BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9323

Length=709
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788397.1|  PREDICTED: uncharacterized protein LOC104236...    155   5e-40   Nicotiana sylvestris
ref|XP_009788398.1|  PREDICTED: uncharacterized protein LOC104236...    154   6e-40   Nicotiana sylvestris
ref|XP_009612432.1|  PREDICTED: uncharacterized protein LOC104105...    150   1e-38   Nicotiana tomentosiformis
ref|XP_009612431.1|  PREDICTED: uncharacterized protein LOC104105...    150   1e-38   Nicotiana tomentosiformis
ref|XP_008221021.1|  PREDICTED: uncharacterized protein LOC103321048    136   2e-33   Prunus mume [ume]
ref|XP_006359309.1|  PREDICTED: uncharacterized protein LOC102597261    135   6e-33   Solanum tuberosum [potatoes]
ref|XP_010277317.1|  PREDICTED: uncharacterized protein LOC104611...    134   1e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010277315.1|  PREDICTED: uncharacterized protein LOC104611...    134   1e-32   Nelumbo nucifera [Indian lotus]
emb|CAN75326.1|  hypothetical protein VITISV_042544                     129   1e-32   Vitis vinifera
ref|XP_002270763.1|  PREDICTED: uncharacterized protein LOC100247878    132   4e-32   Vitis vinifera
gb|KHG02513.1|  U-box domain-containing 63 -like protein                131   1e-31   Gossypium arboreum [tree cotton]
gb|KJB15261.1|  hypothetical protein B456_002G167300                    131   1e-31   Gossypium raimondii
gb|KJB15256.1|  hypothetical protein B456_002G167300                    130   2e-31   Gossypium raimondii
gb|KJB15259.1|  hypothetical protein B456_002G167300                    130   2e-31   Gossypium raimondii
gb|KJB15258.1|  hypothetical protein B456_002G167300                    130   2e-31   Gossypium raimondii
gb|KJB15260.1|  hypothetical protein B456_002G167300                    130   2e-31   Gossypium raimondii
ref|XP_012087714.1|  PREDICTED: uncharacterized protein LOC105646466    129   5e-31   Jatropha curcas
ref|XP_007223380.1|  hypothetical protein PRUPE_ppa003811mg             128   2e-30   
ref|XP_011075298.1|  PREDICTED: uncharacterized protein LOC105159...    127   2e-30   Sesamum indicum [beniseed]
ref|XP_011075296.1|  PREDICTED: uncharacterized protein LOC105159...    127   2e-30   Sesamum indicum [beniseed]
ref|XP_011075299.1|  PREDICTED: uncharacterized protein LOC105159...    127   2e-30   
ref|XP_008340467.1|  PREDICTED: uncharacterized protein LOC103403417    126   8e-30   
ref|XP_009351687.1|  PREDICTED: uncharacterized protein LOC103943186    125   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_002312241.2|  hypothetical protein POPTR_0008s08530g             125   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_007045309.1|  RING/U-box superfamily protein isoform 5           123   3e-29   
ref|XP_007045308.1|  RING/U-box superfamily protein isoform 4           123   3e-29   
ref|XP_007045306.1|  RING/U-box superfamily protein isoform 2           123   4e-29   
ref|XP_011017036.1|  PREDICTED: uncharacterized protein LOC105120...    124   4e-29   Populus euphratica
ref|XP_008350822.1|  PREDICTED: uncharacterized protein LOC103414196    124   6e-29   
ref|XP_011013780.1|  PREDICTED: uncharacterized protein LOC105117...    123   6e-29   Populus euphratica
ref|XP_011013787.1|  PREDICTED: uncharacterized protein LOC105117...    123   6e-29   Populus euphratica
ref|XP_007045307.1|  RING/U-box superfamily protein isoform 3           122   7e-29   
ref|XP_007045305.1|  RING/U-box superfamily protein isoform 1           123   8e-29   
ref|XP_010688769.1|  PREDICTED: uncharacterized protein LOC104902...    123   1e-28   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO53026.1|  hypothetical protein CISIN_1g0077962mg                  122   1e-28   Citrus sinensis [apfelsine]
ref|XP_004236832.1|  PREDICTED: uncharacterized protein LOC101261219    122   1e-28   Solanum lycopersicum
ref|XP_011016093.1|  PREDICTED: uncharacterized protein LOC105119...    123   1e-28   Populus euphratica
ref|XP_011013772.1|  PREDICTED: uncharacterized protein LOC105117...    123   2e-28   Populus euphratica
ref|XP_006437502.1|  hypothetical protein CICLE_v10031032mg             122   3e-28   Citrus clementina [clementine]
ref|XP_006437503.1|  hypothetical protein CICLE_v10031032mg             121   3e-28   
ref|XP_004297760.1|  PREDICTED: uncharacterized protein LOC101297139    121   4e-28   Fragaria vesca subsp. vesca
emb|CBI27450.3|  unnamed protein product                                120   5e-28   Vitis vinifera
ref|XP_003537792.1|  PREDICTED: uncharacterized protein LOC100794424    120   2e-27   Glycine max [soybeans]
ref|XP_006406445.1|  hypothetical protein EUTSA_v10020435mg             119   2e-27   Eutrema salsugineum [saltwater cress]
ref|XP_006592057.1|  PREDICTED: uncharacterized protein LOC100807199    119   2e-27   Glycine max [soybeans]
gb|KCW51263.1|  hypothetical protein EUGRSUZ_J00840                     119   2e-27   Eucalyptus grandis [rose gum]
ref|XP_010031870.1|  PREDICTED: uncharacterized protein LOC104421574    119   2e-27   Eucalyptus grandis [rose gum]
ref|XP_002316144.2|  hypothetical protein POPTR_0010s17820g             119   3e-27   
gb|ERN09498.1|  hypothetical protein AMTR_s00029p00116980               119   3e-27   Amborella trichopoda
ref|XP_006847917.2|  PREDICTED: uncharacterized protein LOC18437651     119   3e-27   Amborella trichopoda
ref|XP_007131675.1|  hypothetical protein PHAVU_011G032200g             119   3e-27   Phaseolus vulgaris [French bean]
emb|CDY33428.1|  BnaC01g32970D                                          118   6e-27   Brassica napus [oilseed rape]
gb|EYU39421.1|  hypothetical protein MIMGU_mgv1a005295mg                116   7e-27   Erythranthe guttata [common monkey flower]
ref|XP_006297358.1|  hypothetical protein CARUB_v10013378mg             117   8e-27   Capsella rubella
ref|XP_009111439.1|  PREDICTED: uncharacterized protein LOC103836884    117   1e-26   Brassica rapa
ref|XP_002515804.1|  conserved hypothetical protein                     117   2e-26   Ricinus communis
ref|XP_009396140.1|  PREDICTED: uncharacterized protein LOC103981...    116   2e-26   
gb|EYU39422.1|  hypothetical protein MIMGU_mgv1a005295mg                115   2e-26   Erythranthe guttata [common monkey flower]
gb|EYU39423.1|  hypothetical protein MIMGU_mgv1a005295mg                115   2e-26   Erythranthe guttata [common monkey flower]
ref|XP_002885344.1|  hypothetical protein ARALYDRAFT_898385             116   2e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_009396138.1|  PREDICTED: uncharacterized protein LOC103981...    116   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH30552.1|  RING/U-box protein                                      115   3e-26   Medicago truncatula
ref|XP_010466153.1|  PREDICTED: uncharacterized protein LOC104746391    115   4e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010487943.1|  PREDICTED: uncharacterized protein LOC104765863    115   6e-26   Camelina sativa [gold-of-pleasure]
gb|KEH30553.1|  RING/U-box protein                                      115   7e-26   Medicago truncatula
ref|XP_004505748.1|  PREDICTED: uncharacterized protein LOC101510...    115   8e-26   Cicer arietinum [garbanzo]
ref|XP_004505749.1|  PREDICTED: uncharacterized protein LOC101510...    115   8e-26   
gb|AAM19828.1|  At3g19895                                               114   8e-26   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB01304.1|  unnamed protein product                                114   2e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_683575.2|  uncharacterized protein                               113   3e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDY42216.1|  BnaA01g25790D                                          112   4e-25   Brassica napus [oilseed rape]
ref|XP_010508172.1|  PREDICTED: uncharacterized protein LOC104784790    112   6e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010557562.1|  PREDICTED: uncharacterized protein LOC104826520    111   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_010112276.1|  hypothetical protein L484_014958                   111   2e-24   Morus notabilis
ref|XP_010935485.1|  PREDICTED: uncharacterized protein LOC105055...    109   1e-23   Elaeis guineensis
emb|CDP09131.1|  unnamed protein product                                108   1e-23   Coffea canephora [robusta coffee]
ref|XP_004140426.1|  PREDICTED: uncharacterized protein LOC101206682    108   2e-23   Cucumis sativus [cucumbers]
ref|XP_008456842.1|  PREDICTED: uncharacterized protein LOC103496...    108   2e-23   Cucumis melo [Oriental melon]
ref|XP_010940316.1|  PREDICTED: uncharacterized protein LOC105058929    107   3e-23   Elaeis guineensis
gb|EPS59106.1|  hypothetical protein M569_15703                         105   6e-23   Genlisea aurea
ref|XP_010533346.1|  PREDICTED: uncharacterized protein LOC104809148    105   3e-22   Tarenaya hassleriana [spider flower]
gb|KFK39311.1|  hypothetical protein AALP_AA3G228400                    103   9e-22   Arabis alpina [alpine rockcress]
ref|XP_008813816.1|  PREDICTED: uncharacterized protein LOC103724361    103   1e-21   
ref|XP_008803754.1|  PREDICTED: uncharacterized protein LOC103717222    101   5e-21   Phoenix dactylifera
ref|XP_001784494.1|  predicted protein                                89.7    9e-18   
gb|EYU26218.1|  hypothetical protein MIMGU_mgv1a005773mg              90.5    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_002983658.1|  hypothetical protein SELMODRAFT_271651           91.3    2e-17   
ref|XP_002990554.1|  hypothetical protein SELMODRAFT_272139           89.7    6e-17   
ref|XP_004954502.1|  PREDICTED: uncharacterized protein LOC101786...  81.6    3e-14   Setaria italica
ref|XP_004954500.1|  PREDICTED: uncharacterized protein LOC101786...  81.3    4e-14   
ref|XP_002454837.1|  hypothetical protein SORBIDRAFT_04g038270        81.3    4e-14   Sorghum bicolor [broomcorn]
ref|XP_004954501.1|  PREDICTED: uncharacterized protein LOC101786...  81.3    4e-14   
gb|KHN39906.1|  U-box domain-containing protein 62                    79.0    2e-13   Glycine soja [wild soybean]
gb|KHN05427.1|  U-box domain-containing protein 62                    79.0    2e-13   Glycine soja [wild soybean]
gb|ACN36386.1|  unknown                                               73.9    1e-12   Zea mays [maize]
ref|XP_003573154.1|  PREDICTED: uncharacterized protein LOC100842356  76.3    1e-12   Brachypodium distachyon [annual false brome]
gb|AFW74140.1|  hypothetical protein ZEAMMB73_517022                  73.2    8e-12   
ref|XP_008643405.1|  PREDICTED: hypothetical protein isoform X1       73.2    2e-11   
ref|NP_001145141.1|  hypothetical protein                             73.2    2e-11   Zea mays [maize]
ref|XP_008643407.1|  PREDICTED: hypothetical protein isoform X3       73.2    2e-11   Zea mays [maize]
ref|XP_008643406.1|  PREDICTED: hypothetical protein isoform X2       72.8    2e-11   
ref|XP_012087410.1|  PREDICTED: uncharacterized protein LOC105646...  71.6    3e-11   
ref|XP_002513412.1|  conserved hypothetical protein                   72.0    4e-11   
ref|XP_009146568.1|  PREDICTED: uncharacterized protein LOC103870...  71.2    5e-11   Brassica rapa
ref|XP_009146567.1|  PREDICTED: uncharacterized protein LOC103870...  71.6    6e-11   Brassica rapa
ref|XP_002317617.2|  hypothetical protein POPTR_0011s14620g           71.2    6e-11   Populus trichocarpa [western balsam poplar]
emb|CDY23555.1|  BnaC05g40390D                                        71.2    7e-11   Brassica napus [oilseed rape]
ref|XP_012087409.1|  PREDICTED: uncharacterized protein LOC105646...  71.2    7e-11   Jatropha curcas
ref|XP_011460851.1|  PREDICTED: uncharacterized protein LOC101303...  70.9    7e-11   Fragaria vesca subsp. vesca
gb|KDP25116.1|  hypothetical protein JCGZ_22651                       71.2    7e-11   Jatropha curcas
ref|XP_007149280.1|  hypothetical protein PHAVU_005G057000g           70.9    8e-11   Phaseolus vulgaris [French bean]
ref|XP_004294206.1|  PREDICTED: uncharacterized protein LOC101303...  70.9    9e-11   Fragaria vesca subsp. vesca
ref|XP_011030743.1|  PREDICTED: uncharacterized protein LOC105130...  70.5    1e-10   Populus euphratica
ref|XP_011030742.1|  PREDICTED: uncharacterized protein LOC105130...  70.5    1e-10   Populus euphratica
ref|XP_011030744.1|  PREDICTED: uncharacterized protein LOC105130...  70.5    1e-10   Populus euphratica
emb|CDY60118.1|  BnaA05g26260D                                        70.5    1e-10   Brassica napus [oilseed rape]
ref|XP_009792142.1|  PREDICTED: uncharacterized protein LOC104239...  69.7    1e-10   Nicotiana sylvestris
gb|KEH38342.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxygena...  69.7    2e-10   Medicago truncatula
ref|XP_009792141.1|  PREDICTED: uncharacterized protein LOC104239...  69.7    2e-10   Nicotiana sylvestris
ref|XP_003596201.1|  hypothetical protein MTR_2g069480                69.7    2e-10   Medicago truncatula
dbj|BAD22941.1|  unknown protein                                      69.7    2e-10   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ25181.1|  hypothetical protein OsJ_08982                        69.7    3e-10   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007022254.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  68.9    4e-10   
ref|XP_007022253.1|  2-oxoglutarate (2OG) and Fe(II)-dependent ox...  68.6    5e-10   
gb|KJB45897.1|  hypothetical protein B456_007G335900                  65.1    9e-10   Gossypium raimondii
ref|XP_004243982.1|  PREDICTED: uncharacterized protein LOC101257983  67.8    9e-10   Solanum lycopersicum
ref|XP_006346041.1|  PREDICTED: uncharacterized protein LOC102581...  67.8    1e-09   Solanum tuberosum [potatoes]
ref|XP_006346040.1|  PREDICTED: uncharacterized protein LOC102581...  67.8    1e-09   
ref|XP_004488830.1|  PREDICTED: uncharacterized protein LOC101499742  67.8    1e-09   Cicer arietinum [garbanzo]
gb|KHG14107.1|  hypothetical protein F383_17856                       67.0    2e-09   Gossypium arboreum [tree cotton]
emb|CDP13604.1|  unnamed protein product                              67.0    2e-09   Coffea canephora [robusta coffee]
dbj|BAJ87112.1|  predicted protein                                    67.0    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010060838.1|  PREDICTED: uncharacterized protein LOC104448669  67.0    2e-09   Eucalyptus grandis [rose gum]
ref|NP_187900.2|  uncharacterized protein                             66.6    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007214418.1|  hypothetical protein PRUPE_ppa026038mg           66.2    3e-09   Prunus persica
dbj|BAB02501.1|  unnamed protein product                              66.2    3e-09   Arabidopsis thaliana [mouse-ear cress]
gb|EEC69783.1|  hypothetical protein OsI_00067                        66.2    3e-09   Oryza sativa Indica Group [Indian rice]
gb|KJB45895.1|  hypothetical protein B456_007G335700                  65.9    3e-09   Gossypium raimondii
ref|XP_011626637.1|  PREDICTED: uncharacterized protein LOC18443189   66.2    3e-09   
gb|ERN14910.1|  hypothetical protein AMTR_s00032p00180040             65.9    4e-09   Amborella trichopoda
ref|XP_010273603.1|  PREDICTED: uncharacterized protein LOC104609...  65.9    4e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010273599.1|  PREDICTED: uncharacterized protein LOC104609...  65.9    4e-09   
ref|XP_004144636.1|  PREDICTED: uncharacterized protein LOC101216737  65.9    4e-09   Cucumis sativus [cucumbers]
gb|KJB45893.1|  hypothetical protein B456_007G335700                  65.9    4e-09   Gossypium raimondii
gb|KJB45894.1|  hypothetical protein B456_007G335700                  65.9    5e-09   Gossypium raimondii
ref|XP_009602643.1|  PREDICTED: uncharacterized protein LOC104097734  65.5    5e-09   Nicotiana tomentosiformis
ref|XP_002884933.1|  hypothetical protein ARALYDRAFT_897504           65.5    5e-09   
ref|XP_006585427.1|  PREDICTED: uncharacterized protein LOC100807...  65.1    7e-09   Glycine max [soybeans]
ref|XP_003531504.1|  PREDICTED: uncharacterized protein LOC100807...  65.1    7e-09   Glycine max [soybeans]
ref|XP_008465438.1|  PREDICTED: uncharacterized protein LOC103503...  65.1    8e-09   Cucumis melo [Oriental melon]
ref|XP_008465436.1|  PREDICTED: uncharacterized protein LOC103503...  65.1    8e-09   Cucumis melo [Oriental melon]
ref|XP_010465075.1|  PREDICTED: uncharacterized protein LOC104745...  64.7    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_006407280.1|  hypothetical protein EUTSA_v10022429mg           64.7    1e-08   
ref|XP_010465074.1|  PREDICTED: uncharacterized protein LOC104745...  64.3    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010487022.1|  PREDICTED: uncharacterized protein LOC104765...  64.3    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010487023.1|  PREDICTED: uncharacterized protein LOC104765...  64.3    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_010542549.1|  PREDICTED: uncharacterized protein LOC104815...  63.9    2e-08   
ref|XP_010542548.1|  PREDICTED: uncharacterized protein LOC104815...  63.9    2e-08   Tarenaya hassleriana [spider flower]
gb|KJB12749.1|  hypothetical protein B456_002G036400                  63.5    2e-08   Gossypium raimondii
gb|KJB12751.1|  hypothetical protein B456_002G036400                  63.2    2e-08   Gossypium raimondii
gb|EEC82089.1|  hypothetical protein OsI_26091                        63.5    2e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_010093062.1|  hypothetical protein L484_016275                 63.5    3e-08   
ref|XP_006657725.1|  PREDICTED: uncharacterized protein LOC102716704  63.2    3e-08   
ref|XP_008383048.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  63.2    3e-08   
gb|KJB12747.1|  hypothetical protein B456_002G036400                  63.2    3e-08   Gossypium raimondii
ref|XP_001763000.1|  predicted protein                                62.8    4e-08   
ref|XP_006441051.1|  hypothetical protein CICLE_v10019785mg           62.4    5e-08   
ref|XP_010936700.1|  PREDICTED: uncharacterized protein LOC105056...  62.4    5e-08   
ref|XP_010936682.1|  PREDICTED: uncharacterized protein LOC105056...  62.4    6e-08   Elaeis guineensis
ref|XP_006478046.1|  PREDICTED: uncharacterized protein LOC102613...  62.4    6e-08   Citrus sinensis [apfelsine]
ref|XP_010936687.1|  PREDICTED: uncharacterized protein LOC105056...  62.4    6e-08   
ref|XP_010936693.1|  PREDICTED: uncharacterized protein LOC105056...  62.4    6e-08   Elaeis guineensis
gb|EEE67219.1|  hypothetical protein OsJ_24337                        62.4    6e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006478045.1|  PREDICTED: uncharacterized protein LOC102613...  62.4    6e-08   Citrus sinensis [apfelsine]
ref|XP_006441053.1|  hypothetical protein CICLE_v10019785mg           62.4    6e-08   Citrus clementina [clementine]
ref|XP_006478043.1|  PREDICTED: uncharacterized protein LOC102613...  62.4    6e-08   
ref|XP_006478044.1|  PREDICTED: uncharacterized protein LOC102613...  62.4    6e-08   
dbj|BAC79714.1|  unknown protein                                      62.4    6e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006598197.1|  PREDICTED: uncharacterized protein LOC100788...  62.0    7e-08   
ref|XP_006291013.1|  hypothetical protein CARUB_v10017125mg           62.4    7e-08   Capsella rubella
ref|XP_006478042.1|  PREDICTED: uncharacterized protein LOC102613...  62.4    7e-08   Citrus sinensis [apfelsine]
ref|XP_006478041.1|  PREDICTED: uncharacterized protein LOC102613...  62.4    7e-08   
ref|XP_006441052.1|  hypothetical protein CICLE_v10019785mg           62.4    7e-08   Citrus clementina [clementine]
ref|XP_006291014.1|  hypothetical protein CARUB_v10017125mg           62.0    7e-08   Capsella rubella
ref|XP_006598194.1|  PREDICTED: uncharacterized protein LOC100788...  62.0    7e-08   
ref|XP_006598196.1|  PREDICTED: uncharacterized protein LOC100788...  62.0    8e-08   
ref|NP_001059704.1|  Os07g0496900                                     62.0    8e-08   
ref|XP_006598198.1|  PREDICTED: uncharacterized protein LOC100788...  62.0    8e-08   
gb|KHN27735.1|  hypothetical protein glysoja_025540                   62.0    8e-08   Glycine soja [wild soybean]
ref|XP_001753049.1|  predicted protein                                61.6    1e-07   
gb|ACN36132.1|  unknown                                               61.2    1e-07   Zea mays [maize]
ref|XP_008667219.1|  PREDICTED: uncharacterized protein LOC100193...  61.6    1e-07   
ref|NP_001132292.1|  uncharacterized protein LOC100193732             61.6    1e-07   Zea mays [maize]
ref|XP_008667221.1|  PREDICTED: uncharacterized protein LOC100193...  61.2    1e-07   Zea mays [maize]
ref|XP_010644995.1|  PREDICTED: uncharacterized protein LOC100255...  61.2    1e-07   
ref|XP_010644992.1|  PREDICTED: uncharacterized protein LOC100255...  61.2    1e-07   Vitis vinifera
ref|XP_010644994.1|  PREDICTED: uncharacterized protein LOC100255...  61.2    1e-07   Vitis vinifera
emb|CBI21777.3|  unnamed protein product                              61.2    1e-07   Vitis vinifera
ref|XP_002984668.1|  hypothetical protein SELMODRAFT_120908           61.2    1e-07   
ref|XP_010644993.1|  PREDICTED: uncharacterized protein LOC100255...  61.2    1e-07   Vitis vinifera
emb|CAN69107.1|  hypothetical protein VITISV_011851                   61.2    2e-07   Vitis vinifera
ref|XP_002978755.1|  hypothetical protein SELMODRAFT_109178           61.2    2e-07   
gb|EPS64475.1|  hypothetical protein M569_10305                       60.5    2e-07   Genlisea aurea
ref|XP_011097649.1|  PREDICTED: uncharacterized protein LOC105176525  60.1    3e-07   
ref|XP_001774036.1|  predicted protein                                60.1    4e-07   
ref|XP_009382699.1|  PREDICTED: uncharacterized protein LOC103970595  59.3    6e-07   
ref|XP_002462889.1|  hypothetical protein SORBIDRAFT_02g033870        59.3    7e-07   Sorghum bicolor [broomcorn]
tpg|DAA62781.1|  TPA: hypothetical protein ZEAMMB73_234802            58.2    8e-07   
ref|XP_010686446.1|  PREDICTED: uncharacterized protein LOC104900...  58.5    1e-06   
ref|XP_010686445.1|  PREDICTED: uncharacterized protein LOC104900...  58.5    1e-06   
ref|XP_010686443.1|  PREDICTED: uncharacterized protein LOC104900...  58.5    1e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010686442.1|  PREDICTED: uncharacterized protein LOC104900...  58.5    1e-06   
ref|XP_001765768.1|  predicted protein                                57.8    2e-06   
gb|EYU33767.1|  hypothetical protein MIMGU_mgv1a026040mg              57.8    2e-06   Erythranthe guttata [common monkey flower]
ref|XP_006437506.1|  hypothetical protein CICLE_v10033750mg           54.3    3e-06   
ref|XP_004957758.1|  PREDICTED: uncharacterized protein LOC101785...  54.7    3e-05   Setaria italica
ref|XP_004957757.1|  PREDICTED: uncharacterized protein LOC101785...  54.3    3e-05   
gb|EMS53113.1|  hypothetical protein TRIUR3_26728                     53.5    6e-05   Triticum urartu
ref|XP_010418917.1|  PREDICTED: uncharacterized protein LOC104704548  50.1    8e-04   Camelina sativa [gold-of-pleasure]



