BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9315

Length=1359
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004246282.1|  PREDICTED: receptor-like protein kinase FERONIA    518   9e-172   Solanum lycopersicum
ref|XP_006341293.1|  PREDICTED: receptor-like protein kinase FERO...    515   5e-171   Solanum tuberosum [potatoes]
ref|XP_009617447.1|  PREDICTED: receptor-like protein kinase FERONIA    513   8e-170   Nicotiana tomentosiformis
ref|XP_009791682.1|  PREDICTED: receptor-like protein kinase FERONIA    511   4e-169   Nicotiana sylvestris
ref|XP_011095158.1|  PREDICTED: receptor-like protein kinase FERONIA    506   3e-167   Sesamum indicum [beniseed]
ref|XP_009337788.1|  PREDICTED: receptor-like protein kinase FERONIA    471   7e-154   Pyrus x bretschneideri [bai li]
ref|XP_009370899.1|  PREDICTED: receptor-like protein kinase FERONIA    467   5e-152   Pyrus x bretschneideri [bai li]
ref|XP_010431249.1|  PREDICTED: receptor-like protein kinase FERONIA    451   5e-151   Camelina sativa [gold-of-pleasure]
ref|XP_007208402.1|  hypothetical protein PRUPE_ppa001164mg             458   9e-149   Prunus persica
gb|EPS73118.1|  hypothetical protein M569_01631                         457   1e-148   Genlisea aurea
ref|XP_008370279.1|  PREDICTED: receptor-like protein kinase FERONIA    457   2e-148   
emb|CDX78012.1|  BnaA09g32070D                                          453   3e-147   
emb|CDP06378.1|  unnamed protein product                                454   4e-147   Coffea canephora [robusta coffee]
ref|XP_009115840.1|  PREDICTED: receptor-like protein kinase FERONIA    454   5e-147   Brassica rapa
ref|XP_006403905.1|  hypothetical protein EUTSA_v10010114mg             454   5e-147   Eutrema salsugineum [saltwater cress]
ref|XP_010426729.1|  PREDICTED: receptor-like protein kinase FERONIA    453   1e-146   Camelina sativa [gold-of-pleasure]
gb|ABT18097.1|  FERONIA receptor-like kinase                            452   1e-146   Cardamine flexuosa
gb|ABT18095.1|  FERONIA receptor-like kinase                            451   5e-146   Cardamine flexuosa
ref|XP_010515573.1|  PREDICTED: receptor-like protein kinase FERONIA    450   1e-145   Camelina sativa [gold-of-pleasure]
ref|XP_008244701.1|  PREDICTED: receptor-like protein kinase FERONIA    449   4e-145   Prunus mume [ume]
ref|XP_010503851.1|  PREDICTED: receptor-like protein kinase FERONIA    449   5e-145   
emb|CDY33271.1|  BnaA01g19380D                                          445   6e-144   Brassica napus [oilseed rape]
ref|XP_010043538.1|  PREDICTED: receptor-like protein kinase FERONIA    445   1e-143   Eucalyptus grandis [rose gum]
gb|AHZ44752.1|  CrRLK1L-like protein                                    441   1e-143   Platanus x hispanica [London plane tree]
gb|ABT18100.1|  FERONIA receptor-like kinase                            445   1e-143   Arabidopsis thaliana [mouse-ear cress]
gb|AAK59558.1|  putative receptor-protein kinase                        444   2e-143   Arabidopsis thaliana [mouse-ear cress]
emb|CDX73714.1|  BnaC08g22890D                                          452   2e-143   
emb|CDY16299.1|  BnaC01g23340D                                          443   2e-143   Brassica napus [oilseed rape]
gb|ABT18094.1|  FERONIA receptor-like kinase                            444   2e-143   Brassica oleracea
ref|NP_190723.1|  receptor-like protein kinase FERONIA                  444   2e-143   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877809.1|  hypothetical protein ARALYDRAFT_485507             441   3e-142   Arabidopsis lyrata subsp. lyrata
ref|XP_004492579.1|  PREDICTED: receptor-like protein kinase FERO...    441   4e-142   Cicer arietinum [garbanzo]
ref|XP_010244547.1|  PREDICTED: receptor-like protein kinase FERONIA    441   5e-142   Nelumbo nucifera [Indian lotus]
gb|KEH32083.1|  feronia receptor-like kinase                            434   1e-141   Medicago truncatula
ref|XP_009148931.1|  PREDICTED: receptor-like protein kinase FERONIA    438   8e-141   Brassica rapa
ref|XP_009136619.1|  PREDICTED: receptor-like protein kinase FERONIA    437   1e-140   Brassica rapa
ref|XP_002528705.1|  kinase, putative                                   437   1e-140   
ref|XP_006290584.1|  hypothetical protein CARUB_v10016673mg             436   3e-140   Capsella rubella
ref|NP_001238686.1|  receptor-like kinase                               436   4e-140   Glycine max [soybeans]
ref|XP_010529939.1|  PREDICTED: receptor-like protein kinase FERONIA    436   5e-140   Tarenaya hassleriana [spider flower]
gb|KJB29840.1|  hypothetical protein B456_005G120700                    435   6e-140   Gossypium raimondii
gb|KHN40613.1|  Receptor-like protein kinase FERONIA                    435   1e-139   Glycine soja [wild soybean]
gb|KEH23293.1|  feronia receptor-like kinase                            434   3e-139   Medicago truncatula
ref|XP_003609098.1|  FERONIA receptor-like kinase                       434   3e-139   
ref|NP_001237656.1|  FERONIA receptor-like kinase precursor             433   4e-139   Glycine max [soybeans]
gb|KHN29489.1|  Receptor-like protein kinase FERONIA                    433   5e-139   Glycine soja [wild soybean]
gb|KJB38065.1|  hypothetical protein B456_006G235700                    432   8e-139   Gossypium raimondii
ref|XP_010252026.1|  PREDICTED: receptor-like protein kinase FERONIA    429   1e-137   Nelumbo nucifera [Indian lotus]
ref|XP_002279218.3|  PREDICTED: receptor-like protein kinase FERONIA    429   2e-137   
ref|XP_004302537.1|  PREDICTED: receptor-like protein kinase FERONIA    429   2e-137   Fragaria vesca subsp. vesca
gb|KJB71482.1|  hypothetical protein B456_011G124900                    427   1e-136   Gossypium raimondii
ref|XP_010252025.1|  PREDICTED: receptor-like protein kinase FERONIA    427   1e-136   Nelumbo nucifera [Indian lotus]
ref|XP_007140079.1|  hypothetical protein PHAVU_008G082400g             425   6e-136   Phaseolus vulgaris [French bean]
ref|XP_012091030.1|  PREDICTED: receptor-like protein kinase FERONIA    425   6e-136   Jatropha curcas
ref|XP_007033491.1|  Malectin/receptor-like protein kinase family...    423   3e-135   Theobroma cacao [chocolate]
ref|XP_006429617.1|  hypothetical protein CICLE_v10011034mg             422   1e-134   Citrus clementina [clementine]
ref|XP_010098025.1|  Receptor-like protein kinase FERONIA               421   1e-134   Morus notabilis
ref|XP_008463270.1|  PREDICTED: receptor-like protein kinase FERONIA    420   4e-134   Cucumis melo [Oriental melon]
gb|KDO64141.1|  hypothetical protein CISIN_1g036624mg                   420   4e-134   Citrus sinensis [apfelsine]
ref|XP_004142677.1|  PREDICTED: receptor-like protein kinase FERONIA    419   1e-133   Cucumis sativus [cucumbers]
gb|ABT18098.1|  FERONIA receptor-like kinase                            419   1e-133   Cardamine flexuosa
ref|XP_002323088.2|  kinase family protein                              409   1e-129   Populus trichocarpa [western balsam poplar]
ref|XP_002308259.1|  kinase family protein                              409   1e-129   
ref|XP_011001679.1|  PREDICTED: receptor-like protein kinase FERONIA    406   1e-128   Populus euphratica
ref|XP_007140062.1|  hypothetical protein PHAVU_008G081000g             405   3e-128   Phaseolus vulgaris [French bean]
gb|ABT18099.1|  FERONIA receptor-like kinase                            404   5e-128   Cardamine flexuosa
ref|XP_011016728.1|  PREDICTED: receptor-like protein kinase FERONIA    403   1e-127   Populus euphratica
gb|EYU42039.1|  hypothetical protein MIMGU_mgv1a001343mg                400   5e-127   Erythranthe guttata [common monkey flower]
emb|CDY29022.1|  BnaC07g32280D                                          399   9e-127   Brassica napus [oilseed rape]
emb|CDX90645.1|  BnaA03g41360D                                          396   1e-125   
ref|XP_010683454.1|  PREDICTED: receptor-like protein kinase FERONIA    389   4e-122   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010553161.1|  PREDICTED: receptor-like protein kinase FERONIA    382   4e-120   Tarenaya hassleriana [spider flower]
ref|XP_008810848.1|  PREDICTED: receptor-like protein kinase FERONIA    380   1e-118   Phoenix dactylifera
ref|XP_010938035.1|  PREDICTED: receptor-like protein kinase FERONIA    373   3e-116   Elaeis guineensis
ref|XP_010667956.1|  PREDICTED: receptor-like protein kinase FERONIA    355   7e-115   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004984479.1|  PREDICTED: receptor-like protein kinase FERO...    368   4e-114   Setaria italica
ref|XP_003557976.1|  PREDICTED: receptor-like protein kinase FERONIA    368   4e-114   Brachypodium distachyon [annual false brome]
ref|XP_008660180.1|  PREDICTED: receptor-like protein kinase FERONIA    364   9e-113   Zea mays [maize]
ref|XP_002467915.1|  hypothetical protein SORBIDRAFT_01g036260          364   1e-112   Sorghum bicolor [broomcorn]
gb|EAY75971.1|  hypothetical protein OsI_03893                          363   1e-112   Oryza sativa Indica Group [Indian rice]
ref|NP_001044372.1|  Os01g0769700                                       363   3e-112   
ref|XP_009391670.1|  PREDICTED: receptor-like protein kinase FERONIA    362   6e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009419820.1|  PREDICTED: receptor-like protein kinase FERO...    350   3e-111   
ref|XP_009419819.1|  PREDICTED: receptor-like protein kinase FERO...    350   4e-111   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008813242.1|  PREDICTED: receptor-like protein kinase FERONIA    360   4e-111   Phoenix dactylifera
ref|XP_009388012.1|  PREDICTED: receptor-like protein kinase FERONIA    349   7e-111   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA45217.1|  TPA: putative receptor-like protein kinase famil...    357   4e-110   
gb|EMT17007.1|  Receptor-like protein kinase FERONIA                    357   6e-110   
ref|XP_009416326.1|  PREDICTED: receptor-like protein kinase FERONIA    356   7e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001050022.1|  Os03g0333200                                       356   9e-110   
gb|EEC75192.1|  hypothetical protein OsI_11431                          356   1e-109   Oryza sativa Indica Group [Indian rice]
ref|XP_009412649.1|  PREDICTED: receptor-like protein kinase FERONIA    352   4e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010921184.1|  PREDICTED: receptor-like protein kinase FERONIA    348   2e-106   Elaeis guineensis
ref|XP_009414253.1|  PREDICTED: receptor-like protein kinase FERONIA    346   9e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004499646.1|  PREDICTED: receptor-like protein kinase FERO...    350   1e-104   
ref|XP_006646366.1|  PREDICTED: receptor-like protein kinase FERO...    339   7e-104   Oryza brachyantha
gb|EMT01093.1|  hypothetical protein F775_16963                         318   3e-99    
dbj|BAK00988.1|  predicted protein                                      318   3e-99    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004976623.1|  PREDICTED: receptor-like protein kinase FERO...    316   4e-98    Setaria italica
ref|XP_010246590.1|  PREDICTED: receptor-like protein kinase FERONIA    323   1e-97    Nelumbo nucifera [Indian lotus]
ref|XP_003580431.1|  PREDICTED: receptor-like protein kinase FERONIA    313   3e-97    Brachypodium distachyon [annual false brome]
ref|XP_002272797.2|  PREDICTED: receptor-like protein kinase ANXUR1     320   3e-96    Vitis vinifera
ref|XP_012072597.1|  PREDICTED: receptor-like protein kinase FERONIA    306   3e-95    Jatropha curcas
gb|KDP37883.1|  hypothetical protein JCGZ_05765                         306   4e-95    Jatropha curcas
gb|EMT27425.1|  Receptor-like protein kinase FERONIA                    316   5e-95    
ref|XP_011623570.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    317   9e-95    
gb|EMT13360.1|  hypothetical protein F775_08521                         306   9e-95    
ref|XP_010250338.1|  PREDICTED: receptor-like protein kinase FERONIA    314   1e-94    Nelumbo nucifera [Indian lotus]
emb|CBI27305.3|  unnamed protein product                                311   6e-94    Vitis vinifera
ref|XP_007045784.1|  Malectin/receptor-like protein kinase family...    312   1e-93    Theobroma cacao [chocolate]
ref|XP_004499647.1|  PREDICTED: receptor-like protein kinase FERO...    305   2e-93    Cicer arietinum [garbanzo]
gb|KDP27678.1|  hypothetical protein JCGZ_20098                         302   2e-93    Jatropha curcas
ref|XP_002447000.1|  hypothetical protein SORBIDRAFT_06g026735          303   2e-93    
ref|XP_012087729.1|  PREDICTED: receptor-like protein kinase FERONIA    304   5e-93    
ref|XP_002273707.2|  PREDICTED: receptor-like protein kinase FERONIA    312   1e-92    Vitis vinifera
ref|NP_001053685.1|  Os04g0586500                                       301   1e-92    
gb|EMT16871.1|  Receptor-like protein kinase FERONIA                    311   1e-92    
gb|KJB80427.1|  hypothetical protein B456_013G096600                    309   1e-92    Gossypium raimondii
ref|XP_008668826.1|  PREDICTED: receptor-like protein kinase FERONIA    311   1e-92    
gb|EMS52253.1|  Receptor-like protein kinase FERONIA                    310   1e-92    Triticum urartu
ref|XP_003568697.1|  PREDICTED: receptor-like protein kinase FERONIA    310   2e-92    Brachypodium distachyon [annual false brome]
ref|XP_012084847.1|  PREDICTED: LOW QUALITY PROTEIN: putative rec...    310   3e-92    Jatropha curcas
ref|XP_012068359.1|  PREDICTED: receptor-like protein kinase FERONIA    308   3e-92    Jatropha curcas
ref|XP_007032832.1|  Malectin/receptor-like protein kinase family...    308   3e-92    
gb|EAY95324.1|  hypothetical protein OsI_17151                          300   5e-92    Oryza sativa Indica Group [Indian rice]
gb|KDP24662.1|  hypothetical protein JCGZ_26521                         306   5e-92    Jatropha curcas
ref|XP_012084348.1|  PREDICTED: receptor-like protein kinase FERONIA    309   6e-92    
ref|XP_007045781.1|  Malectin/receptor-like protein kinase family...    307   9e-92    
ref|XP_010921463.1|  PREDICTED: receptor-like protein kinase ANXUR2     308   9e-92    Elaeis guineensis
ref|XP_004499818.1|  PREDICTED: receptor-like protein kinase FERO...    293   9e-92    
gb|KDP24661.1|  hypothetical protein JCGZ_26520                         309   2e-91    Jatropha curcas
gb|EAY97521.1|  hypothetical protein OsI_19449                          307   2e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_012068357.1|  PREDICTED: receptor-like protein kinase FERONIA    297   2e-91    Jatropha curcas
ref|XP_007227151.1|  hypothetical protein PRUPE_ppa026453mg             306   3e-91    Prunus persica
ref|NP_001055184.1|  Os05g0318700                                       305   3e-91    
gb|KJB10568.1|  hypothetical protein B456_001G207900                    305   4e-91    Gossypium raimondii
ref|XP_006419383.1|  hypothetical protein CICLE_v10004295mg             305   8e-91    Citrus clementina [clementine]
ref|XP_006488842.1|  PREDICTED: receptor-like protein kinase ANXU...    305   1e-90    Citrus sinensis [apfelsine]
gb|EEE63237.1|  hypothetical protein OsJ_18047                          305   1e-90    Oryza sativa Japonica Group [Japonica rice]
gb|EMS54122.1|  Receptor-like protein kinase FERONIA                    305   1e-90    Triticum urartu
ref|XP_004962463.1|  PREDICTED: receptor-like protein kinase FERO...    305   2e-90    Setaria italica
ref|XP_006373380.1|  hypothetical protein POPTR_0017s13240g             305   3e-90    
gb|KHN29954.1|  Receptor-like protein kinase FERONIA                    303   4e-90    Glycine soja [wild soybean]
gb|KDO71938.1|  hypothetical protein CISIN_1g041565mg                   303   4e-90    Citrus sinensis [apfelsine]
ref|XP_006373370.1|  hypothetical protein POPTR_0017s13150g             303   4e-90    
gb|EMS66619.1|  hypothetical protein TRIUR3_14353                       294   5e-90    Triticum urartu
ref|XP_010660578.1|  PREDICTED: receptor-like protein kinase FERONIA    304   5e-90    Vitis vinifera
gb|KJB10587.1|  hypothetical protein B456_001G208900                    295   6e-90    Gossypium raimondii
ref|XP_011071382.1|  PREDICTED: receptor-like protein kinase ANXUR1     303   9e-90    Sesamum indicum [beniseed]
ref|XP_003520131.2|  PREDICTED: receptor-like protein kinase FERO...    302   1e-89    Glycine max [soybeans]
