFTRNHSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
             IG+ Y  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLTV
Sbjct  69   VIGESYVAGNGFHIIGAHTDSPCLKLKPISKVTKGGYLEVGVQTYGGGLWHTWFDRDLTV  128

Query  647  AGRVIL  664
            AGR+++
Sbjct  129  AGRMLI  134



>ref|XP_006280394.1| hypothetical protein CARUB_v10026321mg [Capsella rubella]
 gb|EOA13292.1| hypothetical protein CARUB_v10026321mg [Capsella rubella]
Length=478

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D L +LN S T FHA  E+K++L+ AG+  + E ++W L+ G +YFFTRN S++VAF
Sbjct  7    LVSDFLSFLNASPTAFHAVDESKKRLVEAGYEQVFERDDWKLQAGQKYFFTRNYSTIVAF  66

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG+KY  GNGFHII AHTDSPC+KLKP S   K+GYL V VQTYGGGLW+TWFDRDLTV
Sbjct  67   AIGQKYVAGNGFHIIGAHTDSPCLKLKPVSKISKAGYLEVGVQTYGGGLWYTWFDRDLTV  126

Query  647  AGRVIL  664
            AGRVI+
Sbjct  127  AGRVIV  132



>ref|XP_010930126.1| PREDICTED: probable aspartyl aminopeptidase [Elaeis guineensis]
Length=476

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            DL+D+LN S T FHA  EAK++L  A F+ ++E E+W L+ G +YFFTRN S++VAFAIG
Sbjct  10   DLVDFLNASPTAFHAVDEAKKRLKQARFNQISEREDWVLESGKKYFFTRNYSTIVAFAIG  69

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
            KKY  GNGFHII AHTDSPC+K+KP S   K GYL V VQTYGGGLWHTWFDRDLT+AGR
Sbjct  70   KKYVAGNGFHIIGAHTDSPCLKVKPISKVTKGGYLEVGVQTYGGGLWHTWFDRDLTLAGR  129

Query  656  VIL  664
            V++
Sbjct  130  VMI  132



>ref|XP_010443807.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=478

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D L +LN S T FHA  E+K++L+ AG+  ++E ++W+L+ G +YFFTRN S++VAF
Sbjct  6    LVSDFLSFLNASPTAFHAVDESKKRLVKAGYEQVSERDDWELEAGKKYFFTRNYSTIVAF  65

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG KY  GNGFHII AHTDSPC+KLKP S   K G+L V VQTYGGGLW+TWFDRDLTV
Sbjct  66   AIGHKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGFLEVGVQTYGGGLWYTWFDRDLTV  125

Query  647  AGRVIL  664
            AGRV+L
Sbjct  126  AGRVVL  131



>ref|XP_001784619.1| predicted protein [Physcomitrella patens]
 gb|EDQ50551.1| predicted protein [Physcomitrella patens]
Length=496

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  254  EAFVssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYF  433
            +  V  ES SS+V  LLDY+N S T FHATAE +  L+++GF  ++E EEW ++PGGRYF
Sbjct  8    QGLVCRESQSSVVPHLLDYVNNSCTPFHATAETRNHLLSSGFQEISECEEWAVQPGGRYF  67

Query  434  FTRNMSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGL  613
            FTRNM S+ AFA+G KY  GNGFH++AAHTDSPC KLKP S S K G+L V VQ YG G+
Sbjct  68   FTRNMCSIYAFAVGHKYKPGNGFHVVAAHTDSPCPKLKPVSYSAKGGFLHVRVQPYGAGV  127

Query  614  WHTWFDRDLTVAGRVIL  664
            W TWFDRDL++AGRV++
Sbjct  128  WQTWFDRDLSIAGRVLI  144



>gb|KDO42027.1| hypothetical protein CISIN_1g009941mg [Citrus sinensis]
Length=496

 Score =   181 bits (460),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 119/167 (71%), Gaps = 19/167 (11%)
 Frame = +2

Query  86   FHLLYAPPLSKSSVLLSRFPHSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVPEAFV  265
            FH  Y     +++V+ S+  HS   F ++N   R   L NFS +                
Sbjct  12   FH--YPSSTVRTTVISSKLHHS---FPSSN-RYRPRTLHNFSTS-------------GIA  52

Query  266  ssessssIVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRN  445
             S SSSSIVGDLLDYLNESWT FHATAEAKR LI AGF LLNEN+EW+LKPGG YFFTRN
Sbjct  53   QSSSSSSIVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRN  112

Query  446  MSSLVAFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMV  586
            MS LVAFA+G+KYS+GNGFHIIAAHTDSPC+KLKP+SAS KSG ++V
Sbjct  113  MSCLVAFAVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGRVIV  159



>ref|XP_002318119.2| aspartyl aminopeptidase family protein [Populus trichocarpa]
 gb|EEE96339.2| aspartyl aminopeptidase family protein [Populus trichocarpa]
Length=486

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  +L+++LN S T FHA  EAKR+L  AG+  ++E ++WDL+ G RYFFTRN S++VAF
Sbjct  9    VASELINFLNASPTAFHAVEEAKRRLRNAGYEQVSERQDWDLEAGKRYFFTRNHSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG K+  GNGF+I+ AHTDSPC+KLKP S   K GYL V VQTYG GLWHTWFDRDLTV
Sbjct  69   AIGNKFEAGNGFYIVGAHTDSPCLKLKPVSKVTKGGYLKVGVQTYGSGLWHTWFDRDLTV  128

Query  647  AGRVIL  664
            AGRVI+
Sbjct  129  AGRVIV  134



>ref|XP_006436620.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
 gb|ESR49860.1| hypothetical protein CICLE_v10031166mg [Citrus clementina]
Length=516

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/100 (83%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IVGDLLDYLNESWT FHATAEAKR LI AGF LLNEN+EW+LKPGG YFFTRNMS LVAF
Sbjct  80   IVGDLLDYLNESWTPFHATAEAKRLLIDAGFELLNENDEWELKPGGGYFFTRNMSCLVAF  139

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMV  586
            A+G+KYS+GNGFHIIAAHTDSPC+KLKP+SAS KSG ++V
Sbjct  140  AVGQKYSVGNGFHIIAAHTDSPCLKLKPKSASSKSGRVIV  179



>ref|XP_002283475.1| PREDICTED: probable aspartyl aminopeptidase [Vitis vinifera]
 emb|CBI15632.3| unnamed protein product [Vitis vinifera]
Length=485

 Score =   181 bits (459),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+++LN S T FHA  EAK+ L  +GF  ++E + W+L+ G RYFFTRN S++VAF
Sbjct  13   VVSDLINFLNSSPTAFHAVDEAKKLLKESGFVQVSERDNWNLEAGKRYFFTRNYSTIVAF  72

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGF I+ AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLTV
Sbjct  73   AIGKKYVPGNGFCIVGAHTDSPCLKLKPISKVTKGGYLEVGVQTYGGGLWHTWFDRDLTV  132

Query  647  AGRVIL  664
            AGRVI+
Sbjct  133  AGRVII  138



>ref|XP_008464465.1| PREDICTED: probable aspartyl aminopeptidase isoform X2 [Cucumis 
melo]
Length=481

 Score =   181 bits (459),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D +D+LN S T FHA  EAK++L++ G+  L+E E+W L+ G +YFFTRN S+++AF
Sbjct  11   VVSDFIDFLNASPTAFHAVEEAKKRLVSVGYEQLSETEDWKLEAGKKYFFTRNHSAIIAF  70

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+GKK+  GN FHI+ AHTDSPC+KLKP S   K G+L V VQ YGGGLWHTWFDRDLT+
Sbjct  71   AVGKKFVAGNAFHIVGAHTDSPCLKLKPISKITKGGFLEVGVQIYGGGLWHTWFDRDLTL  130

Query  647  AGRVIL  664
            AGRV+L
Sbjct  131  AGRVLL  136



>ref|XP_008464464.1| PREDICTED: probable aspartyl aminopeptidase isoform X1 [Cucumis 
melo]
Length=482

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D +D+LN S T FHA  EAK++L++ G+  L+E E+W L+ G +YFFTRN S+++AF
Sbjct  11   VVSDFIDFLNASPTAFHAVEEAKKRLVSVGYEQLSETEDWKLEAGKKYFFTRNHSAIIAF  70

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+GKK+  GN FHI+ AHTDSPC+KLKP S   K G+L V VQ YGGGLWHTWFDRDLT+
Sbjct  71   AVGKKFVAGNAFHIVGAHTDSPCLKLKPISKITKGGFLEVGVQIYGGGLWHTWFDRDLTL  130

Query  647  AGRVIL  664
            AGRV+L
Sbjct  131  AGRVLL  136



>ref|XP_010483659.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=478

 Score =   181 bits (458),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D L +LN S T FHA  E+K++L+ AG+  ++E ++W L+ G +YFFTRN S++VAF
Sbjct  6    LVSDFLSFLNASPTAFHAVDESKKRLVKAGYEQVSERDDWKLEAGKKYFFTRNYSTIVAF  65

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG KY  GNGFHII AHTDSPC+KLKP S   K G+L V VQTYGGGLW+TWFDRDLTV
Sbjct  66   AIGHKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGFLEVGVQTYGGGLWYTWFDRDLTV  125

Query  647  AGRVIL  664
            AGRV+L
Sbjct  126  AGRVVL  131



>ref|XP_004138060.2| PREDICTED: probable aspartyl aminopeptidase [Cucumis sativus]
 gb|KGN63497.1| hypothetical protein Csa_1G002660 [Cucumis sativus]
Length=481