>ref|XP_009788397.1| PREDICTED: uncharacterized protein LOC104236215 isoform X1 [Nicotiana 
sylvestris]
Length=567

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 93/131 (71%), Gaps = 12/131 (9%)
 Frame = +1

Query  319  AAQFPSTFPLSLGRDNVIALPMAQAHPPG-EFGAIPLQPLARVKLSDILPYDGAPAGGYL  495
              QFPS  PLSLGRD+VI        PPG E G   L PLARVKLSDI PYDGAP G YL
Sbjct  40   TTQFPSPSPLSLGRDHVIG-------PPGVELG---LPPLARVKLSDIAPYDGAPVGPYL  89

Query  496  RAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRG  675
            RAV+ALS SLMRHNAAVIELG+E  A+LRCGLES R++FKTR VA    AG     G RG
Sbjct  90   RAVEALSGSLMRHNAAVIELGSEGTAVLRCGLESVRYFFKTRAVAQNGGAGTGSKSG-RG  148

Query  676  VYTYRAGRPWE  708
            VY YRAGRP E
Sbjct  149  VYIYRAGRPLE  159



>ref|XP_009788398.1| PREDICTED: uncharacterized protein LOC104236215 isoform X2 [Nicotiana 
sylvestris]
Length=566

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 93/131 (71%), Gaps = 12/131 (9%)
 Frame = +1

Query  319  AAQFPSTFPLSLGRDNVIALPMAQAHPPG-EFGAIPLQPLARVKLSDILPYDGAPAGGYL  495
              QFPS  PLSLGRD+VI        PPG E G   L PLARVKLSDI PYDGAP G YL
Sbjct  40   TTQFPSPSPLSLGRDHVIG-------PPGVELG---LPPLARVKLSDIAPYDGAPVGPYL  89

Query  496  RAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRG  675
            RAV+ALS SLMRHNAAVIELG+E  A+LRCGLES R++FKTR VA    AG     G RG
Sbjct  90   RAVEALSGSLMRHNAAVIELGSEGTAVLRCGLESVRYFFKTRAVAQNGGAGTGSKSG-RG  148

Query  676  VYTYRAGRPWE  708
            VY YRAGRP E
Sbjct  149  VYIYRAGRPLE  159



>ref|XP_009612432.1| PREDICTED: uncharacterized protein LOC104105749 isoform X2 [Nicotiana 
tomentosiformis]
Length=564

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 89/130 (68%), Gaps = 10/130 (8%)
 Frame = +1

Query  319  AAQFPSTFPLSLGRDNVIALPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLR  498
              QFPS  PLSLGRD+ I  P  +         + L PLARVKLSDI PYDGAP G YLR
Sbjct  38   TTQFPSPSPLSLGRDHAIGPPSVE---------LGLPPLARVKLSDIAPYDGAPVGPYLR  88

Query  499  AVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGV  678
            AV+ALS SLMRHNAAVIELG E  A+LRCGLES R++FKTR VA    AG     G RGV
Sbjct  89   AVEALSGSLMRHNAAVIELGGEGTAVLRCGLESVRYFFKTRAVAQNGGAGTGSKSG-RGV  147

Query  679  YTYRAGRPWE  708
            Y YRAGRP E
Sbjct  148  YIYRAGRPLE  157



>ref|XP_009612431.1| PREDICTED: uncharacterized protein LOC104105749 isoform X1 [Nicotiana 
tomentosiformis]
Length=565

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 89/130 (68%), Gaps = 10/130 (8%)
 Frame = +1

Query  319  AAQFPSTFPLSLGRDNVIALPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLR  498
              QFPS  PLSLGRD+ I  P  +         + L PLARVKLSDI PYDGAP G YLR
Sbjct  38   TTQFPSPSPLSLGRDHAIGPPSVE---------LGLPPLARVKLSDIAPYDGAPVGPYLR  88

Query  499  AVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGV  678
            AV+ALS SLMRHNAAVIELG E  A+LRCGLES R++FKTR VA    AG     G RGV
Sbjct  89   AVEALSGSLMRHNAAVIELGGEGTAVLRCGLESVRYFFKTRAVAQNGGAGTGSKSG-RGV  147

Query  679  YTYRAGRPWE  708
            Y YRAGRP E
Sbjct  148  YIYRAGRPLE  157



>ref|XP_008221021.1| PREDICTED: uncharacterized protein LOC103321048 [Prunus mume]
Length=559

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 85/111 (77%), Gaps = 7/111 (6%)
 Frame = +1

Query  376  LPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIEL  555
            LP+A AHP  E  +    PLARV+LSDI PYDGAP+G YLRAV+ALS SLMRHNAAVIEL
Sbjct  61   LPIAAAHPSSEPASTIPCPLARVRLSDIAPYDGAPSGPYLRAVEALSGSLMRHNAAVIEL  120

Query  556  GAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            G+EDAALLRCGLE++R YF++R     + AG    KG+RGVY YRAGR  E
Sbjct  121  GSEDAALLRCGLEASRLYFRSRA---QLGAG----KGSRGVYMYRAGRALE  164



>ref|XP_006359309.1| PREDICTED: uncharacterized protein LOC102597261 [Solanum tuberosum]
Length=559

 Score =   135 bits (339),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 73/93 (78%), Gaps = 0/93 (0%)
 Frame = +1

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            PLARVKLSDI+PYDGAP G YLRAV+ALS SLMRHNAAVIELG E  A+LRCGLES R++
Sbjct  59   PLARVKLSDIVPYDGAPVGPYLRAVEALSGSLMRHNAAVIELGGEGTAVLRCGLESVRYF  118

Query  610  FKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            FKTR VA     G +  K  RGVY YRAGRP E
Sbjct  119  FKTRAVAQNGGGGAALGKSGRGVYIYRAGRPLE  151



>ref|XP_010277317.1| PREDICTED: uncharacterized protein LOC104611796 isoform X2 [Nelumbo 
nucifera]
Length=586

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 84/110 (76%), Gaps = 3/110 (3%)
 Frame = +1

Query  379  PMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELG  558
            P+A AHP G+  AI + PLARV+L+DILPYDGAPAG Y+R+V+ALS SL RHNA VIELG
Sbjct  73   PIATAHPAGD-PAIGVAPLARVRLADILPYDGAPAGSYVRSVEALSGSLTRHNAVVIELG  131

Query  559  AEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            +E+  L+RC LESAR YF+TRV +     G S  KG+RG+Y YRAGR  E
Sbjct  132  SEETTLMRCALESARLYFRTRVQSGNT--GGSWGKGSRGIYMYRAGRALE  179



>ref|XP_010277315.1| PREDICTED: uncharacterized protein LOC104611796 isoform X1 [Nelumbo 
nucifera]
Length=599

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 84/110 (76%), Gaps = 3/110 (3%)
 Frame = +1

Query  379  PMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELG  558
            P+A AHP G+  AI + PLARV+L+DILPYDGAPAG Y+R+V+ALS SL RHNA VIELG
Sbjct  73   PIATAHPAGD-PAIGVAPLARVRLADILPYDGAPAGSYVRSVEALSGSLTRHNAVVIELG  131

Query  559  AEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            +E+  L+RC LESAR YF+TRV +     G S  KG+RG+Y YRAGR  E
Sbjct  132  SEETTLMRCALESARLYFRTRVQSGNT--GGSWGKGSRGIYMYRAGRALE  179



>emb|CAN75326.1| hypothetical protein VITISV_042544 [Vitis vinifera]
Length=237

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 3/119 (3%)
 Frame = +1

Query  343  PLSLGRDNVIALPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSS  522
            P ++  D+V+  P+A  HP GE       PLARV+L DI+ YDGAPAG Y+RAV+ALS S
Sbjct  64   PSAIAVDHVV--PIAATHPSGEPALTMAVPLARVRLCDIVSYDGAPAGPYVRAVEALSGS  121

Query  523  LMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGR  699
            LMRHNAAVIE+G+EDAAL+RCGLESAR YFK R ++ G   GN   KG+RGVY YRAGR
Sbjct  122  LMRHNAAVIEVGSEDAALMRCGLESARLYFKARALSVGTGGGNW-GKGSRGVYMYRAGR  179



>ref|XP_002270763.1| PREDICTED: uncharacterized protein LOC100247878 [Vitis vinifera]
Length=597

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 99/153 (65%), Gaps = 26/153 (17%)
 Frame = +1

Query  313  PIAAQFPSTFPLSLGR---------------------DNVIALPMAQAHPPGEFGAIPLQ  429
            P+ +Q PS  PLSLG                      D+V+  P+A AHP GE       
Sbjct  35   PLQSQLPS--PLSLGPAAPQPPPPSSHRQLPPSAVAVDHVV--PIAAAHPSGEPALTMAV  90

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            PLARV+L DI+ YDGAPAG Y+RAV+ALS SLMRHNAAVIELG+EDAAL+RCGLESAR Y
Sbjct  91   PLARVRLCDIVSYDGAPAGPYVRAVEALSGSLMRHNAAVIELGSEDAALMRCGLESARLY  150

Query  610  FKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            FK R ++ G   GN   KG+RGVY YRAGR  E
Sbjct  151  FKARALSVGTGGGNW-GKGSRGVYMYRAGRALE  182



>gb|KHG02513.1| U-box domain-containing 63 -like protein [Gossypium arboreum]
Length=574

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  370  IALPMAQAHPPGE----FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHN  537
            +A+P++ AHP GE     G   L PLARV+LSDI PYDGAP+  Y+RAV+A S SLMRHN
Sbjct  48   VAVPISAAHPSGEPLVTMGTAAL-PLARVRLSDISPYDGAPSASYVRAVEAFSGSLMRHN  106

Query  538  AAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AAVIE G EDAAL+RC LE+AR YF++RV        N+  KG+RG Y YRAGR  E
Sbjct  107  AAVIEFGNEDAALMRCALEAARLYFRSRV--------NTAGKGSRGFYMYRAGRSLE  155



>gb|KJB15261.1| hypothetical protein B456_002G167300 [Gossypium raimondii]
Length=552

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  370  IALPMAQAHPPGE----FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHN  537
            +A+P++ AHP GE     G   L PLARV+LSDI PYDGAP+  Y+RAV+A S SLMRHN
Sbjct  48   VAVPISAAHPSGEPLVTMGTAAL-PLARVRLSDISPYDGAPSASYVRAVEAFSGSLMRHN  106

Query  538  AAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AAVIE G EDAAL+RC LE+AR YF++RV        N+  KG+RG Y YRAGR  E
Sbjct  107  AAVIEFGNEDAALMRCALEAARLYFRSRV--------NTVGKGSRGFYMYRAGRSLE  155



>gb|KJB15256.1| hypothetical protein B456_002G167300 [Gossypium raimondii]
 gb|KJB15257.1| hypothetical protein B456_002G167300 [Gossypium raimondii]
Length=574

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  370  IALPMAQAHPPGE----FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHN  537
            +A+P++ AHP GE     G   L PLARV+LSDI PYDGAP+  Y+RAV+A S SLMRHN
Sbjct  48   VAVPISAAHPSGEPLVTMGTAAL-PLARVRLSDISPYDGAPSASYVRAVEAFSGSLMRHN  106

Query  538  AAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AAVIE G EDAAL+RC LE+AR YF++RV        N+  KG+RG Y YRAGR  E
Sbjct  107  AAVIEFGNEDAALMRCALEAARLYFRSRV--------NTVGKGSRGFYMYRAGRSLE  155



>gb|KJB15259.1| hypothetical protein B456_002G167300 [Gossypium raimondii]
Length=574

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  370  IALPMAQAHPPGE----FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHN  537
            +A+P++ AHP GE     G   L PLARV+LSDI PYDGAP+  Y+RAV+A S SLMRHN
Sbjct  48   VAVPISAAHPSGEPLVTMGTAAL-PLARVRLSDISPYDGAPSASYVRAVEAFSGSLMRHN  106

Query  538  AAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AAVIE G EDAAL+RC LE+AR YF++RV        N+  KG+RG Y YRAGR  E
Sbjct  107  AAVIEFGNEDAALMRCALEAARLYFRSRV--------NTVGKGSRGFYMYRAGRSLE  155



>gb|KJB15258.1| hypothetical protein B456_002G167300 [Gossypium raimondii]
Length=535

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  370  IALPMAQAHPPGE----FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHN  537
            +A+P++ AHP GE     G   L PLARV+LSDI PYDGAP+  Y+RAV+A S SLMRHN
Sbjct  48   VAVPISAAHPSGEPLVTMGTAAL-PLARVRLSDISPYDGAPSASYVRAVEAFSGSLMRHN  106

Query  538  AAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AAVIE G EDAAL+RC LE+AR YF++RV        N+  KG+RG Y YRAGR  E
Sbjct  107  AAVIEFGNEDAALMRCALEAARLYFRSRV--------NTVGKGSRGFYMYRAGRSLE  155



>gb|KJB15260.1| hypothetical protein B456_002G167300 [Gossypium raimondii]
Length=567

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/117 (59%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  370  IALPMAQAHPPGE----FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHN  537
            +A+P++ AHP GE     G   L PLARV+LSDI PYDGAP+  Y+RAV+A S SLMRHN
Sbjct  48   VAVPISAAHPSGEPLVTMGTAAL-PLARVRLSDISPYDGAPSASYVRAVEAFSGSLMRHN  106

Query  538  AAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AAVIE G EDAAL+RC LE+AR YF++RV        N+  KG+RG Y YRAGR  E
Sbjct  107  AAVIEFGNEDAALMRCALEAARLYFRSRV--------NTVGKGSRGFYMYRAGRSLE  155



>ref|XP_012087714.1| PREDICTED: uncharacterized protein LOC105646466 [Jatropha curcas]
 gb|KDP24689.1| hypothetical protein JCGZ_26510 [Jatropha curcas]
Length=564

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 87/120 (73%), Gaps = 8/120 (7%)
 Frame = +1

Query  349  SLGRDNVIALPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLM  528
            SL  D+VIA  +   H P E  A P+  LA+V+LSDI P+DGAP+G Y++AV+ALS SLM
Sbjct  38   SLSVDHVIAPSITAVHHPAEPAA-PM--LAKVRLSDIAPFDGAPSGLYMKAVEALSGSLM  94

Query  529  RHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            RHNAAVIELG+EDAAL+RCGLE+AR +F+ RV   G   G     G+RGVY YRAGR  E
Sbjct  95   RHNAAVIELGSEDAALMRCGLEAARLFFRCRVQNVGSKGG-----GSRGVYMYRAGRALE  149



>ref|XP_007223380.1| hypothetical protein PRUPE_ppa003811mg [Prunus persica]
 gb|EMJ24579.1| hypothetical protein PRUPE_ppa003811mg [Prunus persica]
Length=547

 Score =   128 bits (321),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 102/165 (62%), Gaps = 15/165 (9%)
 Frame = +1

Query  220  IVMLAMHQHHQstpppppssasslrsataaVPIAAQFPSTFPLSLGRDNVIALPMAQAHP  399
            +VM+ M Q   + P     +  S  +     P A    S  P  L R    ALP+    P
Sbjct  1    MVMIMMQQQTSAPPASHSITPPSSTTTAIRSPTATPTHSQQPSPLSRH---ALPLPA--P  55

Query  400  PGEFGA--IPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAA  573
            P +  A  IP  PLARV+LSDI PYDGAP G YLRAV+ALS SLMRHNAAVIELG+EDAA
Sbjct  56   PVDHPASTIPC-PLARVRLSDIAPYDGAPCGPYLRAVEALSGSLMRHNAAVIELGSEDAA  114

Query  574  LLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            LLRCGLE++R YF++R     + AG    KG+RGVY YRAGR  E
Sbjct  115  LLRCGLEASRLYFRSRA---QLGAG----KGSRGVYMYRAGRALE  152



>ref|XP_011075298.1| PREDICTED: uncharacterized protein LOC105159801 isoform X2 [Sesamum 
indicum]
Length=514

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 70/91 (77%), Gaps = 13/91 (14%)
 Frame = +1

Query  436  ARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFK  615
            +R++LSDILPYDG P G Y+RAVDALS+SLMRHNAAVIELG EDAALLRC LESAR YF+
Sbjct  51   SRIRLSDILPYDGTPMGPYIRAVDALSNSLMRHNAAVIELGPEDAALLRCALESARLYFR  110

Query  616  TRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            TR             KG RGVYTYRAGRP E
Sbjct  111  TR-------------KGGRGVYTYRAGRPLE  128



>ref|XP_011075296.1| PREDICTED: uncharacterized protein LOC105159801 isoform X1 [Sesamum 
indicum]
Length=537

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 70/91 (77%), Gaps = 13/91 (14%)
 Frame = +1

Query  436  ARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFK  615
            +R++LSDILPYDG P G Y+RAVDALS+SLMRHNAAVIELG EDAALLRC LESAR YF+
Sbjct  51   SRIRLSDILPYDGTPMGPYIRAVDALSNSLMRHNAAVIELGPEDAALLRCALESARLYFR  110

Query  616  TRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            TR             KG RGVYTYRAGRP E
Sbjct  111  TR-------------KGGRGVYTYRAGRPLE  128



>ref|XP_011075299.1| PREDICTED: uncharacterized protein LOC105159801 isoform X3 [Sesamum 
indicum]
Length=504

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 70/91 (77%), Gaps = 13/91 (14%)
 Frame = +1

Query  436  ARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFK  615
            +R++LSDILPYDG P G Y+RAVDALS+SLMRHNAAVIELG EDAALLRC LESAR YF+
Sbjct  51   SRIRLSDILPYDGTPMGPYIRAVDALSNSLMRHNAAVIELGPEDAALLRCALESARLYFR  110

Query  616  TRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            TR             KG RGVYTYRAGRP E
Sbjct  111  TR-------------KGGRGVYTYRAGRPLE  128



>ref|XP_008340467.1| PREDICTED: uncharacterized protein LOC103403417 [Malus domestica]
Length=565

 Score =   126 bits (316),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 80/111 (72%), Gaps = 7/111 (6%)
 Frame = +1

Query  376  LPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIEL  555
            LP+A AHP GE        LARV+LSDI PY GAP G Y+RAV+ALS SL RHNAAVIEL
Sbjct  67   LPIAAAHPSGEPAPTIQCQLARVRLSDIAPYHGAPGGSYVRAVEALSGSLTRHNAAVIEL  126

Query  556  GAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            G+ED ALLRCGLE++R YF++R     + AG    KG+RGV+ YRAGR  E
Sbjct  127  GSEDTALLRCGLEASRLYFRSRA---QLGAG----KGSRGVHMYRAGRALE  170



>ref|XP_009351687.1| PREDICTED: uncharacterized protein LOC103943186 [Pyrus x bretschneideri]
Length=537

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 80/111 (72%), Gaps = 7/111 (6%)
 Frame = +1

Query  376  LPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIEL  555
            LP+A AHP GE        LARV+ SDI PY GAP+G Y+RAV+ALS SL RHNAAVIEL
Sbjct  39   LPIAAAHPSGEPAPTIQCQLARVRFSDIAPYHGAPSGSYVRAVEALSGSLTRHNAAVIEL  98

Query  556  GAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            G+EDAALLRCGLE++R YF++R    GV       KG+RGV+ YRAGR  E
Sbjct  99   GSEDAALLRCGLEASRLYFRSRAQL-GVG------KGSRGVHMYRAGRALE  142



>ref|XP_002312241.2| hypothetical protein POPTR_0008s08530g [Populus trichocarpa]
 gb|EEE89608.2| hypothetical protein POPTR_0008s08530g [Populus trichocarpa]
Length=593

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 84/116 (72%), Gaps = 9/116 (8%)
 Frame = +1

Query  361  DNVIALPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNA  540
            D+VI+   + AH      A P   LARV+LSDI PYDGAP G Y+RAVDALS SLMRHNA
Sbjct  70   DHVISPVASAAH----HSADPAPTLARVRLSDISPYDGAPGGPYVRAVDALSGSLMRHNA  125

Query  541  AVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AVIELG+E+A+L+RCGLE+AR YF++R   +GV  G S     RGVY YRAGRP E
Sbjct  126  AVIELGSEEASLMRCGLEAARLYFRSR-SQNGVVKGCS----GRGVYMYRAGRPVE  176



>ref|XP_007045309.1| RING/U-box superfamily protein isoform 5 [Theobroma cacao]
 gb|EOY01141.1| RING/U-box superfamily protein isoform 5 [Theobroma cacao]
Length=400

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  370  IALPMAQAHPPGE----FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHN  537
            + +P++ A+P GE     G  P   L RV+LSDI  YDGAP+G Y+RAV++LS SLMR+N
Sbjct  55   VVVPISAANPSGEPLLTMGTTPFL-LPRVRLSDISAYDGAPSGSYVRAVESLSGSLMRNN  113

Query  538  AAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AAV+E G EDAAL+RCGLE+AR YF++RV        N+  KG+RGVY YRAGR  E
Sbjct  114  AAVVEFGNEDAALMRCGLEAARLYFRSRV--------NTVGKGSRGVYMYRAGRALE  162