ref|NP_001055179.1|  Os05g0317700                                       302   1e-89    
ref|XP_010660597.1|  PREDICTED: receptor-like protein kinase FERONIA    293   1e-89    Vitis vinifera
ref|XP_006373375.1|  hypothetical protein POPTR_0017s13190g             302   1e-89    
gb|EMS63765.1|  Receptor-like protein kinase FERONIA                    301   1e-89    Triticum urartu
ref|XP_003614252.1|  Kinase-like protein                                301   1e-89    
ref|XP_008390536.1|  PREDICTED: receptor-like protein kinase ANXUR1     302   2e-89    
ref|XP_008223394.1|  PREDICTED: receptor-like protein kinase ANXUR1     301   4e-89    Prunus mume [ume]
ref|XP_002512045.1|  conserved hypothetical protein                     300   6e-89    
ref|XP_007153476.1|  hypothetical protein PHAVU_003G038800g             300   7e-89    Phaseolus vulgaris [French bean]
ref|XP_012088049.1|  PREDICTED: receptor-like protein kinase FERONIA    300   8e-89    Jatropha curcas
ref|XP_011009252.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    297   9e-89    Populus euphratica
ref|XP_011021061.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    299   9e-89    Populus euphratica
emb|CAN77538.1|  hypothetical protein VITISV_025026                     300   9e-89    Vitis vinifera
ref|XP_006654257.1|  PREDICTED: receptor-like protein kinase FERO...    300   1e-88    Oryza brachyantha
ref|XP_010914574.1|  PREDICTED: receptor-like protein kinase ANXUR2     300   2e-88    Elaeis guineensis
ref|XP_009799586.1|  PREDICTED: receptor-like protein kinase ANXUR1     299   2e-88    Nicotiana sylvestris
ref|XP_010660576.1|  PREDICTED: receptor-like protein kinase FERONIA    300   2e-88    
ref|XP_009118021.1|  PREDICTED: receptor-like protein kinase FERO...    298   2e-88    Brassica rapa
ref|XP_002277584.3|  PREDICTED: receptor-like protein kinase FERONIA    299   3e-88    Vitis vinifera
gb|EMT17367.1|  Receptor-like protein kinase FERONIA                    297   3e-88    
ref|XP_010247768.1|  PREDICTED: receptor-like protein kinase FERONIA    299   4e-88    Nelumbo nucifera [Indian lotus]
ref|XP_007032813.1|  Malectin/receptor-like protein kinase family...    290   4e-88    
ref|XP_009372137.1|  PREDICTED: receptor-like protein kinase ANXUR1     298   5e-88    
ref|XP_002519226.1|  ATP binding protein, putative                      298   5e-88    Ricinus communis
dbj|BAJ93584.1|  predicted protein                                      298   7e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011019995.1|  PREDICTED: receptor-like protein kinase ANXUR1     297   7e-88    Populus euphratica
ref|XP_006373383.1|  hypothetical protein POPTR_0017s13270g             297   7e-88    
ref|XP_009602553.1|  PREDICTED: receptor-like protein kinase ANXUR1     297   9e-88    Nicotiana tomentosiformis
emb|CBI21192.3|  unnamed protein product                                299   1e-87    Vitis vinifera
ref|NP_001055180.1|  Os05g0317900                                       296   2e-87    
gb|KDP27676.1|  hypothetical protein JCGZ_20096                         296   2e-87    Jatropha curcas
gb|EEE63232.1|  hypothetical protein OsJ_18042                          296   2e-87    Oryza sativa Japonica Group [Japonica rice]
gb|EEC78971.1|  hypothetical protein OsI_19445                          296   2e-87    Oryza sativa Indica Group [Indian rice]
ref|XP_002311383.2|  hypothetical protein POPTR_0008s10500g             296   3e-87    
ref|XP_010660579.1|  PREDICTED: receptor-like protein kinase FERONIA    288   3e-87    Vitis vinifera
ref|XP_008809255.1|  PREDICTED: receptor-like protein kinase ANXUR1     296   4e-87    Phoenix dactylifera
gb|EMS60533.1|  Receptor-like protein kinase FERONIA                    295   5e-87    Triticum urartu
gb|EMS57312.1|  Receptor-like protein kinase FERONIA                    295   5e-87    Triticum urartu
ref|XP_010243447.1|  PREDICTED: receptor-like protein kinase FERONIA    294   9e-87    Nelumbo nucifera [Indian lotus]
ref|XP_007032823.1|  Malectin/receptor-like protein kinase family...    295   9e-87    
ref|XP_012067824.1|  PREDICTED: receptor-like protein kinase FERONIA    293   1e-86    Jatropha curcas
gb|EEE63231.1|  hypothetical protein OsJ_18041                          293   1e-86    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009385155.1|  PREDICTED: receptor-like protein kinase ANXUR2     294   2e-86    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ88190.1|  predicted protein                                      293   2e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007032799.1|  Malectin/receptor protein kinase family prot...    295   2e-86    
ref|XP_011009253.1|  PREDICTED: receptor-like protein kinase FERONIA    293   2e-86    Populus euphratica
ref|XP_008364006.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    291   2e-86    
gb|AAV44117.1|  unknown protein                                         287   2e-86    Oryza sativa Japonica Group [Japonica rice]
gb|KJB42940.1|  hypothetical protein B456_007G175600                    293   3e-86    Gossypium raimondii
ref|XP_012084350.1|  PREDICTED: receptor-like protein kinase FERONIA    296   5e-86    
ref|XP_006842554.1|  PREDICTED: receptor-like protein kinase FERONIA    293   5e-86    
gb|ERN06449.1|  hypothetical protein AMTR_s00016p00259140               292   6e-86    Amborella trichopoda
ref|XP_004962464.1|  PREDICTED: receptor-like protein kinase FERO...    293   1e-85    
emb|CBI21198.3|  unnamed protein product                                293   1e-85    Vitis vinifera
ref|XP_006358215.1|  PREDICTED: receptor-like protein kinase ANXU...    291   1e-85    Solanum tuberosum [potatoes]
ref|XP_012088048.1|  PREDICTED: receptor-like protein kinase FERONIA    291   1e-85    
emb|CDP15786.1|  unnamed protein product                                283   1e-85    Coffea canephora [robusta coffee]
ref|XP_004296245.1|  PREDICTED: receptor-like protein kinase ANXUR1     291   2e-85    Fragaria vesca subsp. vesca
ref|XP_003614249.1|  Kinase-like protein                                290   4e-85    Medicago truncatula
gb|EAY97520.1|  hypothetical protein OsI_19448                          287   1e-84    Oryza sativa Indica Group [Indian rice]
ref|XP_002271113.1|  PREDICTED: receptor-like protein kinase ANXUR1     288   2e-84    Vitis vinifera
ref|XP_003633771.1|  PREDICTED: receptor-like protein kinase FERONIA    288   4e-84    
emb|CDY26624.1|  BnaA09g46530D                                          292   6e-84    Brassica napus [oilseed rape]
gb|KJB11637.1|  hypothetical protein B456_001G269100                    288   6e-84    Gossypium raimondii
gb|KJB80425.1|  hypothetical protein B456_013G096400                    278   8e-84    Gossypium raimondii
ref|XP_002530992.1|  kinase, putative                                   287   9e-84    
emb|CDO98765.1|  unnamed protein product                                286   2e-83    Coffea canephora [robusta coffee]
ref|XP_010242732.1|  PREDICTED: receptor-like protein kinase ANXUR1     285   2e-83    Nelumbo nucifera [Indian lotus]
ref|XP_010319813.1|  PREDICTED: receptor-like protein kinase ANXUR1     285   5e-83    
ref|XP_004243035.1|  PREDICTED: receptor-like protein kinase ANXUR1     285   5e-83    Solanum lycopersicum
ref|XP_007035799.1|  Malectin/receptor-like protein kinase family...    285   6e-83    
ref|XP_007215522.1|  hypothetical protein PRUPE_ppa003761mg             277   6e-83    Prunus persica
ref|XP_006427852.1|  hypothetical protein CICLE_v10024830mg             285   7e-83    Citrus clementina [clementine]
ref|XP_010660596.1|  PREDICTED: receptor-like protein kinase FERONIA    285   8e-83    
gb|KDO53394.1|  hypothetical protein CISIN_1g002533mg                   285   9e-83    Citrus sinensis [apfelsine]
ref|XP_012084846.1|  PREDICTED: receptor-like protein kinase FERONIA    285   1e-82    Jatropha curcas
ref|XP_012084845.1|  PREDICTED: receptor-like protein kinase FERONIA    285   1e-82    Jatropha curcas
ref|XP_002316044.1|  Pto-like kinase OGw family protein                 283   1e-82    
ref|XP_009373799.1|  PREDICTED: receptor-like protein kinase FERONIA    283   2e-82    
ref|XP_010660595.1|  PREDICTED: receptor-like protein kinase FERONIA    277   2e-82    Vitis vinifera
ref|XP_009118022.1|  PREDICTED: receptor-like protein kinase FERO...    280   3e-82    Brassica rapa
ref|XP_008341792.1|  PREDICTED: receptor-like protein kinase FERONIA    283   4e-82    
ref|XP_008231019.1|  PREDICTED: receptor-like protein kinase FERONIA    270   4e-82    
ref|XP_009385224.1|  PREDICTED: receptor-like protein kinase ANXUR1     282   5e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002439522.1|  hypothetical protein SORBIDRAFT_09g009320          282   5e-82    Sorghum bicolor [broomcorn]
ref|XP_007032808.1|  Malectin/receptor-like protein kinase family...    282   7e-82    
ref|XP_002530995.1|  kinase, putative                                   281   1e-81    Ricinus communis
ref|XP_008341791.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    281   1e-81    
gb|KCW87969.1|  hypothetical protein EUGRSUZ_A00377                     280   2e-81    Eucalyptus grandis [rose gum]
ref|XP_002447169.1|  hypothetical protein SORBIDRAFT_06g029710          281   2e-81    Sorghum bicolor [broomcorn]
ref|XP_006405671.1|  hypothetical protein EUTSA_v10027636mg             280   2e-81    Eutrema salsugineum [saltwater cress]
ref|XP_010065050.1|  PREDICTED: receptor-like protein kinase ANXUR2     280   2e-81    Eucalyptus grandis [rose gum]
ref|NP_001055089.1|  Os05g0280700                                       280   3e-81    
ref|XP_008464587.1|  PREDICTED: receptor-like protein kinase FERONIA    281   3e-81    Cucumis melo [Oriental melon]
ref|XP_008368476.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    280   3e-81    
gb|AFW77551.1|  putative receptor-like protein kinase family protein    280   4e-81    
ref|XP_007216899.1|  hypothetical protein PRUPE_ppa019630mg             279   5e-81    
ref|XP_006654205.1|  PREDICTED: receptor-like protein kinase FERO...    278   1e-80    Oryza brachyantha
ref|XP_010025009.1|  PREDICTED: receptor-like protein kinase ANXUR1     278   1e-80    Eucalyptus grandis [rose gum]
ref|XP_010258502.1|  PREDICTED: receptor-like protein kinase ANXUR1     278   2e-80    Nelumbo nucifera [Indian lotus]
ref|XP_009115877.1|  PREDICTED: putative receptor-like protein ki...    278   2e-80    Brassica rapa
ref|XP_010660577.1|  PREDICTED: receptor-like protein kinase FERONIA    278   2e-80    Vitis vinifera
ref|XP_008390575.1|  PREDICTED: receptor-like protein kinase ANXUR1     267   2e-80    
ref|XP_009372136.1|  PREDICTED: receptor-like protein kinase ANXUR2     267   2e-80    Pyrus x bretschneideri [bai li]
ref|XP_010684237.1|  PREDICTED: receptor-like protein kinase ANXUR1     277   2e-80    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009365907.1|  PREDICTED: receptor-like protein kinase FERONIA    278   2e-80    Pyrus x bretschneideri [bai li]
gb|KJB28740.1|  hypothetical protein B456_005G067100                    277   3e-80    Gossypium raimondii
ref|XP_007032827.1|  Malectin/receptor-like protein kinase family...    276   5e-80    
ref|XP_007032831.1|  Malectin/receptor-like protein kinase family...    276   6e-80    
ref|XP_008245502.1|  PREDICTED: receptor-like protein kinase FERONIA    264   1e-79    
ref|XP_004962493.1|  PREDICTED: receptor-like protein kinase ANXU...    275   1e-79    Setaria italica
ref|XP_009365970.1|  PREDICTED: receptor-like protein kinase FERONIA    270   5e-79    
ref|XP_009365906.1|  PREDICTED: receptor-like protein kinase FERO...    274   5e-79    
ref|XP_008341797.1|  PREDICTED: receptor-like protein kinase FERONIA    274   7e-79    
ref|XP_007217617.1|  hypothetical protein PRUPE_ppa016279mg             272   7e-79    
emb|CDX74491.1|  BnaA04g08980D                                          273   8e-79    
ref|XP_006482014.1|  PREDICTED: receptor-like protein kinase FERO...    273   8e-79    Citrus sinensis [apfelsine]
emb|CAN76103.1|  hypothetical protein VITISV_015218                     273   8e-79    Vitis vinifera
ref|XP_009139818.1|  PREDICTED: putative receptor-like protein ki...    273   9e-79    Brassica rapa
ref|XP_003633768.2|  PREDICTED: receptor-like protein kinase FERONIA    273   1e-78    
ref|XP_008230906.1|  PREDICTED: receptor-like protein kinase FERONIA    273   1e-78    Prunus mume [ume]
ref|XP_004137258.1|  PREDICTED: receptor-like protein kinase FERONIA    273   1e-78    Cucumis sativus [cucumbers]
ref|XP_012084077.1|  PREDICTED: receptor-like protein kinase ANXUR1     273   1e-78    Jatropha curcas
emb|CDY37883.1|  BnaC04g31230D                                          271   2e-78    Brassica napus [oilseed rape]
ref|XP_004306057.1|  PREDICTED: receptor-like protein kinase FERONIA    272   3e-78    Fragaria vesca subsp. vesca
ref|XP_010097803.1|  Receptor-like protein kinase FERONIA               271   3e-78    Morus notabilis
gb|KJB10597.1|  hypothetical protein B456_001G210300                    271   4e-78    Gossypium raimondii
ref|XP_007032814.1|  Malectin/receptor-like protein kinase family...    271   5e-78    
emb|CDP19885.1|  unnamed protein product                                271   8e-78    Coffea canephora [robusta coffee]
ref|XP_009588433.1|  PREDICTED: receptor-like protein kinase FERONIA    271   8e-78    
gb|KJB10595.1|  hypothetical protein B456_001G210100                    271   8e-78    
ref|XP_009365903.1|  PREDICTED: receptor-like protein kinase FERO...    271   8e-78    
ref|XP_010097778.1|  Receptor-like protein kinase                       270   1e-77    
ref|XP_004306058.2|  PREDICTED: receptor-like protein kinase FERONIA    270   1e-77    
ref|XP_008230911.1|  PREDICTED: receptor-like protein kinase FERONIA    270   2e-77    
ref|XP_007147183.1|  hypothetical protein PHAVU_006G102700g             270   2e-77    
ref|XP_002884459.1|  kinase family protein                              269   2e-77    
ref|XP_009360627.1|  PREDICTED: receptor-like protein kinase FERONIA    269   3e-77    
ref|XP_004499645.1|  PREDICTED: receptor-like protein kinase FERO...    258   3e-77    
ref|XP_008223395.1|  PREDICTED: receptor-like protein kinase ANXUR2     259   4e-77    
ref|XP_006430474.1|  hypothetical protein CICLE_v10011056mg             268   4e-77    
ref|XP_009790514.1|  PREDICTED: receptor-like protein kinase FERONIA    269   4e-77    
gb|KDO72282.1|  hypothetical protein CISIN_1g042216mg                   267   5e-77    
gb|EMT03407.1|  Receptor-like protein kinase FERONIA                    266   6e-77    
ref|XP_006338349.1|  PREDICTED: receptor-like protein kinase FERO...    268   6e-77    
ref|XP_009125099.1|  PREDICTED: putative receptor-like protein ki...    268   7e-77    
ref|NP_187120.1|  receptor-like protein kinase ANXUR1                   268   7e-77    
ref|XP_007216888.1|  hypothetical protein PRUPE_ppa020589mg             268   8e-77    
emb|CDX67422.1|  BnaA07g14620D                                          265   9e-77    
ref|XP_006482013.1|  PREDICTED: receptor-like protein kinase FERO...    267   1e-76    
ref|XP_006482424.1|  PREDICTED: receptor-like protein kinase FERO...    267   1e-76    
emb|CDP05401.1|  unnamed protein product                                268   1e-76    
ref|XP_008231015.1|  PREDICTED: receptor-like protein kinase FERONIA    259   1e-76    
ref|XP_004304217.1|  PREDICTED: receptor-like protein kinase FERONIA    267   2e-76    
ref|XP_009365902.1|  PREDICTED: receptor-like protein kinase FERO...    267   2e-76    
emb|CDP20271.1|  unnamed protein product                                266   3e-76    
ref|XP_008231018.1|  PREDICTED: receptor-like protein kinase FERONIA    266   4e-76    
emb|CDY36996.1|  BnaC06g12670D                                          266   4e-76    
ref|XP_008218280.1|  PREDICTED: receptor-like protein kinase ANXUR1     266   4e-76    
gb|EYU45497.1|  hypothetical protein MIMGU_mgv1a001016mg                266   5e-76    
ref|XP_008367132.1|  PREDICTED: uncharacterized protein LOC103430767    268   6e-76    
ref|XP_006424004.1|  hypothetical protein CICLE_v10029897mg             265   6e-76    
emb|CDY48660.1|  BnaC07g27490D                                          259   6e-76    
ref|XP_010485852.1|  PREDICTED: receptor-like protein kinase ANXUR1     265   6e-76    