 Score =   181 bits (458),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D +D+LN S T FHA  EAK++L++ G+  L+E E+W L+ G +YFFTRN S+++AF
Sbjct  11   VVSDFIDFLNASPTAFHAVEEAKKRLVSVGYEQLSETEDWKLEAGKKYFFTRNHSAILAF  70

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKK+  GN FHI+ AHTDSPC+KLKP S   K G+L V VQ YGGGLWHTWFDRDLT+
Sbjct  71   AIGKKFVAGNAFHIVGAHTDSPCLKLKPISKITKGGFLEVGVQIYGGGLWHTWFDRDLTL  130

Query  647  AGRVIL  664
            AGRV+L
Sbjct  131  AGRVLL  136



>ref|XP_010456062.1| PREDICTED: probable aspartyl aminopeptidase [Camelina sativa]
Length=475

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D L +LN S T FHA  E+K++L+ AG+  ++E ++W L+ G +YFFTRN S++VAF
Sbjct  6    LVSDFLSFLNASPTAFHAVDESKKRLVKAGYEQVSERDDWKLEAGKKYFFTRNYSTIVAF  65

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG KY  GNGFHII AHTDSPC+KLKP S   K G+L V VQTYGGGLW+TWFDRDLTV
Sbjct  66   AIGHKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGFLEVGVQTYGGGLWYTWFDRDLTV  125

Query  647  AGRVIL  664
            AGRV+L
Sbjct  126  AGRVVL  131



>ref|NP_200824.1| zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
 dbj|BAA97497.1| aspartyl aminopeptidase [Arabidopsis thaliana]
 gb|AAK73942.1| AT5g60160/f15l12_20 [Arabidopsis thaliana]
 gb|AAM91365.1| At5g60160/f15l12_20 [Arabidopsis thaliana]
 gb|AED97287.1| zn-dependent exopeptidases superfamily protein [Arabidopsis thaliana]
Length=477

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D L +LN S T FHA  E+KR+L+ AG+  ++E ++W L+ G +YFFTRN S++VAF
Sbjct  6    LVSDFLSFLNASPTAFHAVDESKRRLLKAGYEQISERDDWKLEAGKKYFFTRNYSTIVAF  65

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG KY  GNGFHII AHTDSPC+KLKP S   K G L V VQTYGGGLW+TWFDRDLTV
Sbjct  66   AIGHKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGCLEVGVQTYGGGLWYTWFDRDLTV  125

Query  647  AGRVIL  664
            AGRVIL
Sbjct  126  AGRVIL  131



>ref|XP_009134060.1| PREDICTED: probable aspartyl aminopeptidase [Brassica rapa]
Length=478

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D L +LN S T FHA  E+KR+L  AG+  L+E ++W L+ G +YFFTRN S++VAF
Sbjct  7    LVSDFLSFLNASPTAFHAVDESKRRLRHAGYEQLSERDDWKLEAGKKYFFTRNYSTIVAF  66

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+GKKY  GNGFHII AHTDSPC+KLKP S   K G L V VQTYGGGLW+TWFDRDLTV
Sbjct  67   AVGKKYEAGNGFHIIGAHTDSPCLKLKPVSKVTKGGCLEVGVQTYGGGLWYTWFDRDLTV  126

Query  647  AGRVIL  664
            AGRVI+
Sbjct  127  AGRVIV  132



>gb|AAM61631.1| aspartyl aminopeptidase-like protein [Arabidopsis thaliana]
Length=477

 Score =   180 bits (457),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D L +LN S T FHA  E+KR+L+ AG+  ++E ++W L+ G +YFFTRN S++VAF
Sbjct  6    LVSDFLSFLNASPTAFHAVDESKRRLLKAGYEQISERDDWKLEAGKKYFFTRNYSTIVAF  65

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG KY  GNGFHII AHTDSPC+KLKP S   K G L V VQTYGGGLW+TWFDRDLTV
Sbjct  66   AIGHKYVAGNGFHIIGAHTDSPCLKLKPVSKITKGGCLEVGVQTYGGGLWYTWFDRDLTV  125

Query  647  AGRVIL  664
            AGRVIL
Sbjct  126  AGRVIL  131



>emb|CDX83160.1| BnaA03g23460D [Brassica napus]
Length=478

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D L +LN S T FHA  E+KR+L  AG+  L+E ++W L+ G +YFFTRN S++VAF
Sbjct  7    LVSDFLSFLNASPTAFHAVDESKRRLRHAGYEQLSERDDWKLEAGKKYFFTRNYSTIVAF  66

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+GKKY  GNGFHII AHTDSPC+KLKP S   K G L V VQTYGGGLW+TWFDRDLTV
Sbjct  67   AVGKKYEAGNGFHIIGAHTDSPCLKLKPVSKVTKGGCLEVGVQTYGGGLWYTWFDRDLTV  126

Query  647  AGRVIL  664
            AGRVI+
Sbjct  127  AGRVIV  132



>ref|XP_001690598.1| aspartyl aminopeptidase-like protein [Chlamydomonas reinhardtii]
 gb|EDP05857.1| aspartyl aminopeptidase-like protein [Chlamydomonas reinhardtii]
Length=565

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/185 (49%), Positives = 125/185 (68%), Gaps = 14/185 (8%)
 Frame = +2

Query  146  HSLRPFSAANANLRTSHLRNFSATPPLCSSSSDAVP---EAFVssessssIVGDLLDYLN  316
            H LR  +A +  + T   R  ++TP   + +++AVP   +A             LLD++N
Sbjct  14   HPLRRLAAPHLIMSTK--RQKTSTPTADNVATEAVPSNADALALHARGKEHAQKLLDFIN  71

Query  317  ESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGN  496
             SWT FHA  EA R+L+AAGF  ++E E W ++PGGRYFFTRN+S++VAFA+G+++  GN
Sbjct  72   YSWTPFHAVEEASRRLVAAGFTPISEREPWSVQPGGRYFFTRNLSTIVAFAVGQQFKPGN  131

Query  497  GFHIIAAHTDSPCMKLKPRSASCKSGYLM---------VNVQTYGGGLWHTWFDRDLTVA  649
            GF ++ AHTDSPC+KLKP S S KSGY M         +NV+TYGGGLW+TW+DRDL +A
Sbjct  132  GFFMVGAHTDSPCLKLKPVSLSNKSGYNMARPGRRAGGINVETYGGGLWYTWYDRDLGLA  191

Query  650  GRVIL  664
            GRV++
Sbjct  192  GRVLV  196



>ref|XP_001773362.1| predicted protein [Physcomitrella patens]
 gb|EDQ61735.1| predicted protein [Physcomitrella patens]
Length=486

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 100/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            I+  LL+Y++ S T FHATAEA++ L+ AGF  ++E EEW L+PGGRYFFTRNM S+ AF
Sbjct  9    IIPHLLEYVDNSCTPFHATAEARKFLLTAGFQEISECEEWALQPGGRYFFTRNMCSIYAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG KY  G+GFH+IAAHTDSPC KLKP S S K G++ V VQ YG G+W TWFDRDL+V
Sbjct  69   AIGHKYKPGSGFHVIAAHTDSPCPKLKPVSYSAKGGFVHVRVQPYGAGVWQTWFDRDLSV  128

Query  647  AGRVIL  664
            AGRV+L
Sbjct  129  AGRVLL  134



>ref|XP_008367478.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   180 bits (457),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+ +LN + T FHA  EAK+ L +AG+  + E E+W L+ G +YFFTRN S++VAF
Sbjct  9    VVSDLISFLNAAPTAFHAVDEAKKLLRSAGYEQVLEREDWKLEAGKKYFFTRNYSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHI+ AHTDSPC+KLKP S   K G+L V VQTYG GLWHTWFDRDLT+
Sbjct  69   AIGKKYVAGNGFHIVGAHTDSPCLKLKPVSKVAKGGFLEVGVQTYGSGLWHTWFDRDLTI  128

Query  647  AGRVIL  664
            AGRVI+
Sbjct  129  AGRVIV  134



>gb|KHF99832.1| Aspartyl aminopeptidase [Gossypium arboreum]
Length=463

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D + +LN S T FHA  EAK++L   G+  + E E+W L+ G RYFFTRN S++VAF
Sbjct  9    VVSDFIGFLNASPTAFHAVDEAKKRLQKVGYEQVIEREDWKLEAGKRYFFTRNHSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFH++ AHTDSPC+KLKP S   K+ YL V VQTYGGGLWHTWFDRDLTV
Sbjct  69   AIGKKYVAGNGFHVVGAHTDSPCLKLKPVSKVKKADYLEVGVQTYGGGLWHTWFDRDLTV  128

Query  647  AGRVIL  664
            AGRV++
Sbjct  129  AGRVMI  134



>gb|KJB27157.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=464

 Score =   179 bits (455),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D + +LN S T FHA  EAK++L   G+  + E E+W L+ G RYFFTRN S++VAF
Sbjct  9    VVSDFIGFLNASPTAFHAVDEAKKRLQKVGYEQVIEREDWKLEAGKRYFFTRNHSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFH++ AHTDSPC+KLKP S   K+ YL V VQTYGGGLWHTWFDRDLTV
Sbjct  69   AIGKKYVAGNGFHVVGAHTDSPCLKLKPVSKVKKADYLEVGVQTYGGGLWHTWFDRDLTV  128