>ref|XP_007045308.1| RING/U-box superfamily protein isoform 4 [Theobroma cacao]
 gb|EOY01140.1| RING/U-box superfamily protein isoform 4 [Theobroma cacao]
Length=398

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  370  IALPMAQAHPPGE----FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHN  537
            + +P++ A+P GE     G  P   L RV+LSDI  YDGAP+G Y+RAV++LS SLMR+N
Sbjct  55   VVVPISAANPSGEPLLTMGTTPFL-LPRVRLSDISAYDGAPSGSYVRAVESLSGSLMRNN  113

Query  538  AAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AAV+E G EDAAL+RCGLE+AR YF++RV        N+  KG+RGVY YRAGR  E
Sbjct  114  AAVVEFGNEDAALMRCGLEAARLYFRSRV--------NTVGKGSRGVYMYRAGRALE  162



>ref|XP_007045306.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY01138.1| RING/U-box superfamily protein isoform 2 [Theobroma cacao]
Length=454

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  370  IALPMAQAHPPGE----FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHN  537
            + +P++ A+P GE     G  P   L RV+LSDI  YDGAP+G Y+RAV++LS SLMR+N
Sbjct  55   VVVPISAANPSGEPLLTMGTTPFL-LPRVRLSDISAYDGAPSGSYVRAVESLSGSLMRNN  113

Query  538  AAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AAV+E G EDAAL+RCGLE+AR YF++RV        N+  KG+RGVY YRAGR  E
Sbjct  114  AAVVEFGNEDAALMRCGLEAARLYFRSRV--------NTVGKGSRGVYMYRAGRALE  162



>ref|XP_011017036.1| PREDICTED: uncharacterized protein LOC105120503 isoform X1 [Populus 
euphratica]
Length=593

 Score =   124 bits (312),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 71/116 (61%), Positives = 85/116 (73%), Gaps = 9/116 (8%)
 Frame = +1

Query  361  DNVIALPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNA  540
            D+VI+ P+A A       A P   LARV+LSDI PYDGAP G Y+RAVDALS SLMRHNA
Sbjct  70   DHVIS-PIASA---AHHSADPAPTLARVRLSDISPYDGAPGGPYVRAVDALSGSLMRHNA  125

Query  541  AVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AVIELG+++A+L+RCGLE+AR YF++R   +GV  G S     RGVY YRAGRP E
Sbjct  126  AVIELGSDEASLMRCGLEAARLYFRSR-SQNGVVKGCS----GRGVYMYRAGRPVE  176



>ref|XP_008350822.1| PREDICTED: uncharacterized protein LOC103414196 [Malus domestica]
Length=561

 Score =   124 bits (310),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +1

Query  376  LPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIEL  555
            LP+A AHP GE        LARV+LSDI PY GAP G Y+ AVDALS SL RHNAAVIEL
Sbjct  64   LPIAAAHPSGEPAPTIQCQLARVRLSDITPYHGAPGGSYVXAVDALSGSLTRHNAAVIEL  123

Query  556  GAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            G++D ALLRCGLE++R YF++R    GV       KG+RGV+ YRAGR  E
Sbjct  124  GSDDTALLRCGLEASRLYFRSRAQL-GVG------KGSRGVHMYRAGRALE  167



>ref|XP_011013780.1| PREDICTED: uncharacterized protein LOC105117715 isoform X2 [Populus 
euphratica]
Length=518

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 84/116 (72%), Gaps = 9/116 (8%)
 Frame = +1

Query  361  DNVIALPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNA  540
            D+VI+     AH   E    P   LARV+LSDI PYDGAPAG Y+RAV+ALS SLM+HNA
Sbjct  72   DHVISPIACAAHHSAE----PALMLARVRLSDISPYDGAPAGPYVRAVEALSGSLMKHNA  127

Query  541  AVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AVIELG+ +A+L+RCGLE+AR YF++R   +GV  G S    +RGVY YRAGRP E
Sbjct  128  AVIELGSAEASLMRCGLEAARLYFRSR-SQNGVVKGCS----SRGVYMYRAGRPVE  178



>ref|XP_011013787.1| PREDICTED: uncharacterized protein LOC105117715 isoform X3 [Populus 
euphratica]
 ref|XP_011016094.1| PREDICTED: uncharacterized protein LOC105119627 isoform X2 [Populus 
euphratica]
Length=486

 Score =   123 bits (308),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 84/116 (72%), Gaps = 9/116 (8%)
 Frame = +1

Query  361  DNVIALPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNA  540
            D+VI+     AH   E    P   LARV+LSDI PYDGAPAG Y+RAV+ALS SLM+HNA
Sbjct  72   DHVISPIACAAHHSAE----PALMLARVRLSDISPYDGAPAGPYVRAVEALSGSLMKHNA  127

Query  541  AVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AVIELG+ +A+L+RCGLE+AR YF++R   +GV  G S    +RGVY YRAGRP E
Sbjct  128  AVIELGSAEASLMRCGLEAARLYFRSR-SQNGVVKGCS----SRGVYMYRAGRPVE  178



>ref|XP_007045307.1| RING/U-box superfamily protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY01139.1| RING/U-box superfamily protein isoform 3, partial [Theobroma 
cacao]
Length=443

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 82/114 (72%), Gaps = 13/114 (11%)
 Frame = +1

Query  370  IALPMAQAHPPGE----FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHN  537
            + +P++ A+P GE     G  P   L RV+LSDI  YDGAP+G Y+RAV++LS SLMR+N
Sbjct  55   VVVPISAANPSGEPLLTMGTTPFL-LPRVRLSDISAYDGAPSGSYVRAVESLSGSLMRNN  113

Query  538  AAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGR  699
            AAV+E G EDAAL+RCGLE+AR YF++RV        N+  KG+RGVY YRAGR
Sbjct  114  AAVVEFGNEDAALMRCGLEAARLYFRSRV--------NTVGKGSRGVYMYRAGR  159



>ref|XP_007045305.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY01137.1| RING/U-box superfamily protein isoform 1 [Theobroma cacao]
Length=579

 Score =   123 bits (309),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 83/117 (71%), Gaps = 13/117 (11%)
 Frame = +1

Query  370  IALPMAQAHPPGE----FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHN  537
            + +P++ A+P GE     G  P   L RV+LSDI  YDGAP+G Y+RAV++LS SLMR+N
Sbjct  55   VVVPISAANPSGEPLLTMGTTPFL-LPRVRLSDISAYDGAPSGSYVRAVESLSGSLMRNN  113

Query  538  AAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AAV+E G EDAAL+RCGLE+AR YF++RV        N+  KG+RGVY YRAGR  E
Sbjct  114  AAVVEFGNEDAALMRCGLEAARLYFRSRV--------NTVGKGSRGVYMYRAGRALE  162



>ref|XP_010688769.1| PREDICTED: uncharacterized protein LOC104902626 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=576

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 8/90 (9%)
 Frame = +1

Query  439  RVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKT  618
            RV+LSDI PYDGAP GGYL+AV+ALS SLMRHNAAV+ELG+ DAA++RCGLESAR YF+ 
Sbjct  75   RVRLSDIGPYDGAPCGGYLKAVEALSGSLMRHNAAVLELGSNDAAIMRCGLESARLYFRN  134

Query  619  RVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            R V  G        KG+RGVY YRAGR  E
Sbjct  135  RAVNVG--------KGSRGVYMYRAGRALE  156



>gb|KDO53026.1| hypothetical protein CISIN_1g0077962mg, partial [Citrus sinensis]
 gb|KDO53027.1| hypothetical protein CISIN_1g0077962mg, partial [Citrus sinensis]
Length=406

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 8/92 (9%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RV+LSD+ PYDGAPAG YL+AV+ALS SLMRHNAAVIELG+EDAA++RCGLE+AR YF
Sbjct  85   LPRVRLSDVAPYDGAPAGPYLKAVEALSGSLMRHNAAVIELGSEDAAIMRCGLEAARLYF  144

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            +T+    G        KG+RGVY YRAGR  E
Sbjct  145  RTKSQTVG--------KGSRGVYMYRAGRALE  168



>ref|XP_004236832.1| PREDICTED: uncharacterized protein LOC101261219 [Solanum lycopersicum]
Length=562

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/96 (71%), Positives = 74/96 (77%), Gaps = 3/96 (3%)
 Frame = +1

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            PLARVKLSDI+PYDGAP G YLRAV+ALS SLMRHNAAVIELG E  A+LRCGLESAR++
Sbjct  59   PLARVKLSDIVPYDGAPVGPYLRAVEALSGSLMRHNAAVIELGGEGTAVLRCGLESARYF  118

Query  610  FKTR---VVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            FKTR       G A G +  K  RGVY YRAGRP E
Sbjct  119  FKTRAVAQNGGGGAGGAALGKSGRGVYIYRAGRPLE  154



>ref|XP_011016093.1| PREDICTED: uncharacterized protein LOC105119627 isoform X1 [Populus 
euphratica]
Length=594

 Score =   123 bits (308),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 84/116 (72%), Gaps = 9/116 (8%)
 Frame = +1

Query  361  DNVIALPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNA  540
            D+VI+     AH   E    P   LARV+LSDI PYDGAPAG Y+RAV+ALS SLM+HNA
Sbjct  72   DHVISPIACAAHHSAE----PALMLARVRLSDISPYDGAPAGPYVRAVEALSGSLMKHNA  127

Query  541  AVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AVIELG+ +A+L+RCGLE+AR YF++R   +GV  G S    +RGVY YRAGRP E
Sbjct  128  AVIELGSAEASLMRCGLEAARLYFRSR-SQNGVVKGCS----SRGVYMYRAGRPVE  178



>ref|XP_011013772.1| PREDICTED: uncharacterized protein LOC105117715 isoform X1 [Populus 
euphratica]
Length=594

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 84/116 (72%), Gaps = 9/116 (8%)
 Frame = +1

Query  361  DNVIALPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNA  540
            D+VI+     AH   E    P   LARV+LSDI PYDGAPAG Y+RAV+ALS SLM+HNA
Sbjct  72   DHVISPIACAAHHSAE----PALMLARVRLSDISPYDGAPAGPYVRAVEALSGSLMKHNA  127

Query  541  AVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AVIELG+ +A+L+RCGLE+AR YF++R   +GV  G S    +RGVY YRAGRP E
Sbjct  128  AVIELGSAEASLMRCGLEAARLYFRSR-SQNGVVKGCS----SRGVYMYRAGRPVE  178



>ref|XP_006437502.1| hypothetical protein CICLE_v10031032mg [Citrus clementina]
 gb|ESR50742.1| hypothetical protein CICLE_v10031032mg [Citrus clementina]
Length=590

 Score =   122 bits (305),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 8/92 (9%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RV+LSD+ PYDGAPAG YL+AV+ALS SLMRHNAAVIELG+EDAA++RCGLE+AR YF
Sbjct  86   LPRVRLSDVAPYDGAPAGPYLKAVEALSGSLMRHNAAVIELGSEDAAIMRCGLEAARLYF  145

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            +T+    G        KG+RGVY YRAGR  E
Sbjct  146  RTKSQTVG--------KGSRGVYMYRAGRALE  169



>ref|XP_006437503.1| hypothetical protein CICLE_v10031032mg [Citrus clementina]
 gb|ESR50743.1| hypothetical protein CICLE_v10031032mg [Citrus clementina]
Length=548

 Score =   121 bits (304),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 8/92 (9%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RV+LSD+ PYDGAPAG YL+AV+ALS SLMRHNAAVIELG+EDAA++RCGLE+AR YF
Sbjct  86   LPRVRLSDVAPYDGAPAGPYLKAVEALSGSLMRHNAAVIELGSEDAAIMRCGLEAARLYF  145

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            +T+    G        KG+RGVY YRAGR  E
Sbjct  146  RTKSQTVG--------KGSRGVYMYRAGRALE  169



>ref|XP_004297760.1| PREDICTED: uncharacterized protein LOC101297139 [Fragaria vesca 
subsp. vesca]
Length=542

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 7/92 (8%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            LARV++SDI PYDGAP G Y+RAV+AL+ SLMRHNAAVIELGA+DAALLRCGLE++R YF
Sbjct  62   LARVRISDIAPYDGAPTGTYVRAVEALAGSLMRHNAAVIELGADDAALLRCGLEASRLYF  121

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            ++R     + AG    KG+RGVY YRAGR  E
Sbjct  122  RSRA---QLGAG----KGSRGVYMYRAGRALE  146



>emb|CBI27450.3| unnamed protein product [Vitis vinifera]
Length=510

 Score =   120 bits (302),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 75/93 (81%), Gaps = 1/93 (1%)
 Frame = +1

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            PLARV+L DI+ YDGAPAG Y+RAV+ALS SLMRHNAAVIELG+EDAAL+RCGLESAR Y
Sbjct  4    PLARVRLCDIVSYDGAPAGPYVRAVEALSGSLMRHNAAVIELGSEDAALMRCGLESARLY  63

Query  610  FKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            FK R ++     G +  KG+RGVY YRAGR  E
Sbjct  64   FKARALSV-GTGGGNWGKGSRGVYMYRAGRALE  95



>ref|XP_003537792.1| PREDICTED: uncharacterized protein LOC100794424 [Glycine max]
Length=585

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 75/98 (77%), Gaps = 7/98 (7%)
 Frame = +1

Query  415  AIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLE  594
            A+P  PL RV+LSDI PYDGAP G YLRA++AL  SL+RHNAA+IELG ED AL+RCGLE
Sbjct  80   AVPTCPLVRVRLSDIAPYDGAPGGPYLRAMEALCGSLLRHNAALIELGNEDTALMRCGLE  139

Query  595  SARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
             AR +F++R  AH + +G    KG+RGVY YRAGR  E
Sbjct  140  GARLFFRSR--AH-LGSG----KGSRGVYMYRAGRALE  170



>ref|XP_006406445.1| hypothetical protein EUTSA_v10020435mg [Eutrema salsugineum]
 gb|ESQ47898.1| hypothetical protein EUTSA_v10020435mg [Eutrema salsugineum]
Length=554

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 88/134 (66%), Gaps = 8/134 (6%)
 Frame = +1

Query  310  VPIAAQFPSTFPLSLGRDNVIALPMAQAHPPGE-FGAIPLQPLARVKLSDILPYDGAPAG  486
            V +AA   S    S     +   P++ A+P G+    +   PLARV+LSDILPY+GAP+ 
Sbjct  18   VSVAADVSSALNKSPLSHPITVTPISAAYPSGDPMLMMSANPLARVRLSDILPYEGAPSP  77

Query  487  GYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKG  666
             Y +AV++LS SLMR+NA+VIELG++DAAL+RCGLE+AR YF+TR       + N   KG
Sbjct  78   AYAKAVESLSVSLMRYNASVIELGSKDAALMRCGLEAARLYFRTR-------SFNVSGKG  130

Query  667  TRGVYTYRAGRPWE  708
             RG+  YRAGR  E
Sbjct  131  NRGLSMYRAGRSVE  144



>ref|XP_006592057.1| PREDICTED: uncharacterized protein LOC100807199 [Glycine max]
Length=587

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 80/111 (72%), Gaps = 9/111 (8%)
 Frame = +1

Query  376  LPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIEL  555
            +P+    P     A+P  PL RV+LSDI PY+GAPAG YLRA++AL  SL+RHNAA+IEL
Sbjct  71   VPVTSVEP--ALTAVPTCPLVRVRLSDIAPYEGAPAGPYLRAMEALCGSLLRHNAALIEL  128

Query  556  GAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            G ED AL+RCGLE AR +F++R  AH + +G    KG+RGVY YRAGR  E
Sbjct  129  GNEDTALMRCGLEGARLFFRSR--AH-LGSG----KGSRGVYMYRAGRALE  172



>gb|KCW51263.1| hypothetical protein EUGRSUZ_J00840 [Eucalyptus grandis]
Length=580

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 71/92 (77%), Gaps = 5/92 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            +ARV+LSDI PYDGAPAG YLRAV+ALS SL RHNAAVIELG EDAAL+RCGLE+A+ Y 
Sbjct  84   MARVRLSDIAPYDGAPAGPYLRAVEALSGSLTRHNAAVIELGPEDAALMRCGLEAAKLYL  143

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            +TR  A     G SP    RGVY YRAGRP E
Sbjct  144  RTRSQAPAAGKG-SP----RGVYLYRAGRPIE  170



>ref|XP_010031870.1| PREDICTED: uncharacterized protein LOC104421574 [Eucalyptus grandis]
 gb|KCW51264.1| hypothetical protein EUGRSUZ_J00840 [Eucalyptus grandis]
Length=586

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 71/92 (77%), Gaps = 5/92 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            +ARV+LSDI PYDGAPAG YLRAV+ALS SL RHNAAVIELG EDAAL+RCGLE+A+ Y 
Sbjct  84   MARVRLSDIAPYDGAPAGPYLRAVEALSGSLTRHNAAVIELGPEDAALMRCGLEAAKLYL  143

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            +TR  A     G SP    RGVY YRAGRP E
Sbjct  144  RTRSQAPAAGKG-SP----RGVYLYRAGRPIE  170



>ref|XP_002316144.2| hypothetical protein POPTR_0010s17820g [Populus trichocarpa]
 gb|EEF02315.2| hypothetical protein POPTR_0010s17820g [Populus trichocarpa]
Length=586

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/116 (58%), Positives = 83/116 (72%), Gaps = 9/116 (8%)
 Frame = +1

Query  361  DNVIALPMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNA  540
            D+VI+   + AH   E    P   LA V+LSDI PYDGAP G Y+RAV+ALS SLM+HNA
Sbjct  64   DHVISPIASAAHHSAE----PALMLATVRLSDISPYDGAPGGPYVRAVEALSGSLMKHNA  119

Query  541  AVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            AVIELG+ +A+L+RCGLE+AR YF++R   +GV  G S    +RGVY YRAGRP E
Sbjct  120  AVIELGSAEASLMRCGLEAARLYFRSR-SQNGVVKGCS----SRGVYMYRAGRPVE  170



>gb|ERN09498.1| hypothetical protein AMTR_s00029p00116980 [Amborella trichopoda]
Length=583

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 76/111 (68%), Gaps = 8/111 (7%)
 Frame = +1

Query  379  PMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELG  558
            P++ AHP  E   I    L R+K SDI PYDGAP+G Y +AV+ LS SL RHNAAVIELG
Sbjct  59   PLSSAHPLHESSPISTF-LPRIKFSDIAPYDGAPSGLYNKAVETLSGSLTRHNAAVIELG  117

Query  559  AEDAALLRCGLESARFYFKTRVVAHGVAAGNSPW-KGTRGVYTYRAGRPWE  708
            +ED+ALLRC +ESA+ YF+TR  A GV      W K  RG+Y YRAGR  E
Sbjct  118  SEDSALLRCAMESAKLYFRTRTTAGGV------WSKSNRGIYMYRAGRALE  162



>ref|XP_006847917.2| PREDICTED: uncharacterized protein LOC18437651 [Amborella trichopoda]
 ref|XP_011624668.1| PREDICTED: uncharacterized protein LOC18437651 [Amborella trichopoda]
Length=593

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 76/111 (68%), Gaps = 8/111 (7%)
 Frame = +1

Query  379  PMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELG  558
            P++ AHP  E   I    L R+K SDI PYDGAP+G Y +AV+ LS SL RHNAAVIELG
Sbjct  69   PLSSAHPLHESSPISTF-LPRIKFSDIAPYDGAPSGLYNKAVETLSGSLTRHNAAVIELG  127

Query  559  AEDAALLRCGLESARFYFKTRVVAHGVAAGNSPW-KGTRGVYTYRAGRPWE  708
            +ED+ALLRC +ESA+ YF+TR  A GV      W K  RG+Y YRAGR  E
Sbjct  128  SEDSALLRCAMESAKLYFRTRTTAGGV------WSKSNRGIYMYRAGRALE  172



>ref|XP_007131675.1| hypothetical protein PHAVU_011G032200g [Phaseolus vulgaris]
 gb|ESW03669.1| hypothetical protein PHAVU_011G032200g [Phaseolus vulgaris]
Length=588

 Score =   119 bits (298),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 74/98 (76%), Gaps = 7/98 (7%)
 Frame = +1

Query  415  AIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLE  594
            A+P  PL RV+LSDI PYDGAPAG YLRA++AL  SL+RHNAA+IELG+ED AL+RCGLE
Sbjct  83   AVPTCPLVRVRLSDIGPYDGAPAGPYLRAMEALCGSLLRHNAALIELGSEDTALMRCGLE  142

Query  595  SARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
             A+ +F++R    GV       KG+RGVY YRAGR  E
Sbjct  143  GAKLFFRSR-AQLGVG------KGSRGVYMYRAGRALE  173



>emb|CDY33428.1| BnaC01g32970D [Brassica napus]
Length=550

 Score =   118 bits (295),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 79/112 (71%), Gaps = 10/112 (9%)
 Frame = +1

Query  379  PMAQAHPPGEFGAIPLQ--PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIE  552
            P++ +HP G+   +     PLARV+LSDILPY+GAP+  Y +AV+ALS+SLMR+NA+VIE
Sbjct  39   PISASHPTGDSTLMSSSGCPLARVRLSDILPYEGAPSPSYAKAVEALSTSLMRYNASVIE  98

Query  553  LGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            LG+ED AL+RCGLE+AR YF+TR    G        K  RG+  YRAGR  E
Sbjct  99   LGSEDTALMRCGLEAARLYFRTRNSVSG--------KANRGLSMYRAGRSVE  142



>gb|EYU39421.1| hypothetical protein MIMGU_mgv1a005295mg [Erythranthe guttata]
Length=342

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 66/91 (73%), Gaps = 13/91 (14%)
 Frame = +1

Query  436  ARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFK  615
             R++LSDILPYDG P   YLRA+DALS+SL RHNAA+IEL  EDAALLRC ++S+R YF+
Sbjct  46   CRIRLSDILPYDGPPMATYLRALDALSTSLDRHNAAIIELSPEDAALLRCAIDSSRLYFR  105

Query  616  TRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            TR             KG RGVYTYRAGRP E
Sbjct  106  TR-------------KGGRGVYTYRAGRPLE  123



>ref|XP_006297358.1| hypothetical protein CARUB_v10013378mg [Capsella rubella]
 gb|EOA30256.1| hypothetical protein CARUB_v10013378mg [Capsella rubella]
Length=552

 Score =   117 bits (294),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 87/134 (65%), Gaps = 8/134 (6%)
 Frame = +1

Query  310  VPIAAQFPSTFPLSLGRDNVIALPMAQAHPPGE-FGAIPLQPLARVKLSDILPYDGAPAG  486
            V IA+  PS    S     +   P++ A+P G+    +    LARV+LSDILPY+GAP+ 
Sbjct  18   VSIASDVPSGLTKSPLSHAIPVSPISAAYPSGDPMLMMSGSALARVRLSDILPYEGAPSP  77