emb|CDP19887.1|  unnamed protein product                                265   8e-76    
ref|XP_010494105.1|  PREDICTED: receptor-like protein kinase ANXUR2     265   8e-76    
gb|KJB10602.1|  hypothetical protein B456_001G210700                    265   1e-75    
ref|XP_010463957.1|  PREDICTED: receptor-like protein kinase ANXUR1     264   1e-75    
ref|XP_010041081.1|  PREDICTED: receptor-like protein kinase FERONIA    256   2e-75    
ref|XP_009365908.1|  PREDICTED: receptor-like protein kinase FERONIA    264   2e-75    
ref|XP_010417830.1|  PREDICTED: receptor-like protein kinase ANXUR1     264   2e-75    
ref|XP_002874434.1|  kinase family protein                              264   2e-75    
gb|KJB71481.1|  hypothetical protein B456_011G124900                    261   4e-75    
ref|XP_006430476.1|  hypothetical protein CICLE_v10011088mg             262   4e-75    
ref|XP_006395027.1|  hypothetical protein EUTSA_v10003639mg             263   4e-75    
gb|KJB75372.1|  hypothetical protein B456_012G038800                    263   4e-75    
ref|XP_008379440.1|  PREDICTED: receptor-like protein kinase FERONIA    263   5e-75    
ref|XP_011099029.1|  PREDICTED: receptor-like protein kinase FERONIA    263   5e-75    
ref|XP_010421701.1|  PREDICTED: receptor-like protein kinase ANXUR2     263   6e-75    
ref|XP_010455191.1|  PREDICTED: receptor-like protein kinase ANXUR2     263   7e-75    
ref|XP_006289663.1|  hypothetical protein CARUB_v10003221mg             262   8e-75    
ref|NP_198716.1|  putative receptor-like protein kinase                 262   8e-75    
ref|XP_008348094.1|  PREDICTED: receptor-like protein kinase FERONIA    262   9e-75    
gb|KHN31469.1|  Receptor-like protein kinase ANXUR2                     262   9e-75    
ref|XP_003520841.1|  PREDICTED: receptor-like protein kinase ANXU...    262   9e-75    
gb|EYU46822.1|  hypothetical protein MIMGU_mgv1a022107mg                262   1e-74    
emb|CDX78036.1|  BnaA09g32310D                                          262   1e-74    
ref|XP_010034409.1|  PREDICTED: receptor-like protein kinase FERONIA    262   1e-74    
emb|CDP17056.1|  unnamed protein product                                262   1e-74    
ref|XP_010550913.1|  PREDICTED: receptor-like protein kinase ANXUR2     262   1e-74    
ref|XP_006487877.1|  PREDICTED: receptor-like protein kinase ANXU...    261   2e-74    
emb|CDO99857.1|  unnamed protein product                                265   2e-74    
ref|XP_007208221.1|  hypothetical protein PRUPE_ppa018611mg             261   2e-74    
gb|KCW52051.1|  hypothetical protein EUGRSUZ_J01491                     261   2e-74    
ref|XP_006482015.1|  PREDICTED: receptor-like protein kinase FERO...    261   2e-74    
ref|XP_010032550.1|  PREDICTED: receptor-like protein kinase FERONIA    262   2e-74    
gb|KCW61585.1|  hypothetical protein EUGRSUZ_H04319                     260   2e-74    
ref|XP_010034437.1|  PREDICTED: receptor-like protein kinase FERONIA    261   3e-74    
gb|KCW52041.1|  hypothetical protein EUGRSUZ_J01482                     260   3e-74    
ref|XP_011099030.1|  PREDICTED: receptor-like protein kinase FERONIA    261   3e-74    
ref|XP_010519979.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    260   4e-74    
ref|XP_011009251.1|  PREDICTED: receptor-like protein kinase FERONIA    261   4e-74    
ref|XP_010034429.1|  PREDICTED: receptor-like protein kinase FERONIA    261   4e-74    
ref|XP_006387808.1|  hypothetical protein POPTR_0554s00200g             257   4e-74    
ref|XP_006430941.1|  hypothetical protein CICLE_v10013889mg             260   4e-74    
ref|XP_004306062.1|  PREDICTED: receptor-like protein kinase FERONIA    259   5e-74    
emb|CDX86206.1|  BnaA06g29230D                                          260   5e-74    
ref|XP_007217152.1|  hypothetical protein PRUPE_ppa001413mg             259   5e-74    
ref|XP_009151260.1|  PREDICTED: receptor-like protein kinase ANXUR2     260   6e-74    
gb|KDO54400.1|  hypothetical protein CISIN_1g039107mg                   259   6e-74    
ref|XP_008230910.1|  PREDICTED: receptor-like protein kinase FERONIA    260   6e-74    
ref|XP_010032549.1|  PREDICTED: receptor-like protein kinase FERONIA    260   6e-74    
ref|XP_011015035.1|  PREDICTED: receptor-like protein kinase FERONIA    260   9e-74    
ref|XP_004137257.1|  PREDICTED: receptor-like protein kinase FERONIA    260   9e-74    
ref|XP_007225032.1|  hypothetical protein PRUPE_ppa019931mg             249   1e-73    
gb|KEH43006.1|  malectin/receptor-like kinase family protein            259   1e-73    
ref|XP_006408164.1|  hypothetical protein EUTSA_v10020050mg             259   1e-73    
ref|XP_002457574.1|  hypothetical protein SORBIDRAFT_03g009660          259   1e-73    
gb|KFK33213.1|  hypothetical protein AALP_AA6G345300                    259   2e-73    
ref|XP_008370712.1|  PREDICTED: receptor-like protein kinase ANXUR2     259   2e-73    
ref|XP_006604845.1|  PREDICTED: receptor-like protein kinase ANXU...    258   2e-73    
ref|XP_007217058.1|  hypothetical protein PRUPE_ppa001157mg             258   3e-73    
ref|XP_008456162.1|  PREDICTED: receptor-like protein kinase ANXU...    257   3e-73    
gb|KHN14703.1|  Receptor-like protein kinase ANXUR1                     253   3e-73    
ref|XP_011013067.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    258   3e-73    
ref|NP_198719.1|  putative receptor-like protein kinase                 257   4e-73    
gb|KDP27270.1|  hypothetical protein JCGZ_19969                         257   4e-73    
ref|XP_002440485.1|  hypothetical protein SORBIDRAFT_09g001733          256   5e-73    
ref|XP_011079535.1|  PREDICTED: receptor-like protein kinase ANXUR1     258   5e-73    
ref|XP_010099331.1|  hypothetical protein L484_018194                   249   5e-73    
ref|XP_008456155.1|  PREDICTED: receptor-like protein kinase ANXU...    257   6e-73    
ref|XP_010230703.1|  PREDICTED: receptor-like protein kinase ANXUR1     261   7e-73    
ref|XP_009364589.1|  PREDICTED: receptor-like protein kinase ANXUR2     257   8e-73    
ref|NP_198220.1|  receptor-like protein kinase ANXUR2                   257   8e-73    
ref|XP_003568703.1|  PREDICTED: receptor-like protein kinase ANXUR1     256   1e-72    
ref|XP_002323908.2|  Pto-like kinase OGw family protein                 256   2e-72    
ref|XP_007217578.1|  hypothetical protein PRUPE_ppa019352mg             256   2e-72    
ref|XP_009139815.1|  PREDICTED: putative receptor-like protein ki...    256   2e-72    
ref|XP_008230415.1|  PREDICTED: receptor-like protein kinase FERONIA    257   2e-72    
ref|XP_008655515.1|  PREDICTED: receptor-like protein kinase ANXUR1     256   2e-72    
gb|EYU19262.1|  hypothetical protein MIMGU_mgv1a024030mg                245   2e-72    
ref|XP_008230912.1|  PREDICTED: receptor-like protein kinase FERONIA    256   3e-72    
ref|XP_006285765.1|  hypothetical protein CARUB_v10007239mg             256   3e-72    
ref|XP_008388681.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    255   3e-72    
ref|XP_008340601.1|  PREDICTED: receptor-like protein kinase ANXUR2     246   3e-72    
tpg|DAA53962.1|  TPA: putative receptor-like protein kinase famil...    255   5e-72    
ref|XP_006606937.1|  PREDICTED: receptor-like protein kinase ANXU...    254   6e-72    
gb|KGN60792.1|  hypothetical protein Csa_2G010280                       253   7e-72    
gb|EMT27556.1|  Receptor-like protein kinase ANXUR1                     258   8e-72    
emb|CDY37884.1|  BnaC04g31220D                                          254   9e-72    
ref|XP_004232151.1|  PREDICTED: receptor-like protein kinase FERONIA    254   9e-72    
ref|XP_006286236.1|  hypothetical protein CARUB_v10007805mg             253   9e-72    
ref|XP_011032387.1|  PREDICTED: receptor-like protein kinase ANXUR1     254   1e-71    
gb|EMS48200.1|  Receptor-like protein kinase HERK 1                     253   1e-71    
ref|XP_004139382.1|  PREDICTED: receptor-like protein kinase ANXUR2     253   1e-71    
ref|XP_004494710.1|  PREDICTED: receptor-like protein kinase ANXU...    253   1e-71    
ref|XP_004296244.1|  PREDICTED: receptor-like protein kinase ANXUR1     245   2e-71    
gb|KDP23678.1|  hypothetical protein JCGZ_23511                         253   2e-71    
emb|CDX74492.1|  BnaA04g08970D                                          253   2e-71    
ref|XP_008379865.1|  PREDICTED: receptor-like protein kinase FERONIA    252   2e-71    
ref|XP_002319081.1|  kinase family protein                              253   2e-71    
emb|CDY33885.1|  BnaA02g31020D                                          252   3e-71    
emb|CDP05402.1|  unnamed protein product                                253   3e-71    
ref|XP_006593699.1|  PREDICTED: receptor-like protein kinase FERO...    250   3e-71    
gb|KJB10590.1|  hypothetical protein B456_001G209200                    253   3e-71    
emb|CDY05602.1|  BnaC02g39350D                                          252   4e-71    
ref|XP_009129817.1|  PREDICTED: receptor-like protein kinase ANXUR2     252   4e-71    
ref|XP_010441031.1|  PREDICTED: probable receptor-like protein ki...    251   4e-71    
ref|XP_008464586.1|  PREDICTED: receptor-like protein kinase FERONIA    252   5e-71    
ref|XP_002531275.1|  ATP binding protein, putative                      251   5e-71    
ref|XP_010552466.1|  PREDICTED: putative receptor-like protein ki...    253   6e-71    
ref|XP_006493338.1|  PREDICTED: receptor-like protein kinase FERO...    247   7e-71    
ref|XP_004967845.1|  PREDICTED: receptor-like protein kinase FERO...    251   7e-71    
ref|XP_007030540.1|  Malectin/receptor-like protein kinase family...    251   8e-71    
ref|XP_010099328.1|  Receptor-like protein kinase FERONIA               251   9e-71    
ref|XP_011038554.1|  PREDICTED: receptor-like protein kinase ANXUR1     251   1e-70    
ref|XP_012089283.1|  PREDICTED: receptor-like protein kinase ANXUR1     252   1e-70    
ref|XP_006644001.1|  PREDICTED: receptor-like protein kinase ANXU...    251   1e-70    
gb|EYU38427.1|  hypothetical protein MIMGU_mgv1a001092mg                251   1e-70    
gb|KGN53791.1|  hypothetical protein Csa_4G129570                       249   3e-70    
ref|XP_004306059.2|  PREDICTED: receptor-like protein kinase FERO...    249   3e-70    
ref|XP_006382811.1|  serine-threonine kinase family protein             249   4e-70    
gb|KHN18064.1|  Receptor-like protein kinase ANXUR2                     249   4e-70    
ref|XP_003535370.1|  PREDICTED: receptor-like protein kinase ANXU...    249   4e-70    
ref|XP_011467877.1|  PREDICTED: receptor-like protein kinase FERO...    249   4e-70    
ref|XP_011653414.1|  PREDICTED: receptor-like protein kinase FERONIA    249   5e-70    
ref|XP_008341790.1|  PREDICTED: receptor-like protein kinase FERONIA    248   7e-70    
ref|XP_009601576.1|  PREDICTED: receptor-like protein kinase ANXUR1     249   8e-70    
ref|XP_006593700.1|  PREDICTED: receptor-like protein kinase FERO...    248   9e-70    
gb|EPS72234.1|  hypothetical protein M569_02521                         248   1e-69    
gb|EYU38426.1|  hypothetical protein MIMGU_mgv1a026661mg                238   1e-69    
ref|XP_008231022.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-lik...    248   1e-69    
ref|NP_001238536.1|  receptor-like kinase                               249   2e-69    
ref|XP_006493305.1|  PREDICTED: receptor-like protein kinase FERO...    248   2e-69    
ref|XP_009790513.1|  PREDICTED: receptor-like protein kinase FERONIA    247   3e-69    
emb|CDX88223.1|  BnaA06g28140D                                          246   3e-69    
ref|XP_010435808.1|  PREDICTED: probable receptor-like protein ki...    246   3e-69    
ref|XP_007151360.1|  hypothetical protein PHAVU_004G040000g             246   4e-69    
ref|XP_006593316.1|  PREDICTED: FERONIA receptor-like kinase isof...    246   5e-69    
ref|NP_001238431.1|  FERONIA receptor-like kinase precursor             246   5e-69    
ref|XP_009785956.1|  PREDICTED: receptor-like protein kinase ANXUR1     246   5e-69    
ref|XP_010032628.1|  PREDICTED: receptor-like protein kinase FERONIA    246   6e-69    
ref|XP_010450844.1|  PREDICTED: putative receptor-like protein ki...    246   7e-69    
ref|XP_006595251.1|  PREDICTED: receptor-like protein kinase FERO...    245   8e-69    
ref|XP_010441030.1|  PREDICTED: putative receptor-like protein ki...    233   9e-69    
ref|XP_007151359.1|  hypothetical protein PHAVU_004G039900g             245   9e-69    
ref|XP_009151130.1|  PREDICTED: probable receptor-like protein ki...    245   1e-68    
ref|XP_007217052.1|  hypothetical protein PRUPE_ppa001190mg             246   1e-68    
ref|XP_006285704.1|  hypothetical protein CARUB_v10007175mg             246   1e-68    
ref|XP_006388667.1|  hypothetical protein POPTR_0125s00210g             245   1e-68    
ref|XP_002277565.2|  PREDICTED: receptor-like protein kinase FERONIA    245   1e-68    
ref|XP_007151348.1|  hypothetical protein PHAVU_004G038800g             245   1e-68    
ref|XP_006493304.1|  PREDICTED: receptor-like protein kinase FERO...    244   2e-68    
ref|NP_198718.1|  putative receptor-like protein kinase                 244   2e-68    
ref|XP_012084843.1|  PREDICTED: receptor-like protein kinase FERONIA    244   3e-68    
ref|XP_010099322.1|  Receptor-like protein kinase FERONIA               244   3e-68    
gb|KDP27267.1|  hypothetical protein JCGZ_19966                         244   3e-68    
ref|XP_004240568.1|  PREDICTED: receptor-like protein kinase ANXUR1     244   3e-68    
dbj|BAK06468.1|  predicted protein                                      244   4e-68    
ref|NP_198715.1|  putative receptor-like protein kinase                 244   4e-68    
gb|AAM10331.1|  AT5g38990/K15E6_170                                     244   5e-68    
ref|XP_006354974.1|  PREDICTED: receptor-like protein kinase FERO...    246   5e-68    
ref|XP_003543886.1|  PREDICTED: receptor-like protein kinase FERO...    244   6e-68    
gb|KHN07112.1|  Receptor-like protein kinase FERONIA                    243   7e-68    
ref|XP_004495609.1|  PREDICTED: receptor-like protein kinase ANXU...    243   7e-68    
gb|KHN37921.1|  Receptor-like protein kinase FERONIA                    243   9e-68    
gb|KHN07118.1|  Receptor-like protein kinase FERONIA                    243   1e-67    
gb|KHN07116.1|  Receptor-like protein kinase FERONIA                    243   1e-67    
gb|KHN07117.1|  Receptor-like protein kinase FERONIA                    242   1e-67    
ref|XP_006354973.1|  PREDICTED: receptor-like protein kinase FERO...    244   1e-67    
gb|EMT04378.1|  Receptor-like protein kinase FERONIA                    242   2e-67    
ref|XP_003518179.1|  PREDICTED: receptor-like protein kinase FERO...    241   2e-67    
ref|XP_006338348.1|  PREDICTED: receptor-like protein kinase FERO...    242   2e-67    
ref|XP_007144836.1|  hypothetical protein PHAVU_007G188300g             241   2e-67    
ref|XP_006388339.1|  Pto-like kinase OGw family protein                 241   4e-67    
ref|XP_003552594.2|  PREDICTED: receptor-like protein kinase FERO...    241   4e-67    
ref|XP_003552590.2|  PREDICTED: receptor-like protein kinase FERO...    241   4e-67    
ref|XP_010315551.1|  PREDICTED: receptor-like protein kinase FERONIA    242   5e-67    
ref|XP_007151352.1|  hypothetical protein PHAVU_004G039200g             239   6e-67    
ref|XP_010102280.1|  Receptor-like protein kinase                       240   7e-67    
gb|KHN04378.1|  Receptor-like protein kinase FERONIA                    240   1e-66    
ref|XP_012078068.1|  PREDICTED: receptor-like protein kinase FERONIA    240   1e-66    
ref|XP_010450843.1|  PREDICTED: putative receptor-like protein ki...    240   1e-66    
gb|EPS72507.1|  hypothetical protein M569_02249                         239   1e-66    
ref|XP_011099165.1|  PREDICTED: receptor-like protein kinase FERONIA    241   1e-66    
ref|XP_010034426.1|  PREDICTED: receptor-like protein kinase FERONIA    239   2e-66    
ref|XP_003531868.1|  PREDICTED: receptor-like protein kinase FERO...    239   2e-66    
ref|XP_002870808.1|  hypothetical protein ARALYDRAFT_916421             239   2e-66    
gb|KHN07113.1|  Receptor-like protein kinase FERONIA                    238   2e-66    
ref|XP_006602953.1|  PREDICTED: receptor-like protein kinase FERO...    239   3e-66    