Query  647  AGRVIL  664
            AGRV++
Sbjct  129  AGRVMI  134



>gb|KJB27156.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=461

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D + +LN S T FHA  EAK++L   G+  + E E+W L+ G RYFFTRN S++VAF
Sbjct  9    VVSDFIGFLNASPTAFHAVDEAKKRLQKVGYEQVIEREDWKLEAGKRYFFTRNHSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFH++ AHTDSPC+KLKP S   K+ YL V VQTYGGGLWHTWFDRDLTV
Sbjct  69   AIGKKYVAGNGFHVVGAHTDSPCLKLKPVSKVKKADYLEVGVQTYGGGLWHTWFDRDLTV  128

Query  647  AGRVIL  664
            AGRV++
Sbjct  129  AGRVMI  134



>gb|KJB27155.1| hypothetical protein B456_004G282900 [Gossypium raimondii]
Length=463

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 97/126 (77%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D + +LN S T FHA  EAK++L   G+  + E E+W L+ G RYFFTRN S++VAF
Sbjct  9    VVSDFIGFLNASPTAFHAVDEAKKRLQKVGYEQVIEREDWKLEAGKRYFFTRNHSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFH++ AHTDSPC+KLKP S   K+ YL V VQTYGGGLWHTWFDRDLTV
Sbjct  69   AIGKKYVAGNGFHVVGAHTDSPCLKLKPVSKVKKADYLEVGVQTYGGGLWHTWFDRDLTV  128

Query  647  AGRVIL  664
            AGRV++
Sbjct  129  AGRVMI  134



>ref|XP_011044185.1| PREDICTED: probable aspartyl aminopeptidase [Populus euphratica]
Length=486

 Score =   179 bits (455),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  +L+++LN S T FHA  EAK++L  AG+  ++E ++WDL+ G RYFFTRN S++VAF
Sbjct  9    VASELINFLNASPTAFHAVEEAKKRLRNAGYEQVSERQDWDLEAGKRYFFTRNHSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIG K+  GNGF+I+ AHTDSPC+KLKP S   K GYL V VQTYG GLWHTWFDRDLTV
Sbjct  69   AIGNKFEAGNGFYIVGAHTDSPCLKLKPVSKVTKGGYLKVGVQTYGSGLWHTWFDRDLTV  128

Query  647  AGRVIL  664
            AGRVI+
Sbjct  129  AGRVIV  134



>emb|CDY34036.1| BnaC03g27790D [Brassica napus]
Length=478

 Score =   179 bits (454),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D L +LN S T FHA  E+KR+L  AG+  ++E ++W L+ G +YFFTRN S++VAF
Sbjct  7    LVSDFLSFLNASPTAFHAVDESKRRLRHAGYEQISERDDWKLEAGKKYFFTRNYSTIVAF  66

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+GKKY  GNGFHII AHTDSPC+KLKP S   K G L V VQTYGGGLW+TWFDRDLTV
Sbjct  67   AVGKKYEAGNGFHIIGAHTDSPCLKLKPVSKVTKGGCLEVGVQTYGGGLWYTWFDRDLTV  126

Query  647  AGRVIL  664
            AGRVI+
Sbjct  127  AGRVIV  132



>gb|KCW83185.1| hypothetical protein EUGRSUZ_B00132 [Eucalyptus grandis]
Length=407

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D + +LN S T FHA  E+KR L  AG+  ++E E+W+L+ G +YFFTRN S++VAF
Sbjct  8    VVPDFVAFLNASPTAFHAVDESKRLLREAGYKQVSEREDWNLEAGKKYFFTRNHSTIVAF  67

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+GKKY  GNGFHI+ AHTDSPC+KLKP +   K G L V VQTYGGGLWHTWFDRDLT+
Sbjct  68   AVGKKYVAGNGFHIVGAHTDSPCLKLKPVTMVSKGGCLQVGVQTYGGGLWHTWFDRDLTI  127

Query  647  AGRVIL  664
            AGRV++
Sbjct  128  AGRVMI  133



>ref|XP_012079871.1| PREDICTED: probable aspartyl aminopeptidase [Jatropha curcas]
 gb|KDP30945.1| hypothetical protein JCGZ_11321 [Jatropha curcas]
Length=483

 Score =   178 bits (452),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  DL+ +LN S T FHA  EAK++L  AG+  ++E E+W L+ G +YFFTRN S++VAF
Sbjct  10   VASDLIHFLNASPTAFHAVDEAKKRLRNAGYVQVSEREDWKLEAGKKYFFTRNHSTIVAF  69

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGK+Y  GNGF++I AHTDSPC+KLKP S   K GYL V VQTYGGGLWHTWFDRDLTV
Sbjct  70   AIGKRYVAGNGFYVIGAHTDSPCIKLKPVSKVKKGGYLGVGVQTYGGGLWHTWFDRDLTV  129

Query  647  AGRVIL  664
            AGRVI+
Sbjct  130  AGRVIV  135



>gb|EMS55846.1| Aspartyl aminopeptidase [Triticum urartu]
Length=618

 Score =   179 bits (455),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 101/128 (79%), Gaps = 2/128 (2%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATA-EAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLV  460
            +V DL+D+LN S T FHA   EAKR L AAGF  L+E EEW  L+PG +YFFTRN S++V
Sbjct  4    VVSDLVDFLNASPTAFHAVEDEAKRLLKAAGFEQLSEREEWTGLQPGRKYFFTRNHSAIV  63

Query  461  AFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDL  640
            AFAIG KY  GNGFHII AHTDSPC+KLKP +   K GYL V VQTYGGGLW+TWFDRDL
Sbjct  64   AFAIGAKYVAGNGFHIIGAHTDSPCLKLKPVTKITKGGYLEVGVQTYGGGLWYTWFDRDL  123

Query  641  TVAGRVIL  664
            T+AGRV++
Sbjct  124  TIAGRVLV  131



>ref|XP_011083884.1| PREDICTED: probable aspartyl aminopeptidase [Sesamum indicum]
Length=480

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 97/123 (79%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            DL+++LN S T FHA  EAK++L +AG+  ++E E+W L+ G +YFFTRN S++VAF IG
Sbjct  8    DLVEFLNASPTAFHAVDEAKKRLRSAGYEQVSEREDWKLEAGKKYFFTRNHSTIVAFGIG  67

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
            KKY  GNG +I+ AHTDSPC+KLKP +   K GYL V VQTYGGGLWHTWFDRDL +AGR
Sbjct  68   KKYVAGNGIYIVGAHTDSPCLKLKPVTKVSKGGYLEVGVQTYGGGLWHTWFDRDLAIAGR  127

Query  656  VIL  664
            VI+
Sbjct  128  VII  130



>ref|XP_011396821.1| Aspartyl aminopeptidase [Auxenochlorella protothecoides]
 gb|KFM23943.1| Aspartyl aminopeptidase [Auxenochlorella protothecoides]
Length=469

 Score =   177 bits (448),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 101/127 (80%), Gaps = 1/127 (1%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWD-LKPGGRYFFTRNMSSLVA  463
            +  DLL+Y+N+S TQFHA  +AK +L AAG+  L+E + WD L+PGGRY+FTRN S+LVA
Sbjct  12   LADDLLEYINDSDTQFHAVEQAKARLDAAGYMRLSERQSWDGLRPGGRYYFTRNDSTLVA  71

Query  464  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  643
            FA+G +Y  GNGF+I+ AHTDSPC KLKP S   KSGY MVNV+ YGG L HTWFDRDL+
Sbjct  72   FAVGARYEPGNGFYILGAHTDSPCFKLKPVSKCTKSGYAMVNVEPYGGLLQHTWFDRDLS  131

Query  644  VAGRVIL  664
            VAGRV++
Sbjct  132  VAGRVLI  138



>ref|XP_010026684.1| PREDICTED: probable aspartyl aminopeptidase [Eucalyptus grandis]
 gb|KCW83183.1| hypothetical protein EUGRSUZ_B00132 [Eucalyptus grandis]
Length=473

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D + +LN S T FHA  E+KR L  AG+  ++E E+W+L+ G +YFFTRN S++VAF
Sbjct  8    VVPDFVAFLNASPTAFHAVDESKRLLREAGYKQVSEREDWNLEAGKKYFFTRNHSTIVAF  67

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+GKKY  GNGFHI+ AHTDSPC+KLKP +   K G L V VQTYGGGLWHTWFDRDLT+
Sbjct  68   AVGKKYVAGNGFHIVGAHTDSPCLKLKPVTMVSKGGCLQVGVQTYGGGLWHTWFDRDLTI  127

Query  647  AGRVIL  664
            AGRV++
Sbjct  128  AGRVMI  133



>ref|XP_002511215.1| Aspartyl aminopeptidase, putative [Ricinus communis]
 gb|EEF51817.1| Aspartyl aminopeptidase, putative [Ricinus communis]
Length=441

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            I  DL+++LN S T FHA  EAK++L  +G+  ++E ++W L+ G RYFFTRN S++VAF
Sbjct  13   IDSDLINFLNASPTAFHAIDEAKKRLKHSGYVQVSERDDWKLELGKRYFFTRNHSTIVAF  72

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGF+++ AHTDSPC+KLKP S   KSGYL V VQ YGGGLWHTWFDRDL V
Sbjct  73   AIGKKYVAGNGFYVVGAHTDSPCIKLKPVSKVTKSGYLEVGVQPYGGGLWHTWFDRDLAV  132

Query  647  AGRVIL  664
            AGRVI+
Sbjct  133  AGRVIV  138



>gb|KIY94035.1| Aminopeptidase I zinc metalloprotease [Monoraphidium neglectum]
Length=436