Query  487  GYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKG  666
             Y +AV+ALS SLMR+NA+VIELG+ED AL+RCGLE+AR YF+TR +       N   KG
Sbjct  78   AYAKAVEALSVSLMRYNASVIELGSEDTALIRCGLEAARLYFRTRSL-------NVSGKG  130

Query  667  TRGVYTYRAGRPWE  708
             RG+  YRAGR  E
Sbjct  131  NRGLSMYRAGRSVE  144



>ref|XP_009111439.1| PREDICTED: uncharacterized protein LOC103836884 [Brassica rapa]
Length=552

 Score =   117 bits (293),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 92/139 (66%), Gaps = 19/139 (14%)
 Frame = +1

Query  316  IAAQFPSTFPLSLGRDNVIAL--PMAQAHPPGEFGAIPLQ------PLARVKLSDILPYD  471
            I A  PS  P  L + ++I +  P++ +HP G+  + P+       PLARV+LSDILPY+
Sbjct  17   IPAHSPSPSP-RLNKPHLITVTPPISASHPTGD--STPMMSSSSGCPLARVRLSDILPYE  73

Query  472  GAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGN  651
            GAP+  Y +AV+ALS+SLMR+NA+VIELG+ED AL+RCGLE+AR YF+TR    G     
Sbjct  74   GAPSPSYAKAVEALSASLMRYNASVIELGSEDTALMRCGLEAARLYFRTRSSVSG-----  128

Query  652  SPWKGTRGVYTYRAGRPWE  708
               K  RG+  YRAGR  E
Sbjct  129  ---KPNRGLSMYRAGRSVE  144



>ref|XP_002515804.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46585.1| conserved hypothetical protein [Ricinus communis]
Length=560

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 71/93 (76%), Gaps = 11/93 (12%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            LARV+LSDI P+DGAP G Y+RAVD LS SLMRHNAAVIE+G+EDA+L++C LES+R +F
Sbjct  61   LARVRLSDISPFDGAPGGAYMRAVDTLSGSLMRHNAAVIEVGSEDASLIKCALESSRLFF  120

Query  613  KTRVVAHGVAAGNSPWK-GTRGVYTYRAGRPWE  708
            +TR          +P K G RGVYTYRAGR  E
Sbjct  121  RTR----------APSKIGGRGVYTYRAGRALE  143



>ref|XP_009396140.1| PREDICTED: uncharacterized protein LOC103981215 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=550

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +1

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            P+A+VKL+DI+PY+GAP G Y +AV+ LS SLMRHNA VIELG+E+A +++C LESAR  
Sbjct  81   PVAKVKLADIVPYEGAPGGVYSKAVEELSGSLMRHNAVVIELGSEEAVVVKCALESARMC  140

Query  610  FKTRVVAHGVAAGNSPW-KGTRGVYTYRAGRPWE  708
            FK R   +G  +G S W K  RGVYTYRAGR  E
Sbjct  141  FKARAQCNGAGSGVSGWGKLGRGVYTYRAGRALE  174



>gb|EYU39422.1| hypothetical protein MIMGU_mgv1a005295mg [Erythranthe guttata]
Length=467

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 66/91 (73%), Gaps = 13/91 (14%)
 Frame = +1

Query  436  ARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFK  615
             R++LSDILPYDG P   YLRA+DALS+SL RHNAA+IEL  EDAALLRC ++S+R YF+
Sbjct  46   CRIRLSDILPYDGPPMATYLRALDALSTSLDRHNAAIIELSPEDAALLRCAIDSSRLYFR  105

Query  616  TRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            TR             KG RGVYTYRAGRP E
Sbjct  106  TR-------------KGGRGVYTYRAGRPLE  123



>gb|EYU39423.1| hypothetical protein MIMGU_mgv1a005295mg [Erythranthe guttata]
Length=490

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 66/91 (73%), Gaps = 13/91 (14%)
 Frame = +1

Query  436  ARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFK  615
             R++LSDILPYDG P   YLRA+DALS+SL RHNAA+IEL  EDAALLRC ++S+R YF+
Sbjct  46   CRIRLSDILPYDGPPMATYLRALDALSTSLDRHNAAIIELSPEDAALLRCAIDSSRLYFR  105

Query  616  TRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            TR             KG RGVYTYRAGRP E
Sbjct  106  TR-------------KGGRGVYTYRAGRPLE  123



>ref|XP_002885344.1| hypothetical protein ARALYDRAFT_898385 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61603.1| hypothetical protein ARALYDRAFT_898385 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   116 bits (291),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 65/134 (49%), Positives = 88/134 (66%), Gaps = 8/134 (6%)
 Frame = +1

Query  310  VPIAAQFPSTFPLSLGRDNVIALPMAQAHPPGE-FGAIPLQPLARVKLSDILPYDGAPAG  486
            V IA+  P+    S     +   P++ A+P G+    +   PLARV+LSDILPY+GAP+ 
Sbjct  18   VSIASDVPTGLTKSPLSHAIPVSPISAAYPSGDPMLMMSGTPLARVRLSDILPYEGAPSP  77

Query  487  GYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKG  666
             Y +AV+ALS SLMR+NA+VIE+G++D AL+RCGLE+AR YF+TR +       N   KG
Sbjct  78   VYAKAVEALSVSLMRYNASVIEIGSDDTALMRCGLEAARLYFRTRSL-------NVSGKG  130

Query  667  TRGVYTYRAGRPWE  708
             RG+  YRAGR  E
Sbjct  131  NRGLSMYRAGRSVE  144



>ref|XP_009396138.1| PREDICTED: uncharacterized protein LOC103981215 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009396139.1| PREDICTED: uncharacterized protein LOC103981215 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=592

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 71/94 (76%), Gaps = 1/94 (1%)
 Frame = +1

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            P+A+VKL+DI+PY+GAP G Y +AV+ LS SLMRHNA VIELG+E+A +++C LESAR  
Sbjct  81   PVAKVKLADIVPYEGAPGGVYSKAVEELSGSLMRHNAVVIELGSEEAVVVKCALESARMC  140

Query  610  FKTRVVAHGVAAGNSPW-KGTRGVYTYRAGRPWE  708
            FK R   +G  +G S W K  RGVYTYRAGR  E
Sbjct  141  FKARAQCNGAGSGVSGWGKLGRGVYTYRAGRALE  174



>gb|KEH30552.1| RING/U-box protein [Medicago truncatula]
Length=511

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 83/120 (69%), Gaps = 11/120 (9%)
 Frame = +1

Query  358  RDNVIALPMAQAHPPGE-FGAIPLQ-PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMR  531
            R  ++  P+A   P GE     P+   LARV+LSDI PYDGAPAG Y RAV+ L SSL++
Sbjct  67   RQPLLPAPVAAVLPSGEPVSTAPVNFQLARVRLSDIAPYDGAPAGPYARAVEMLCSSLLK  126

Query  532  HNAAVIELGAEDAALLRCGLESARFYFKTRVVAH-GVAAGNSPWKGTRGVYTYRAGRPWE  708
            +NAAVIELG+ED AL+RCGLE AR +F++R  AH GV       KG+RGVY YRAGR  E
Sbjct  127  YNAAVIELGSEDTALMRCGLEGARLFFRSR--AHLGVG------KGSRGVYMYRAGRALE  178



>ref|XP_010466153.1| PREDICTED: uncharacterized protein LOC104746391 [Camelina sativa]
Length=558

 Score =   115 bits (289),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 87/137 (64%), Gaps = 11/137 (8%)
 Frame = +1

Query  310  VPIAAQFPSTFPLSLGRDNVIALPMAQAHPPGE----FGAIPLQPLARVKLSDILPYDGA  477
            V IA+  P+    S     +   P++ A+P G+      +     LARV+LSDILPY+GA
Sbjct  19   VSIASDVPTGLTKSPLSHAIPVSPISAAYPSGDPMLMSSSSSRTALARVRLSDILPYEGA  78

Query  478  PAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSP  657
            P+  Y +AV+ALS SLMR+NA+VIELG+ED AL+RCGLE+AR YF+TR +       N  
Sbjct  79   PSPAYAKAVEALSVSLMRYNASVIELGSEDTALMRCGLEAARLYFRTRSL-------NVS  131

Query  658  WKGTRGVYTYRAGRPWE  708
             KG RG+  YRAGR  E
Sbjct  132  GKGNRGLSMYRAGRSVE  148



>ref|XP_010487943.1| PREDICTED: uncharacterized protein LOC104765863 [Camelina sativa]
Length=558

 Score =   115 bits (288),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 87/137 (64%), Gaps = 11/137 (8%)
 Frame = +1

Query  310  VPIAAQFPSTFPLSLGRDNVIALPMAQAHPPGE----FGAIPLQPLARVKLSDILPYDGA  477
            V IA+  P+    S     +   P++ A+P G+      +     LARV+LSDILPY+GA
Sbjct  19   VSIASDVPTGLTKSPLSHAIPVSPISAAYPSGDPMLMSSSSSGSALARVRLSDILPYEGA  78

Query  478  PAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSP  657
            P+  Y +AV+ALS SLMR+NA+VIELG+ED AL+RCGLE+AR YF+TR +       N  
Sbjct  79   PSPAYAKAVEALSVSLMRYNASVIELGSEDTALMRCGLEAARLYFRTRSL-------NVS  131

Query  658  WKGTRGVYTYRAGRPWE  708
             KG RG+  YRAGR  E
Sbjct  132  GKGNRGLSMYRAGRSVE  148



>gb|KEH30553.1| RING/U-box protein [Medicago truncatula]
Length=594

 Score =   115 bits (288),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 83/120 (69%), Gaps = 11/120 (9%)
 Frame = +1

Query  358  RDNVIALPMAQAHPPGE-FGAIPLQ-PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMR  531
            R  ++  P+A   P GE     P+   LARV+LSDI PYDGAPAG Y RAV+ L SSL++
Sbjct  67   RQPLLPAPVAAVLPSGEPVSTAPVNFQLARVRLSDIAPYDGAPAGPYARAVEMLCSSLLK  126

Query  532  HNAAVIELGAEDAALLRCGLESARFYFKTRVVAH-GVAAGNSPWKGTRGVYTYRAGRPWE  708
            +NAAVIELG+ED AL+RCGLE AR +F++R  AH GV       KG+RGVY YRAGR  E
Sbjct  127  YNAAVIELGSEDTALMRCGLEGARLFFRSR--AHLGVG------KGSRGVYMYRAGRALE  178



>ref|XP_004505748.1| PREDICTED: uncharacterized protein LOC101510730 isoform X1 [Cicer 
arietinum]
Length=593

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 11/113 (10%)
 Frame = +1

Query  379  PMAQAHPPGE--FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIE  552
            P+A   P GE    A P   LARV+LSDI PYDGAPA  Y+RA++ L SSL++HNAA+IE
Sbjct  73   PVAAGLPSGEPVSTAPPTFQLARVRLSDIAPYDGAPAVSYVRAMETLCSSLLKHNAALIE  132

Query  553  LGAEDAALLRCGLESARFYFKTRVVAH-GVAAGNSPWKGTRGVYTYRAGRPWE  708
            LG+ED +L+RCGLE AR +F++R  AH GV       KG+RGVY YRAGR  E
Sbjct  133  LGSEDTSLMRCGLEGARLFFRSR--AHLGVG------KGSRGVYMYRAGRALE  177



>ref|XP_004505749.1| PREDICTED: uncharacterized protein LOC101510730 isoform X2 [Cicer 
arietinum]
Length=590

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 80/113 (71%), Gaps = 11/113 (10%)
 Frame = +1

Query  379  PMAQAHPPGE--FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIE  552
            P+A   P GE    A P   LARV+LSDI PYDGAPA  Y+RA++ L SSL++HNAA+IE
Sbjct  73   PVAAGLPSGEPVSTAPPTFQLARVRLSDIAPYDGAPAVSYVRAMETLCSSLLKHNAALIE  132

Query  553  LGAEDAALLRCGLESARFYFKTRVVAH-GVAAGNSPWKGTRGVYTYRAGRPWE  708
            LG+ED +L+RCGLE AR +F++R  AH GV       KG+RGVY YRAGR  E
Sbjct  133  LGSEDTSLMRCGLEGARLFFRSR--AHLGVG------KGSRGVYMYRAGRALE  177



>gb|AAM19828.1| At3g19895 [Arabidopsis thaliana]
 gb|AAN64515.1| At3g19895/At3g19895 [Arabidopsis thaliana]
Length=463

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 87/134 (65%), Gaps = 8/134 (6%)
 Frame = +1

Query  310  VPIAAQFPSTFPLSLGRDNVIALPMAQAHPPGE-FGAIPLQPLARVKLSDILPYDGAPAG  486
            V IA+  P+    S     +   P++ A+P G+    +   PLARV+LS+ILPY+GAP+ 
Sbjct  18   VSIASDVPTGLTKSPLSHAIPVSPISAAYPSGDPILMMSGTPLARVRLSEILPYEGAPSP  77

Query  487  GYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKG  666
             Y +AV+ALS SLMR+NA+VIE+G+ED AL+RCGLE+AR YF+TR +           KG
Sbjct  78   VYAKAVEALSVSLMRYNASVIEIGSEDTALMRCGLEAARLYFRTRSL-------TVSGKG  130

Query  667  TRGVYTYRAGRPWE  708
             RG+  YRAGR  E
Sbjct  131  NRGLSMYRAGRSVE  144



>dbj|BAB01304.1| unnamed protein product [Arabidopsis thaliana]
Length=565

 Score =   114 bits (284),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 87/134 (65%), Gaps = 8/134 (6%)
 Frame = +1

Query  310  VPIAAQFPSTFPLSLGRDNVIALPMAQAHPPGE-FGAIPLQPLARVKLSDILPYDGAPAG  486
            V IA+  P+    S     +   P++ A+P G+    +   PLARV+LS+ILPY+GAP+ 
Sbjct  18   VSIASDVPTGLTKSPLSHAIPVSPISAAYPSGDPILMMSGTPLARVRLSEILPYEGAPSP  77

Query  487  GYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKG  666
             Y +AV+ALS SLMR+NA+VIE+G+ED AL+RCGLE+AR YF+TR +           KG
Sbjct  78   VYAKAVEALSVSLMRYNASVIEIGSEDTALMRCGLEAARLYFRTRSLT-------VSGKG  130

Query  667  TRGVYTYRAGRPWE  708
             RG+  YRAGR  E
Sbjct  131  NRGLSMYRAGRSVE  144



>ref|NP_683575.2| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC43540.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76305.1| uncharacterized protein AT3G19895 [Arabidopsis thaliana]
Length=554

 Score =   113 bits (283),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/134 (48%), Positives = 87/134 (65%), Gaps = 8/134 (6%)
 Frame = +1

Query  310  VPIAAQFPSTFPLSLGRDNVIALPMAQAHPPGE-FGAIPLQPLARVKLSDILPYDGAPAG  486
            V IA+  P+    S     +   P++ A+P G+    +   PLARV+LS+ILPY+GAP+ 
Sbjct  18   VSIASDVPTGLTKSPLSHAIPVSPISAAYPSGDPILMMSGTPLARVRLSEILPYEGAPSP  77

Query  487  GYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKG  666
             Y +AV+ALS SLMR+NA+VIE+G+ED AL+RCGLE+AR YF+TR +           KG
Sbjct  78   VYAKAVEALSVSLMRYNASVIEIGSEDTALMRCGLEAARLYFRTRSLT-------VSGKG  130

Query  667  TRGVYTYRAGRPWE  708
             RG+  YRAGR  E
Sbjct  131  NRGLSMYRAGRSVE  144



>emb|CDY42216.1| BnaA01g25790D [Brassica napus]
Length=500

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 70/93 (75%), Gaps = 8/93 (9%)
 Frame = +1

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            PLARV+LSDILPY+GAP+  Y +AV+ALS+SLMR+NA+VIELG+ED AL+RCGLE+AR Y
Sbjct  8    PLARVRLSDILPYEGAPSPSYAKAVEALSASLMRYNASVIELGSEDTALMRCGLEAARLY  67

Query  610  FKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            F+TR    G        K  RG+  YRAGR  E
Sbjct  68   FRTRSSVSG--------KPNRGLSMYRAGRSVE  92



>ref|XP_010508172.1| PREDICTED: uncharacterized protein LOC104784790 [Camelina sativa]
Length=557

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/137 (47%), Positives = 86/137 (63%), Gaps = 11/137 (8%)
 Frame = +1

Query  310  VPIAAQFPSTFPLSLGRDNVIALPMAQAHPPGE----FGAIPLQPLARVKLSDILPYDGA  477
            V IA+  P+    S     +   P++ A+P G+      +     LARV+LSDIL Y+GA
Sbjct  18   VSIASDVPTGLTKSPLSHAIPVSPISAAYPSGDPMLMSSSSSGSALARVRLSDILAYEGA  77

Query  478  PAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSP  657
            P+  Y +AV+ALS SLMR+NA+VIELG+ED AL+RCGLE+AR YF+TR +       N  
Sbjct  78   PSPAYAKAVEALSVSLMRYNASVIELGSEDTALMRCGLEAARLYFRTRSL-------NVS  130

Query  658  WKGTRGVYTYRAGRPWE  708
             KG RG+  YRAGR  E
Sbjct  131  GKGNRGLSMYRAGRSVE  147



>ref|XP_010557562.1| PREDICTED: uncharacterized protein LOC104826520 [Tarenaya hassleriana]
Length=540

 Score =   111 bits (278),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 77/108 (71%), Gaps = 8/108 (7%)
 Frame = +1

Query  379  PMAQAHPPGE-FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIEL  555
            P++ A+P GE    +   PLARV+L DI+PYDGAP+  Y+RAV+ALS SLMR+NA+VIEL
Sbjct  27   PISTANPSGEALLGMAGGPLARVRLCDIIPYDGAPSPAYVRAVEALSGSLMRYNASVIEL  86

Query  556  GAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGR  699
            G EDAAL+RCGLE+A  +F+TR             KG+RG+  YRAGR
Sbjct  87   GHEDAALMRCGLEAAGLFFRTRRQTF-------LGKGSRGLCMYRAGR  127



>ref|XP_010112276.1| hypothetical protein L484_014958 [Morus notabilis]
 gb|EXC33079.1| hypothetical protein L484_014958 [Morus notabilis]
Length=588

 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 81/110 (74%), Gaps = 7/110 (6%)
 Frame = +1

Query  379  PMAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELG  558
            P+A AHP GE   +P  PL RV+LSDI P+ GAP+G YLRAVDALS SLMRHNAAVIELG
Sbjct  71   PIAVAHPNGE--PVP-SPLPRVRLSDISPFYGAPSGPYLRAVDALSGSLMRHNAAVIELG  127

Query  559  AEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            ++ AA++RCGLE+ARFYF++     G A      KG RGVY YRAGR  E
Sbjct  128  SDAAAVMRCGLEAARFYFRSGAAQQGGAG----GKGGRGVYMYRAGRALE  173



>ref|XP_010935485.1| PREDICTED: uncharacterized protein LOC105055393 isoform X1 [Elaeis 
guineensis]
Length=587

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 68/105 (65%), Gaps = 1/105 (1%)
 Frame = +1

Query  397  PPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAAL  576
            PP         P+ARV+L+DI PY+GAP   Y RAV+ALS SLMRHNA+VIELG E+A +
Sbjct  63   PPSGLDPAESTPVARVRLADIAPYEGAPGAAYARAVEALSGSLMRHNASVIELGREEAVV  122

Query  577  LRCGLESARFYFKTRV-VAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            +RC LES R YFK R   + G        K +RGVY YRAGR  E
Sbjct  123  VRCALESVRMYFKARAQCSSGGGGLVGWGKSSRGVYIYRAGRALE  167



>emb|CDP09131.1| unnamed protein product [Coffea canephora]
Length=580

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 69/97 (71%), Gaps = 6/97 (6%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RV+LSDILPYDG P   Y RAV+ALS SLMRHNAAVIE+G +DAALLRCGLE+AR +F
Sbjct  76   LTRVRLSDILPYDGPPVAPYFRAVEALSGSLMRHNAAVIEVGCDDAALLRCGLEAARLFF  135

Query  613  KTRVVAH-----GVAAGNSPWKGTRGVYTYRAGRPWE  708
            +TR  AH     G     S  KG RGVY YR GR  E
Sbjct  136  RTR-TAHVPGGGGGGGAGSWGKGGRGVYMYRPGRSLE  171



>ref|XP_004140426.1| PREDICTED: uncharacterized protein LOC101206682 [Cucumis sativus]
Length=580

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 68/93 (73%), Gaps = 9/93 (10%)
 Frame = +1

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            PLARV+LSDI PYDGAPAG Y+RAV+ALS SL R+NAAVIEL  E AAL RCGLE+AR +
Sbjct  76   PLARVRLSDIAPYDGAPAGSYVRAVEALSGSLTRYNAAVIELENEAAALTRCGLEAARLF  135

Query  610  FKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            FK+R  + G        KG R VY YRAGR  E
Sbjct  136  FKSRAQSGG--------KG-RSVYMYRAGRAVE  159



>ref|XP_008456842.1| PREDICTED: uncharacterized protein LOC103496673 isoform X1 [Cucumis 
melo]
Length=580

 Score =   108 bits (270),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 68/93 (73%), Gaps = 9/93 (10%)
 Frame = +1

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            PLARV+LSDI PYDGAPAG Y+RAV+ALS SL R+NAAVIEL  E AAL RCGLE+AR +
Sbjct  76   PLARVRLSDIAPYDGAPAGSYVRAVEALSGSLTRYNAAVIELENEAAALTRCGLEAARLF  135

Query  610  FKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            FK+R  + G        KG R VY YRAGR  E
Sbjct  136  FKSRAQSGG--------KG-RSVYMYRAGRAVE  159



>ref|XP_010940316.1| PREDICTED: uncharacterized protein LOC105058929 [Elaeis guineensis]
Length=580

 Score =   107 bits (268),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 64/93 (69%), Gaps = 4/93 (4%)
 Frame = +1

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            P+ARV+L+DI PY+GAP   Y RAV+ LS SLMRHNA VIELG+E+A ++RC LES R Y
Sbjct  73   PVARVRLADIAPYEGAPGAAYARAVELLSGSLMRHNAVVIELGSEEAVVVRCALESVRMY  132

Query  610  FKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            FK R        G    K +RGVY YRAGR  E
Sbjct  133  FKARARCSSGGGG----KASRGVYIYRAGRALE  161



>gb|EPS59106.1| hypothetical protein M569_15703, partial [Genlisea aurea]
Length=446

 Score =   105 bits (263),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 63/90 (70%), Gaps = 13/90 (14%)
 Frame = +1