>ref|XP_004246282.1| PREDICTED: receptor-like protein kinase FERONIA [Solanum lycopersicum]
Length=889

 Score =   518 bits (1333),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 244/335 (73%), Positives = 281/335 (84%), Gaps = 1/335 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +YVP D ILLNCGGPD + D D RKW TDVGSK++LG+ KSS S A  QKPSVPQVPFM+
Sbjct  29    NYVPGDDILLNCGGPDNLPDADGRKWGTDVGSKYMLGS-KSSISDAADQKPSVPQVPFMS  87

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR FQSEFTYSFPVASGRKF+RLYFYP+SYN LNATN++F V  G+YTLL+NFSA QT E
Sbjct  88    ARVFQSEFTYSFPVASGRKFVRLYFYPSSYNKLNATNAIFDVASGQYTLLRNFSAAQTAE  147

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+D+L KEFS+NVP ETLN+TFTPSPN+ NS AFVNGIE++SHPDIYNT DG+T IVG
Sbjct  148   ALNYDYLTKEFSINVPSETLNITFTPSPNTSNSFAFVNGIEIISHPDIYNTEDGNTFIVG  207

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q SP  IDNSTALE++YR+NVGGNVISPS DTGMFRSW +DS YIF A TGVT TADD N
Sbjct  208   QKSPFIIDNSTALENVYRLNVGGNVISPSGDTGMFRSWGDDSNYIFGAATGVTNTADDEN  267

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +TI+Y  G PTY+AP++VYKT RSMGP   +N  +NL+W F VDSGF YLVRLHFCE T 
Sbjct  268   VTITYGNGQPTYIAPLDVYKTARSMGPTFQINQQFNLSWVFSVDSGFSYLVRLHFCEITR  327

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT++N+RVFIIY+NNQTAEP AD IAWA  NG+P
Sbjct  328   NITKVNQRVFIIYMNNQTAEPAADVIAWADGNGIP  362



>ref|XP_006341293.1| PREDICTED: receptor-like protein kinase FERONIA-like [Solanum 
tuberosum]
Length=889

 Score =   515 bits (1327),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 244/335 (73%), Positives = 281/335 (84%), Gaps = 1/335 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +YVP D ILLNCGGPD + D D RKW TD+GSK++LG+ KSSTS A  QKPSVPQVPFM+
Sbjct  29    NYVPGDDILLNCGGPDNLPDADGRKWGTDIGSKYMLGS-KSSTSDAADQKPSVPQVPFMS  87

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR FQSEFTYSFPVASGRKF+RLYFYP+SYN LNATN++F+V  G+YTLL+NFSA QT E
Sbjct  88    ARVFQSEFTYSFPVASGRKFVRLYFYPSSYNKLNATNAIFNVASGQYTLLRNFSAAQTAE  147

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+D+L KEFS+NVP ETLN+TFTPSPN+ NS AFVNGIE++SHPDIYNT DG+T IVG
Sbjct  148   ALNYDYLTKEFSINVPSETLNITFTPSPNTSNSFAFVNGIEIISHPDIYNTEDGNTFIVG  207

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q S   I NSTALE++YR+NVGGNVISPS DTGMFRSW +DS YIF A TGVT TADD N
Sbjct  208   QKSSFIIGNSTALENVYRLNVGGNVISPSGDTGMFRSWGDDSNYIFGAATGVTNTADDEN  267

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +TISY  G PTYVAP++VYKT R MGP   +N  +NL+W F VDSGF YLVRLHFCE T 
Sbjct  268   VTISYGNGQPTYVAPLDVYKTARLMGPTFQINEQFNLSWVFSVDSGFSYLVRLHFCEITK  327

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT++N+RVF+IY+NNQTAEP AD IAWAG NGVP
Sbjct  328   NITKVNQRVFVIYMNNQTAEPAADVIAWAGGNGVP  362



>ref|XP_009617447.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana tomentosiformis]
Length=888

 Score =   513 bits (1320),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 239/332 (72%), Positives = 279/332 (84%), Gaps = 1/332 (0%)
 Frame = +3

Query  360   PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTART  539
             P D ILLNCGGPDG+ D D RKW +D+GS +L G+ KSSTS A  QKPSVPQVPFM+AR 
Sbjct  32    PGDDILLNCGGPDGLKDADGRKWGSDIGSTYLKGS-KSSTSDAADQKPSVPQVPFMSARV  90

Query  540   FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  719
             FQSEFTYSFPVA GRKF+RLYFYP+SYN LNATN++F V VG Y+LL+NFSA QT EALN
Sbjct  91    FQSEFTYSFPVAPGRKFVRLYFYPSSYNKLNATNAIFGVTVGPYSLLRNFSAAQTAEALN  150

Query  720   FDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNS  899
             +D+L KEFS+NVP ETLN+TFTPSPN+ NS AFVNGIE++SHPDIYNT DG+T IVGQ +
Sbjct  151   YDYLTKEFSINVPSETLNMTFTPSPNTSNSFAFVNGIEIISHPDIYNTEDGTTFIVGQTA  210

Query  900   PLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTI  1079
                IDNSTALE++YR+NVGGNVISPS+DTGMFRSW +DS+YIF A  GVT+TADD N+T+
Sbjct  211   AFIIDNSTALENVYRLNVGGNVISPSADTGMFRSWSDDSQYIFGAANGVTDTADDENVTV  270

Query  1080  SYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIIT  1259
             SYP G  + +AP++VYKT RSMGP A +N  YNLTW+F VDSGF YLVRLHFCE T  IT
Sbjct  271   SYPAGARSDIAPLDVYKTARSMGPTAQINLQYNLTWFFSVDSGFSYLVRLHFCEITMNIT  330

Query  1260  EINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             E+N+RVF+IY+NNQTAEP AD IAW G NGVP
Sbjct  331   EVNQRVFVIYMNNQTAEPAADVIAWVGSNGVP  362



>ref|XP_009791682.1| PREDICTED: receptor-like protein kinase FERONIA [Nicotiana sylvestris]
Length=888

 Score =   511 bits (1315),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 239/333 (72%), Positives = 279/333 (84%), Gaps = 1/333 (0%)
 Frame = +3

Query  357   VPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTAR  536
              P D ILLNCGGPDG+ D D RKW +D+GS +L G+ KSSTS A  QKPSVPQVPFM+AR
Sbjct  31    APGDDILLNCGGPDGLKDADGRKWGSDIGSTYLKGS-KSSTSDAADQKPSVPQVPFMSAR  89

Query  537   TFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  716
              F+SEFTYSFPVA GRKF+RLYFYP+SYN LNATN++FSV VG Y+LL+NFSA QT EAL
Sbjct  90    VFESEFTYSFPVAPGRKFVRLYFYPSSYNKLNATNAIFSVTVGPYSLLRNFSAAQTAEAL  149

Query  717   NFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQN  896
             N+D+L KEFS+NVP ETLN+TFTPSPN+ NS AFVNGIE++SH DIYNT DG+T IVGQ 
Sbjct  150   NYDYLTKEFSINVPSETLNMTFTPSPNTSNSFAFVNGIEIISHRDIYNTDDGTTFIVGQT  209

Query  897   SPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMT  1076
             +   IDNSTALE++YR+NVGGNVISPS+DTGMFRSW +DS+YIF A  GVT+TADD N+T
Sbjct  210   AAFIIDNSTALENVYRLNVGGNVISPSADTGMFRSWSDDSQYIFGAANGVTDTADDENLT  269

Query  1077  ISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTII  1256
             +SYP G P+ +AP++VYKT RSMGP A +N  YNLTW F VDSGF YLVRLHFCE T  I
Sbjct  270   VSYPEGTPSDIAPLDVYKTARSMGPTAQINLQYNLTWVFSVDSGFSYLVRLHFCEITKNI  329

Query  1257  TEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             T+IN+RVF+IY+NNQTAEP AD IAW G NGVP
Sbjct  330   TKINQRVFVIYMNNQTAEPAADVIAWTGSNGVP  362



>ref|XP_011095158.1| PREDICTED: receptor-like protein kinase FERONIA [Sesamum indicum]
Length=883

 Score =   506 bits (1302),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 243/335 (73%), Positives = 282/335 (84%), Gaps = 2/335 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DYVPTDKI LNCGGP   TD D RKWT+D+GSKF L T KSST++A  QKPSVP+VP+MT
Sbjct  29    DYVPTDKIFLNCGGPPDSTDSDGRKWTSDIGSKFALSTTKSSTATAAIQKPSVPEVPYMT  88

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR FQSEFTYSFPVASGRKF+RLYFYPASYNGLNA+N++FSV  G YTLL+NFSA  TTE
Sbjct  89    ARIFQSEFTYSFPVASGRKFVRLYFYPASYNGLNASNAIFSVTSGAYTLLRNFSAALTTE  148

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+D+++KEFSVNVP E LNVTF PS N+ NS AFVNGIEVVSHPDIY+T DG+ ++VG
Sbjct  149   ALNYDYIMKEFSVNVPSEVLNVTFIPSQNASNSYAFVNGIEVVSHPDIYST-DGTEIVVG  207

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q++  NIDN TALE++YR+NVGGN ISPS DTG+FRSW +DS YIFSA  GVTE  D  N
Sbjct  208   QSTGFNIDNRTALENVYRLNVGGNDISPSGDTGLFRSWRDDSNYIFSAANGVTEVPDP-N  266

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +T+ +PPG P+YVAP++VY TLRSMGPNASVN N+NLTW F +DSGF YLVRLHFCE T 
Sbjct  267   VTVGFPPGSPSYVAPLDVYSTLRSMGPNASVNQNFNLTWVFNIDSGFSYLVRLHFCEITD  326

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             II ++N+RVF I+LNNQTAE  AD IAWAG NGVP
Sbjct  327   IIYKVNQRVFTIFLNNQTAEQAADVIAWAGTNGVP  361



>ref|XP_009337788.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=893

 Score =   471 bits (1213),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 224/335 (67%), Positives = 270/335 (81%), Gaps = 1/335 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +YVP+DKI LNCGGP   TD D  KWT+DVGSKF  G   S+TS+A +Q P+VP VPFMT
Sbjct  26    NYVPSDKIFLNCGGPPETTDSDGLKWTSDVGSKFASGGNSSTTSAAATQDPAVPDVPFMT  85

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S+FTY FPVASGRKF+RLYFYPASY+GLNA+N+VF+V    YT+LKNFS  QTTE
Sbjct  86    ARVFRSKFTYKFPVASGRKFIRLYFYPASYSGLNASNAVFTVTAQSYTILKNFSVAQTTE  145

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL++ ++ KEFSVNV GETL+V+F PS    N+ AFVNGIE+VS PDIY+  DG+TMIVG
Sbjct  146   ALDYVYITKEFSVNVDGETLDVSFAPSAGVANAFAFVNGIEIVSMPDIYSATDGTTMIVG  205

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q++P  IDN+TALE++YR+NVGGN ISP  DTG+FRSW +D++Y+  A  GVTETAD  N
Sbjct  206   QSAPFYIDNTTALENVYRLNVGGNDISPPDDTGLFRSWYDDTQYLLGAAFGVTETADP-N  264

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTISYP  MPTYVAP +VY T RSMGPNA +N NYNLTW F +DSGF YLVRLHFCE   
Sbjct  265   MTISYPTSMPTYVAPQDVYSTARSMGPNARINLNYNLTWIFSIDSGFSYLVRLHFCEVAQ  324

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT++N+RVF I+LNNQTA+ GAD +AWAG NG+P
Sbjct  325   NITKVNQRVFDIFLNNQTAQSGADVVAWAGGNGIP  359



>ref|XP_009370899.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
 ref|XP_009370904.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=892

 Score =   467 bits (1201),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 223/335 (67%), Positives = 266/335 (79%), Gaps = 1/335 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +YVP+DKI LNCGGP   TD +  KWT+DVGSKF  G   S+TS A +Q P+VP+VPFMT
Sbjct  26    NYVPSDKIFLNCGGPAETTDSNGVKWTSDVGSKFASGGNSSTTSPAATQDPAVPEVPFMT  85

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S+FTY FPVASGRKF+RLYFYPASY GLNA+N+VF+V    YT+LKNFS  QTTE
Sbjct  86    ARVFRSQFTYKFPVASGRKFIRLYFYPASYAGLNASNAVFTVAAQSYTILKNFSVAQTTE  145

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL++ F+ KEF VNV GETL V+FTPS    N+ AFVNGIE+VS PDIY+  DG+TMIVG
Sbjct  146   ALDYVFITKEFIVNVEGETLAVSFTPSSRVANAFAFVNGIEIVSMPDIYSATDGTTMIVG  205