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 100/123 (81%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            D+L+++N +WT +HA  E+ ++L AAGF  + E + WDL+PGG+Y+FTRNMS++VAFA+G
Sbjct  15   DMLEFINAAWTPYHAVEESAKRLAAAGFQHIAEKDAWDLQPGGKYYFTRNMSTIVAFAVG  74

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
            KKYS GN F++I AHTDSPC+K+KP S +   G  ++NV+TYGGGLW+TWFDRDL VAGR
Sbjct  75   KKYSPGNPFYMIGAHTDSPCLKVKPVSKATGGGCQLINVETYGGGLWYTWFDRDLGVAGR  134

Query  656  VIL  664
             ++
Sbjct  135  ALV  137



>gb|KCW83184.1| hypothetical protein EUGRSUZ_B00132 [Eucalyptus grandis]
Length=508

 Score =   176 bits (447),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 98/126 (78%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D + +LN S T FHA  E+KR L  AG+  ++E E+W+L+ G +YFFTRN S++VAF
Sbjct  8    VVPDFVAFLNASPTAFHAVDESKRLLREAGYKQVSEREDWNLEAGKKYFFTRNHSTIVAF  67

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            A+GKKY  GNGFHI+ AHTDSPC+KLKP +   K G L V VQTYGGGLWHTWFDRDLT+
Sbjct  68   AVGKKYVAGNGFHIVGAHTDSPCLKLKPVTMVSKGGCLQVGVQTYGGGLWHTWFDRDLTI  127

Query  647  AGRVIL  664
            AGRV++
Sbjct  128  AGRVMI  133



>sp|B9RAJ0.2|DNPEP_RICCO RecName: Full=Probable aspartyl aminopeptidase [Ricinus communis]
Length=491

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            I  DL+++LN S T FHA  EAK++L  +G+  ++E ++W L+ G RYFFTRN S++VAF
Sbjct  13   IDSDLINFLNASPTAFHAIDEAKKRLKHSGYVQVSERDDWKLELGKRYFFTRNHSTIVAF  72

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGF+++ AHTDSPC+KLKP S   KSGYL V VQ YGGGLWHTWFDRDL V
Sbjct  73   AIGKKYVAGNGFYVVGAHTDSPCIKLKPVSKVTKSGYLEVGVQPYGGGLWHTWFDRDLAV  132

Query  647  AGRVIL  664
            AGRVI+
Sbjct  133  AGRVIV  138



>gb|KCW51475.1| hypothetical protein EUGRSUZ_J00996 [Eucalyptus grandis]
Length=136

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 74/106 (70%), Positives = 89/106 (84%), Gaps = 1/106 (1%)
 Frame = +2

Query  344  AEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHT  523
            AEAKRQLI A F+ LNEN+EW+L+PGG YF TRNMSSL+A A+ ++Y +G+GFH+IAA  
Sbjct  9    AEAKRQLIDAEFYFLNENDEWNLRPGGHYF-TRNMSSLIALAVEERYDVGSGFHVIAAQA  67

Query  524  DSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVI  661
            DSPC+KLKP+SAS K  Y+ VNVQTYGG LWHTWFDRD +V GRVI
Sbjct  68   DSPCLKLKPKSASTKFNYVTVNVQTYGGDLWHTWFDRDRSVGGRVI  113



>ref|XP_005849269.1| hypothetical protein CHLNCDRAFT_143544 [Chlorella variabilis]
 gb|EFN57167.1| hypothetical protein CHLNCDRAFT_143544 [Chlorella variabilis]
Length=497

 Score =   176 bits (445),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWD-LKPGGRYFFTRNMSSLVA  463
            I  D+LD+LN   T+FHA   A ++L  AGF  L+E +EWD L PGGRYFFTRN S+LVA
Sbjct  11   IAADMLDFLNVGVTEFHAVDAAVQRLKKAGFTELSERQEWDGLGPGGRYFFTRNASTLVA  70

Query  464  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  643
            FA+G+KY  GNGF ++ AHTDSPC KLKP S S KSGY MVNV+ YGG L HTWFDRDLT
Sbjct  71   FAVGQKYEPGNGFMMVGAHTDSPCFKLKPVSKSIKSGYGMVNVEPYGGLLHHTWFDRDLT  130

Query  644  VAGRVIL  664
            VAGRV+L
Sbjct  131  VAGRVLL  137



>gb|EMT03759.1| Aspartyl aminopeptidase [Aegilops tauschii]
Length=893

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 101/128 (79%), Gaps = 2/128 (2%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATA-EAKRQLIAAGFHLLNENEEWD-LKPGGRYFFTRNMSSLV  460
            +V DL+D+LN S T FHA   EAKR L AAGF  L+E EEW  L+PG +YFFTRN S++V
Sbjct  4    VVSDLVDFLNASPTAFHAVEDEAKRLLKAAGFEQLSEREEWSGLQPGRKYFFTRNHSAIV  63

Query  461  AFAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDL  640
            AFAIG KY  GNGFHII AHTDSPC+KLKP +   K GYL V VQTYGGGLW+TWFDRDL
Sbjct  64   AFAIGAKYVAGNGFHIIGAHTDSPCLKLKPVTKITKGGYLEVGVQTYGGGLWYTWFDRDL  123

Query  641  TVAGRVIL  664
            T+AGRV++
Sbjct  124  TIAGRVLV  131



>ref|XP_002977420.1| hypothetical protein SELMODRAFT_176342 [Selaginella moellendorffii]
 gb|EFJ21424.1| hypothetical protein SELMODRAFT_176342 [Selaginella moellendorffii]
Length=445

 Score =   174 bits (442),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +2

Query  347  EAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHIIAAHTD  526
            EAK+ L+ AGF  LNE +EW ++PGGRYFFTRNMS+LVAFAIG+KY  GNGFH++AAHTD
Sbjct  2    EAKKLLLDAGFLQLNEEDEWSIEPGGRYFFTRNMSTLVAFAIGQKYQTGNGFHVVAAHTD  61

Query  527  SPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            SPC KLKP SA  KSG+L + VQTYGGGLWHTWFDRDL+VAGR ++
Sbjct  62   SPCPKLKPVSALSKSGFLNLGVQTYGGGLWHTWFDRDLSVAGRALV  107



>ref|XP_008392833.1| PREDICTED: probable aspartyl aminopeptidase [Malus domestica]
Length=486

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 78/126 (62%), Positives = 96/126 (76%), Gaps = 0/126 (0%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+ +LN + T FHA  EAK+ L +AG+  + E E+W L+ G +YFFTRN S++VAF
Sbjct  9    VVSDLISFLNAAPTAFHAVDEAKKLLRSAGYEQVLEREDWKLEXGKKYFFTRNYSTIVAF  68

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AI KKY  GNGFH + AHTDSPC+KLKP S   K G+L V VQTYG GLWHTWFDRDLT+
Sbjct  69   AIXKKYVAGNGFHXVGAHTDSPCLKLKPVSKVAKGGFLEVGVQTYGSGLWHTWFDRDLTI  128

Query  647  AGRVIL  664
            AGRVI+
Sbjct  129  AGRVIV  134



>gb|EYU43065.1| hypothetical protein MIMGU_mgv1a005789mg [Erythranthe guttata]
Length=470

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            DL+++LN S T FHA  EAK +L +AG+  L+E ++W L+ G +YFFTRN S++VAFAIG
Sbjct  8    DLVEFLNASPTAFHAVDEAKNRLKSAGYGQLSERDDWKLEAGKKYFFTRNHSTIVAFAIG  67

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
            KKY  GNG +II AHTDSPC+KLKP S   K GYL V VQ YGGGLWHTWFDRDL +AGR
Sbjct  68   KKYIAGNGIYIIGAHTDSPCIKLKPVSKVSKGGYLEVGVQPYGGGLWHTWFDRDLAIAGR  127

Query  656  VIL  664
            VI+
Sbjct  128  VIV  130



>ref|XP_002963681.1| hypothetical protein SELMODRAFT_80579 [Selaginella moellendorffii]
 gb|EFJ35552.1| hypothetical protein SELMODRAFT_80579 [Selaginella moellendorffii]
Length=475

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            DL+ +LN + T FHA AEAKR+L AAGF  L+E + W L PGG Y+FTRN S++VAFAIG
Sbjct  14   DLISFLNAAPTPFHAVAEAKRRLEAAGFTQLSERDSWALLPGGTYYFTRNFSTIVAFAIG  73

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
            K++  G GF I+ AHTDSPC KLKPRS   K G+L + VQTYG GLWHTWFDRDLTVAGR
Sbjct  74   KRFYPGCGFAIVGAHTDSPCPKLKPRSKIVKGGFLELGVQTYGSGLWHTWFDRDLTVAGR  133

Query  656  VIL  664
            V++
Sbjct  134  VMV  136



>ref|XP_008394651.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Poecilia reticulata]
 ref|XP_008394656.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Poecilia reticulata]
 ref|XP_008394657.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Poecilia reticulata]
Length=160

 Score =   164 bits (414),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N+  + +H   E +R+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  12   EFLQFVNKGVSPYHVVEECRRRLLEAGFTELKETEQWDIKPASKYFVTRNFSSLIAFAVG  71

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             KY  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLTVAGR
Sbjct  72   GKYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGVLQVGVECYGGGIWNTWFDRDLTVAGR  131

Query  656  VIL  664
            +++
Sbjct  132  IMV  134



>ref|XP_001756754.1| predicted protein [Physcomitrella patens]
 gb|EDQ78351.1| predicted protein [Physcomitrella patens]
Length=467