Query  439  RVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKT  618
            +V++SDILPYDGAP   YLRAVDALS+SL RHNAAVIELG+++AAL RC LESAR +F +
Sbjct  25   KVRISDILPYDGAPLSRYLRAVDALSASLTRHNAAVIELGSDEAALFRCALESARLFFLS  84

Query  619  RVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
                          K  RG YTYRAGR  E
Sbjct  85   -------------GKCDRGFYTYRAGRQQE  101



>ref|XP_010533346.1| PREDICTED: uncharacterized protein LOC104809148 [Tarenaya hassleriana]
Length=543

 Score =   105 bits (261),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 8/111 (7%)
 Frame = +1

Query  379  PMAQAHPPGE-FGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIEL  555
            P++ A+P  E    +   PLARV+L DI+ YDGA +  Y+RAV+ALS SLMR+NA+VIEL
Sbjct  29   PISAANPSSEAMLVMSGSPLARVRLCDIMLYDGASSLAYIRAVEALSGSLMRYNASVIEL  88

Query  556  GAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            G+EDAAL+RCGLE+A  +F+TR             KG+  +  YRAGR  E
Sbjct  89   GSEDAALMRCGLEAASLFFRTR-------GQTLVGKGSHNLCMYRAGRSLE  132



>gb|KFK39311.1| hypothetical protein AALP_AA3G228400 [Arabis alpina]
Length=505

 Score =   103 bits (256),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 64/93 (69%), Gaps = 13/93 (14%)
 Frame = +1

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            PL+RV+L DILPY+GAP   Y +AV+ALS SLMR NA+VIELG+ED AL+RCGLE+AR Y
Sbjct  17   PLSRVRLCDILPYEGAPCPSYTKAVEALSLSLMRFNASVIELGSEDVALMRCGLEAARLY  76

Query  610  FKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            F+T              K  RG+  YRAGR  E
Sbjct  77   FRT-------------AKPNRGLSMYRAGRSLE  96



>ref|XP_008813816.1| PREDICTED: uncharacterized protein LOC103724361, partial [Phoenix 
dactylifera]
Length=515

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 1/94 (1%)
 Frame = +1

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            P+ARV+L+D+ PY+GAP   Y RAV++LS SLMRHNA VIELG+E+A ++RC LES R Y
Sbjct  3    PVARVRLADVAPYEGAPGAAYARAVESLSGSLMRHNAVVIELGSEEAVVVRCALESVRMY  62

Query  610  FK-TRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            FK     + G        K +RGVY YRAGR  E
Sbjct  63   FKARARSSSGGGGVAGWGKASRGVYIYRAGRALE  96



>ref|XP_008803754.1| PREDICTED: uncharacterized protein LOC103717222 [Phoenix dactylifera]
Length=591

 Score =   101 bits (252),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 66/105 (63%), Gaps = 1/105 (1%)
 Frame = +1

Query  397  PPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAAL  576
            PP         P+ARV+L+DI PY+GAP   Y+RAV+ALS SLMRHNA VIELG E+A +
Sbjct  67   PPSGLDPDESAPIARVRLADIAPYEGAPGAAYVRAVEALSGSLMRHNAVVIELGREEAVV  126

Query  577  LRCGLESARFYFKTRV-VAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            +RC LES R +FK R   + G        K  R VY YRAGR  E
Sbjct  127  VRCALESVRMFFKARAQCSSGGGGLVGWGKVGREVYIYRAGRALE  171



>ref|XP_001784494.1| predicted protein [Physcomitrella patens]
 gb|EDQ50707.1| predicted protein [Physcomitrella patens]
Length=304

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 63/98 (64%), Gaps = 9/98 (9%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            + R+KL DILP DGA +  Y RAV+ LS SL R+NAA+I+L +EDAAL+RCGLESA+ YF
Sbjct  168  IVRIKLQDILPEDGAASAAYTRAVEKLSLSLARNNAAIIQLSSEDAALVRCGLESAKLYF  227

Query  613  KTRVVAHGVAAGNSPWKG--------TRGVYTYRAGRP  702
            ++R   +     +S W           R +Y YRAGR 
Sbjct  228  RSR-CRNASLWNSSVWLKLSGYLAAPARDMYFYRAGRT  264



>gb|EYU26218.1| hypothetical protein MIMGU_mgv1a005773mg [Erythranthe guttata]
Length=471

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 53/73 (73%), Gaps = 13/73 (18%)
 Frame = +1

Query  490  YLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGT  669
            YLRA+DALS+SL RHNAA+IEL  ED+ALLRC ++S+R YF+TR             KG 
Sbjct  4    YLRALDALSTSLDRHNAAIIELSPEDSALLRCAIDSSRLYFRTR-------------KGG  50

Query  670  RGVYTYRAGRPWE  708
            RGVYTYRAGRP E
Sbjct  51   RGVYTYRAGRPLE  63



>ref|XP_002983658.1| hypothetical protein SELMODRAFT_271651 [Selaginella moellendorffii]
 gb|EFJ15154.1| hypothetical protein SELMODRAFT_271651 [Selaginella moellendorffii]
Length=597

 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 74/125 (59%), Gaps = 13/125 (10%)
 Frame = +1

Query  367  VIALPMAQAHPPGEFGA----IPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRH  534
             + LP +   P G FGA    +    L RVKL+D+LP +G P+  YL+AVDA+S+SL R 
Sbjct  56   TLGLPPSSTLPGGGFGAPANGLGETGLMRVKLADMLPEEGEPSPVYLKAVDAVSTSLARA  115

Query  535  NAAVIELGAEDAALLRCGLESARFYFK----TRVVAHGVAAGNSPWKGT---RGVYTYRA  693
            NA +IEL +EDA L+RC L+SA+ Y +    T    H  A G+S W  T   R  + Y+A
Sbjct  116  NAVIIELSSEDAKLVRCALQSAKLYLRNCVHTTTTTH--AWGSSDWNKTTACRDSFVYKA  173

Query  694  GRPWE  708
            GR  E
Sbjct  174  GRSEE  178



>ref|XP_002990554.1| hypothetical protein SELMODRAFT_272139 [Selaginella moellendorffii]
 gb|EFJ08431.1| hypothetical protein SELMODRAFT_272139 [Selaginella moellendorffii]
Length=596

 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 74/125 (59%), Gaps = 13/125 (10%)
 Frame = +1

Query  367  VIALPMAQAHPPGEFGA----IPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRH  534
             + LP +   P G FGA    +    L RVKL+D+LP +G P+  YL+AVDA+S+SL R 
Sbjct  56   TLGLPPSSTLPGGGFGAPANGLGETGLMRVKLADMLPEEGEPSPVYLKAVDAVSTSLARA  115

Query  535  NAAVIELGAEDAALLRCGLESARFYFK----TRVVAHGVAAGNSPWKGT---RGVYTYRA  693
            NA +IEL +EDA L+RC L+SA+ Y +    T    H  A G+S W  +   R  + Y+A
Sbjct  116  NAVIIELSSEDAKLVRCALQSAKLYLRNCVHTTTTTH--AWGSSDWNKSTACRDSFVYKA  173

Query  694  GRPWE  708
            GR  E
Sbjct  174  GRSEE  178



>ref|XP_004954502.1| PREDICTED: uncharacterized protein LOC101786766 isoform X3 [Setaria 
italica]
Length=515

 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 60/109 (55%), Gaps = 16/109 (15%)
 Frame = +1

Query  382  MAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGA  561
            M+   PP    A    PLARV+L D+ P+DGA    Y  AVDA++ S  RH AA +EL A
Sbjct  1    MSTFSPPSPAPARNRIPLARVRLDDLAPFDGASTRAYATAVDAIAESFTRHGAAALELPA  60

Query  562  EDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
             DAA++RCGLESAR +F  R                 G+Y YRAGR  +
Sbjct  61   PDAAIVRCGLESARAFFHARP----------------GLYVYRAGRALD  93



>ref|XP_004954500.1| PREDICTED: uncharacterized protein LOC101786766 isoform X1 [Setaria 
italica]
Length=545

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 60/109 (55%), Gaps = 16/109 (15%)
 Frame = +1

Query  382  MAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGA  561
            M+   PP    A    PLARV+L D+ P+DGA    Y  AVDA++ S  RH AA +EL A
Sbjct  1    MSTFSPPSPAPARNRIPLARVRLDDLAPFDGASTRAYATAVDAIAESFTRHGAAALELPA  60

Query  562  EDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
             DAA++RCGLESAR +F  R                 G+Y YRAGR  +
Sbjct  61   PDAAIVRCGLESARAFFHARP----------------GLYVYRAGRALD  93



>ref|XP_002454837.1| hypothetical protein SORBIDRAFT_04g038270 [Sorghum bicolor]
 gb|EES07813.1| hypothetical protein SORBIDRAFT_04g038270 [Sorghum bicolor]
Length=496

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 58/93 (62%), Gaps = 16/93 (17%)
 Frame = +1

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            PLARV+L D+ P+DGA    Y RAV+A+++SL RH AA ++L A DAA++RC LESAR +
Sbjct  14   PLARVRLDDLAPFDGASTPAYARAVEAIAASLTRHGAAAVDLPAADAAVVRCALESARAF  73

Query  610  FKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            F+ R                 G+Y YRAGR  +
Sbjct  74   FRARP----------------GLYVYRAGRALD  90



>ref|XP_004954501.1| PREDICTED: uncharacterized protein LOC101786766 isoform X2 [Setaria 
italica]
Length=544

 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 60/109 (55%), Gaps = 16/109 (15%)
 Frame = +1

Query  382  MAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGA  561
            M+   PP    A    PLARV+L D+ P+DGA    Y  AVDA++ S  RH AA +EL A
Sbjct  1    MSTFSPPSPAPARNRIPLARVRLDDLAPFDGASTRAYATAVDAIAESFTRHGAAALELPA  60

Query  562  EDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
             DAA++RCGLESAR +F  R                 G+Y YRAGR  +
Sbjct  61   PDAAIVRCGLESARAFFHARP----------------GLYVYRAGRALD  93



>gb|KHN39906.1| U-box domain-containing protein 62 [Glycine soja]
Length=471

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 7/69 (10%)
 Frame = +1

Query  502  VDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVY  681
            ++AL  SL+RHNAA+IELG ED AL+RCGLE AR +F++R  AH + +G    KG+RGVY
Sbjct  1    MEALCGSLLRHNAALIELGNEDTALMRCGLEGARLFFRSR--AH-LGSG----KGSRGVY  53

Query  682  TYRAGRPWE  708
             YRAGR  E
Sbjct  54   MYRAGRALE  62



>gb|KHN05427.1| U-box domain-containing protein 62 [Glycine soja]
Length=477

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 52/69 (75%), Gaps = 7/69 (10%)
 Frame = +1

Query  502  VDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVY  681
            ++AL  SL+RHNAA+IELG ED AL+RCGLE AR +F++R  AH + +G    KG+RGVY
Sbjct  1    MEALCGSLLRHNAALIELGNEDTALMRCGLEGARLFFRSR--AH-LGSG----KGSRGVY  53

Query  682  TYRAGRPWE  708
             YRAGR  E
Sbjct  54   MYRAGRALE  62



>gb|ACN36386.1| unknown [Zea mays]
 gb|AFW74139.1| hypothetical protein ZEAMMB73_517022 [Zea mays]
Length=191

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (61%), Gaps = 16/92 (17%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            +ARV+L  ++P+DGA    Y RAV+A+++SL RH AA ++L A DAA++RC LESAR +F
Sbjct  16   VARVRLDHLVPFDGAFTPAYARAVEAVAASLTRHGAAAVDLPAADAAVVRCALESARAFF  75

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
              R                 G+Y YRAGR  +
Sbjct  76   CDR----------------SGLYVYRAGRALD  91



>ref|XP_003573154.1| PREDICTED: uncharacterized protein LOC100842356 [Brachypodium 
distachyon]
Length=492

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 54/91 (59%), Gaps = 16/91 (18%)
 Frame = +1

Query  436  ARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFK  615
            ARV+L D+  +DGA A  Y R+V AL+ SL R NAAV+EL A DAA++RC LESAR +F+
Sbjct  13   ARVRLDDVAVHDGAAAPAYARSVAALADSLARRNAAVLELPAHDAAVVRCALESARAFFR  72

Query  616  TRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
             R                  VY YRAGR  E
Sbjct  73   GRA----------------SVYVYRAGRTLE  87



>gb|AFW74140.1| hypothetical protein ZEAMMB73_517022 [Zea mays]
Length=345

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (61%), Gaps = 16/92 (17%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            +ARV+L  ++P+DGA    Y RAV+A+++SL RH AA ++L A DAA++RC LESAR +F
Sbjct  16   VARVRLDHLVPFDGAFTPAYARAVEAVAASLTRHGAAAVDLPAADAAVVRCALESARAFF  75

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
              R                 G+Y YRAGR  +
Sbjct  76   CDR----------------SGLYVYRAGRALD  91



>ref|XP_008643405.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=508

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (61%), Gaps = 16/92 (17%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            +ARV+L  ++P+DGA    Y RAV+A+++SL RH AA ++L A DAA++RC LESAR +F
Sbjct  16   VARVRLDHLVPFDGAFTPAYARAVEAVAASLTRHGAAAVDLPAADAAVVRCALESARAFF  75

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
              R                 G+Y YRAGR  +
Sbjct  76   CDR----------------SGLYVYRAGRALD  91



>ref|NP_001145141.1| hypothetical protein [Zea mays]
 gb|ACG45396.1| hypothetical protein [Zea mays]
 gb|ACN33431.1| unknown [Zea mays]
 gb|AFW74141.1| hypothetical protein ZEAMMB73_517022 [Zea mays]
Length=497

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (61%), Gaps = 16/92 (17%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            +ARV+L  ++P+DGA    Y RAV+A+++SL RH AA ++L A DAA++RC LESAR +F
Sbjct  16   VARVRLDHLVPFDGAFTPAYARAVEAVAASLTRHGAAAVDLPAADAAVVRCALESARAFF  75

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
              R                 G+Y YRAGR  +
Sbjct  76   CDR----------------SGLYVYRAGRALD  91



>ref|XP_008643407.1| PREDICTED: hypothetical protein isoform X3 [Zea mays]
 gb|AFW74142.1| hypothetical protein ZEAMMB73_517022 [Zea mays]
Length=489

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (61%), Gaps = 16/92 (17%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            +ARV+L  ++P+DGA    Y RAV+A+++SL RH AA ++L A DAA++RC LESAR +F
Sbjct  16   VARVRLDHLVPFDGAFTPAYARAVEAVAASLTRHGAAAVDLPAADAAVVRCALESARAFF  75

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
              R                 G+Y YRAGR  +
Sbjct  76   CDR----------------SGLYVYRAGRALD  91



>ref|XP_008643406.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=500

 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (61%), Gaps = 16/92 (17%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            +ARV+L  ++P+DGA    Y RAV+A+++SL RH AA ++L A DAA++RC LESAR +F
Sbjct  16   VARVRLDHLVPFDGAFTPAYARAVEAVAASLTRHGAAAVDLPAADAAVVRCALESARAFF  75

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
              R                 G+Y YRAGR  +
Sbjct  76   CDR----------------SGLYVYRAGRALD  91



>ref|XP_012087410.1| PREDICTED: uncharacterized protein LOC105646208 isoform X2 [Jatropha 
curcas]
Length=361

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKLSD++P +G P+  Y  +V  LS SL + +AA+I+  A D ALLR GL+SAR
Sbjct  6    LPSLGRVKLSDLIPSEGLPSDSYKLSVSTLSQSLAQFSAAIIQFSASDGALLRSGLDSAR  65

Query  604  FYFKTR---VVAHGVAAGNSPWKGTRGVY  681
             YF  R     A  +   +  W  T G Y
Sbjct  66   LYFHQRPSYPSADMIHTNDREWCKTSGYY  94



>ref|XP_002513412.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48815.1| conserved hypothetical protein [Ricinus communis]
Length=500

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 54/90 (60%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKLSD++P +G P+  Y  +V ALS SL +++A +I+  A D ALLR GL+SAR
Sbjct  6    LPSLGRVKLSDLIPSEGLPSDSYKLSVSALSQSLAQYSAVIIQFSASDGALLRSGLDSAR  65

Query  604  FYFKTRVVAH----GVAAGNSPWKGTRGVY  681
             YF  R  ++     + + +  W  T G Y
Sbjct  66   LYFHQRSSSYPSSADMISDSREWCKTSGYY  95



>ref|XP_009146568.1| PREDICTED: uncharacterized protein LOC103870208 isoform X2 [Brassica 
rapa]
Length=390

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL D+LP +G+P+  Y  AV  LS SL +++AA+I+  A DAALLR GL+SAR
Sbjct  6    LPTLGRVKLCDLLPTEGSPSDSYKLAVSTLSQSLAQYSAAIIQFPATDAALLRSGLDSAR  65

Query  604  FYFKTRV----VAHGVAAGNSPWKGTRGVYT  684
             YF  R       H     +  W  T G Y+
Sbjct  66   LYFHQRDSYPPTIH-TTNDSREWCKTSGYYS  95



>ref|XP_009146567.1| PREDICTED: uncharacterized protein LOC103870208 isoform X1 [Brassica 
rapa]
Length=464

 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL D+LP +G+P+  Y  AV  LS SL +++AA+I+  A DAALLR GL+SAR
Sbjct  6    LPTLGRVKLCDLLPTEGSPSDSYKLAVSTLSQSLAQYSAAIIQFPATDAALLRSGLDSAR  65

Query  604  FYFKTRV----VAHGVAAGNSPWKGTRGVYT  684
             YF  R       H     +  W  T G Y+
Sbjct  66   LYFHQRDSYPPTIH-TTNDSREWCKTSGYYS  95



>ref|XP_002317617.2| hypothetical protein POPTR_0011s14620g [Populus trichocarpa]
 gb|EEE98229.2| hypothetical protein POPTR_0011s14620g [Populus trichocarpa]
Length=482

 Score = 71.2 bits (173),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L PL RVKLSD++P +G P+  Y  +V  LS SL++++AA+I+  + D ALLR GL+SAR
Sbjct  6    LPPLGRVKLSDLVPSEGLPSESYKLSVTTLSQSLVQYSAAIIQFSSSDGALLRSGLDSAR  65

Query  604  FYFKTR  621
             YF  R
Sbjct  66   LYFHQR  71



>emb|CDY23555.1| BnaC05g40390D [Brassica napus]
Length=465

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 53/87 (61%), Gaps = 1/87 (1%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL D+LP +G P+  Y  AV  LS SL +++AA+I+  + DAALLR GL+SAR
Sbjct  6    LPTLGRVKLCDLLPTEGLPSDSYKLAVSTLSQSLAQYSAAIIQFPSADAALLRSGLDSAR  65

Query  604  FYFKTRVVAHGVAAGNSPWKGTRGVYT  684
             YF  R  ++     +  W  T G Y+
Sbjct  66   LYFHQR-DSYPSTNDSREWCKTSGYYS  91



>ref|XP_012087409.1| PREDICTED: uncharacterized protein LOC105646208 isoform X1 [Jatropha 
curcas]
Length=480

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKLSD++P +G P+  Y  +V  LS SL + +AA+I+  A D ALLR GL+SAR
Sbjct  6    LPSLGRVKLSDLIPSEGLPSDSYKLSVSTLSQSLAQFSAAIIQFSASDGALLRSGLDSAR  65

Query  604  FYFKTR---VVAHGVAAGNSPWKGTRGVY  681
             YF  R     A  +   +  W  T G Y
Sbjct  66   LYFHQRPSYPSADMIHTNDREWCKTSGYY  94



>ref|XP_011460851.1| PREDICTED: uncharacterized protein LOC101303785 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=369

 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 55/102 (54%), Gaps = 14/102 (14%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D++P +G P+  Y  +V  LS SL +++AA+I+    DAALLR GL+SAR YF
Sbjct  9    LGRVKLADLIPSEGLPSDSYKLSVSTLSQSLAQYSAAIIQFSVSDAALLRSGLDSARLYF  68

Query  613  KTRVV--AHGVAAGNSP--WKGTRG----------VYTYRAG  696
              R    A  +   N P  W  T G           Y YR G
Sbjct  69   HQRASYPAPDIVHTNDPRDWCKTSGYNADPQLWLETYDYRPG  110



>gb|KDP25116.1| hypothetical protein JCGZ_22651 [Jatropha curcas]
Length=524

 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 51/89 (57%), Gaps = 3/89 (3%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKLSD++P +G P+  Y  +V  LS SL + +AA+I+  A D ALLR GL+SAR
Sbjct  6    LPSLGRVKLSDLIPSEGLPSDSYKLSVSTLSQSLAQFSAAIIQFSASDGALLRSGLDSAR  65

Query  604  FYFKTR---VVAHGVAAGNSPWKGTRGVY  681
             YF  R     A  +   +  W  T G Y
Sbjct  66   LYFHQRPSYPSADMIHTNDREWCKTSGYY  94



>ref|XP_007149280.1| hypothetical protein PHAVU_005G057000g [Phaseolus vulgaris]
 gb|ESW21274.1| hypothetical protein PHAVU_005G057000g [Phaseolus vulgaris]
Length=464

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 52/92 (57%), Gaps = 8/92 (9%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            LQ L RVKLSD++P DG P+  Y  +V  LS SL + +A +I+  A D ALLR GLESAR
Sbjct  6    LQSLGRVKLSDLVPSDGLPSDSYKISVSILSQSLAQFSAVIIQFPASDGALLRSGLESAR  65

Query  604  FYFKTRV------VAHGVAAGNSPWKGTRGVY  681
             YF  R       + H   + +  W  T G Y
Sbjct  66   LYFHQRETYPPEDIIHN--SESREWCKTSGYY  95



>ref|XP_004294206.1| PREDICTED: uncharacterized protein LOC101303785 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=474

 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 42/102 (41%), Positives = 55/102 (54%), Gaps = 14/102 (14%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D++P +G P+  Y  +V  LS SL +++AA+I+    DAALLR GL+SAR YF
Sbjct  9    LGRVKLADLIPSEGLPSDSYKLSVSTLSQSLAQYSAAIIQFSVSDAALLRSGLDSARLYF  68

Query  613  KTRVV--AHGVAAGNSP--WKGTRG----------VYTYRAG  696
              R    A  +   N P  W  T G           Y YR G
Sbjct  69   HQRASYPAPDIVHTNDPRDWCKTSGYNADPQLWLETYDYRPG  110



>ref|XP_011030743.1| PREDICTED: uncharacterized protein LOC105130094 isoform X2 [Populus 
euphratica]
Length=527

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L PL RVKLSD++P +G P+  Y  +V  LS SL++++AA+I+  + D ALLR GL+SAR
Sbjct  59   LPPLGRVKLSDLVPSEGLPSESYKLSVMTLSQSLVQYSAAIIQFSSSDGALLRSGLDSAR  118