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q++P  IDNSTALE++YR+NVGGN ISP  DTG+FRSW +D++Y+  A  GV ETAD  N
Sbjct  206   QSTPFYIDNSTALENVYRINVGGNDISPPDDTGLFRSWYDDTQYLLGAAYGVPETADP-N  264

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTISYPPGMPTY+AP +VY T RSMGPN  +N NYNLTW F +DSGF YLVRLHFCE   
Sbjct  265   MTISYPPGMPTYIAPEDVYSTARSMGPNQRINLNYNLTWIFSIDSGFSYLVRLHFCEVAQ  324

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT++N+RVF I+LNNQTA  GAD +AWA  NG+P
Sbjct  325   NITKVNQRVFDIFLNNQTAMAGADVVAWAQGNGIP  359



>ref|XP_010431249.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=490

 Score =   451 bits (1160),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 223/336 (66%), Positives = 261/336 (78%), Gaps = 2/336 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFM  527
             DY PT+KILLNCGG   + D DNR W +DV SKFL   +G S TS A +Q PSVP+VP+M
Sbjct  29    DYSPTEKILLNCGGASDLVDTDNRTWISDVKSKFLSSPSGDSKTSPALTQDPSVPEVPYM  88

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F+S FTY+FPVASGRKF+RLYFYP SY+ LNATNS+FSV  G YTLLKNFSA QT 
Sbjct  89    TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDSLNATNSLFSVSSGPYTLLKNFSAAQTA  148

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
             EAL + F+VKEF VNV G TLN+TFTP  +  N+ AFVNGIEV S PDIY++ DG+  +V
Sbjct  149   EALTYAFIVKEFVVNVEGGTLNMTFTPETSPANAYAFVNGIEVTSMPDIYSSTDGTLSMV  208

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             G +  + IDNSTALE++YR+NVGGN ISPS+DTG+FRSW +D  YIF AG G+ ETAD  
Sbjct  209   GSSGAVTIDNSTALENVYRLNVGGNDISPSADTGLFRSWYDDQPYIFGAGLGIPETADP-  267

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             NMTI YP G PTYVAPV+VY T RSMGP A +N NYNLTW F +DSGF YLVRLHFCE +
Sbjct  268   NMTIKYPTGTPTYVAPVDVYSTARSMGPTAQINQNYNLTWIFSIDSGFSYLVRLHFCEVS  327

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
               IT+IN+RVF+IYLNNQTAEP AD   W   NG+P
Sbjct  328   PNITKINQRVFVIYLNNQTAEPEADVAGWTSGNGIP  363



>ref|XP_007208402.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
 gb|EMJ09601.1| hypothetical protein PRUPE_ppa001164mg [Prunus persica]
Length=891

 Score =   458 bits (1179),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 219/335 (65%), Positives = 264/335 (79%), Gaps = 3/335 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +Y+P+DKI LNCGGP   TD +  KWT+D+GSKF  G   S+TS A +Q P+VP+VPFMT
Sbjct  28    NYIPSDKIFLNCGGPPETTDSNGLKWTSDIGSKFASG-ANSTTSPAATQDPAVPEVPFMT  86

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+SE+TY FPVASGRKF+RLYFYPASY GLNA+N++F+V    YTLLKNFS  QTTE
Sbjct  87    ARVFRSEYTYKFPVASGRKFIRLYFYPASYAGLNASNAIFTVTAQSYTLLKNFSVAQTTE  146

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL++ F+ KEFSVNV GETLN++F PS +  N+ AFVNGIE+VS PDIY  ADG TMIVG
Sbjct  147   ALDYVFITKEFSVNVEGETLNISFAPSSSIANAYAFVNGIEIVSMPDIYGAADG-TMIVG  205

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q+SP  IDNSTALE++YR+NVGG  ISP  DTG+FRSW +D++Y+  A  GV ETAD  N
Sbjct  206   QSSPFFIDNSTALENVYRINVGGKDISPPGDTGLFRSWYDDTQYLLGAAFGVPETADP-N  264

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MT+ YP  MPTY+AP +VY T RSMGPNA +N NYNLTW F +DSGF YLVRLHFCE   
Sbjct  265   MTVKYPKNMPTYIAPEDVYTTARSMGPNAKINLNYNLTWIFSIDSGFSYLVRLHFCEVAQ  324

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             I T++N+RVF I+LNNQTAE   D +AWAG NG+P
Sbjct  325   IFTKVNQRVFDIFLNNQTAESAVDVVAWAGGNGIP  359



>gb|EPS73118.1| hypothetical protein M569_01631 [Genlisea aurea]
Length=873

 Score =   457 bits (1177),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 226/336 (67%), Positives = 269/336 (80%), Gaps = 3/336 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSS-TSSADSQKPSVPQVPFM  527
             +YVPTDKI LNCGGP   TD DN+ WTTDV SKFL     +S T+SA  Q P VPQVP+M
Sbjct  27    NYVPTDKIFLNCGGPAVSTDSDNQTWTTDVLSKFLSSPSTNSLTASASVQLPDVPQVPYM  86

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F+SEFTYSFP+A+GRKFLRLYFYPASY GLNA+N +FSV  G YTLL NFSA  TT
Sbjct  87    TARIFKSEFTYSFPLAAGRKFLRLYFYPASYAGLNASNGIFSVSSGGYTLLNNFSAFITT  146

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
             +ALNFD++VKE+S+NVP + LNVTFTP+  S +S AF+NGIEVVSHPDIY ++DG+  +V
Sbjct  147   QALNFDYVVKEYSLNVPSKVLNVTFTPNA-SASSYAFINGIEVVSHPDIY-SSDGAITVV  204

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             GQ +   IDNST LE++YR+NVGG  ISPS DTGMFRSW++D  YIFSA  G+TE+ D  
Sbjct  205   GQPTGFVIDNSTVLENVYRLNVGGQAISPSDDTGMFRSWNDDLPYIFSAAIGITESLDPS  264

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
              + IS+P G P+YVAP  VY TLRSMGPN+SVN N+NLTW F +D+GF YLVRLHFCE T
Sbjct  265   VLNISFPSGSPSYVAPFNVYATLRSMGPNSSVNVNFNLTWVFDIDTGFSYLVRLHFCEVT  324

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             T I+++N+RVF I+LNNQTAEP AD IAWAG NGVP
Sbjct  325   TYISKVNQRVFTIFLNNQTAEPAADVIAWAGSNGVP  360



>ref|XP_008370279.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=891

 Score =   457 bits (1177),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 220/335 (66%), Positives = 261/335 (78%), Gaps = 1/335 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +YVP+DKI LNCGGP   TD    KWT+DVGSKF  G   S+TS A +Q P+VP+VPFMT
Sbjct  26    NYVPSDKIFLNCGGPAETTDSXGVKWTSDVGSKFASGGNSSTTSPAATQDPAVPEVPFMT  85

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S+FTY FPVASGRKF+RLYFYPASY  LNA+N+VF+V    YT+LKNFS  QTTE
Sbjct  86    ARVFRSQFTYKFPVASGRKFIRLYFYPASYAELNASNAVFTVTAQSYTILKNFSVAQTTE  145

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL++ F+ KEF VNV GETL V+FTPS    N+ AFVNGIE+VS PDIY+  DG+TMIVG
Sbjct  146   ALDYVFITKEFIVNVEGETLAVSFTPSSXVANAFAFVNGIEIVSMPDIYSATDGTTMIVG  205

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q++P  IDNSTALE++YR+NVGGN ISP  DTG+FRSW +D++Y+  A  G  ET D  N
Sbjct  206   QSTPFYIDNSTALENVYRINVGGNDISPPKDTGLFRSWYDDTQYLLGAAXGAPETXDP-N  264

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTISYP GMPTY+AP +VY T RSMGP+  +N NYNLTW F +DSGF YLVRLHFCE   
Sbjct  265   MTISYPSGMPTYIAPEDVYSTARSMGPDQRINLNYNLTWIFSIDSGFSYLVRLHFCEVAQ  324

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT+IN+RVF I+LN QTA  GAD IAWAG NG+P
Sbjct  325   NITKINQRVFDIFLNKQTAMAGADVIAWAGGNGIP  359



>emb|CDX78012.1| BnaA09g32070D [Brassica napus]
Length=851

 Score =   453 bits (1166),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 219/334 (66%), Positives = 260/334 (78%), Gaps = 1/334 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP VP+M+
Sbjct  30    DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPTVPYMS  89

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTYSFPVASGRKF+RLYFYP SY+GLNATNS+FS+  G YTLLKNFSA QT++
Sbjct  90    ARIFRSPFTYSFPVASGRKFVRLYFYPNSYDGLNATNSLFSLSSGPYTLLKNFSAAQTSQ  149

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ +++KEF VNV G TLN+TFTP     N+ AFVNGIEV S PDIY++ DG+  +VG
Sbjct  150   ALNYAYIIKEFVVNVEGGTLNMTFTPESTPSNAYAFVNGIEVTSMPDIYSSTDGTLTVVG  209

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +S + IDN+TALE++YR+NVGGN ISPS+DTG+FRSW +D  YIF+A  G+ ETAD  N
Sbjct  210   TSSGVTIDNTTALENVYRLNVGGNDISPSADTGLFRSWYDDQDYIFAASLGIPETADP-N  268

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI YP G P+Y+AP +VY T RSMGP   VN NYNLTW F VDSGF YLVRLHFCE ++
Sbjct  269   MTIQYPTGTPSYIAPADVYSTARSMGPTPQVNLNYNLTWVFSVDSGFSYLVRLHFCEVSS  328

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
              I +IN+RVF IYLNNQTAEP AD   W G NG+
Sbjct  329   NINKINQRVFTIYLNNQTAEPAADVAGWTGGNGI  362



>emb|CDP06378.1| unnamed protein product [Coffea canephora]
Length=889

 Score =   454 bits (1167),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 217/334 (65%), Positives = 264/334 (79%), Gaps = 2/334 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +YVPTDKILL+CGGP   TD D RKW +D+GSKF L +  SS   A  QKPSVPQVP+M 
Sbjct  29    NYVPTDKILLSCGGPSQSTDIDGRKWYSDIGSKFALASSNSSVFPAAVQKPSVPQVPYMN  88

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR FQS +TY FPVA GRKF+RLYFYP SY GLNA+N++FSV  G + L+KNFSA QT E
Sbjct  89    ARIFQSNYTYRFPVAPGRKFIRLYFYPTSYGGLNASNAIFSVTAGRFMLMKNFSAAQTAE  148

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+DF+ KEFSVNVP   LN+TF+P+ +  NS AFVNGIEVVSHPDIY +A+G +++ G
Sbjct  149   ALNYDFITKEFSVNVPSGVLNLTFSPASDPGNSYAFVNGIEVVSHPDIY-SAEGPSLLAG  207

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             QN+P +IDN+TALE++YR+NVGGN ISPS+DTG+FRSW  DS YI  +G GVT  AD  N
Sbjct  208   QNAPFSIDNTTALENVYRLNVGGNDISPSNDTGLFRSWIADSNYILGSGFGVTNAADP-N  266

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +TI+YPPG P+YVAP++VY+T R+MGPNA+VN  YNLTW F VD+GF+YLVRLHFCE   
Sbjct  267   VTINYPPGTPSYVAPLDVYRTFRTMGPNANVNLQYNLTWLFSVDTGFYYLVRLHFCEGFE  326

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
              I+ IN+RVF I+LNNQT +  AD IAW   NGV
Sbjct  327   NISLINQRVFDIFLNNQTVQKAADVIAWGNTNGV  360



>ref|XP_009115840.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
 ref|XP_009115841.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=895

 Score =   454 bits (1167),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 219/334 (66%), Positives = 260/334 (78%), Gaps = 1/334 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP VP+M+
Sbjct  30    DYTPTDKILLNCGGSSDLTDTDNRTWIQDVKSKFLSSSGDSKTSPAATQDPSVPTVPYMS  89

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTYSFPVASGRKF+RLYFYP SY+GLNATNS+FS+  G YTLLKNFSA QT++
Sbjct  90    ARIFRSPFTYSFPVASGRKFVRLYFYPNSYDGLNATNSLFSLSSGPYTLLKNFSAAQTSQ  149

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ +++KEF VNV G TLN+TFTP     N+ AFVNGIEV S PDIY++ DG+  +VG
Sbjct  150   ALNYAYIIKEFVVNVEGGTLNMTFTPESTPSNAYAFVNGIEVTSMPDIYSSTDGTLTVVG  209

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +S + IDN+TALE++YR+NVGGN ISPS+DTG+FRSW +D  YIF+A  G+ ETAD  N
Sbjct  210   TSSGVTIDNTTALENVYRLNVGGNDISPSADTGLFRSWYDDQDYIFAASLGIPETADP-N  268

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI YP G P+Y+AP +VY T RSMGP   VN NYNLTW F VDSGF YLVRLHFCE ++
Sbjct  269   MTIQYPTGTPSYIAPADVYSTARSMGPTPQVNLNYNLTWVFSVDSGFSYLVRLHFCEVSS  328

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
              I +IN+RVF IYLNNQTAEP AD   W G NG+
Sbjct  329   NINKINQRVFTIYLNNQTAEPAADVAGWTGGNGI  362



>ref|XP_006403905.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
 gb|ESQ45358.1| hypothetical protein EUTSA_v10010114mg [Eutrema salsugineum]
Length=891

 Score =   454 bits (1167),  Expect = 5e-147, Method: Compositional matrix adjust.
 Identities = 224/335 (67%), Positives = 261/335 (78%), Gaps = 3/335 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY PTDKILLNCGG     D DNR W  DV SKFL  +G S TS A +Q PSVP+VPFMT
Sbjct  30    DYTPTDKILLNCGGSSDSADTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPEVPFMT  89

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTY+FPVA+GRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFSA QT +
Sbjct  90    ARIFRSPFTYTFPVAAGRKFVRLYFYPNSYDGLNATNSLFSVSSGSYTLLKNFSASQTAQ  149

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL + F+VKEF VNV G  LN+TFTP  ++PN+ AFVNGIEV S PD+Y++ DGS ++VG
Sbjct  150   ALTYAFIVKEFIVNVEGGALNMTFTPE-STPNAYAFVNGIEVTSMPDLYSSTDGSLLVVG  208

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +  + IDNSTALE++YR+NVGGN ISPS+DTG++RSW +D  YIF A  G+ ETAD  N
Sbjct  209   SSGSVTIDNSTALENVYRLNVGGNDISPSADTGLYRSWYDDQPYIFGAALGIPETADP-N  267

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI YP G PTYVAPV+VY T RSMGP A +N NYNLTW F VDSGF YLVRLHFCE + 
Sbjct  268   MTIKYPTGTPTYVAPVDVYSTARSMGPTAEININYNLTWIFSVDSGFSYLVRLHFCEVSA  327

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAW-AGKNGV  1352
              IT+IN+R FIIYLNNQTAEP AD  AW  G NG+
Sbjct  328   NITKINQRAFIIYLNNQTAEPEADVAAWTGGGNGI  362



>ref|XP_010426729.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=894

 Score =   453 bits (1165),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 223/336 (66%), Positives = 261/336 (78%), Gaps = 2/336 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFM  527
             DY PT+KILLNCGG   + D DNR W +DV SKFL   +G S TS A +Q PSVP+VP+M
Sbjct  29    DYSPTEKILLNCGGASDLVDTDNRTWISDVKSKFLSSPSGDSKTSPALTQDPSVPEVPYM  88

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F+S FTY+FPVASGRKF+RLYFYP SY+ LNATNS+FSV  G YTLLKNFSA QT 
Sbjct  89    TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDSLNATNSLFSVSSGPYTLLKNFSAAQTA  148

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
             EAL + F+VKEF VNV G TLN+TFTP  +  N+ AFVNGIEV S PDIY++ DG+  +V
Sbjct  149   EALTYAFIVKEFVVNVEGGTLNMTFTPETSPANAYAFVNGIEVTSMPDIYSSTDGTLSMV  208

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             G +  + IDNSTALE++YR+NVGGN ISPS+DTG+FRSW +D  YIF AG G+ ETAD  
Sbjct  209   GSSGAVTIDNSTALENVYRLNVGGNDISPSADTGLFRSWYDDQPYIFGAGLGIPETADP-  267

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             NMTI YP G PTYVAPV+VY T RSMGP A +N NYNLTW F +DSGF YLVRLHFCE +
Sbjct  268   NMTIKYPTGTPTYVAPVDVYSTARSMGPTAQINQNYNLTWIFSIDSGFSYLVRLHFCEVS  327