 Score =   172 bits (435),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 97/129 (75%), Gaps = 3/129 (2%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +  +L+D+LN S T FHA  E+K +L+ AG+  L+E   W L+ GGRYFFTRN S++VAF
Sbjct  5    VAQELVDFLNASPTPFHAVQESKNRLLKAGYQQLSERASWTLEAGGRYFFTRNYSTIVAF  64

Query  467  AIGKK---YSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRD  637
            A+GKK   Y  GNGF II AHTDSPC KLKP +   KSG+L V V TYGGGLWHTWFDRD
Sbjct  65   AVGKKQVLYVPGNGFLIIGAHTDSPCPKLKPTTKVIKSGFLEVGVSTYGGGLWHTWFDRD  124

Query  638  LTVAGRVIL  664
            LTVAGRV+L
Sbjct  125  LTVAGRVVL  133



>ref|XP_008394645.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Poecilia reticulata]
Length=165

 Score =   164 bits (414),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N+  + +H   E +R+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  17   EFLQFVNKGVSPYHVVEECRRRLLEAGFTELKETEQWDIKPASKYFVTRNFSSLIAFAVG  76

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             KY  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLTVAGR
Sbjct  77   GKYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGVLQVGVECYGGGIWNTWFDRDLTVAGR  136

Query  656  VIL  664
            +++
Sbjct  137  IMV  139



>ref|XP_009025082.1| hypothetical protein HELRODRAFT_187369 [Helobdella robusta]
 gb|ESN96961.1| hypothetical protein HELRODRAFT_187369 [Helobdella robusta]
Length=468

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            D L ++N+S + FHA  E+K++L+ AGF  LNE E+W +KPG ++F TRN S+LVAFA+G
Sbjct  14   DFLKFINKSPSPFHAVEESKKRLLEAGFKELNEAEKWSVKPGDKFFLTRNHSTLVAFAVG  73

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             K+  GNGF II  HTDSPC+K+KP S   K+GYL V VQ YGGG+WHTWFDRDL +AGR
Sbjct  74   GKFQPGNGFSIIGTHTDSPCLKIKPTSKIVKNGYLQVGVQLYGGGIWHTWFDRDLKLAGR  133

Query  656  VIL  664
            V++
Sbjct  134  VLI  136



>ref|XP_011463290.1| PREDICTED: probable aspartyl aminopeptidase, partial [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +2

Query  332  FHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGKKYSIGNGFHII  511
            F  T EAK++L +AG+  + E E+W+L+ G +YFFTRN S++VAFAIGKKY  GNGFH+I
Sbjct  5    FGVTDEAKKRLQSAGYEQVLEREDWNLEAGKKYFFTRNYSTIVAFAIGKKYVAGNGFHVI  64

Query  512  AAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRVIL  664
             AHTDSPC+KLKP S   K G+L V VQTYGGGLWHTWFDRDLT+AGRVI+
Sbjct  65   GAHTDSPCLKLKPVSKVTKGGFLEVGVQTYGGGLWHTWFDRDLTIAGRVIV  115



>ref|XP_010102886.1| Aspartyl aminopeptidase [Morus notabilis]
 gb|EXB94323.1| Aspartyl aminopeptidase [Morus notabilis]
Length=507

 Score =   169 bits (428),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 100/147 (68%), Gaps = 21/147 (14%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V DL+D+LN S T FHA   AK+ L +AG+  ++E E+W L+ G +YFFTRN S++VAF
Sbjct  10   VVSDLMDFLNSSPTAFHAVDVAKKLLRSAGYEQVSEREDWKLEAGKKYFFTRNHSTIVAF  69

Query  467  AIGK---------------------KYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLM  583
            AIGK                     +Y  GNGF+I+ AHTDSPC+KLKP +   K GYL 
Sbjct  70   AIGKSIEIDYTIYMTLFANGLELMSRYVAGNGFYIVGAHTDSPCLKLKPVTKVTKGGYLE  129

Query  584  VNVQTYGGGLWHTWFDRDLTVAGRVIL  664
            V VQTYGGGLWHTWFDRDLT+AGRVI+
Sbjct  130  VGVQTYGGGLWHTWFDRDLTLAGRVII  156



>ref|XP_003082377.1| aspartyl aminopeptidase (ISS) [Ostreococcus tauri]
Length=486

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +2

Query  299  LLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVAFAIG  475
            L+DYLN+SWT + AT  + + L AAG+  ++E+ EW DL+ GG+Y+ TRN S+LVAFA+G
Sbjct  34   LIDYLNDSWTAWEATESSVKILEAAGYVRISEHAEWSDLRAGGKYYVTRNQSALVAFAVG  93

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             KY+ GNGF++IAAHTDSPC KLKP +   K G++ V VQTYGGGLWHTWFDRDL+VAGR
Sbjct  94   GKYAPGNGFNVIAAHTDSPCPKLKPVTKIKKGGFMQVGVQTYGGGLWHTWFDRDLSVAGR  153

Query  656  VIL  664
            V++
Sbjct  154  VLV  156



>emb|CEF99925.1| Peptidase M18 [Ostreococcus tauri]
Length=549

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +2

Query  299  LLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVAFAIG  475
            L+DYLN+SWT + AT  + + L AAG+  ++E+ EW DL+ GG+Y+ TRN S+LVAFA+G
Sbjct  97   LIDYLNDSWTAWEATESSVKILEAAGYVRISEHAEWSDLRAGGKYYVTRNQSALVAFAVG  156

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             KY+ GNGF++IAAHTDSPC KLKP +   K G++ V VQTYGGGLWHTWFDRDL+VAGR
Sbjct  157  GKYAPGNGFNVIAAHTDSPCPKLKPVTKIKKGGFMQVGVQTYGGGLWHTWFDRDLSVAGR  216

Query  656  VIL  664
            V++
Sbjct  217  VLV  219



>ref|XP_001420830.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99123.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=465

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEW-DLKPGGRYFFTRNMSSLVA  463
            +  DL+D+LN+SWT  HAT  + + L AAG+  ++E+ EW DLK  G+Y+ TRN S+LVA
Sbjct  6    VANDLVDFLNDSWTAHHATEASVKLLEAAGYSKISESVEWGDLKRNGKYYVTRNQSALVA  65

Query  464  FAIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLT  643
            FA+G  Y  GNGF+++AAHTDSPC KLKP S   K G++ V VQTYGGGLWHTWFDRDL+
Sbjct  66   FAVGGAYEPGNGFNVVAAHTDSPCPKLKPVSKIKKGGFMQVGVQTYGGGLWHTWFDRDLS  125

Query  644  VAGRVIL  664
            VAGRV++
Sbjct  126  VAGRVLV  132



>ref|XP_005814088.1| PREDICTED: aspartyl aminopeptidase-like [Xiphophorus maculatus]
Length=470

 Score =   166 bits (421),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N   + +H   E +R+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  17   EFLQFVNRGVSPYHVVEECRRRLLEAGFTELKETEQWDIKPASKYFVTRNFSSLIAFAVG  76

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             KY  GNGF +I AHTDSPC+K+KPRS   K G L V V+ YGGG+W+TWFDRDLTVAGR
Sbjct  77   GKYLPGNGFSMIGAHTDSPCLKVKPRSKRTKQGVLQVGVECYGGGIWNTWFDRDLTVAGR  136

Query  656  VIL  664
            V++
Sbjct  137  VMV  139



>ref|XP_007575369.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Poecilia formosa]
Length=467

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N   + +H   E +R+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  12   EFLQFVNRGVSPYHVVEECRRRLLEAGFTELKETEQWDIKPASKYFVTRNFSSLIAFAVG  71

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             KY  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLTVAGR
Sbjct  72   GKYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGVLQVGVECYGGGIWNTWFDRDLTVAGR  131

Query  656  VIL  664
            V++
Sbjct  132  VMV  134



>ref|XP_007575368.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Poecilia formosa]
Length=472

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N   + +H   E +R+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  17   EFLQFVNRGVSPYHVVEECRRRLLEAGFTELKETEQWDIKPASKYFVTRNFSSLIAFAVG  76

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             KY  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLTVAGR
Sbjct  77   GKYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGVLQVGVECYGGGIWNTWFDRDLTVAGR  136

Query  656  VIL  664
            V++
Sbjct  137  VMV  139



>gb|EIE78284.1| hypothetical protein RO3G_02988 [Rhizopus delemar RA 99-880]
Length=469

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + ++++N S + FHAT EA + LIAAGF  + E E W ++  G+YFFTRN S++VAF +G
Sbjct  15   EFIEFVNNSPSPFHATHEASQLLIAAGFKEIKERESWKIERKGKYFFTRNGSAIVAFVVG  74

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF I+ AHTDSPC+KLKP S   KSGYL V VQ YGGG+WH+WFDRDL+VAGR
Sbjct  75   GQYKPGNGFSIVGAHTDSPCLKLKPISKKEKSGYLEVGVQLYGGGIWHSWFDRDLSVAGR  134

Query  656  VIL  664
            V++
Sbjct  135  VLV  137



>gb|EFB19842.1| hypothetical protein PANDA_014251, partial [Ailuropoda melanoleuca]
Length=391

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  8    ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  67

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  68   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  127

Query  656  VIL  664
            VI+
Sbjct  128  VIV  130



>ref|XP_004662959.1| PREDICTED: aspartyl aminopeptidase [Jaculus jaculus]
Length=471

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN SS++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSSIIAFAVG  75

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K +S   + GY  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRKSRRSQMGYQQVGVETYGGGIWSTWFDRDLTLAGR  135

Query  656  VIL  664
            VI+
Sbjct  136  VII  138



>ref|XP_007519740.1| PREDICTED: aspartyl aminopeptidase [Erinaceus europaeus]
Length=475