Query  604  FYFKTR  621
             YF  R
Sbjct  119  LYFHQR  124



>ref|XP_011030742.1| PREDICTED: uncharacterized protein LOC105130094 isoform X1 [Populus 
euphratica]
Length=535

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L PL RVKLSD++P +G P+  Y  +V  LS SL++++AA+I+  + D ALLR GL+SAR
Sbjct  59   LPPLGRVKLSDLVPSEGLPSESYKLSVMTLSQSLVQYSAAIIQFSSSDGALLRSGLDSAR  118

Query  604  FYFKTR  621
             YF  R
Sbjct  119  LYFHQR  124



>ref|XP_011030744.1| PREDICTED: uncharacterized protein LOC105130094 isoform X3 [Populus 
euphratica]
Length=482

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L PL RVKLSD++P +G P+  Y  +V  LS SL++++AA+I+  + D ALLR GL+SAR
Sbjct  6    LPPLGRVKLSDLVPSEGLPSESYKLSVMTLSQSLVQYSAAIIQFSSSDGALLRSGLDSAR  65

Query  604  FYFKTR  621
             YF  R
Sbjct  66   LYFHQR  71



>emb|CDY60118.1| BnaA05g26260D [Brassica napus]
Length=464

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 5/91 (5%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL D+LP +G+P+  Y  AV  LS SL +++AA+I+  A DAALLR GL+SA+
Sbjct  6    LPTLGRVKLCDLLPTEGSPSDSYKLAVSTLSQSLAQYSAAIIQFPATDAALLRSGLDSAK  65

Query  604  FYFKTRV----VAHGVAAGNSPWKGTRGVYT  684
             YF  R       H     +  W  T G Y+
Sbjct  66   LYFHQRDSYPPTIH-TTNDSREWCKTSGYYS  95



>ref|XP_009792142.1| PREDICTED: uncharacterized protein LOC104239256 isoform X2 [Nicotiana 
sylvestris]
Length=358

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL D++P +G P+  Y  +V  LS SL +++AA+I+L   D ALLRC LESAR
Sbjct  6    LPTLGRVKLIDLIPLEGLPSDSYKLSVSTLSQSLAQYSAAIIQLSTSDGALLRCSLESAR  65

Query  604  FYFKTR  621
             YF+ +
Sbjct  66   LYFQHK  71



>gb|KEH38342.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Medicago truncatula]
Length=361

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 51/87 (59%), Gaps = 4/87 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKLSD++P DG P+  Y  +V  LS SL + +A +++  A DAALLR GLESAR YF
Sbjct  9    LGRVKLSDLVPSDGLPSDSYKISVSILSQSLAQFSAVIVQFPATDAALLRSGLESARLYF  68

Query  613  KTRVV---AHGVAAGNS-PWKGTRGVY  681
              R     A  +   +S  W  T G Y
Sbjct  69   NQRETYPPADMIHNSDSLDWCKTSGYY  95



>ref|XP_009792141.1| PREDICTED: uncharacterized protein LOC104239256 isoform X1 [Nicotiana 
sylvestris]
Length=472

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL D++P +G P+  Y  +V  LS SL +++AA+I+L   D ALLRC LESAR YF
Sbjct  9    LGRVKLIDLIPLEGLPSDSYKLSVSTLSQSLAQYSAAIIQLSTSDGALLRCSLESARLYF  68

Query  613  KTR  621
            + +
Sbjct  69   QHK  71



>ref|XP_003596201.1| hypothetical protein MTR_2g069480 [Medicago truncatula]
 gb|AES66452.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Medicago truncatula]
Length=466

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 51/87 (59%), Gaps = 4/87 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKLSD++P DG P+  Y  +V  LS SL + +A +++  A DAALLR GLESAR YF
Sbjct  9    LGRVKLSDLVPSDGLPSDSYKISVSILSQSLAQFSAVIVQFPATDAALLRSGLESARLYF  68

Query  613  KTRVV---AHGVAAGNS-PWKGTRGVY  681
              R     A  +   +S  W  T G Y
Sbjct  69   NQRETYPPADMIHNSDSLDWCKTSGYY  95



>dbj|BAD22941.1| unknown protein [Oryza sativa Japonica Group]
Length=522

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 53/88 (60%), Gaps = 14/88 (16%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            LARV+L D+ PYDGA    Y RAV ALS+SL RH AA+++L    AA+LRC L+SAR +F
Sbjct  19   LARVRLHDLAPYDGAATPAYGRAVHALSASLTRHGAALLDLPDAHAAILRCALQSARAFF  78

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAG  696
            +         A + P       Y YRAG
Sbjct  79   R---------ANDQP-----AFYLYRAG  92



>gb|EAZ25181.1| hypothetical protein OsJ_08982 [Oryza sativa Japonica Group]
Length=551

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 53/88 (60%), Gaps = 14/88 (16%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            LARV+L D+ PYDGA    Y RAV ALS+SL RH AA+++L    AA+LRC L+SAR +F
Sbjct  17   LARVRLHDLAPYDGAATPAYGRAVHALSASLTRHGAALLDLPDAHAAILRCALQSARAFF  76

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAG  696
            +         A + P       Y YRAG
Sbjct  77   R---------ANDQP-----AFYLYRAG  90



>ref|XP_007022254.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY13779.1| 2-oxoglutarate and Fe(II)-dependent oxygenase superfamily protein 
isoform 2 [Theobroma cacao]
Length=519

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D++P +G P+  Y  +V  LS S  ++ AA+I+  A D ALLR GL+SAR
Sbjct  6    LPSLGRVKLTDLIPSEGLPSDSYKLSVSTLSQSFAQYCAAIIQFPASDGALLRSGLDSAR  65

Query  604  FYFKTRVV---AHGVAAGNS-PWKGTRGVY  681
             YF+ R     A  + A +S  W  T G Y
Sbjct  66   LYFQQRAAYPSADMIHANDSREWCKTSGYY  95



>ref|XP_007022253.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007022255.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007022256.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007022257.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 5, partial [Theobroma cacao]
 gb|EOY13778.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY13780.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY13781.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY13782.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein isoform 5, partial [Theobroma cacao]
Length=476

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D++P +G P+  Y  +V  LS S  ++ AA+I+  A D ALLR GL+SAR
Sbjct  6    LPSLGRVKLTDLIPSEGLPSDSYKLSVSTLSQSFAQYCAAIIQFPASDGALLRSGLDSAR  65

Query  604  FYFKTRVV---AHGVAAGNS-PWKGTRGVY  681
             YF+ R     A  + A +S  W  T G Y
Sbjct  66   LYFQQRAAYPSADMIHANDSREWCKTSGYY  95



>gb|KJB45897.1| hypothetical protein B456_007G335900 [Gossypium raimondii]
Length=174

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D++P +G P+  Y  +V  LS S  +++AA+I+  A D ALLR GL+SAR
Sbjct  6    LPSLGRVKLTDLVPSEGIPSDSYKLSVSTLSQSFAQYSAAIIQFPASDGALLRFGLDSAR  65

Query  604  FYFKTRVV---AHGVAAGNS-PWKGTRGVY  681
             YF+ +        +   +S  W  T G Y
Sbjct  66   LYFQQKAAYPPEELIHTNDSREWCKTSGYY  95



>ref|XP_004243982.1| PREDICTED: uncharacterized protein LOC101257983 [Solanum lycopersicum]
Length=472

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKLSD++P +G P+  Y  +V  LS SL +++AA+I+L   D ALLR  LESAR YF
Sbjct  9    LGRVKLSDLVPLEGLPSDSYKLSVSTLSQSLAQYSAAIIQLSTSDGALLRSSLESARLYF  68

Query  613  KTR  621
            + +
Sbjct  69   QHK  71



>ref|XP_006346041.1| PREDICTED: uncharacterized protein LOC102581396 isoform X2 [Solanum 
tuberosum]
Length=472

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKLSD++P +G P+  Y  +V  LS SL +++AA+I+L   D ALLR  LESAR YF
Sbjct  9    LGRVKLSDLVPLEGLPSDSYKLSVSTLSQSLAQYSAAIIQLSTSDGALLRSSLESARLYF  68

Query  613  KTR  621
            + +
Sbjct  69   QHK  71



>ref|XP_006346040.1| PREDICTED: uncharacterized protein LOC102581396 isoform X1 [Solanum 
tuberosum]
Length=479

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKLSD++P +G P+  Y  +V  LS SL +++AA+I+L   D ALLR  LESAR YF
Sbjct  9    LGRVKLSDLVPLEGLPSDSYKLSVSTLSQSLAQYSAAIIQLSTSDGALLRSSLESARLYF  68

Query  613  KTR  621
            + +
Sbjct  69   QHK  71



>ref|XP_004488830.1| PREDICTED: uncharacterized protein LOC101499742 [Cicer arietinum]
Length=471

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 8/91 (9%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D++P +G P   Y  +V  LS SL + +A +I+  + DAALLR GLESAR YF
Sbjct  9    LGRVKLTDLVPSEGLPTDSYKISVSILSQSLAQFSAVIIQFPSTDAALLRSGLESARLYF  68

Query  613  KTRV------VAHGVAAGNS--PWKGTRGVY  681
              R       + H  ++ +    W  T G Y
Sbjct  69   HQRETYPPHDIIHNTSSNDDSHDWCKTSGYY  99



>gb|KHG14107.1| hypothetical protein F383_17856 [Gossypium arboreum]
Length=477

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D++P +G P+  Y  +V  LS S  +++AAVI+  A DAALLR  L+SAR
Sbjct  7    LPSLGRVKLTDLIPSEGLPSDSYKLSVSTLSQSFAQYSAAVIQFPAADAALLRSSLDSAR  66

Query  604  FYFKTRVV---AHGVAAGNS-PWKGTRGVY  681
             YF+ R     A  +   +S  W  T G Y
Sbjct  67   LYFQQREAYPSADMIHTNDSREWCKTSGYY  96



>emb|CDP13604.1| unnamed protein product [Coffea canephora]
Length=497

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +1

Query  439  RVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKT  618
            RVKLSD++P +G P+  Y  +V  LS SL +++AA+I+L A DAALLR  LESAR YF  
Sbjct  14   RVKLSDLVPSEGLPSDSYKLSVSTLSQSLAQYSAAIIQLPASDAALLRSCLESARLYFNQ  73

Query  619  R  621
            +
Sbjct  74   K  74



>dbj|BAJ87112.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 62/108 (57%), Gaps = 21/108 (19%)
 Frame = +1

Query  385  AQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAE  564
            A A PP      P  PLARV+L D+ P+DGA A GY RAV AL++SL R  AAV+EL A 
Sbjct  7    AMASPP-----CPPSPLARVRLDDVAPHDGAAAPGYARAVAALAASLARRGAAVLELPAA  61

Query  565  DAALLRCGLESARFYFKTRVVAHGVAAGNSPWKGTRGVYTYRAGRPWE  708
            DAA++RC LESAR +F                +G    Y YRAGR  E
Sbjct  62   DAAVVRCALESARAFF----------------RGRHAAYLYRAGRTLE  93



>ref|XP_010060838.1| PREDICTED: uncharacterized protein LOC104448669 [Eucalyptus grandis]
 gb|KCW67716.1| hypothetical protein EUGRSUZ_F01456 [Eucalyptus grandis]
Length=462

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D++P +G P   Y  +V  LS SL +++AAVI+    D ALLR GL+SAR YF
Sbjct  9    LGRVKLADLVPSEGLPTDSYKISVSTLSQSLAQYSAAVIQFSTSDGALLRSGLDSARLYF  68

Query  613  KTRVVAHGVAAGNS----PWKGTRGVY  681
              R    G    ++     W  T G Y
Sbjct  69   HQRASYPGSDMIHTNETREWCKTSGYY  95



>ref|NP_187900.2| uncharacterized protein [Arabidopsis thaliana]
 gb|ABO45693.1| At3g12940 [Arabidopsis thaliana]
 gb|AEE75264.1| uncharacterized protein AT3G12940 [Arabidopsis thaliana]
Length=474

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 5/88 (6%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVK+ D++P +G P+  Y  AV  LS SL +++AA+I+  A D ALLR GL+SAR YF
Sbjct  10   LGRVKVCDLVPSEGLPSDSYKLAVTTLSQSLAQYSAAIIQFPASDGALLRSGLDSARLYF  69

Query  613  KTR----VVAHGVAAGNS-PWKGTRGVY  681
              R       + +   +S  W  T G Y
Sbjct  70   HQRDSYPATNNMIHTNDSQEWCKTSGYY  97



>ref|XP_007214418.1| hypothetical protein PRUPE_ppa026038mg, partial [Prunus persica]
 gb|EMJ15617.1| hypothetical protein PRUPE_ppa026038mg, partial [Prunus persica]
Length=476

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D+ P +G P+  Y  +V  LS SL +++AA+I+    D ALLR GL+SAR YF
Sbjct  9    LGRVKLTDLAPAEGLPSDSYKLSVSTLSQSLAQYSAAIIQFPVSDGALLRSGLDSARLYF  68

Query  613  KTRVV--AHGVAAGNSP--WKGTRGVY  681
              +    A  +   N P  W  T G Y
Sbjct  69   HQKASYPAADMVNTNDPRDWCKTSGYY  95



>dbj|BAB02501.1| unnamed protein product [Arabidopsis thaliana]
Length=496

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 51/88 (58%), Gaps = 5/88 (6%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVK+ D++P +G P+  Y  AV  LS SL +++AA+I+  A D ALLR GL+SAR YF
Sbjct  10   LGRVKVCDLVPSEGLPSDSYKLAVTTLSQSLAQYSAAIIQFPASDGALLRSGLDSARLYF  69

Query  613  KTR----VVAHGVAAGNS-PWKGTRGVY  681
              R       + +   +S  W  T G Y
Sbjct  70   HQRDSYPATNNMIHTNDSQEWCKTSGYY  97



>gb|EEC69783.1| hypothetical protein OsI_00067 [Oryza sativa Indica Group]
Length=520

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 52/88 (59%), Gaps = 14/88 (16%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            LARV+L D+  YDGA    Y RAV ALS+SL RH AA+++L    AA+LRC L+SAR +F
Sbjct  17   LARVRLHDLARYDGAATPAYGRAVHALSASLTRHGAALLDLPDAHAAILRCALQSARAFF  76

Query  613  KTRVVAHGVAAGNSPWKGTRGVYTYRAG  696
            +         A + P       Y YRAG
Sbjct  77   R---------ANDQP-----AFYLYRAG  90



>gb|KJB45895.1| hypothetical protein B456_007G335700 [Gossypium raimondii]
Length=355

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D++P +G P+  Y  +V  LS S  +++AA+I+  A D ALLR GL+SAR
Sbjct  6    LPSLGRVKLTDLIPSEGIPSDSYKLSVSTLSQSFAQYSAAIIQFPASDGALLRSGLDSAR  65

Query  604  FYFKTR  621
             YF+ +
Sbjct  66   LYFQQK  71



>ref|XP_011626637.1| PREDICTED: uncharacterized protein LOC18443189 [Amborella trichopoda]
Length=458

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 52/90 (58%), Gaps = 3/90 (3%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L R++LSD++  DG P+  Y  +V  LS SL +++AA+I+L   + ALLR  LESAR
Sbjct  6    LPTLGRIRLSDLIASDGLPSDSYKISVSTLSQSLAQYSAAIIQLPPGEEALLRSALESAR  65

Query  604  FYFKTRV-VAHGVAAGNSP--WKGTRGVYT  684
             YF  R   +  +   N P  W  T G YT
Sbjct  66   LYFHQRTYTSPDIRRSNDPRGWCKTSGYYT  95



>gb|ERN14910.1| hypothetical protein AMTR_s00032p00180040 [Amborella trichopoda]
Length=465

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 52/90 (58%), Gaps = 3/90 (3%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L R++LSD++  DG P+  Y  +V  LS SL +++AA+I+L   + ALLR  LESAR
Sbjct  6    LPTLGRIRLSDLIASDGLPSDSYKISVSTLSQSLAQYSAAIIQLPPGEEALLRSALESAR  65

Query  604  FYFKTRV-VAHGVAAGNSP--WKGTRGVYT  684
             YF  R   +  +   N P  W  T G YT
Sbjct  66   LYFHQRTYTSPDIRRSNDPRGWCKTSGYYT  95



>ref|XP_010273603.1| PREDICTED: uncharacterized protein LOC104609083 isoform X2 [Nelumbo 
nucifera]
Length=466

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D++  +G P+  Y  +V  LS SL +++AA+I+L   D ALLR GL+SAR
Sbjct  9    LPSLGRVKLTDLIASEGLPSDSYKISVSTLSQSLAQYSAAIIQLPGNDGALLRSGLDSAR  68

Query  604  FYFKTR---VVAHGVAAGNS-PWKGTRGVY  681
             YF  R     A  V   +S  W  T G Y
Sbjct  69   LYFHQRSSYSAAEMVHTNDSREWCKTSGYY  98



>ref|XP_010273599.1| PREDICTED: uncharacterized protein LOC104609083 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010273600.1| PREDICTED: uncharacterized protein LOC104609083 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010273601.1| PREDICTED: uncharacterized protein LOC104609083 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010273602.1| PREDICTED: uncharacterized protein LOC104609083 isoform X1 [Nelumbo 
nucifera]
Length=469

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D++  +G P+  Y  +V  LS SL +++AA+I+L   D ALLR GL+SAR
Sbjct  9    LPSLGRVKLTDLIASEGLPSDSYKISVSTLSQSLAQYSAAIIQLPGNDGALLRSGLDSAR  68

Query  604  FYFKTR---VVAHGVAAGNS-PWKGTRGVY  681
             YF  R     A  V   +S  W  T G Y
Sbjct  69   LYFHQRSSYSAAEMVHTNDSREWCKTSGYY  98



>ref|XP_004144636.1| PREDICTED: uncharacterized protein LOC101216737 [Cucumis sativus]
 ref|XP_011653973.1| PREDICTED: uncharacterized protein LOC101216737 [Cucumis sativus]
Length=473

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+DI P +G P+  +  +V  LS SL +++AA+I+  A D ALLR GL+SAR
Sbjct  6    LPSLGRVKLTDIAPSEGVPSESFKLSVSTLSHSLAQYSAAIIQFPACDGALLRSGLDSAR  65

Query  604  FYFKTRVVAHGVAAGNS----PWKGTRGVY  681
             YF  R          S     W  T G Y
Sbjct  66   LYFHQRAACSSAELMQSNDSREWCRTSGYY  95



>gb|KJB45893.1| hypothetical protein B456_007G335700 [Gossypium raimondii]
Length=474

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D++P +G P+  Y  +V  LS S  +++AA+I+  A D ALLR GL+SAR
Sbjct  6    LPSLGRVKLTDLIPSEGIPSDSYKLSVSTLSQSFAQYSAAIIQFPASDGALLRSGLDSAR  65

Query  604  FYFKTR  621
             YF+ +
Sbjct  66   LYFQQK  71



>gb|KJB45894.1| hypothetical protein B456_007G335700 [Gossypium raimondii]
Length=481

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D++P +G P+  Y  +V  LS S  +++AA+I+  A D ALLR GL+SAR
Sbjct  6    LPSLGRVKLTDLIPSEGIPSDSYKLSVSTLSQSFAQYSAAIIQFPASDGALLRSGLDSAR  65

Query  604  FYFKTR  621
             YF+ +
Sbjct  66   LYFQQK  71



>ref|XP_009602643.1| PREDICTED: uncharacterized protein LOC104097734 [Nicotiana tomentosiformis]
 ref|XP_009602644.1| PREDICTED: uncharacterized protein LOC104097734 [Nicotiana tomentosiformis]
Length=472

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL D++P +G P+  Y  +V  LS SL +++AA+I+L   D ALLR  LESAR
Sbjct  6    LPSLGRVKLIDLIPLEGLPSDSYKLSVSTLSQSLAQYSAAIIQLSTSDGALLRSSLESAR  65

Query  604  FYFKTR  621
             YF+ +
Sbjct  66   LYFQHK  71



>ref|XP_002884933.1| hypothetical protein ARALYDRAFT_897504 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61192.1| hypothetical protein ARALYDRAFT_897504 [Arabidopsis lyrata subsp. 
lyrata]
Length=480

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 5/91 (5%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            +  L RVK+SD+ P +G P+  Y  AV  LS SL +++AA+I+    D ALLR GL+SAR
Sbjct  6    MHTLGRVKVSDLAPSEGLPSDSYKLAVTTLSQSLAQYSAAIIQFPPSDGALLRSGLDSAR  65

Query  604  FYFKTR----VVAHGVAAGNS-PWKGTRGVY  681
             YF  R       + +   +S  W  T G Y
Sbjct  66   LYFHQRDSYPATNNMIHTNDSQEWCKTSGYY  96



>ref|XP_006585427.1| PREDICTED: uncharacterized protein LOC100807442 isoform X3 [Glycine 
max]
Length=464

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D++P DG P+  Y  +V  LS SL + +A +I+  A D ALLR  LESAR YF
Sbjct  9    LGRVKLTDLVPSDGLPSDSYKISVSILSQSLAQFSAVIIQFPASDGALLRSSLESARLYF  68

Query  613  KTRVV---AHGVAAGNS-PWKGTRGVY  681
              R     A  +    S  W  T G Y
Sbjct  69   HQRETYPPADIIHTSESREWCKTSGYY  95



>ref|XP_003531504.1| PREDICTED: uncharacterized protein LOC100807442 isoform X1 [Glycine 
max]
 ref|XP_006585426.1| PREDICTED: uncharacterized protein LOC100807442 isoform X2 [Glycine 
max]
Length=504

 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D++P DG P+  Y  +V  LS SL + +A +I+  A D ALLR  LESAR
Sbjct  6    LPSLGRVKLTDLVPSDGLPSDSYKISVSILSQSLAQFSAVIIQFPASDGALLRSSLESAR  65

Query  604  FYFKTRVV---AHGVAAGNS-PWKGTRGVY  681
             YF  R     A  +    S  W  T G Y
Sbjct  66   LYFHQRETYPPADIIHTSESREWCKTSGYY  95



>ref|XP_008465438.1| PREDICTED: uncharacterized protein LOC103503048 isoform X2 [Cucumis 
melo]
Length=473

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+DI P +G P+  +  +V  LS SL +++AA+I+  A D ALLR GL+SAR
Sbjct  6    LPSLGRVKLTDIAPSEGVPSESFKLSVSTLSHSLAQYSAAIIQFPACDGALLRSGLDSAR  65

Query  604  FYFKTRVVAHGVA----AGNSPWKGTRGVY  681
             YF  R             +  W  T G Y
Sbjct  66   LYFHQRAACSSAELMQNNDSREWCRTSGYY  95



>ref|XP_008465436.1| PREDICTED: uncharacterized protein LOC103503048 isoform X1 [Cucumis 
melo]
 ref|XP_008465437.1| PREDICTED: uncharacterized protein LOC103503048 isoform X1 [Cucumis 
melo]
Length=478