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
               IT+IN+RVF+IYLNNQTAEP AD   W   NG+P
Sbjct  328   PNITKINQRVFVIYLNNQTAEPEADVAGWTSGNGIP  363



>gb|ABT18097.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score =   452 bits (1164),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 223/335 (67%), Positives = 263/335 (79%), Gaps = 4/335 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY PTDKILLNCGG   + D DNR W +DV SKFL  +G S TS A +Q PSV QVP+MT
Sbjct  30    DYSPTDKILLNCGGVSDLVDTDNRTWISDVKSKFLSSSGDSKTSPAATQDPSVSQVPYMT  89

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTYSFPVA+GRKF+RLYFYP +Y+GLNATN++FSV  G YTLLKNFSA QT E
Sbjct  90    ARVFRSPFTYSFPVAAGRKFVRLYFYPNTYDGLNATNALFSVSFGPYTLLKNFSAAQTAE  149

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL +  +VKEF VNV G +LN+TFTP     N+ AF+NGIEV S PDIY++ DGS ++VG
Sbjct  150   ALTYAVIVKEFIVNVEGGSLNMTFTP---ESNAYAFMNGIEVTSMPDIYSSTDGSLIMVG  206

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +S   IDNSTALE+++R+NVGGN ISPS+DTG++RSW +D  YIF+AG G+ ETAD  N
Sbjct  207   ASSDFTIDNSTALENVFRLNVGGNDISPSADTGLYRSWYDDQPYIFAAGLGIPETADP-N  265

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI YP G PTYVAPV+VY T RSMGP AS+N NYNLTW F +DSGF YLVRLHFCE + 
Sbjct  266   MTIQYPTGTPTYVAPVDVYSTARSMGPTASININYNLTWVFSIDSGFSYLVRLHFCEVSP  325

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT+IN+RVF IYLNNQTAE  AD IAWA  NG+P
Sbjct  326   RITKINQRVFTIYLNNQTAEEEADVIAWAQGNGIP  360



>gb|ABT18095.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=891

 Score =   451 bits (1160),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 222/335 (66%), Positives = 262/335 (78%), Gaps = 4/335 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY PTDKILLNCGG   + D DNR W +DV SKFL  +G S TS A +Q PSV QVP+MT
Sbjct  30    DYSPTDKILLNCGGASDLVDTDNRTWISDVKSKFLSSSGDSKTSPAATQDPSVSQVPYMT  89

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTY FPVA+GRKF+RLYFYP +Y+GLNATN++FSV  G YTLLKNFSA QT E
Sbjct  90    ARVFRSPFTYPFPVAAGRKFVRLYFYPNTYDGLNATNALFSVSFGPYTLLKNFSAAQTAE  149

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL +  +VKEF VNV G +LN+TFTP     N+ AF+NGIEV S PDIY++ DGS ++VG
Sbjct  150   ALTYAVIVKEFIVNVEGGSLNMTFTP---ESNAYAFMNGIEVTSMPDIYSSTDGSLIMVG  206

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +S   IDNSTALE+++R+NVGGN ISPS+DTG++RSW +D  YIF+AG G+ ETAD  N
Sbjct  207   ASSDFTIDNSTALENVFRLNVGGNDISPSADTGLYRSWYDDQPYIFAAGLGIPETADP-N  265

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI YP G PTYVAPV+VY T RSMGP AS+N NYNLTW F +DSGF YLVRLHFCE + 
Sbjct  266   MTIQYPTGTPTYVAPVDVYSTARSMGPTASININYNLTWVFSIDSGFSYLVRLHFCEVSP  325

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT+IN+RVF IYLNNQTAE  AD IAWA  NG+P
Sbjct  326   RITKINQRVFTIYLNNQTAEEEADVIAWAQGNGIP  360



>ref|XP_010515573.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=896

 Score =   450 bits (1158),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 223/335 (67%), Positives = 259/335 (77%), Gaps = 2/335 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFM  527
             DY PT+KILLNCGG   + D D R W  DV SKFL   +G S TS A +Q PSVP+VP+M
Sbjct  31    DYSPTEKILLNCGGASDLDDADKRTWIPDVKSKFLSSPSGDSKTSPALTQDPSVPEVPYM  90

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFSA QT 
Sbjct  91    TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSSGPYTLLKNFSAAQTA  150

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
             EAL + F+VKEF VNV G TLN+TFTP  +  N+ AFVNGIEV S PDIY++ DG+  +V
Sbjct  151   EALTYAFIVKEFVVNVEGGTLNMTFTPETSPANAYAFVNGIEVTSMPDIYSSTDGTLSMV  210

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             G +  + IDNSTALE++YR+NVGGN ISPS+DTG+FRSW +D  YIF AG G+ ETAD  
Sbjct  211   GSSGAVTIDNSTALENVYRLNVGGNDISPSADTGLFRSWYDDQPYIFGAGLGIPETADP-  269

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             NMTI YP G PTYVAPV+VY T RSMGP A +N NYNLTW F +DSGF YLVRLHFCE +
Sbjct  270   NMTIKYPTGTPTYVAPVDVYSTARSMGPTAQINQNYNLTWIFSIDSGFSYLVRLHFCEVS  329

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
               IT+IN+RVFIIYLNNQTAEP AD   W   NG+
Sbjct  330   PNITKINQRVFIIYLNNQTAEPEADVAGWTSGNGI  364



>ref|XP_008244701.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=891

 Score =   449 bits (1154),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 218/335 (65%), Positives = 263/335 (79%), Gaps = 3/335 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +Y+P+DKI LNCGGP   TD D  KWT+D+GSKF  G   S+TS A +Q P+VP+VPFMT
Sbjct  28    NYIPSDKIFLNCGGPPETTDSDGLKWTSDIGSKFASG-ANSTTSPAATQDPAVPEVPFMT  86

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+SE+TY FPVASGRKF+RLYFYPASY GLNA+N++F+V    YTLLKNFS  QTTE
Sbjct  87    ARVFRSEYTYKFPVASGRKFIRLYFYPASYAGLNASNAIFTVTAQSYTLLKNFSVAQTTE  146

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL++ F+ KEFSVNV GETL+++F PS +  N+ AFVNGIE+VS PDIY+  DG TMIVG
Sbjct  147   ALDYVFVTKEFSVNVEGETLDISFAPSSSVANAYAFVNGIEIVSMPDIYSAPDG-TMIVG  205

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q+S   IDNSTALE++YR+NVGG  ISP  DTG+FRSW +D++Y+  A  GV ETAD  N
Sbjct  206   QSSTFFIDNSTALENVYRINVGGKDISPPGDTGLFRSWYDDTQYLLGAAFGVPETADP-N  264

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MT+ YP  MPTYVAP +VY T RSMGPNA++N NYNLTW F +DSGF YLVRLHFCE   
Sbjct  265   MTVKYPKSMPTYVAPEDVYTTARSMGPNANINLNYNLTWIFSIDSGFSYLVRLHFCEVAQ  324

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             IIT+ N+RVF I+LNNQTAE G D +  AG NG+P
Sbjct  325   IITKENQRVFNIFLNNQTAESGVDVVTLAGGNGIP  359



>ref|XP_010503851.1| PREDICTED: receptor-like protein kinase FERONIA [Camelina sativa]
Length=895

 Score =   449 bits (1154),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 222/335 (66%), Positives = 260/335 (78%), Gaps = 2/335 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFM  527
             DY PT+KILLNCGG   + D D R W  DV SKFL   +G S TS A +Q PSVP+VP+M
Sbjct  30    DYSPTEKILLNCGGASDLEDTDKRTWIPDVKSKFLSSPSGDSKTSPALTQDPSVPEVPYM  89

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFSA QT 
Sbjct  90    TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSSGPYTLLKNFSAAQTA  149

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
             EAL + F+VKEF V+V G TLN+TFTP  +  N+ AFVNGIEV S PDIY++ DG+  +V
Sbjct  150   EALTYAFIVKEFVVHVEGGTLNMTFTPETSPANAYAFVNGIEVTSMPDIYSSTDGTLSMV  209

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             G ++ + IDNSTALE++YR+NVGGN ISPS+DTG+FRSW +D  YIF AG G+ ETAD  
Sbjct  210   GTSTSVTIDNSTALENVYRLNVGGNDISPSADTGLFRSWYDDQPYIFGAGLGIPETADP-  268

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             NMTI YP G PTYVAPV+VY T RSMGP A +N NYNLTW F +DSGF YLVRLHFCE +
Sbjct  269   NMTIKYPTGTPTYVAPVDVYSTARSMGPTAQINQNYNLTWIFSIDSGFSYLVRLHFCEVS  328

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
               IT+IN+RVFIIYLNNQTAEP AD   W   NG+
Sbjct  329   PNITKINQRVFIIYLNNQTAEPEADVAGWTSGNGI  363



>emb|CDY33271.1| BnaA01g19380D [Brassica napus]
Length=856

 Score =   445 bits (1144),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 217/335 (65%), Positives = 252/335 (75%), Gaps = 1/335 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY PTD  LLNCGG   + D DNR W  DV SKFL  +  S TS A +Q PSVP VP+MT
Sbjct  27    DYSPTDNFLLNCGGSSDLPDTDNRTWIPDVKSKFLSSSADSKTSPAATQDPSVPDVPYMT  86

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTYSFPV+SGRKF+RL+FYP SY+GLNATNS+FSV +G YTLLKNFSA Q  +
Sbjct  87    ARIFRSPFTYSFPVSSGRKFVRLHFYPNSYDGLNATNSLFSVSLGSYTLLKNFSAAQMAQ  146

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL F F+VKEF VNV G  LNVTFTP     N+ A+VNGIEV S PD+Y++ DGS  +VG
Sbjct  147   ALTFSFIVKEFIVNVEGGALNVTFTPESTPSNAYAYVNGIEVTSMPDLYSSTDGSLTVVG  206

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +  + IDNSTALE++YR+NVGGN ISPS DTG++RSW +D  YIF AG G+TETAD  N
Sbjct  207   SSGGVTIDNSTALENVYRLNVGGNDISPSDDTGLYRSWYDDQPYIFGAGLGITETADP-N  265

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI YP G PTYVAPV+VY T RSMGP   +N NYNLTW F +DSGF YLVRLHFCE   
Sbjct  266   MTIEYPSGTPTYVAPVDVYSTARSMGPTPQINLNYNLTWIFSIDSGFSYLVRLHFCEVAP  325

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT+IN+RVF +YLNNQTAEP AD   W G  G+P
Sbjct  326   NITKINQRVFTVYLNNQTAEPEADVAGWTGGQGIP  360



>ref|XP_010043538.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 ref|XP_010043545.1| PREDICTED: receptor-like protein kinase FERONIA [Eucalyptus grandis]
 gb|KCW88392.1| hypothetical protein EUGRSUZ_A00782 [Eucalyptus grandis]
Length=897

 Score =   445 bits (1145),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 214/335 (64%), Positives = 256/335 (76%), Gaps = 1/335 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY P D+ILL+CG     TD D + WT+++GSK    T  +  ++A +Q PSVPQVP+MT
Sbjct  31    DYKPADRILLDCGAASQTTDADGQVWTSEIGSKIPASTANAIMATAATQDPSVPQVPYMT  90

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR FQS FTYSFPVASGRKF+RLYFYP+ YN  NA+N++FSV    YTLLKNFS  QTTE
Sbjct  91    ARIFQSNFTYSFPVASGRKFVRLYFYPSVYNTYNASNAIFSVSAEGYTLLKNFSVAQTTE  150

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALNF +++KE+SVNV GETLN+TF+PS N   + AFVNGIEV S PDIY+  DGSTMIVG
Sbjct  151   ALNFAYVLKEYSVNVEGETLNITFSPSKNYAGAFAFVNGIEVQSMPDIYSATDGSTMIVG  210

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              N+PL IDN+TALE+ YR+NVGG  ISPS DTG+FRSW +D+ YI+ AG GVTETA   N
Sbjct  211   LNAPLTIDNTTALETAYRLNVGGQDISPSGDTGLFRSWYDDTAYIYGAGIGVTETAGP-N  269

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI YP  MPTYVAPV VY T RSMGPNASVN  YNLTW F VDSGF YL+RLHFCE   
Sbjct  270   MTIHYPSSMPTYVAPVNVYSTARSMGPNASVNLQYNLTWIFSVDSGFNYLIRLHFCEVAD  329

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +IT++N+R+F I++ NQTA+  AD   W   NG+P
Sbjct  330   VITKLNQRMFEIFIGNQTADDQADVAGWTKGNGIP  364



>gb|AHZ44752.1| CrRLK1L-like protein, partial [Platanus x acerifolia]
Length=774

 Score =   441 bits (1135),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 218/335 (65%), Positives = 257/335 (77%), Gaps = 6/335 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             D++P DKILLNCG      D D RKWTTD+GSKF+     S  SSA +Q PSVP VPFMT
Sbjct  71    DFIPGDKILLNCGSAPETVDTDGRKWTTDIGSKFVAAGDNSLASSAATQDPSVPDVPFMT  130

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+SEFTYSFPV SGRKF+RLYFYPASY+ LNA+N++FSV  G YTLL+NFSA QTTE
Sbjct  131   ARIFRSEFTYSFPVVSGRKFVRLYFYPASYDNLNASNAIFSVTSGSYTLLRNFSASQTTE  190

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ F+VKEF +NV  E LNVTF PS N+ N+ AFVNGIEVVS PDIYNT +     VG
Sbjct  191   ALNYAFIVKEFLINVDNERLNVTFKPS-NAANAYAFVNGIEVVSMPDIYNTDN--VYFVG  247

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q+   NIDNS+ALE ++R+NVGGN ISP++DTGMFRSW +DS YIF A  GVT   D  N
Sbjct  248   QSGQFNIDNSSALEKVFRLNVGGNDISPTADTGMFRSWSDDSPYIFGAAFGVT---DITN  304

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +TI Y P MP+Y+AP +VY T R+MGP+ ++N  YNLTW F VDSGFFYLVRLH CE   
Sbjct  305   LTIVYSPDMPSYIAPTDVYATARTMGPDHNINLGYNLTWIFTVDSGFFYLVRLHLCEIQP  364

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT+IN+RVF I++NNQTA  GAD IAWAG NG+P
Sbjct  365   DITKINQRVFDIFINNQTAIAGADVIAWAGGNGIP  399



>gb|ABT18100.1| FERONIA receptor-like kinase [Arabidopsis thaliana]
Length=893

 Score =   445 bits (1144),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 223/337 (66%), Positives = 265/337 (79%), Gaps = 3/337 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPF  524
             DY PT+KILLNCGG    +TD DNR W +DV SKFL  + + S +S A +Q PSVP+VP+
Sbjct  27    DYSPTEKILLNCGGGASNLTDTDNRIWISDVKSKFLSSSSEDSKTSPALTQDPSVPEVPY  86

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFSA QT
Sbjct  87    MTARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYTLLKNFSASQT  146

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMI  884
              EAL + F++KEF VNV G TLN+TFTP  +  N+ AFVNGIEV S PD+Y++ DG+  +
Sbjct  147   AEALTYAFIIKEFVVNVEGGTLNMTFTPESSPSNAYAFVNGIEVTSMPDMYSSTDGTLTM  206

Query  885   VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
             VG +  + IDNSTALE++YR+NVGGN ISPS+DTG++RSW +D  YIF AG G+ ETAD 
Sbjct  207   VGSSGSVTIDNSTALENVYRLNVGGNDISPSADTGLYRSWYDDQPYIFGAGLGIPETADP  266

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              NMTI YP G PTYVAPV+VY T RSMGP A +N NYNLTW F +DSGF YLVRLHFCE 
Sbjct  267   -NMTIKYPTGTPTYVAPVDVYSTARSMGPTAQINLNYNLTWIFSIDSGFTYLVRLHFCEV  325

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             ++ IT+IN+RVF IYLNNQTAEP AD IAW   NGVP
Sbjct  326   SSNITKINQRVFTIYLNNQTAEPEADVIAWTSSNGVP  362



>gb|AAK59558.1| putative receptor-protein kinase [Arabidopsis thaliana]
Length=895

 Score =   444 bits (1143),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 223/337 (66%), Positives = 264/337 (78%), Gaps = 3/337 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPF  524
             DY PT+KILLNCGG    +TD DNR W +DV SKFL  + + S +S A +Q PSVP+VP+
Sbjct  29    DYSPTEKILLNCGGGASNLTDTDNRIWISDVKSKFLSSSSEDSKTSPALTQDPSVPEVPY  88

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFSA QT
Sbjct  89    MTARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYTLLKNFSASQT  148