 Score =   164 bits (416),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 95/123 (77%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL+++N S + FHA AE + +L+ AGFH L E E W LKP  +YF TRN S+++AFA+G
Sbjct  20   ELLNFVNRSPSPFHAVAECRNRLLQAGFHELKETETWTLKPESKYFLTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   ++G+  V V+TYGGG+W+TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQAGFQQVGVETYGGGIWNTWFDRDLTLAGR  139

Query  656  VIL  664
            VIL
Sbjct  140  VIL  142



>gb|ACC64563.1| aspartyl aminopeptidase (predicted) [Rhinolophus ferrumequinum]
Length=475

 Score =   164 bits (415),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FH  AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHVVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+L V V+TYGGG+W TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFLQVGVETYGGGIWSTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VII  142



>ref|XP_008323213.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Cynoglossus semilaevis]
 ref|XP_008323214.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Cynoglossus semilaevis]
Length=475

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N+  + +H   E +R+L  AGF  LNE E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  14   EFLQFVNKGASPYHVVDECRRRLREAGFIELNETEQWDIKPASKYFVTRNFSSLIAFAVG  73

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             KY  GNGF +I AHTDSPC+K+K RS   K G L V V+ YGGG+W+TWFDRDLTVAGR
Sbjct  74   GKYLPGNGFSMIGAHTDSPCLKVKTRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTVAGR  133

Query  656  VIL  664
            VI+
Sbjct  134  VIV  136



>ref|XP_008323212.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Cynoglossus semilaevis]
Length=480

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N+  + +H   E +R+L  AGF  LNE E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  19   EFLQFVNKGASPYHVVDECRRRLREAGFIELNETEQWDIKPASKYFVTRNFSSLIAFAVG  78

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             KY  GNGF +I AHTDSPC+K+K RS   K G L V V+ YGGG+W+TWFDRDLTVAGR
Sbjct  79   GKYLPGNGFSMIGAHTDSPCLKVKTRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTVAGR  138

Query  656  VIL  664
            VI+
Sbjct  139  VIV  141



>ref|XP_008323211.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Cynoglossus semilaevis]
Length=493

 Score =   164 bits (415),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N+  + +H   E +R+L  AGF  LNE E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  32   EFLQFVNKGASPYHVVDECRRRLREAGFIELNETEQWDIKPASKYFVTRNFSSLIAFAVG  91

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             KY  GNGF +I AHTDSPC+K+K RS   K G L V V+ YGGG+W+TWFDRDLTVAGR
Sbjct  92   GKYLPGNGFSMIGAHTDSPCLKVKTRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTVAGR  151

Query  656  VIL  664
            VI+
Sbjct  152  VIV  154



>ref|XP_004325560.1| PREDICTED: aspartyl aminopeptidase isoform 3 [Tursiops truncatus]
Length=475

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +L+ ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELIKFVNRSPSPFHAVAECRNRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   ++G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQAGFQQVGVETYGGGIWSTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VIV  142



>ref|XP_004262732.1| PREDICTED: aspartyl aminopeptidase isoform 2 [Orcinus orca]
Length=475

 Score =   164 bits (414),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +L+ ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELIKFVNRSPSPFHAVAECRNRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   ++G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQAGFQQVGVETYGGGIWSTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VIV  142



>ref|XP_004262731.1| PREDICTED: aspartyl aminopeptidase isoform 1 [Orcinus orca]
Length=481

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +L+ ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELIKFVNRSPSPFHAVAECRNRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   ++G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQAGFQQVGVETYGGGIWSTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VIV  142



>gb|EPZ34400.1| Peptidase M18 2 domain-containing protein [Rozella allomycis 
CSF55]
Length=402

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 93/124 (75%), Gaps = 1/124 (1%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDL-KPGGRYFFTRNMSSLVAFAI  472
            +LL ++ +S + FHA  E K++LIA GF  L+E + W + KP  +YFFTRN SS++AF I
Sbjct  9    NLLKFIEKSPSPFHAVEEVKQKLIAVGFKELSERKCWPVFKPSEKYFFTRNSSSIIAFHI  68

Query  473  GKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAG  652
            G KY  GNGF IIAAHTDSPC+K+KP S      YL + VQTYGGGLWHTWFDRDL+VAG
Sbjct  69   GSKYKPGNGFSIIAAHTDSPCLKVKPISKIVTKNYLQIGVQTYGGGLWHTWFDRDLSVAG  128

Query  653  RVIL  664
            RVI+
Sbjct  129  RVIV  132



>ref|XP_002592514.1| hypothetical protein BRAFLDRAFT_69005 [Branchiostoma floridae]
 gb|EEN48525.1| hypothetical protein BRAFLDRAFT_69005 [Branchiostoma floridae]
Length=473

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 90/122 (74%), Gaps = 0/122 (0%)
 Frame = +2

Query  299  LLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGK  478
             +D++N+  + FH   E +  L AAGF  L E ++WD+KP  +YF TRN S++VAFA+G 
Sbjct  20   FVDFVNKCQSPFHVVEECRTILRAAGFSELREADQWDIKPNNKYFVTRNQSTVVAFAVGG  79

Query  479  KYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRV  658
            KY  GNGF I+ AHTDSPC+K+KP S   KSGY  V V+ YGGG+WHTWFDRDLTVAGRV
Sbjct  80   KYKPGNGFTIVGAHTDSPCLKVKPLSNKLKSGYQCVGVECYGGGIWHTWFDRDLTVAGRV  139

Query  659  IL  664
            ++
Sbjct  140  MV  141



>ref|XP_004325559.1| PREDICTED: aspartyl aminopeptidase isoform 2 [Tursiops truncatus]
Length=481

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +L+ ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELIKFVNRSPSPFHAVAECRNRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   ++G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQAGFQQVGVETYGGGIWSTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VIV  142



>ref|XP_006906751.1| PREDICTED: aspartyl aminopeptidase [Pteropus alecto]
Length=475

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKEAESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W+TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQMGFQQVGVETYGGGIWNTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VII  142



>gb|KFH62765.1| aspartyl aminopeptidase [Mortierella verticillata NRRL 6337]
Length=357

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 93/125 (74%), Gaps = 2/125 (2%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWD--LKPGGRYFFTRNMSSLVAFA  469
            D LD++N++ + FHAT +A  +L  AGF  + E + W+  LK  G+Y+FTRN S+++AFA
Sbjct  13   DFLDFVNQAQSPFHATEQAVLRLRKAGFQEIKEKDNWNNTLKRNGKYYFTRNRSAVIAFA  72

Query  470  IGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVA  649
            +G KY  GNGF  I AHTDSPC+K+KP S   K GYL V VQ YGGGLWHTWFDRDL+VA
Sbjct  73   VGGKYKPGNGFSAIGAHTDSPCLKIKPVSKKEKLGYLQVGVQLYGGGLWHTWFDRDLSVA  132

Query  650  GRVIL  664
            GRV++
Sbjct  133  GRVVV  137



>ref|XP_007122487.1| PREDICTED: aspartyl aminopeptidase [Physeter catodon]
Length=471

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRNRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  135

Query  656  VIL  664
            VI+
Sbjct  136  VIV  138



>ref|XP_005202875.1| PREDICTED: aspartyl aminopeptidase isoform X5 [Bos taurus]
 ref|XP_005889752.1| PREDICTED: aspartyl aminopeptidase [Bos mutus]
 ref|XP_006059032.1| PREDICTED: aspartyl aminopeptidase [Bubalus bubalis]
Length=475

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VIV  142



>ref|XP_004762907.1| PREDICTED: aspartyl aminopeptidase isoform X6 [Mustela putorius 
furo]
 ref|XP_004807175.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Mustela putorius 
furo]
Length=475

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VIV  142



>ref|XP_005676645.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Capra hircus]
 ref|XP_011969015.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Ovis aries musimon]
Length=475

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VIV  142



>ref|XP_003784969.1| PREDICTED: aspartyl aminopeptidase [Otolemur garnettii]
Length=485

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  30   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFMTRNSSTIIAFAVG  89

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  90   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  149

Query  656  VIL  664
            VI+
Sbjct  150  VIV  152



>gb|ELR60782.1| Aspartyl aminopeptidase, partial [Bos mutus]
Length=485

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  30   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  89

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  90   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  149

Query  656  VIL  664
            VI+
Sbjct  150  VIV  152



>ref|NP_001039417.1| aspartyl aminopeptidase [Bos taurus]
 ref|XP_005202876.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Bos taurus]
 sp|Q2HJH1.1|DNPEP_BOVIN RecName: Full=Aspartyl aminopeptidase [Bos taurus]
 gb|AAI05403.1| Aspartyl aminopeptidase [Bos taurus]
 tpg|DAA32399.1| TPA: aspartyl aminopeptidase [Bos taurus]
Length=471

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  135

Query  656  VIL  664
            VI+
Sbjct  136  VIV  138



>ref|XP_004005000.1| PREDICTED: LOW QUALITY PROTEIN: aspartyl aminopeptidase isoform 
X1 [Ovis aries]
Length=471

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  135

Query  656  VIL  664
            VI+
Sbjct  136  VIV  138



>ref|XP_005676646.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Capra hircus]
 ref|XP_005676647.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Capra hircus]
 ref|XP_011969016.1| PREDICTED: aspartyl aminopeptidase isoform X4 [Ovis aries musimon]
 ref|XP_011969017.1| PREDICTED: aspartyl aminopeptidase isoform X4 [Ovis aries musimon]
 ref|XP_011969018.1| PREDICTED: aspartyl aminopeptidase isoform X4 [Ovis aries musimon]
Length=471