 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+DI P +G P+  +  +V  LS SL +++AA+I+  A D ALLR GL+SAR
Sbjct  6    LPSLGRVKLTDIAPSEGVPSESFKLSVSTLSHSLAQYSAAIIQFPACDGALLRSGLDSAR  65

Query  604  FYFKTRVVAHGVA----AGNSPWKGTRGVY  681
             YF  R             +  W  T G Y
Sbjct  66   LYFHQRAACSSAELMQNNDSREWCRTSGYY  95



>ref|XP_010465075.1| PREDICTED: uncharacterized protein LOC104745515 isoform X2 [Camelina 
sativa]
Length=444

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 50/90 (56%), Gaps = 8/90 (9%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVK+ D+ P +G P+  Y  AV  LS SL +++AA+I+    D ALLR GL+SAR YF
Sbjct  9    LGRVKVCDLAPSEGLPSDSYKLAVTTLSQSLAQYSAAIIQFPTSDGALLRSGLDSARLYF  68

Query  613  KTRVVAHGVAAGN-------SPWKGTRGVY  681
              R  ++  A  N       S W  T G Y
Sbjct  69   HQR-DSYPAANNNMIHTNDSSDWCKTSGYY  97



>ref|XP_006407280.1| hypothetical protein EUTSA_v10022429mg [Eutrema salsugineum]
 gb|ESQ48733.1| hypothetical protein EUTSA_v10022429mg [Eutrema salsugineum]
Length=481

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 50/88 (57%), Gaps = 5/88 (6%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVK+ D+ P +G P+  Y  AV  LS SL +++AA+I+  + D ALLR GL+SAR YF
Sbjct  9    LGRVKVCDLAPTEGLPSDSYKLAVTTLSQSLAQYSAAIIQFPSSDGALLRSGLDSARLYF  68

Query  613  KTR----VVAHGVAAGNS-PWKGTRGVY  681
              R       + +   +S  W  T G Y
Sbjct  69   HQRDSYPATNNMIHTNDSREWCKTSGYY  96



>ref|XP_010465074.1| PREDICTED: uncharacterized protein LOC104745515 isoform X1 [Camelina 
sativa]
Length=481

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 50/90 (56%), Gaps = 8/90 (9%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVK+ D+ P +G P+  Y  AV  LS SL +++AA+I+    D ALLR GL+SAR YF
Sbjct  9    LGRVKVCDLAPSEGLPSDSYKLAVTTLSQSLAQYSAAIIQFPTSDGALLRSGLDSARLYF  68

Query  613  KTRVVAHGVAAGN-------SPWKGTRGVY  681
              R  ++  A  N       S W  T G Y
Sbjct  69   HQR-DSYPAANNNMIHTNDSSDWCKTSGYY  97



>ref|XP_010487022.1| PREDICTED: uncharacterized protein LOC104765061 isoform X1 [Camelina 
sativa]
 ref|XP_010487024.1| PREDICTED: uncharacterized protein LOC104765061 isoform X3 [Camelina 
sativa]
Length=481

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 50/90 (56%), Gaps = 8/90 (9%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVK+ D+ P +G P+  Y  AV  LS SL +++AA+I+    D ALLR GL+SAR YF
Sbjct  9    LGRVKVCDLAPSEGLPSDSYKLAVTTLSQSLAQYSAAIIQFPTSDGALLRSGLDSARLYF  68

Query  613  KTRVVAHGVAAGN-------SPWKGTRGVY  681
              R  ++  A  N       S W  T G Y
Sbjct  69   HQR-DSYPAANNNMIHTNDSSDWCKTSGYY  97



>ref|XP_010487023.1| PREDICTED: uncharacterized protein LOC104765061 isoform X2 [Camelina 
sativa]
Length=474

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 50/90 (56%), Gaps = 8/90 (9%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVK+ D+ P +G P+  Y  AV  LS SL +++AA+I+    D ALLR GL+SAR YF
Sbjct  9    LGRVKVCDLAPSEGLPSDSYKLAVTTLSQSLAQYSAAIIQFPTSDGALLRSGLDSARLYF  68

Query  613  KTRVVAHGVAAGN-------SPWKGTRGVY  681
              R  ++  A  N       S W  T G Y
Sbjct  69   HQR-DSYPAANNNMIHTNDSSDWCKTSGYY  97



>ref|XP_010542549.1| PREDICTED: uncharacterized protein LOC104815713 isoform X2 [Tarenaya 
hassleriana]
Length=358

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 51/90 (57%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKLSD+ P +G P   Y  AV  LS SL +++AAVI+  A D ALLR  L+SAR
Sbjct  6    LPTLGRVKLSDLAPSEGLPPDSYKLAVTTLSQSLAQYSAAVIQFPAGDGALLRSSLDSAR  65

Query  604  FYFKTRV---VAHGVAAGNS-PWKGTRGVY  681
             YF  R     +  + + +S  W  T G Y
Sbjct  66   LYFHQRDSYPASDMIHSNDSREWCKTSGYY  95



>ref|XP_010542548.1| PREDICTED: uncharacterized protein LOC104815713 isoform X1 [Tarenaya 
hassleriana]
Length=472

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 51/90 (57%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKLSD+ P +G P   Y  AV  LS SL +++AAVI+  A D ALLR  L+SAR
Sbjct  6    LPTLGRVKLSDLAPSEGLPPDSYKLAVTTLSQSLAQYSAAVIQFPAGDGALLRSSLDSAR  65

Query  604  FYFKTRV---VAHGVAAGNS-PWKGTRGVY  681
             YF  R     +  + + +S  W  T G Y
Sbjct  66   LYFHQRDSYPASDMIHSNDSREWCKTSGYY  95



>gb|KJB12749.1| hypothetical protein B456_002G036400 [Gossypium raimondii]
 gb|KJB12750.1| hypothetical protein B456_002G036400 [Gossypium raimondii]
Length=361

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVK++D++P +G P+  Y  +V  LS S  +++AAVI+  A D ALLR GL+SA 
Sbjct  7    LPSLGRVKITDLIPSEGLPSDSYKLSVSTLSQSFAQYSAAVIQFPAGDGALLRSGLDSAC  66

Query  604  FYFKTRVV---AHGVAAGNS-PWKGTRGVY  681
             YF+ R     A  +   +S  W  T G Y
Sbjct  67   LYFQQREAYPSADMIHTNDSREWCKTSGYY  96



>gb|KJB12751.1| hypothetical protein B456_002G036400 [Gossypium raimondii]
Length=362

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVK++D++P +G P+  Y  +V  LS S  +++AAVI+  A D ALLR GL+SA 
Sbjct  7    LPSLGRVKITDLIPSEGLPSDSYKLSVSTLSQSFAQYSAAVIQFPAGDGALLRSGLDSAC  66

Query  604  FYFKTRVV---AHGVAAGNS-PWKGTRGVY  681
             YF+ R     A  +   +S  W  T G Y
Sbjct  67   LYFQQREAYPSADMIHTNDSREWCKTSGYY  96



>gb|EEC82089.1| hypothetical protein OsI_26091 [Oryza sativa Indica Group]
Length=551

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV+L D+   DG P+ GY   V AL+ SL +++AAV+EL   D ALLR GL+SAR
Sbjct  83   LASLGRVRLCDLAAADGLPSDGYKMCVSALTQSLAQYSAAVVELPPADGALLRSGLDSAR  142

Query  604  FYFKTR  621
             +F  R
Sbjct  143  LFFHQR  148



>ref|XP_010093062.1| hypothetical protein L484_016275 [Morus notabilis]
 gb|EXB53390.1| hypothetical protein L484_016275 [Morus notabilis]
Length=495

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D+ P +G P+  Y  +V  L+ SL +++AA+I+    D ALLR  L+SAR YF
Sbjct  9    LGRVKLTDLAPAEGLPSDSYKLSVSTLTQSLAQYSAAIIQFPMSDGALLRAALDSARLYF  68

Query  613  KTRVV--AHGVAAGNSP--WKGTRGVY  681
            + +    +  +   N P  W  T G Y
Sbjct  69   QQKASYPSTDMINNNDPRDWCKTSGYY  95



>ref|XP_006657725.1| PREDICTED: uncharacterized protein LOC102716704 [Oryza brachyantha]
Length=465

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 51/90 (57%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV+L D+   DG P+ GY   V AL+ SL +++AAV+EL   D ALLR GL+S+R
Sbjct  9    LASLGRVRLCDLAAADGLPSDGYKMCVSALTQSLAQYSAAVVELPPADGALLRSGLDSSR  68

Query  604  FYFKTRVVAHGVAAGNS----PWKGTRGVY  681
             +F  R    G A G S     W  T G Y
Sbjct  69   LFFHRRGYGSGEAGGGSDEAREWCKTSGYY  98



>ref|XP_008383048.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103445784 
[Malus domestica]
Length=476

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 52/102 (51%), Gaps = 14/102 (14%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D+ P +G P+  Y  +V  LS SL +++AA+I+    D ALLR GL+SA  YF
Sbjct  9    LGRVKLADLAPAEGLPSDSYKLSVSTLSQSLAQYSAAIIQFPVSDGALLRSGLDSAHLYF  68

Query  613  KTRVV--AHGVAAGNSP--WKGTRG----------VYTYRAG  696
              +    A  +   N P  W  T G           Y YR G
Sbjct  69   HQKASYPAADMVNNNDPRDWCKTSGYNADPQLWLETYDYRPG  110



>gb|KJB12747.1| hypothetical protein B456_002G036400 [Gossypium raimondii]
 gb|KJB12748.1| hypothetical protein B456_002G036400 [Gossypium raimondii]
 gb|KJB12752.1| hypothetical protein B456_002G036400 [Gossypium raimondii]
Length=477

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 52/90 (58%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVK++D++P +G P+  Y  +V  LS S  +++AAVI+  A D ALLR GL+SA 
Sbjct  7    LPSLGRVKITDLIPSEGLPSDSYKLSVSTLSQSFAQYSAAVIQFPAGDGALLRSGLDSAC  66

Query  604  FYFKTRVV---AHGVAAGNS-PWKGTRGVY  681
             YF+ R     A  +   +S  W  T G Y
Sbjct  67   LYFQQREAYPSADMIHTNDSREWCKTSGYY  96



>ref|XP_001763000.1| predicted protein [Physcomitrella patens]
 gb|EDQ72205.1| predicted protein [Physcomitrella patens]
Length=490

 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 3/86 (3%)
 Frame = +1

Query  436  ARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFK  615
            AR+KL+D++  DG P+  Y  AV +L+ SL   NAA+I++   D  LLRC L+S R +F 
Sbjct  10   ARIKLTDLIGIDGLPSENYKHAVGSLAQSLRNFNAAIIQIPESDNVLLRCVLDSVRMFFH  69

Query  616  TR-VVAHGVAAGNSP--WKGTRGVYT  684
            ++ +V         P  W G  G Y 
Sbjct  70   SKPMVGADALHSEDPQNWNGAVGYYV  95



>ref|XP_006441051.1| hypothetical protein CICLE_v10019785mg [Citrus clementina]
 gb|ESR54291.1| hypothetical protein CICLE_v10019785mg [Citrus clementina]
Length=361

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D++P +G P+  Y  +   LS S  +++AA+I+  A D  LLR  LESAR YF
Sbjct  9    LGRVKLTDLMPSEGLPSDSYKLSATTLSQSFAQYSAAIIQFPASDGPLLRSCLESARLYF  68

Query  613  KTR---VVAHGVAAGNS-PWKGTRGVY  681
              R     A  +   +S  W  T G Y
Sbjct  69   HQRPSYPAAEMIHTNDSREWCKTSGYY  95



>ref|XP_010936700.1| PREDICTED: uncharacterized protein LOC105056241 isoform X4 [Elaeis 
guineensis]
Length=478

 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = +1

Query  421  PLQP-LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLES  597
            P+ P L R++L+D++  +G P+  Y  +V  L+ SL +++AA+I+L + D ALLR GLES
Sbjct  7    PVMPSLGRIRLADLIASEGLPSDSYKISVSTLTQSLAQYSAAIIQLPSADGALLRSGLES  66

Query  598  ARFYFKTRVV--AHGVAAGNS-PWKGTRGVY  681
            AR +F  R    A  V + +S  W  T G Y
Sbjct  67   ARLFFHHRPYPPADMVHSNDSREWCKTSGYY  97



>ref|XP_010936682.1| PREDICTED: uncharacterized protein LOC105056241 isoform X1 [Elaeis 
guineensis]
Length=491

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = +1

Query  421  PLQP-LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLES  597
            P+ P L R++L+D++  +G P+  Y  +V  L+ SL +++AA+I+L + D ALLR GLES
Sbjct  7    PVMPSLGRIRLADLIASEGLPSDSYKISVSTLTQSLAQYSAAIIQLPSADGALLRSGLES  66

Query  598  ARFYFKTRVV--AHGVAAGNS-PWKGTRGVY  681
            AR +F  R    A  V + +S  W  T G Y
Sbjct  67   ARLFFHHRPYPPADMVHSNDSREWCKTSGYY  97



>ref|XP_006478046.1| PREDICTED: uncharacterized protein LOC102613563 isoform X6 [Citrus 
sinensis]
Length=474

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D++P +G P+  Y  +   LS S  +++AA+I+  A D  LLR  LESAR YF
Sbjct  9    LGRVKLTDLMPSEGLPSDSYKLSATTLSQSFAQYSAAIIQFPASDGPLLRSCLESARLYF  68

Query  613  KTR---VVAHGVAAGNS-PWKGTRGVY  681
              R     A  +   +S  W  T G Y
Sbjct  69   HQRPSYPAAEMIHTNDSREWCKTSGYY  95



>ref|XP_010936687.1| PREDICTED: uncharacterized protein LOC105056241 isoform X2 [Elaeis 
guineensis]
Length=490

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = +1

Query  421  PLQP-LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLES  597
            P+ P L R++L+D++  +G P+  Y  +V  L+ SL +++AA+I+L + D ALLR GLES
Sbjct  7    PVMPSLGRIRLADLIASEGLPSDSYKISVSTLTQSLAQYSAAIIQLPSADGALLRSGLES  66

Query  598  ARFYFKTRVV--AHGVAAGNS-PWKGTRGVY  681
            AR +F  R    A  V + +S  W  T G Y
Sbjct  67   ARLFFHHRPYPPADMVHSNDSREWCKTSGYY  97



>ref|XP_010936693.1| PREDICTED: uncharacterized protein LOC105056241 isoform X3 [Elaeis 
guineensis]
Length=479

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 56/91 (62%), Gaps = 4/91 (4%)
 Frame = +1

Query  421  PLQP-LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLES  597
            P+ P L R++L+D++  +G P+  Y  +V  L+ SL +++AA+I+L + D ALLR GLES
Sbjct  7    PVMPSLGRIRLADLIASEGLPSDSYKISVSTLTQSLAQYSAAIIQLPSADGALLRSGLES  66

Query  598  ARFYFKTRVV--AHGVAAGNS-PWKGTRGVY  681
            AR +F  R    A  V + +S  W  T G Y
Sbjct  67   ARLFFHHRPYPPADMVHSNDSREWCKTSGYY  97



>gb|EEE67219.1| hypothetical protein OsJ_24337 [Oryza sativa Japonica Group]
Length=573

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV+L D+   DG P+ GY   V AL  SL +++AAV+EL   D ALLR GL+SAR
Sbjct  105  LASLGRVRLCDLAAADGLPSDGYKMCVSALMQSLAQYSAAVVELPPADGALLRSGLDSAR  164

Query  604  FYFKTR  621
             +F  R
Sbjct  165  LFFHQR  170



>ref|XP_006478045.1| PREDICTED: uncharacterized protein LOC102613563 isoform X5 [Citrus 
sinensis]
Length=476

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D++P +G P+  Y  +   LS S  +++AA+I+  A D  LLR  LESAR YF
Sbjct  9    LGRVKLTDLMPSEGLPSDSYKLSATTLSQSFAQYSAAIIQFPASDGPLLRSCLESARLYF  68

Query  613  KTR---VVAHGVAAGNS-PWKGTRGVY  681
              R     A  +   +S  W  T G Y
Sbjct  69   HQRPSYPAAEMIHTNDSREWCKTSGYY  95



>ref|XP_006441053.1| hypothetical protein CICLE_v10019785mg [Citrus clementina]
 gb|ESR54293.1| hypothetical protein CICLE_v10019785mg [Citrus clementina]
Length=474

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D++P +G P+  Y  +   LS S  +++AA+I+  A D  LLR  LESAR YF
Sbjct  9    LGRVKLTDLMPSEGLPSDSYKLSATTLSQSFAQYSAAIIQFPASDGPLLRSCLESARLYF  68

Query  613  KTR---VVAHGVAAGNS-PWKGTRGVY  681
              R     A  +   +S  W  T G Y
Sbjct  69   HQRPSYPAAEMIHTNDSREWCKTSGYY  95



>ref|XP_006478043.1| PREDICTED: uncharacterized protein LOC102613563 isoform X3 [Citrus 
sinensis]
Length=486

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D++P +G P+  Y  +   LS S  +++AA+I+  A D  LLR  LESAR YF
Sbjct  9    LGRVKLTDLMPSEGLPSDSYKLSATTLSQSFAQYSAAIIQFPASDGPLLRSCLESARLYF  68

Query  613  KTR---VVAHGVAAGNS-PWKGTRGVY  681
              R     A  +   +S  W  T G Y
Sbjct  69   HQRPSYPAAEMIHTNDSREWCKTSGYY  95



>ref|XP_006478044.1| PREDICTED: uncharacterized protein LOC102613563 isoform X4 [Citrus 
sinensis]
Length=480

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D++P +G P+  Y  +   LS S  +++AA+I+  A D  LLR  LESAR YF
Sbjct  9    LGRVKLTDLMPSEGLPSDSYKLSATTLSQSFAQYSAAIIQFPASDGPLLRSCLESARLYF  68

Query  613  KTR---VVAHGVAAGNS-PWKGTRGVY  681
              R     A  +   +S  W  T G Y
Sbjct  69   HQRPSYPAAEMIHTNDSREWCKTSGYY  95



>dbj|BAC79714.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30440.1| unknown protein [Oryza sativa Japonica Group]
Length=471

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV+L D+   DG P+ GY   V AL  SL +++AAV+EL   D ALLR GL+SAR
Sbjct  9    LASLGRVRLCDLAAADGLPSDGYKMCVSALMQSLAQYSAAVVELPPADGALLRSGLDSAR  68

Query  604  FYFKTR  621
             +F  R
Sbjct  69   LFFHQR  74



>ref|XP_006598197.1| PREDICTED: uncharacterized protein LOC100788178 isoform X4 [Glycine 
max]
Length=425

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 9/80 (11%)
 Frame = +1

Query  382  MAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGA  561
            MA + PP          L RVKL+D++P++G  +  Y  +V  LS SL + +A +++  A
Sbjct  1    MADSDPPS---------LGRVKLTDLVPWNGLASDSYKISVSILSHSLAQFSAVIVQFPA  51

Query  562  EDAALLRCGLESARFYFKTR  621
             D A+LR GLESAR YF  R
Sbjct  52   SDGAILRSGLESARMYFHQR  71



>ref|XP_006291013.1| hypothetical protein CARUB_v10017125mg [Capsella rubella]
 gb|EOA23911.1| hypothetical protein CARUB_v10017125mg [Capsella rubella]
Length=473

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 5/88 (6%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVK+ D+ P +G P+  Y  AV  LS SL +++A +I+    D ALLR GL+SAR YF
Sbjct  9    LGRVKVCDLAPSEGLPSDSYKLAVSTLSQSLAQYSAVIIQFPTSDGALLRSGLDSARLYF  68

Query  613  KTRV---VAHGVAAGNS--PWKGTRGVY  681
              R     ++ +   N    W  T G Y
Sbjct  69   HQRDSYPASNDMIHSNDSREWCKTSGYY  96



>ref|XP_006478042.1| PREDICTED: uncharacterized protein LOC102613563 isoform X2 [Citrus 
sinensis]
Length=488

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D++P +G P+  Y  +   LS S  +++AA+I+  A D  LLR  LESAR YF
Sbjct  9    LGRVKLTDLMPSEGLPSDSYKLSATTLSQSFAQYSAAIIQFPASDGPLLRSCLESARLYF  68

Query  613  KTR---VVAHGVAAGNS-PWKGTRGVY  681
              R     A  +   +S  W  T G Y
Sbjct  69   HQRPSYPAAEMIHTNDSREWCKTSGYY  95



>ref|XP_006478041.1| PREDICTED: uncharacterized protein LOC102613563 isoform X1 [Citrus 
sinensis]
Length=508

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVKL+D++P +G P+  Y  +   LS S  +++AA+I+  A D  LLR  LESAR YF
Sbjct  9    LGRVKLTDLMPSEGLPSDSYKLSATTLSQSFAQYSAAIIQFPASDGPLLRSCLESARLYF  68

Query  613  KTR---VVAHGVAAGNS-PWKGTRGVY  681
              R     A  +   +S  W  T G Y
Sbjct  69   HQRPSYPAAEMIHTNDSREWCKTSGYY  95



>ref|XP_006441052.1| hypothetical protein CICLE_v10019785mg [Citrus clementina]
 gb|ESR54292.1| hypothetical protein CICLE_v10019785mg [Citrus clementina]
Length=508

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D++P +G P+  Y  +   LS S  +++AA+I+  A D  LLR  LESAR
Sbjct  6    LPSLGRVKLTDLMPSEGLPSDSYKLSATTLSQSFAQYSAAIIQFPASDGPLLRSCLESAR  65

Query  604  FYFKTR---VVAHGVAAGNS-PWKGTRGVY  681
             YF  R     A  +   +S  W  T G Y
Sbjct  66   LYFHQRPSYPAAEMIHTNDSREWCKTSGYY  95



>ref|XP_006291014.1| hypothetical protein CARUB_v10017125mg [Capsella rubella]
 gb|EOA23912.1| hypothetical protein CARUB_v10017125mg [Capsella rubella]
Length=480

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 5/88 (6%)
 Frame = +1

Query  433  LARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF  612
            L RVK+ D+ P +G P+  Y  AV  LS SL +++A +I+    D ALLR GL+SAR YF
Sbjct  9    LGRVKVCDLAPSEGLPSDSYKLAVSTLSQSLAQYSAVIIQFPTSDGALLRSGLDSARLYF  68

Query  613  KTRV---VAHGVAAGNS--PWKGTRGVY  681
              R     ++ +   N    W  T G Y
Sbjct  69   HQRDSYPASNDMIHSNDSREWCKTSGYY  96



>ref|XP_006598194.1| PREDICTED: uncharacterized protein LOC100788178 isoform X1 [Glycine 
max]
 ref|XP_006598195.1| PREDICTED: uncharacterized protein LOC100788178 isoform X2 [Glycine 
max]
Length=444