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMI  884
              EAL + F++KEF VNV G TLN+TFTP     N+ AFVNGIEV S PD+Y++ DG+  +
Sbjct  149   AEALTYAFIIKEFVVNVEGGTLNMTFTPESAPSNAYAFVNGIEVTSMPDMYSSTDGTLTM  208

Query  885   VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
             VG +  + IDNSTALE++YR+NVGGN ISPS+DTG++RSW +D  YIF AG G+ ETAD 
Sbjct  209   VGSSGSVTIDNSTALENVYRLNVGGNDISPSADTGLYRSWYDDQPYIFGAGLGIPETADP  268

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              NMTI YP G PTYVAPV+VY T RSMGP A +N NYNLTW F +DSGF YLVRLHFCE 
Sbjct  269   -NMTIKYPTGTPTYVAPVDVYSTARSMGPTAQINLNYNLTWIFSIDSGFTYLVRLHFCEV  327

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             ++ IT+IN+RVF IYLNNQTAEP AD IAW   NGVP
Sbjct  328   SSNITKINQRVFTIYLNNQTAEPEADVIAWTSSNGVP  364



>emb|CDX73714.1| BnaC08g22890D [Brassica napus]
Length=1176

 Score =   452 bits (1162),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 217/334 (65%), Positives = 258/334 (77%), Gaps = 1/334 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP VP+M+
Sbjct  342   DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPTVPYMS  401

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTYSFPVASGRKF+RLYFYP SY+GLNATNS+FS+  G YTLLKNFSA QT++
Sbjct  402   ARIFRSPFTYSFPVASGRKFVRLYFYPNSYDGLNATNSLFSLSSGPYTLLKNFSAAQTSQ  461

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ +++KEF VNV G TLN+TFTP     N+ AFVNGIEV S PDIY++ DG+  +VG
Sbjct  462   ALNYAYIIKEFVVNVEGGTLNMTFTPESTPSNAYAFVNGIEVTSMPDIYSSTDGTLTVVG  521

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +  + IDN+TALE++YR+NVGGN ISPS+DTG+FRSW +D  YIF+A  G+ ETAD  N
Sbjct  522   TSGGVTIDNTTALENVYRLNVGGNDISPSADTGLFRSWHDDQDYIFAASLGIPETADP-N  580

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI YP G P+++AP +VY T RSMGP A VN NYNLTW F VDSGF YLVRLHFCE + 
Sbjct  581   MTIQYPTGTPSFIAPADVYSTARSMGPTAQVNLNYNLTWVFSVDSGFSYLVRLHFCEVSA  640

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
              I +IN+RVF IYLNNQTAEP AD   W G N +
Sbjct  641   NINKINQRVFTIYLNNQTAEPAADVAGWTGGNRI  674



>emb|CDY16299.1| BnaC01g23340D [Brassica napus]
Length=866

 Score =   443 bits (1140),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 216/335 (64%), Positives = 253/335 (76%), Gaps = 1/335 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY PTD  LLNCGG   + D DNR W  DV SKFL  +  S TS A +Q PSVP VP+MT
Sbjct  31    DYSPTDNFLLNCGGSSDLPDTDNRTWIPDVKSKFLSSSADSKTSPAATQDPSVPDVPYMT  90

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTYSFPVA+GRKF+R +FYP SY+GLNATNS+FSV +G YTLLKNFSA QT +
Sbjct  91    ARIFRSPFTYSFPVAAGRKFVRFHFYPNSYDGLNATNSLFSVSLGSYTLLKNFSAAQTAQ  150

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL F F+VKEF VNV G  LNVTFTP     N+ A+VNGIEV S PD+Y++ DGS  +VG
Sbjct  151   ALTFSFIVKEFIVNVEGGALNVTFTPESAPSNAYAYVNGIEVTSMPDLYSSTDGSLTVVG  210

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +  + IDNSTALE++YR+NVGGN ISPS DTG++RSW +D  YIF AG G+TETAD  N
Sbjct  211   SSGGVTIDNSTALENVYRLNVGGNDISPSDDTGLYRSWYDDQPYIFGAGLGITETADP-N  269

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI YP G PTYVAPV+VY T RSMGP   +N NYNLTW F +DSGF YLVRLHFCE   
Sbjct  270   MTIEYPSGTPTYVAPVDVYSTARSMGPTPQINLNYNLTWIFSIDSGFSYLVRLHFCEVAP  329

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              +T+IN+RVF +YLNNQTAEP AD   W G +G+P
Sbjct  330   NMTKINQRVFTVYLNNQTAEPEADVAGWTGGHGIP  364



>gb|ABT18094.1| FERONIA receptor-like kinase [Brassica oleracea]
Length=895

 Score =   444 bits (1143),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 216/335 (64%), Positives = 253/335 (76%), Gaps = 1/335 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY PTD   LNCGG   + D DNR W  DV SKFL  +  S TS A +Q PSVP VP+MT
Sbjct  29    DYSPTDNFFLNCGGSSDLPDTDNRTWIPDVKSKFLSSSADSKTSPAATQDPSVPDVPYMT  88

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTYSFPVA+GRKF+RL+FYP SY+GLNATNS+FSV +G YTLLKNFSA QT +
Sbjct  89    ARIFRSPFTYSFPVAAGRKFVRLHFYPNSYDGLNATNSLFSVSLGSYTLLKNFSAAQTAQ  148

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL F F+VKEF VNV G  LNVTFTP     N+ A+VNGIEV S PD+Y++ DGS  +VG
Sbjct  149   ALTFSFIVKEFIVNVEGGALNVTFTPESAPSNAYAYVNGIEVTSMPDLYSSTDGSLTVVG  208

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +  + IDNSTALE++YR+NVGGN ISPS DTG++RSW +D  YIF AG G+TETAD  N
Sbjct  209   SSGGVTIDNSTALENVYRLNVGGNDISPSDDTGLYRSWYDDQPYIFGAGLGITETADP-N  267

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI YP G PTYVAPV+VY T RSMGP   +N NYNLTW F +DSGF YLVRLHFCE   
Sbjct  268   MTIEYPSGTPTYVAPVDVYSTARSMGPTPQINLNYNLTWIFSIDSGFSYLVRLHFCEVAP  327

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              +T+IN+RVF +YLNNQTAEP AD   W G +G+P
Sbjct  328   NMTKINQRVFTVYLNNQTAEPEADVAGWTGGHGIP  362



>ref|NP_190723.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana]
 sp|Q9SCZ4.1|FERON_ARATH RecName: Full=Receptor-like protein kinase FERONIA; AltName: 
Full=Protein SIRENE; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB63019.1| receptor-protein kinase-like protein [Arabidopsis thaliana]
 gb|AEE78805.1| receptor-like protein kinase FERONIA [Arabidopsis thaliana]
Length=895

 Score =   444 bits (1143),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 223/337 (66%), Positives = 264/337 (78%), Gaps = 3/337 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPF  524
             DY PT+KILLNCGG    +TD DNR W +DV SKFL  + + S +S A +Q PSVP+VP+
Sbjct  29    DYSPTEKILLNCGGGASNLTDTDNRIWISDVKSKFLSSSSEDSKTSPALTQDPSVPEVPY  88

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFSA QT
Sbjct  89    MTARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYTLLKNFSASQT  148

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMI  884
              EAL + F++KEF VNV G TLN+TFTP     N+ AFVNGIEV S PD+Y++ DG+  +
Sbjct  149   AEALTYAFIIKEFVVNVEGGTLNMTFTPESAPSNAYAFVNGIEVTSMPDMYSSTDGTLTM  208

Query  885   VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
             VG +  + IDNSTALE++YR+NVGGN ISPS+DTG++RSW +D  YIF AG G+ ETAD 
Sbjct  209   VGSSGSVTIDNSTALENVYRLNVGGNDISPSADTGLYRSWYDDQPYIFGAGLGIPETADP  268

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              NMTI YP G PTYVAPV+VY T RSMGP A +N NYNLTW F +DSGF YLVRLHFCE 
Sbjct  269   -NMTIKYPTGTPTYVAPVDVYSTARSMGPTAQINLNYNLTWIFSIDSGFTYLVRLHFCEV  327

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             ++ IT+IN+RVF IYLNNQTAEP AD IAW   NGVP
Sbjct  328   SSNITKINQRVFTIYLNNQTAEPEADVIAWTSSNGVP  364



>ref|XP_002877809.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. 
lyrata]
 gb|ABT18096.1| FERONIA receptor-like kinase [Arabidopsis lyrata]
 gb|EFH54068.1| hypothetical protein ARALYDRAFT_485507 [Arabidopsis lyrata subsp. 
lyrata]
Length=891

 Score =   441 bits (1135),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 223/336 (66%), Positives = 263/336 (78%), Gaps = 2/336 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPFM  527
             DY PT+KILLNCGG   + D DNR W +DV SKFL  +   S +S A +Q PSVP+VP+M
Sbjct  26    DYSPTEKILLNCGGASDLVDTDNRTWISDVKSKFLSSSSSDSKTSPALTQDPSVPEVPYM  85

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFSA QT 
Sbjct  86    TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYTLLKNFSAAQTA  145

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
             EAL + F++KEF VNV G TLN+TFTP     N+ AFVNGIEV S PDIY++ DG+  +V
Sbjct  146   EALTYAFIIKEFVVNVEGGTLNMTFTPESTPSNAYAFVNGIEVTSMPDIYSSTDGTLTMV  205

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             G ++ + IDNSTALE++YR+NVGGN ISPS+DTG++RSW +D  YIF AG G+ ETAD  
Sbjct  206   GSSTSITIDNSTALENVYRLNVGGNDISPSADTGLYRSWYDDQPYIFGAGLGIPETADP-  264

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             NMTI YP G PTYVAPV+VY T RSMGP A +N NYNLTW F +DSGF YLVRLHFCE +
Sbjct  265   NMTIKYPTGTPTYVAPVDVYSTARSMGPTAQINLNYNLTWIFSIDSGFTYLVRLHFCEVS  324

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             + IT+IN+RVF IYLNNQTAEP AD IAW   NGVP
Sbjct  325   SNITKINQRVFTIYLNNQTAEPEADIIAWTSSNGVP  360



>ref|XP_004492579.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=896

 Score =   441 bits (1134),  Expect = 4e-142, Method: Compositional matrix adjust.
 Identities = 222/341 (65%), Positives = 267/341 (78%), Gaps = 9/341 (3%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             D+ PTDKILLNCGGP   +D D R+WTTD GSKF   TGKS+TS A +Q P+VPQVPFMT
Sbjct  28    DFKPTDKILLNCGGPAVSSDPDGREWTTDNGSKFGSLTGKSTTSQAAAQDPAVPQVPFMT  87

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR FQS++TYSFPVASG KFLRLYFY ASY+GLN +++ F V    Y++L NFS  +TT 
Sbjct  88    ARIFQSQYTYSFPVASGWKFLRLYFYAASYSGLNVSDARFGVTSQSYSVLSNFSVLETTL  147

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
              LN+D++VKE+S++V G TLNVTFTPSP + N+ AFVNGIE+VS PDIY++ D  TMIVG
Sbjct  148   GLNYDYIVKEYSIHVDGGTLNVTFTPSPKATNAYAFVNGIEIVSMPDIYSSTD--TMIVG  205

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              N+   IDNSTALE+IYR+NVGGN ISPS DTGMFRSW +D  +I+ AG GVTETAD   
Sbjct  206   TNNIFTIDNSTALENIYRLNVGGNDISPSHDTGMFRSWSDDVPFIYGAGFGVTETADP-Q  264

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             + I YPPG P+Y+AP +VY T RSMGP+A++N+NYNLTW F +DSGF YLVRLHFCE TT
Sbjct  265   VKIEYPPGTPSYIAPTDVYLTARSMGPDANINSNYNLTWIFSIDSGFSYLVRLHFCEGTT  324

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWA------GKNGVP  1355
              IT+INERVF I+++NQTA  GAD IAWA        NGVP
Sbjct  325   TITKINERVFNIFISNQTAFGGADVIAWADTFNLPHSNGVP  365



>ref|XP_010244547.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=890

 Score =   441 bits (1133),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 211/334 (63%), Positives = 258/334 (77%), Gaps = 4/334 (1%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             Y PTDKILLNCG     TD D RKWT DVGSKF      + TS+A +Q PSVP VP+MTA
Sbjct  32    YFPTDKILLNCGAAQESTDSDGRKWTGDVGSKFAPAAANTLTSTAATQDPSVPDVPYMTA  91

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R F+SEFTYSFPVASGRKF+RLYFYPASYNGLNA+N++FSV  G YTLLKNFS  QT EA
Sbjct  92    RVFRSEFTYSFPVASGRKFVRLYFYPASYNGLNASNALFSVTSGPYTLLKNFSVSQTAEA  151

Query  714   LNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQ  893
             L + F++KE+S+NV  E LNVTF PS N+ NS AF+NGIEVVS PDIY++A+G+ ++VG 
Sbjct  152   LTYAFIIKEYSLNVENEILNVTFRPSSNASNSYAFINGIEVVSMPDIYSSANGA-LLVGL  210

Query  894   NSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNM  1073
             +S   IDNST LE+++R+NVGGN ISP+ D G+FRSW +DS YIF A  GVT+ A   NM
Sbjct  211   SSQFTIDNSTTLENVFRINVGGNYISPTGDPGLFRSWYDDSPYIFGAAFGVTDVA---NM  267

Query  1074  TISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTI  1253
             TI YP  +P Y APV+VY T R+MGP+AS+N NYNLTW F VD GF++LVRLHFCE  ++
Sbjct  268   TIQYPTDLPKYTAPVDVYATARTMGPDASINQNYNLTWIFSVDPGFYHLVRLHFCEIQSV  327

Query  1254  ITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             I ++N+RVF I++NNQTAE   D +AW   NG+P
Sbjct  328   INKVNQRVFQIFINNQTAEAAFDVVAWTQGNGIP  361



>gb|KEH32083.1| feronia receptor-like kinase [Medicago truncatula]
Length=701

 Score =   434 bits (1115),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 214/341 (63%), Positives = 259/341 (76%), Gaps = 7/341 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             D+ PTDKILLNCGGP   TD D R+WTTD GSKF     KS+TS A +Q P+VPQ+PFMT
Sbjct  31    DFKPTDKILLNCGGPAVSTDPDGREWTTDNGSKFGSSAVKSTTSQAATQDPAVPQIPFMT  90

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR FQS +TYSFPVASG KFLRLYFY ASY GLNA+++ F V    YT+L+NFS  +T  
Sbjct  91    ARVFQSPYTYSFPVASGWKFLRLYFYSASYGGLNASDARFGVTAQSYTVLRNFSVSETAL  150

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
              LN+D++VKE+ ++V   TLNVTFTPS N+  + AFVNGIEVVS PDIY + DG+TMIVG
Sbjct  151   GLNYDYIVKEYCIHVDEGTLNVTFTPSANASKAYAFVNGIEVVSMPDIYTSTDGTTMIVG  210

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
               +   IDNSTALE++YR+NVGGN ISPS DTGMFRSW +D +YI+ A  GVTETAD   
Sbjct  211   TGTTFTIDNSTALENVYRLNVGGNDISPSKDTGMFRSWTDDVRYIYGAAFGVTETADP-E  269

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             + + YPPG P+Y+AP +VY T RSMGPN +++ N+NLTW F +DSGF YLVRLHFCE TT
Sbjct  270   VKLEYPPGTPSYIAPSDVYVTARSMGPNPNISLNWNLTWIFSIDSGFSYLVRLHFCEGTT  329

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWA------GKNGVP  1355
              IT++N+RVF I+L NQTA+ GAD IAWA        NGVP
Sbjct  330   TITKVNQRVFDIFLGNQTAQDGADVIAWADSFDLPHSNGVP  370



>ref|XP_009148931.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=899

 Score =   438 bits (1126),  Expect = 8e-141, Method: Compositional matrix adjust.
 Identities = 218/336 (65%), Positives = 252/336 (75%), Gaps = 2/336 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY PTD  LLNCGG   + D DNR W  DV SKFL  +  S TS A +Q PSVP VP+MT
Sbjct  31    DYSPTDNFLLNCGGSSDLPDTDNRTWIPDVKSKFLSSSADSKTSPAATQDPSVPDVPYMT  90

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTYSFPV+SGRKF+RL+FYP SY+GLNATNS+FSV +G YTLLKNFSA Q  +
Sbjct  91    ARIFRSPFTYSFPVSSGRKFVRLHFYPNSYDGLNATNSLFSVSLGSYTLLKNFSAAQMAQ  150