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  135

Query  656  VIL  664
            VI+
Sbjct  136  VIV  138



>ref|XP_010765443.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Notothenia coriiceps]
Length=291

 Score =   159 bits (402),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N+  + +H   E KR+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  19   EFLQFVNKGVSPYHVVEECKRRLLQAGFIELKEAEQWDIKPSSKYFVTRNYSSLIAFAVG  78

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
              +  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W TWFDRDLT+AGR
Sbjct  79   GHFLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWSTWFDRDLTLAGR  138

Query  656  VIL  664
            VI+
Sbjct  139  VII  141



>ref|XP_010765444.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Notothenia coriiceps]
 ref|XP_010765445.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Notothenia coriiceps]
Length=286

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N+  + +H   E KR+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  14   EFLQFVNKGVSPYHVVEECKRRLLQAGFIELKEAEQWDIKPSSKYFVTRNYSSLIAFAVG  73

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
              +  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W TWFDRDLT+AGR
Sbjct  74   GHFLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWSTWFDRDLTLAGR  133

Query  656  VIL  664
            VI+
Sbjct  134  VII  136



>ref|XP_004762903.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Mustela putorius 
furo]
 ref|XP_004762904.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Mustela putorius 
furo]
 ref|XP_004762905.1| PREDICTED: aspartyl aminopeptidase isoform X4 [Mustela putorius 
furo]
 ref|XP_004762906.1| PREDICTED: aspartyl aminopeptidase isoform X5 [Mustela putorius 
furo]
 ref|XP_004807176.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Mustela putorius 
furo]
 ref|XP_004807177.1| PREDICTED: aspartyl aminopeptidase isoform X4 [Mustela putorius 
furo]
 ref|XP_004807178.1| PREDICTED: aspartyl aminopeptidase isoform X5 [Mustela putorius 
furo]
 ref|XP_004807179.1| PREDICTED: aspartyl aminopeptidase isoform X6 [Mustela putorius 
furo]
Length=471

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  135

Query  656  VIL  664
            VI+
Sbjct  136  VIV  138



>ref|XP_004325558.1| PREDICTED: aspartyl aminopeptidase isoform 1 [Tursiops truncatus]
Length=496

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +L+ ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  41   ELIKFVNRSPSPFHAVAECRNRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  100

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   ++G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  101  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQAGFQQVGVETYGGGIWSTWFDRDLTLAGR  160

Query  656  VIL  664
            VI+
Sbjct  161  VIV  163



>ref|XP_006935664.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Felis catus]
Length=475

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VIV  142



>ref|XP_006739743.1| PREDICTED: aspartyl aminopeptidase [Leptonychotes weddellii]
Length=475

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VIV  142



>ref|XP_007445869.1| PREDICTED: aspartyl aminopeptidase [Lipotes vexillifer]
Length=474

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRNRLLQAGFHELKETESWDIKPESKYFLTRNSSAIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VIV  142



>gb|ELK17177.1| Aspartyl aminopeptidase [Pteropus alecto]
Length=515

 Score =   163 bits (413),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  60   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKEAESWDIKPESKYFLTRNSSTIIAFAVG  119

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W+TWFDRDLT+AGR
Sbjct  120  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQMGFQQVGVETYGGGIWNTWFDRDLTLAGR  179

Query  656  VIL  664
            VI+
Sbjct  180  VII  182



>ref|XP_006935665.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Felis catus]
 ref|XP_006935666.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Felis catus]
Length=471

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  135

Query  656  VIL  664
            VI+
Sbjct  136  VIV  138



>ref|XP_003446617.1| PREDICTED: aspartyl aminopeptidase-like isoform X1 [Oreochromis 
niloticus]
Length=474

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N   + +H   E +R L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  19   EFLQFVNRGVSPYHVVEECRRHLLEAGFIELKETEQWDIKPASKYFVTRNFSSLIAFAVG  78

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLT+AGR
Sbjct  79   GRYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTIAGR  138

Query  656  VIL  664
            V++
Sbjct  139  VMV  141



>ref|XP_005452349.1| PREDICTED: aspartyl aminopeptidase-like isoform X2 [Oreochromis 
niloticus]
 ref|XP_005452350.1| PREDICTED: aspartyl aminopeptidase-like isoform X3 [Oreochromis 
niloticus]
Length=469

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N   + +H   E +R L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  14   EFLQFVNRGVSPYHVVEECRRHLLEAGFIELKETEQWDIKPASKYFVTRNFSSLIAFAVG  73

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLT+AGR
Sbjct  74   GRYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTIAGR  133

Query  656  VIL  664
            V++
Sbjct  134  VMV  136



>ref|XP_004402809.1| PREDICTED: aspartyl aminopeptidase isoform 2 [Odobenus rosmarus 
divergens]
Length=477

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  135

Query  656  VIL  664
            VI+
Sbjct  136  VIV  138



>ref|XP_004563350.1| PREDICTED: aspartyl aminopeptidase-like isoform X2 [Maylandia 
zebra]
 ref|XP_005738688.1| PREDICTED: aspartyl aminopeptidase-like isoform X2 [Pundamilia 
nyererei]
 ref|XP_005919954.1| PREDICTED: aspartyl aminopeptidase-like isoform X2 [Haplochromis 
burtoni]
Length=469

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N   + +H   E +R L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  14   EFLQFVNRGVSPYHVVEECRRHLLEAGFIELKETEQWDIKPASKYFVTRNFSSLIAFAVG  73

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLT+AGR
Sbjct  74   GRYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTIAGR  133

Query  656  VIL  664
            V++
Sbjct  134  VMV  136



>ref|XP_004563349.1| PREDICTED: aspartyl aminopeptidase-like isoform X1 [Maylandia 
zebra]
 ref|XP_005738687.1| PREDICTED: aspartyl aminopeptidase-like isoform X1 [Pundamilia 
nyererei]
 ref|XP_005919953.1| PREDICTED: aspartyl aminopeptidase-like isoform X1 [Haplochromis 
burtoni]
Length=474

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N   + +H   E +R L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  19   EFLQFVNRGVSPYHVVEECRRHLLEAGFIELKETEQWDIKPASKYFVTRNFSSLIAFAVG  78

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLT+AGR
Sbjct  79   GRYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTIAGR  138

Query  656  VIL  664
            V++
Sbjct  139  VMV  141



>ref|XP_002712541.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Oryctolagus cuniculus]
 ref|XP_008257445.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Oryctolagus cuniculus]
Length=471

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FH  AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHVVAECRSRLLQAGFHELKETESWDIKPECKYFLTRNSSTIIAFAVG  75

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + GY  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGYQQVGVETYGGGIWSTWFDRDLTLAGR  135

Query  656  VIL  664
            VI+
Sbjct  136  VIV  138



>pdb|3VAR|A Chain A, Crystal Structure Of Dnpep, Znzn Form
 pdb|3VAT|A Chain A, Crystal Structure Of Dnpep, Znmg Form
Length=496

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  41   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  100

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  101  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  160

Query  656  VIL  664
            VI+
Sbjct  161  VIV  163



>ref|XP_010800626.1| PREDICTED: aspartyl aminopeptidase isoform X4 [Bos taurus]
Length=490

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  35   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  94

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  95   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  154

Query  656  VIL  664
            VI+
Sbjct  155  VIV  157



>ref|XP_010800625.1| PREDICTED: aspartyl aminopeptidase isoform X3 [Bos taurus]
Length=500

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  45   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  104

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  105  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  164

Query  656  VIL  664
            VI+
Sbjct  165  VIV  167



>gb|EWM25484.1| aspartyl aminopeptidase [Nannochloropsis gaditana]
Length=553

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 96/133 (72%), Gaps = 7/133 (5%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            IV  L+ +LNE+WT FHA   A  +L  AGF  L E + W LK GG+Y+FTRNM++L+AF
Sbjct  14   IVDGLITFLNEAWTPFHAVQAAASRLRDAGFKELREGDAWGLKAGGKYYFTRNMTTLIAF  73

Query  467  AIGKKYSI-------GNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTW  625
            A+G K+ I       G+GF II AHTDSPC KLKP S   KSGYL ++V  YGGGLWHTW
Sbjct  74   AVGNKFQICQHSGQGGSGFTIIGAHTDSPCPKLKPVSKLTKSGYLSLSVVGYGGGLWHTW  133

Query  626  FDRDLTVAGRVIL  664
            FDRDL++AGRV++
Sbjct  134  FDRDLSLAGRVLV  146



>ref|XP_006402123.1| hypothetical protein EUTSA_v10015798mg [Eutrema salsugineum]
 gb|ESQ43576.1| hypothetical protein EUTSA_v10015798mg [Eutrema salsugineum]
Length=465

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 91/126 (72%), Gaps = 14/126 (11%)
 Frame = +2

Query  287  IVGDLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAF  466
            +V D L +LN S T FHA              +++E ++W L+ G +YFFTRN S++VAF
Sbjct  8    LVSDFLAFLNASPTAFHA--------------VVSERDDWKLEAGKKYFFTRNYSTIVAF  53

Query  467  AIGKKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTV  646
            AIGKKY  GNGFHII AHTDSPC+KLKP S   K GYL V VQTYGGGLW+TWFDRDLTV
Sbjct  54   AIGKKYVAGNGFHIIGAHTDSPCLKLKPVSKVSKGGYLEVGVQTYGGGLWYTWFDRDLTV  113

Query  647  AGRVIL  664
            AGRVI+
Sbjct  114  AGRVIV  119



>ref|XP_005956749.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Pantholops hodgsonii]
Length=493