 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 9/80 (11%)
 Frame = +1

Query  382  MAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGA  561
            MA + PP          L RVKL+D++P++G  +  Y  +V  LS SL + +A +++  A
Sbjct  1    MADSDPPS---------LGRVKLTDLVPWNGLASDSYKISVSILSHSLAQFSAVIVQFPA  51

Query  562  EDAALLRCGLESARFYFKTR  621
             D A+LR GLESAR YF  R
Sbjct  52   SDGAILRSGLESARMYFHQR  71



>ref|XP_006598196.1| PREDICTED: uncharacterized protein LOC100788178 isoform X3 [Glycine 
max]
Length=443

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 9/80 (11%)
 Frame = +1

Query  382  MAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGA  561
            MA + PP          L RVKL+D++P++G  +  Y  +V  LS SL + +A +++  A
Sbjct  1    MADSDPPS---------LGRVKLTDLVPWNGLASDSYKISVSILSHSLAQFSAVIVQFPA  51

Query  562  EDAALLRCGLESARFYFKTR  621
             D A+LR GLESAR YF  R
Sbjct  52   SDGAILRSGLESARMYFHQR  71



>ref|NP_001059704.1| Os07g0496900 [Oryza sativa Japonica Group]
 dbj|BAC79715.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD30441.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF21618.1| Os07g0496900 [Oryza sativa Japonica Group]
Length=470

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV+L D+   DG P+ GY   V AL  SL +++AAV+EL   D ALLR GL+SAR
Sbjct  9    LASLGRVRLCDLAAADGLPSDGYKMCVSALMQSLAQYSAAVVELPPADGALLRSGLDSAR  68

Query  604  FYFKTR  621
             +F  R
Sbjct  69   LFFHQR  74



>ref|XP_006598198.1| PREDICTED: uncharacterized protein LOC100788178 isoform X5 [Glycine 
max]
Length=423

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 9/80 (11%)
 Frame = +1

Query  382  MAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGA  561
            MA + PP          L RVKL+D++P++G  +  Y  +V  LS SL + +A +++  A
Sbjct  1    MADSDPPS---------LGRVKLTDLVPWNGLASDSYKISVSILSHSLAQFSAVIVQFPA  51

Query  562  EDAALLRCGLESARFYFKTR  621
             D A+LR GLESAR YF  R
Sbjct  52   SDGAILRSGLESARMYFHQR  71



>gb|KHN27735.1| hypothetical protein glysoja_025540 [Glycine soja]
Length=464

 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 9/80 (11%)
 Frame = +1

Query  382  MAQAHPPGEFGAIPLQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGA  561
            MA + PP          L RVKL+D++P++G  +  Y  +V  LS SL + +A +++  A
Sbjct  1    MADSDPPS---------LGRVKLTDLVPWNGLASDSYKISVSILSHSLAQFSAVIVQFPA  51

Query  562  EDAALLRCGLESARFYFKTR  621
             D A+LR GLESAR YF  R
Sbjct  52   SDGAILRSGLESARMYFHQR  71



>ref|XP_001753049.1| predicted protein [Physcomitrella patens]
 gb|EDQ82090.1| predicted protein [Physcomitrella patens]
Length=452

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 53/101 (52%), Gaps = 13/101 (13%)
 Frame = +1

Query  436  ARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYF-  612
            AR+KL D++  DG P+  Y  AV +LS SL  +N A+I++   D  LLRC L+S R +F 
Sbjct  10   ARIKLKDLVAVDGLPSESYKIAVASLSQSLRNYNVAIIQVPQSDDVLLRCVLDSVRMFFH  69

Query  613  -KTRVVAHGVAAGN-SPWKGT----------RGVYTYRAGR  699
             K  V A  V A +   W  T          R V+ +R GR
Sbjct  70   LKPMVSADTVHAEDPHNWNCTVGYHAEPQHSREVFDFRPGR  110



>gb|ACN36132.1| unknown [Zea mays]
 tpg|DAA40900.1| TPA: hypothetical protein ZEAMMB73_674698 [Zea mays]
Length=359

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 47/90 (52%), Gaps = 3/90 (3%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV L D++  +G P+  Y   V  L  SL +++AA+I+L   D ALLR GL+SAR
Sbjct  9    LASLGRVHLVDLMASEGLPSDSYKMCVSTLMQSLAQYSAAIIQLSPADGALLRSGLDSAR  68

Query  604  FYFKTRVVAHGVAAGNS---PWKGTRGVYT  684
            F+F  R      A  +     W  T G Y 
Sbjct  69   FFFHQRGYNSNEAVHSDDSREWCKTSGYYV  98



>ref|XP_008667219.1| PREDICTED: uncharacterized protein LOC100193732 isoform X1 [Zea 
mays]
 ref|XP_008667220.1| PREDICTED: uncharacterized protein LOC100193732 isoform X1 [Zea 
mays]
 gb|ACN35898.1| unknown [Zea mays]
 tpg|DAA40898.1| TPA: hypothetical protein ZEAMMB73_674698 [Zea mays]
 tpg|DAA40899.1| TPA: hypothetical protein ZEAMMB73_674698 [Zea mays]
Length=465

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 47/89 (53%), Gaps = 3/89 (3%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV L D++  +G P+  Y   V  L  SL +++AA+I+L   D ALLR GL+SAR
Sbjct  9    LASLGRVHLVDLMASEGLPSDSYKMCVSTLMQSLAQYSAAIIQLSPADGALLRSGLDSAR  68

Query  604  FYFKTRVVAHGVAAGNS---PWKGTRGVY  681
            F+F  R      A  +     W  T G Y
Sbjct  69   FFFHQRGYNSNEAVHSDDSREWCKTSGYY  97



>ref|NP_001132292.1| uncharacterized protein LOC100193732 [Zea mays]
 gb|ACG29238.1| hypothetical protein [Zea mays]
Length=465

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 47/89 (53%), Gaps = 3/89 (3%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV L D++  +G P+  Y   V  L  SL +++AA+I+L   D ALLR GL+SAR
Sbjct  9    LASLGRVHLVDLMASEGLPSDSYKMCVSTLMQSLAQYSAAIIQLSPADGALLRSGLDSAR  68

Query  604  FYFKTRVVAHGVAAGNS---PWKGTRGVY  681
            F+F  R      A  +     W  T G Y
Sbjct  69   FFFHQRGYNSNEAVHSDDSREWCKTSGYY  97



>ref|XP_008667221.1| PREDICTED: uncharacterized protein LOC100193732 isoform X2 [Zea 
mays]
Length=463

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 47/89 (53%), Gaps = 3/89 (3%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV L D++  +G P+  Y   V  L  SL +++AA+I+L   D ALLR GL+SAR
Sbjct  9    LASLGRVHLVDLMASEGLPSDSYKMCVSTLMQSLAQYSAAIIQLSPADGALLRSGLDSAR  68

Query  604  FYFKTRVVAHGVAAGNS---PWKGTRGVY  681
            F+F  R      A  +     W  T G Y
Sbjct  69   FFFHQRGYNSNEAVHSDDSREWCKTSGYY  97



>ref|XP_010644995.1| PREDICTED: uncharacterized protein LOC100255982 isoform X4 [Vitis 
vinifera]
Length=360

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL D++  +G P+  Y  +V  LS SL +++AA+I+  + D ALLR GL+SA 
Sbjct  6    LPSLGRVKLCDLIACEGLPSDSYKLSVSTLSQSLAQYSAAIIQFPSSDGALLRSGLDSAH  65

Query  604  FYFKTRV---VAHGVAAGNS-PWKGTRGVY  681
             YF  R     A  +    S  W  T G Y
Sbjct  66   LYFHQRASYPAADMIHNNESREWCKTSGYY  95



>ref|XP_010644992.1| PREDICTED: uncharacterized protein LOC100255982 isoform X1 [Vitis 
vinifera]
Length=483

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL D++  +G P+  Y  +V  LS SL +++AA+I+  + D ALLR GL+SA 
Sbjct  6    LPSLGRVKLCDLIACEGLPSDSYKLSVSTLSQSLAQYSAAIIQFPSSDGALLRSGLDSAH  65

Query  604  FYFKTRV---VAHGVAAGNS-PWKGTRGVY  681
             YF  R     A  +    S  W  T G Y
Sbjct  66   LYFHQRASYPAADMIHNNESREWCKTSGYY  95



>ref|XP_010644994.1| PREDICTED: uncharacterized protein LOC100255982 isoform X3 [Vitis 
vinifera]
Length=475

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL D++  +G P+  Y  +V  LS SL +++AA+I+  + D ALLR GL+SA 
Sbjct  6    LPSLGRVKLCDLIACEGLPSDSYKLSVSTLSQSLAQYSAAIIQFPSSDGALLRSGLDSAH  65

Query  604  FYFKTRV---VAHGVAAGNS-PWKGTRGVY  681
             YF  R     A  +    S  W  T G Y
Sbjct  66   LYFHQRASYPAADMIHNNESREWCKTSGYY  95



>emb|CBI21777.3| unnamed protein product [Vitis vinifera]
Length=500

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL D++  +G P+  Y  +V  LS SL +++AA+I+  + D ALLR GL+SA 
Sbjct  6    LPSLGRVKLCDLIACEGLPSDSYKLSVSTLSQSLAQYSAAIIQFPSSDGALLRSGLDSAH  65

Query  604  FYFKTRV---VAHGVAAGNS-PWKGTRGVY  681
             YF  R     A  +    S  W  T G Y
Sbjct  66   LYFHQRASYPAADMIHNNESREWCKTSGYY  95



>ref|XP_002984668.1| hypothetical protein SELMODRAFT_120908 [Selaginella moellendorffii]
 gb|EFJ14313.1| hypothetical protein SELMODRAFT_120908 [Selaginella moellendorffii]
Length=491

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 54/106 (51%), Gaps = 17/106 (16%)
 Frame = +1

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            P+ RV+L+D++P DG  +  Y +A   L  SL +++ AVI+L A D  LLRC L+SAR +
Sbjct  5    PVPRVRLADLVPSDGLASDCYKQAAVLLFQSLQKYSFAVIQLSASDGTLLRCVLDSARMF  64

Query  610  FKTR-----VVAHGVAAGNSPWKGTRGVYT----------YRAGRP  702
            F  R        H   + N  W  T G Y+          YR G P
Sbjct  65   FHQRPPPGPETIHTEDSQN--WHRTAGYYSDPHFAKEVFDYRPGTP  108



>ref|XP_010644993.1| PREDICTED: uncharacterized protein LOC100255982 isoform X2 [Vitis 
vinifera]
Length=476

 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL D++  +G P+  Y  +V  LS SL +++AA+I+  + D ALLR GL+SA 
Sbjct  6    LPSLGRVKLCDLIACEGLPSDSYKLSVSTLSQSLAQYSAAIIQFPSSDGALLRSGLDSAH  65

Query  604  FYFKTRV---VAHGVAAGNS-PWKGTRGVY  681
             YF  R     A  +    S  W  T G Y
Sbjct  66   LYFHQRASYPAADMIHNNESREWCKTSGYY  95



>emb|CAN69107.1| hypothetical protein VITISV_011851 [Vitis vinifera]
Length=465

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 4/90 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL D++  +G P+  Y  +V  LS SL +++AA+I+  + D ALLR GL+SA 
Sbjct  6    LPSLGRVKLCDLIACEGLPSDSYKLSVSTLSQSLAQYSAAIIQFPSSDGALLRSGLDSAH  65

Query  604  FYFKTRV---VAHGVAAGNS-PWKGTRGVY  681
             YF  R     A  +    S  W  T G Y
Sbjct  66   LYFHQRASYPAADMIHNNESREWCKTSGYY  95



>ref|XP_002978755.1| hypothetical protein SELMODRAFT_109178 [Selaginella moellendorffii]
 gb|EFJ20202.1| hypothetical protein SELMODRAFT_109178 [Selaginella moellendorffii]
Length=491

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 54/106 (51%), Gaps = 17/106 (16%)
 Frame = +1

Query  430  PLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFY  609
            P+ RV+L+D++P DG  +  Y +A   L  SL +++ AVI+L A D  LLRC L+SAR +
Sbjct  5    PVPRVRLADLVPSDGLASDCYKQAAVLLFQSLQKYSFAVIQLSASDGTLLRCVLDSARMF  64

Query  610  FKTR-----VVAHGVAAGNSPWKGTRGVYT----------YRAGRP  702
            F  R        H   + N  W  T G Y+          YR G P
Sbjct  65   FHQRPPPGPETIHTEDSQN--WHRTAGYYSDPHFAKEVFDYRPGTP  108



>gb|EPS64475.1| hypothetical protein M569_10305, partial [Genlisea aurea]
Length=457

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV+L D++P +G P+  Y  +V  LS SL  ++AA+++    D ALLR GLES R
Sbjct  6    LPTLGRVRLLDLVPSEGLPSDAYKMSVSTLSQSLAHYSAAIVQFPCSDGALLRSGLESLR  65

Query  604  FYFKTR  621
             YF  R
Sbjct  66   LYFHHR  71



>ref|XP_011097649.1| PREDICTED: uncharacterized protein LOC105176525 [Sesamum indicum]
Length=457

 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL D++P +G P+  Y  +V  LS SL +++AA+I+    D ALLR  LES+R
Sbjct  6    LPTLGRVKLVDLIPSEGLPSDTYKLSVSTLSQSLAQYSAAIIQFPINDGALLRSCLESSR  65

Query  604  FYFKTR  621
             YF  +
Sbjct  66   LYFHHK  71



>ref|XP_001774036.1| predicted protein [Physcomitrella patens]
 gb|EDQ61088.1| predicted protein [Physcomitrella patens]
Length=481

 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 53/101 (52%), Gaps = 13/101 (13%)
 Frame = +1

Query  436  ARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFK  615
            AR+KL D++  DG  +  Y  AV +LS SL   NAA+I++   D  LLRC L+S R +F 
Sbjct  10   ARIKLKDLVAIDGLSSQDYKIAVASLSQSLRNFNAAIIQVPQPDDVLLRCVLDSVRMFFH  69

Query  616  TR--VVAHGVAAGN-SPWKGT----------RGVYTYRAGR  699
            ++  V A  V A +   W  T          R V+ YR GR
Sbjct  70   SKPMVGADNVRAEDPQNWNRTAGYYAEPQHFREVFDYRPGR  110



>ref|XP_009382699.1| PREDICTED: uncharacterized protein LOC103970595 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009382700.1| PREDICTED: uncharacterized protein LOC103970595 [Musa acuminata 
subsp. malaccensis]
Length=465

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 50/89 (56%), Gaps = 3/89 (3%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV+L+D++  +G P   Y  +V  L+ S  +++AA+IEL   D+ALLR GLESAR
Sbjct  9    LPSLGRVRLADLVASEGLPPDSYKISVSTLTQSFAQYSAAIIELPPGDSALLRSGLESAR  68

Query  604  FYFKTRVV--AHGVAAGNS-PWKGTRGVY  681
             +F  R    A  V    +  W  T G Y
Sbjct  69   LFFHQRAYPPADMVHTNETREWCKTSGYY  97



>ref|XP_002462889.1| hypothetical protein SORBIDRAFT_02g033870 [Sorghum bicolor]
 gb|EER99410.1| hypothetical protein SORBIDRAFT_02g033870 [Sorghum bicolor]
Length=467

 Score = 59.3 bits (142),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 46/89 (52%), Gaps = 3/89 (3%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV L D++  +G P+  Y   V  +  SL +++A +I+L   D ALLR GL+SAR
Sbjct  9    LASLGRVHLVDLMASEGLPSDSYKMCVSTMMQSLAQYSAVIIQLSPADGALLRSGLDSAR  68

Query  604  FYFKTRVVAHGVAAGNS---PWKGTRGVY  681
            F+F  R      A  +     W  T G Y
Sbjct  69   FFFHQRGYNSNEAVHSDDSREWCKTSGYY  97



>tpg|DAA62781.1| TPA: hypothetical protein ZEAMMB73_234802 [Zea mays]
Length=265

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 40/66 (61%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV L D++  +G P+  Y   V  L  SL +++ A+I+L   D ALLR GLESAR
Sbjct  9    LASLGRVHLVDLVASEGLPSDNYKMCVSTLMQSLSQYSTAIIQLSPADGALLRSGLESAR  68

Query  604  FYFKTR  621
            F+F  +
Sbjct  69   FFFHQQ  74



>ref|XP_010686446.1| PREDICTED: uncharacterized protein LOC104900658 isoform X5 [Beta 
vulgaris subsp. vulgaris]
Length=360

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D+   +G P+  Y  +V  L  SL +++AA+++L A D ALLR  LESAR
Sbjct  6    LPTLGRVKLADLEAKEGLPSDSYKVSVSTLCQSLAQYSAAIVQLPAGDGALLRSCLESAR  65

Query  604  FYFKTR  621
             YF  R
Sbjct  66   LYFHHR  71



>ref|XP_010686445.1| PREDICTED: uncharacterized protein LOC104900658 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=361

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D+   +G P+  Y  +V  L  SL +++AA+++L A D ALLR  LESAR
Sbjct  6    LPTLGRVKLADLEAKEGLPSDSYKVSVSTLCQSLAQYSAAIVQLPAGDGALLRSCLESAR  65

Query  604  FYFKTR  621
             YF  R
Sbjct  66   LYFHHR  71



>ref|XP_010686443.1| PREDICTED: uncharacterized protein LOC104900658 isoform X2 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010686444.1| PREDICTED: uncharacterized protein LOC104900658 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=474

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D+   +G P+  Y  +V  L  SL +++AA+++L A D ALLR  LESAR
Sbjct  6    LPTLGRVKLADLEAKEGLPSDSYKVSVSTLCQSLAQYSAAIVQLPAGDGALLRSCLESAR  65

Query  604  FYFKTR  621
             YF  R
Sbjct  66   LYFHHR  71



>ref|XP_010686442.1| PREDICTED: uncharacterized protein LOC104900658 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=482

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 42/66 (64%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL+D+   +G P+  Y  +V  L  SL +++AA+++L A D ALLR  LESAR
Sbjct  6    LPTLGRVKLADLEAKEGLPSDSYKVSVSTLCQSLAQYSAAIVQLPAGDGALLRSCLESAR  65

Query  604  FYFKTR  621
             YF  R
Sbjct  66   LYFHHR  71



>ref|XP_001765768.1| predicted protein [Physcomitrella patens]
 gb|EDQ69359.1| predicted protein [Physcomitrella patens]
Length=494

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 47/87 (54%), Gaps = 7/87 (8%)
 Frame = +1

Query  436  ARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFK  615
            AR+KL+D++  DG P+  Y  AV  L+ SL   NAA+I++   +  LLRC L+S R +F 
Sbjct  10   ARIKLTDLIALDGLPSENYKLAVANLAQSLRSFNAAIIQVPESENVLLRCVLDSVRMFFH  69

Query  616  TRVVA-----HGVAAGNSPWKGTRGVY  681
            ++ V      H     N  W  T G Y
Sbjct  70   SKPVVGADTLHVEDLQN--WNNTVGYY  94



>gb|EYU33767.1| hypothetical protein MIMGU_mgv1a026040mg [Erythranthe guttata]
Length=457

 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RVKL D++P +G P+  Y  +V  LS SL +++AA+I+    D ALL   LES+R
Sbjct  6    LPTLGRVKLVDLIPTEGLPSDTYKLSVSTLSQSLAQYSAAIIQFPITDGALLNSCLESSR  65

Query  604  FYFKTR  621
             YF  +
Sbjct  66   LYFHHK  71



>ref|XP_006437506.1| hypothetical protein CICLE_v10033750mg [Citrus clementina]
 gb|ESR50746.1| hypothetical protein CICLE_v10033750mg [Citrus clementina]
Length=115

 Score = 54.3 bits (129),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/31 (81%), Positives = 29/31 (94%), Gaps = 0/31 (0%)
 Frame = +1

Query  508  ALSSSLMRHNAAVIELGAEDAALLRCGLESA  600
            ALS SLMRHNAAVIELG+EDAA++ CGLE+A
Sbjct  79   ALSGSLMRHNAAVIELGSEDAAIMSCGLEAA  109



>ref|XP_004957758.1| PREDICTED: uncharacterized protein LOC101785594 isoform X2 [Setaria 
italica]
Length=466

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 3/89 (3%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV+L D+   +G P   Y   V  L  SL +++AAVI+L   ++ALLR GL+SAR
Sbjct  9    LASLGRVRLVDLAACEGLPTENYKICVSTLMQSLAQYSAAVIQLPPSESALLRSGLDSAR  68

Query  604  FYFKTRVV--AHGVAAGNS-PWKGTRGVY  681
             +F  R    +  V + ++  W  T G Y
Sbjct  69   LFFHQRGYNPSEAVHSDDAREWCKTSGYY  97



>ref|XP_004957757.1| PREDICTED: uncharacterized protein LOC101785594 isoform X1 [Setaria 
italica]
Length=476

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 49/89 (55%), Gaps = 3/89 (3%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV+L D+   +G P   Y   V  L  SL +++AAVI+L   ++ALLR GL+SAR
Sbjct  9    LASLGRVRLVDLAACEGLPTENYKICVSTLMQSLAQYSAAVIQLPPSESALLRSGLDSAR  68

Query  604  FYFKTRVV--AHGVAAGNS-PWKGTRGVY  681
             +F  R    +  V + ++  W  T G Y
Sbjct  69   LFFHQRGYNPSEAVHSDDAREWCKTSGYY  97



>gb|EMS53113.1| hypothetical protein TRIUR3_26728 [Triticum urartu]
Length=426

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = +1

Query  424  LQPLARVKLSDILPYDGAPAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESAR  603
            L  L RV+L D+   +G  +  Y   V  L  SL +++AA+I+L   DAALLR GL+SAR
Sbjct  86   LPSLGRVRLGDLAAVEGLASDSYKICVSTLMQSLAQYSAAIIQLPPADAALLRSGLDSAR  145

Query  604  FYFK---TRVVAHGVAAGNSP  657
             +F      V  HG A   SP
Sbjct  146  LFFHQPGVSVREHGGAMELSP  166



>ref|XP_010418917.1| PREDICTED: uncharacterized protein LOC104704548, partial [Camelina 
sativa]
Length=458

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 40/75 (53%), Gaps = 8/75 (11%)
 Frame = +1

Query  478  PAGGYLRAVDALSSSLMRHNAAVIELGAEDAALLRCGLESARFYFKTRVVAHGVAAGN--  651
            P+  Y  AV  LS SL +++AA+I+    D ALLR GL+SAR YF  R  ++  A  N  
Sbjct  1    PSDSYKLAVTTLSQSLAQYSAAIIQFPTSDGALLRSGLDSARLYFHQR-DSYPAANDNMI  59

Query  652  -----SPWKGTRGVY  681
                 S W  T G Y
Sbjct  60   HTNDSSDWCKTSGYY  74



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1267397107886