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  38   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  97

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  98   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  157

Query  656  VIL  664
            VI+
Sbjct  158  VIV  160



>ref|XP_006890316.1| PREDICTED: aspartyl aminopeptidase [Elephantulus edwardii]
Length=471

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E + WDLKP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETDSWDLKPESKYFLTRNSSTIIAFAVG  75

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W+TWFDRDLT+AGR
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFHQVGVETYGGGIWNTWFDRDLTLAGR  135

Query  656  VIL  664
            VI+
Sbjct  136  VIV  138



>ref|XP_005640751.1| PREDICTED: aspartyl aminopeptidase isoform X4 [Canis lupus familiaris]
Length=493

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  38   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  97

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  98   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  157

Query  656  VIL  664
            VI+
Sbjct  158  VIV  160



>ref|XP_004402808.1| PREDICTED: aspartyl aminopeptidase isoform 1 [Odobenus rosmarus 
divergens]
Length=493

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  38   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  97

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  98   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  157

Query  656  VIL  664
            VI+
Sbjct  158  VIV  160



>ref|XP_004427652.1| PREDICTED: aspartyl aminopeptidase [Ceratotherium simum simum]
Length=493

 Score =   163 bits (412),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  38   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETETWDIKPESKYFLTRNSSTIIAFAVG  97

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  98   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  157

Query  656  VIL  664
            VI+
Sbjct  158  VIV  160



>ref|XP_004762902.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Mustela putorius 
furo]
 ref|XP_004807174.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Mustela putorius 
furo]
Length=509

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  54   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  113

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  114  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  173

Query  656  VIL  664
            VI+
Sbjct  174  VIV  176



>ref|XP_006935663.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Felis catus]
Length=509

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  54   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  113

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  114  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  173

Query  656  VIL  664
            VI+
Sbjct  174  VIV  176



>ref|XP_005202874.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Bos taurus]
Length=509

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  54   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  113

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  114  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  173

Query  656  VIL  664
            VI+
Sbjct  174  VIV  176



>ref|XP_005956748.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Pantholops hodgsonii]
 ref|XP_011969014.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Ovis aries musimon]
Length=509

 Score =   163 bits (412),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  54   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  113

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  114  GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  173

Query  656  VIL  664
            VI+
Sbjct  174  VIV  176



>ref|XP_008257444.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Oryctolagus cuniculus]
Length=491

 Score =   162 bits (411),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FH  AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  36   ELLKFVNRSPSPFHVVAECRSRLLQAGFHELKETESWDIKPECKYFLTRNSSTIIAFAVG  95

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + GY  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  96   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGYQQVGVETYGGGIWSTWFDRDLTLAGR  155

Query  656  VIL  664
            VI+
Sbjct  156  VIV  158



>ref|XP_007956515.1| PREDICTED: aspartyl aminopeptidase [Orycteropus afer afer]
Length=473

 Score =   162 bits (410),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E + WD+KP  +YF TRN S+++AFA+G
Sbjct  18   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETDSWDIKPESKYFLTRNSSTIIAFAVG  77

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K +S   + G+L V V+TYGGG+W TWFDRDLT+AGR
Sbjct  78   GQYVPGNGFSLIGAHTDSPCLRVKRKSRRSQVGFLQVGVETYGGGIWGTWFDRDLTLAGR  137

Query  656  VIL  664
            VI+
Sbjct  138  VIV  140



>ref|XP_006792993.1| PREDICTED: aspartyl aminopeptidase-like [Neolamprologus brichardi]
Length=459

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N   + +H   E ++ L+ AGF  L E E+WD+KP  +YF TRN SS++AFA+G
Sbjct  19   EFLQFVNRGVSPYHVVEECRQHLLEAGFIELKETEQWDIKPASKYFLTRNFSSIIAFAVG  78

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+K+KPRS   K G L V V+ YGGG+W+TWFDRDLT+AGR
Sbjct  79   GRYLPGNGFSMIGAHTDSPCLKVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTIAGR  138

Query  656  VIL  664
            V++
Sbjct  139  VMV  141



>ref|XP_010748612.1| PREDICTED: aspartyl aminopeptidase isoform X1 [Larimichthys crocea]
Length=469

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N   + +H   E +R+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  14   EFLHFVNRGVSPYHVVDECRRRLLEAGFIELKETEQWDIKPSSKYFVTRNYSSLIAFAVG  73

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLT+AGR
Sbjct  74   GRYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTIAGR  133

Query  656  VIL  664
            V++
Sbjct  134  VMV  136



>ref|XP_011230094.1| PREDICTED: aspartyl aminopeptidase [Ailuropoda melanoleuca]
Length=511

 Score =   162 bits (410),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  35   ELLKFVNRSPSPFHAVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  94

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  95   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  154

Query  656  VIL  664
            VI+
Sbjct  155  VIV  157



>ref|XP_004876190.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Heterocephalus 
glaber]
 ref|XP_004864585.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Heterocephalus 
glaber]
Length=475

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGF  L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRNRLLQAGFRELKETESWDIKPESKYFLTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   ++G+  V V+TYGGG+W+TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQAGFHQVGVETYGGGIWNTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VII  142



>ref|XP_010748613.1| PREDICTED: aspartyl aminopeptidase isoform X2 [Larimichthys crocea]
Length=474

 Score =   162 bits (409),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 91/123 (74%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            + L ++N   + +H   E +R+L+ AGF  L E E+WD+KP  +YF TRN SSL+AFA+G
Sbjct  19   EFLHFVNRGVSPYHVVDECRRRLLEAGFIELKETEQWDIKPSSKYFVTRNYSSLIAFAVG  78

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++KPRS   K G L V V+ YGGG+W+TWFDRDLT+AGR
Sbjct  79   GRYLPGNGFSMIGAHTDSPCLRVKPRSKRTKQGCLQVGVECYGGGIWNTWFDRDLTIAGR  138

Query  656  VIL  664
            V++
Sbjct  139  VMV  141



>dbj|BAB13923.1| unnamed protein product [Homo sapiens]
 gb|EAW70736.1| aspartyl aminopeptidase, isoform CRA_g [Homo sapiens]
Length=267

 Score =   157 bits (397),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 93/123 (76%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FHA AE + +L+ AGF  L E E+W++KP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHAVAECRNRLLQAGFSELKETEKWNIKPESKYFMTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFQQVGVETYGGGIWSTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VIV  142



>ref|XP_004576859.1| PREDICTED: aspartyl aminopeptidase [Ochotona princeps]
Length=471

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + +H  AE + +L+ AGFH L E E WD+KP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPYHVVAECRSRLLQAGFHELKETESWDIKPESKYFLTRNSSTIIAFAVG  75

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + GY  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGYHQVGVETYGGGIWSTWFDRDLTLAGR  135

Query  656  VIL  664
            VI+
Sbjct  136  VIV  138



>ref|XP_011404738.1| PREDICTED: aspartyl aminopeptidase-like [Amphimedon queenslandica]
Length=465

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 89/122 (73%), Gaps = 0/122 (0%)
 Frame = +2

Query  299  LLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIGK  478
            L+D++N+  + +H   E KRQL+   F  L E E W++KP G YF   N S+++AFA+G 
Sbjct  17   LIDFVNKGPSPYHVVEECKRQLMERNFTELKEKESWEIKPNGLYFVVNNFSTIIAFAVGG  76

Query  479  KYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGRV  658
            +Y  GNGF+ + AHTDSPC+K+KPRS   + GYL V V+ YGGG+WHTWFDRDLTVAGRV
Sbjct  77   QYKPGNGFNAVGAHTDSPCLKVKPRSNRSRCGYLQVGVECYGGGIWHTWFDRDLTVAGRV  136

Query  659  IL  664
            ++
Sbjct  137  VV  138



>gb|ELK30546.1| Aspartyl aminopeptidase [Myotis davidii]
Length=472

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FH  AE + +L+ AGFH L E E WDLKP  +YF TRN S+++AFA+G
Sbjct  16   ELLKFVNRSPSPFHVVAECRSRLLQAGFHELKETESWDLKPESKYFLTRNSSTIIAFAVG  75

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  76   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFHQVGVETYGGGIWSTWFDRDLTLAGR  135

Query  656  VIL  664
            VI+
Sbjct  136  VIV  138



>ref|XP_006763438.1| PREDICTED: LOW QUALITY PROTEIN: aspartyl aminopeptidase [Myotis 
davidii]
Length=475

 Score =   161 bits (408),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 92/123 (75%), Gaps = 0/123 (0%)
 Frame = +2

Query  296  DLLDYLNESWTQFHATAEAKRQLIAAGFHLLNENEEWDLKPGGRYFFTRNMSSLVAFAIG  475
            +LL ++N S + FH  AE + +L+ AGFH L E E WDLKP  +YF TRN S+++AFA+G
Sbjct  20   ELLKFVNRSPSPFHVVAECRSRLLQAGFHELKETESWDLKPESKYFLTRNSSTIIAFAVG  79

Query  476  KKYSIGNGFHIIAAHTDSPCMKLKPRSASCKSGYLMVNVQTYGGGLWHTWFDRDLTVAGR  655
             +Y  GNGF +I AHTDSPC+++K RS   + G+  V V+TYGGG+W TWFDRDLT+AGR
Sbjct  80   GQYVPGNGFSLIGAHTDSPCLRVKRRSRRSQVGFHQVGVETYGGGIWSTWFDRDLTLAGR  139

Query  656  VIL  664
            VI+
Sbjct  140  VIV  142



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1091433822726