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTP-SPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
             AL F F+VKEF VNV G  LNVTFTP S  S N+ AFVNGIEV S PD+Y++  GS  +V
Sbjct  151   ALTFSFIVKEFIVNVEGGALNVTFTPESTPSNNAYAFVNGIEVTSMPDLYSSTHGSLTVV  210

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             G +  + IDNSTALE++YR+NVGGN ISPS DTG++RSW +D  YIF AG G+TETAD  
Sbjct  211   GSSGGVTIDNSTALENVYRLNVGGNDISPSDDTGLYRSWYDDQPYIFGAGLGITETADP-  269

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             NMTI YP G PTYVAPV+VY T RSMGP   +N N NLTW F +DSGF YLVRLHFCE  
Sbjct  270   NMTIEYPSGTPTYVAPVDVYSTARSMGPTPQINLNSNLTWIFSIDSGFSYLVRLHFCEVA  329

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
               IT+IN+RVF +YLNNQTAEP AD   W G  G+P
Sbjct  330   PNITKINQRVFTVYLNNQTAEPEADVAGWTGGQGIP  365



>ref|XP_009136619.1| PREDICTED: receptor-like protein kinase FERONIA [Brassica rapa]
Length=896

 Score =   437 bits (1125),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 218/337 (65%), Positives = 260/337 (77%), Gaps = 4/337 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP+VP+MT
Sbjct  29    DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPEVPYMT  88

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG-EYTLLKNFSAGQTT  707
             AR F+S FTYSFPVASGRKF+RLYF+P SY+GLNAT S+FSV +G  YTLLKNFSA QT 
Sbjct  89    ARIFRSPFTYSFPVASGRKFVRLYFHPNSYDGLNATTSLFSVTLGSSYTLLKNFSAAQTA  148

Query  708   EALNFDFLVKEFSVNVP-GETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMI  884
             +AL++  +VKEF VNV  G +LN+TFTP  ++P + AFVNGIEV S PD+Y+  DG+  I
Sbjct  149   QALSYSSIVKEFIVNVEGGASLNITFTPE-STPKAYAFVNGIEVTSMPDLYSNTDGTLSI  207

Query  885   VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
             VG ++ ++IDNSTALE++YR+NVGGN ISPS DTG++RSW +DS YIF+AG GV ET D 
Sbjct  208   VGSSTAVDIDNSTALENVYRLNVGGNDISPSEDTGLYRSWYDDSPYIFTAGIGVVETVDP  267

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              NMTI YP   PTY+APV+VY T RSM P A +N N+NLTW F +DSGF YLVRLHFCE 
Sbjct  268   -NMTIKYPTDTPTYIAPVDVYSTARSMTPTAQINLNFNLTWVFSIDSGFTYLVRLHFCEV  326

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                IT+IN+RVF IYLNNQTAE  AD   W G NG+P
Sbjct  327   LPDITKINQRVFTIYLNNQTAESEADVAGWTGGNGIP  363



>ref|XP_002528705.1| kinase, putative [Ricinus communis]
 gb|EEF33694.1| kinase, putative [Ricinus communis]
Length=891

 Score =   437 bits (1124),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 213/336 (63%), Positives = 260/336 (77%), Gaps = 4/336 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +YVPTDKILL+CG      D D +KWT D  SKFLL +  S+ SSA +Q P+V Q+PFMT
Sbjct  26    NYVPTDKILLDCGATSDNADDDGQKWTADKNSKFLLSSDNSTISSAATQDPAVSQIPFMT  85

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F S FTYSFP+A+GRKF+RLYFYPASY+GLNA++++FSV  G YT+LKNFS  QTT+
Sbjct  86    ARVFHSNFTYSFPLAAGRKFVRLYFYPASYSGLNASDALFSVTAGSYTILKNFSVAQTTQ  145

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ ++VKE+S+NV G +LN+TF+PS N   S AFVNGIE+VS PDIY + DG+ M++G
Sbjct  146   ALNYAYIVKEYSINVDGGSLNITFSPSTNPSKSYAFVNGIEIVSMPDIYGSTDGTLMLLG  205

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +SP+ IDNSTALE++YR+NVGGNVISPS DTGM RSW +D  YI+ A  GV ETAD  N
Sbjct  206   NDSPIYIDNSTALENVYRINVGGNVISPSRDTGMLRSWVDDQPYIYGAAIGVPETADP-N  264

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI  P  +P Y+AP +VY T RSMGP   VN NYNLTW F VDSGF YLVRLHFCE  +
Sbjct  265   MTIKDP--VPPYIAPKDVYSTARSMGPTVYVNLNYNLTWIFSVDSGFNYLVRLHFCEVAS  322

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGK-NGVP  1355
              IT+IN+R F I+LNNQTAE  AD +AWA + NGVP
Sbjct  323   NITKINQRAFTIFLNNQTAEDQADVVAWANEHNGVP  358



>ref|XP_006290584.1| hypothetical protein CARUB_v10016673mg [Capsella rubella]
 gb|EOA23482.1| hypothetical protein CARUB_v10016673mg [Capsella rubella]
Length=892

 Score =   436 bits (1122),  Expect = 3e-140, Method: Compositional matrix adjust.
 Identities = 215/336 (64%), Positives = 259/336 (77%), Gaps = 2/336 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPFM  527
             DY PT+KILLNCGG   + D DNR W +DV SKFL  +   S +S A +Q PSVP+VP+M
Sbjct  27    DYSPTEKILLNCGGASDLRDTDNRTWISDVKSKFLSSSSGDSKTSPALTQDPSVPEVPYM  86

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F+S FTY+FPVASGRKF+RLYFYP SY+GLNATNS+FSV  G YTLLKNFS  QT 
Sbjct  87    TARVFRSPFTYTFPVASGRKFVRLYFYPNSYDGLNATNSLFSVSFGPYTLLKNFSVAQTA  146

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
             +AL + F++KEF VNV G TLN+TFTP     N+ AFVNGIEV S PD+Y++ DG+ ++V
Sbjct  147   DALTYAFIIKEFIVNVEGGTLNMTFTPESTPSNAYAFVNGIEVTSMPDLYSSTDGTLIVV  206

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             G ++ + IDNSTALE++YR+NVGGN ISPS+DTG+FRSW +D  Y+F AG G+ ETAD  
Sbjct  207   GSSASITIDNSTALENVYRLNVGGNDISPSADTGLFRSWYDDQPYLFGAGLGIPETADP-  265

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             NMTI YP G P+YVAPV+VY T RSMGP A +N NYNLTW F +DSGF YLVRLHFCE +
Sbjct  266   NMTIKYPTGTPSYVAPVDVYSTARSMGPTAQINLNYNLTWIFSIDSGFSYLVRLHFCEVS  325

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
               IT+IN+RVF IYLNNQTAE  AD   W   NG+P
Sbjct  326   PNITKINQRVFTIYLNNQTAEGEADVAGWTNGNGIP  361



>ref|NP_001238686.1| receptor-like kinase [Glycine max]
 gb|ACM89482.1| receptor-like kinase [Glycine max]
Length=883

 Score =   436 bits (1120),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 209/341 (61%), Positives = 265/341 (78%), Gaps = 7/341 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             D+ P DKILLNCGGP   TD D R+WTTDVGSKF   T KS+TS A +Q P+VPQVP+MT
Sbjct  17    DFEPKDKILLNCGGPPSSTDTDGREWTTDVGSKFGSSTAKSATSPAATQDPAVPQVPYMT  76

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F + +TY+FPVASG KFLRL+FY ASY+ LNA++++F+V    YT+L+NFS  QTT 
Sbjct  77    ARVFHAPYTYTFPVASGWKFLRLHFYSASYSSLNASDALFAVAANSYTVLRNFSVAQTTL  136

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ ++++EF+++V GE+LNVTFTPS N+ NS AFVNGIE+VS P+IY + DG+ M+VG
Sbjct  137   ALNYAYIMREFAIHVEGESLNVTFTPSTNASNSYAFVNGIEIVSMPEIYTSTDGTLMMVG  196

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              N+P+ IDNSTALE +YR+NVGGN ISPS DTGMFRSW +D  +++ A  GVTE AD  +
Sbjct  197   SNAPVTIDNSTALECVYRLNVGGNDISPSHDTGMFRSWSDDMPFLYGAAFGVTEPADP-D  255

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +   YPP  P+Y+AP++VY T R+MGPNA +N NYNLTW F +DSGF YLVRLHF E ++
Sbjct  256   VKFEYPPDTPSYIAPLDVYTTARTMGPNAEINTNYNLTWIFNIDSGFSYLVRLHFAEVSS  315

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGK------NGVP  1355
              IT+ N+RVF I+LNNQTA P AD IAWAG+      NGVP
Sbjct  316   NITKSNQRVFDIFLNNQTAMPEADVIAWAGEFDLSHSNGVP  356



>ref|XP_010529939.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=892

 Score =   436 bits (1120),  Expect = 5e-140, Method: Compositional matrix adjust.
 Identities = 211/334 (63%), Positives = 256/334 (77%), Gaps = 1/334 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             D+ P DK LLNCG      D DNR W  DV SKFL  +G S  S A +Q PSVPQVP+MT
Sbjct  26    DFSPPDKFLLNCGESSEAFDTDNRTWIPDVKSKFLSSSGDSKASPASTQDPSVPQVPYMT  85

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTYSFPVASGRKF+RLYFYP SY+GLNAT+++FSV  G YTLLKNFSA QT +
Sbjct  86    ARVFRSSFTYSFPVASGRKFVRLYFYPNSYDGLNATDALFSVSFGPYTLLKNFSASQTAQ  145

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL + F+VKE+ VNV G TLN+TF+P+    ++ AFVNGIEV S PDIY++ DGS +IVG
Sbjct  146   ALTYAFIVKEYVVNVDGGTLNLTFSPASTPSSAYAFVNGIEVTSMPDIYSSTDGSLVIVG  205

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
               +  +IDN T+LE++YR+NVGGN ISPS+DTG++RSW +D  Y+F+AG G+TETAD  N
Sbjct  206   SATSFSIDNGTSLENVYRLNVGGNDISPSADTGLYRSWYDDQPYVFAAGLGITETADP-N  264

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI YP G PTY+APV VY T RSMGP A++N NYNLTW F +DSGF YLVRLHFCE + 
Sbjct  265   MTIRYPSGTPTYIAPVNVYATARSMGPTAAINVNYNLTWIFSIDSGFNYLVRLHFCEVSP  324

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
              IT+IN+RVF I+LNNQTA+P AD   W   NG+
Sbjct  325   NITKINQRVFTIFLNNQTADPEADVAGWTNGNGI  358



>gb|KJB29840.1| hypothetical protein B456_005G120700 [Gossypium raimondii]
Length=889

 Score =   435 bits (1119),  Expect = 6e-140, Method: Compositional matrix adjust.
 Identities = 220/329 (67%), Positives = 258/329 (78%), Gaps = 4/329 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DYVPT+KILLNCGG    TD DNRKWT DVGSKFLLG+G S  S A +Q P+VP+VP+MT
Sbjct  27    DYVPTEKILLNCGGKSEATDNDNRKWTPDVGSKFLLGSGNSVASQAATQDPAVPEVPYMT  86

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTYSFPV  GRKFLRLYFY  SY+G  A N++FSV  G YTLLKNFSA QT+E
Sbjct  87    ARVFRSNFTYSFPVVPGRKFLRLYFYANSYDGQIAANALFSVTCGSYTLLKNFSAAQTSE  146

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ F+VKE+S+NV  + LN+TFTPS  S N+ AFVNGIEV+S PDIY  ADG + IVG
Sbjct  147   ALNYAFVVKEYSINVDDDHLNLTFTPSTPS-NAYAFVNGIEVLSMPDIYGNADGIS-IVG  204

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             QN P  IDNSTALE+IYR+NVGGN ISPS+DTG+FRSW +D  Y+F A  GV+  AD  N
Sbjct  205   QNIPFTIDNSTALENIYRLNVGGNDISPSADTGLFRSWYDDQPYLFGAAYGVSGAADP-N  263

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +TI Y   MPTY+AP +VY + RSMGPNA +N +YNLTW F VDSGF YLVRLHFCEFT 
Sbjct  264   VTIDYGT-MPTYIAPKDVYASARSMGPNAEINNHYNLTWMFSVDSGFSYLVRLHFCEFTD  322

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWA  1337
              IT+IN+RVF ++LNNQTA+ G D IA A
Sbjct  323   NITKINQRVFDVFLNNQTADQGVDVIALA  351



>gb|KHN40613.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=894

 Score =   435 bits (1118),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 208/341 (61%), Positives = 265/341 (78%), Gaps = 7/341 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             D+ P DKILLNCGGP   TD D R+WTTDVGSKF   T KS+TS A +Q P+VPQVP+MT
Sbjct  28    DFEPKDKILLNCGGPPSSTDTDGREWTTDVGSKFGSSTAKSATSPAATQDPAVPQVPYMT  87

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F + +TY+FPVASG KFLRL+FY ASY+ LNA++++F++    YT+L+NFS  QTT 
Sbjct  88    ARVFHAPYTYTFPVASGWKFLRLHFYSASYSSLNASDALFAMAANSYTVLRNFSVAQTTL  147

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ ++++EF+++V GE+LNVTFTPS N+ NS AFVNGIE+VS P+IY + DG+ M+VG
Sbjct  148   ALNYAYIMREFAIHVEGESLNVTFTPSTNASNSYAFVNGIEIVSMPEIYTSTDGTLMMVG  207

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              N+P+ IDNSTALE +YR+NVGGN ISPS DTGMFRSW +D  +++ A  GVTE AD  +
Sbjct  208   SNAPVTIDNSTALECVYRLNVGGNDISPSHDTGMFRSWSDDMPFLYGAAFGVTEPADP-D  266

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +   YPP  P+Y+AP++VY T R+MGPNA +N NYNLTW F +DSGF YLVRLHF E ++
Sbjct  267   VKFEYPPDTPSYIAPLDVYTTARTMGPNAEINTNYNLTWIFNIDSGFSYLVRLHFAEVSS  326

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGK------NGVP  1355
              IT+ N+RVF I+LNNQTA P AD IAWAG+      NGVP
Sbjct  327   NITKSNQRVFDIFLNNQTAMPEADVIAWAGEFDLSHSNGVP  367



>gb|KEH23293.1| feronia receptor-like kinase [Medicago truncatula]
Length=899

 Score =   434 bits (1116),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 214/341 (63%), Positives = 259/341 (76%), Gaps = 7/341 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             D+ PTDKILLNCGGP   TD D R+WTTD GSKF     KS+TS A +Q P+VPQ+PFMT
Sbjct  31    DFKPTDKILLNCGGPAVSTDPDGREWTTDNGSKFGSSAVKSTTSQAATQDPAVPQIPFMT  90

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR FQS +TYSFPVASG KFLRLYFY ASY GLNA+++ F V    YT+L+NFS  +T  
Sbjct  91    ARVFQSPYTYSFPVASGWKFLRLYFYSASYGGLNASDARFGVTAQSYTVLRNFSVSETAL  150

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
              LN+D++VKE+ ++V   TLNVTFTPS N+  + AFVNGIEVVS PDIY + DG+TMIVG
Sbjct  151   GLNYDYIVKEYCIHVDEGTLNVTFTPSANASKAYAFVNGIEVVSMPDIYTSTDGTTMIVG  210

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
               +   IDNSTALE++YR+NVGGN ISPS DTGMFRSW +D +YI+ A  GVTETAD   
Sbjct  211   TGTTFTIDNSTALENVYRLNVGGNDISPSKDTGMFRSWTDDVRYIYGAAFGVTETADP-E  269

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             + + YPPG P+Y+AP +VY T RSMGPN +++ N+NLTW F +DSGF YLVRLHFCE TT
Sbjct  270   VKLEYPPGTPSYIAPSDVYVTARSMGPNPNISLNWNLTWIFSIDSGFSYLVRLHFCEGTT  329

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWA------GKNGVP  1355
              IT++N+RVF I+L NQTA+ GAD IAWA        NGVP
Sbjct  330   TITKVNQRVFDIFLGNQTAQDGADVIAWADSFDLPHSNGVP  370



>ref|XP_003609098.1| FERONIA receptor-like kinase [Medicago truncatula]
Length=893

 Score =   434 bits (1115),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 214/341 (63%), Positives = 259/341 (76%), Gaps = 7/341 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             D+ PTDKILLNCGGP   TD D R+WTTD GSKF     KS+TS A +Q P+VPQ+PFMT
Sbjct  25    DFKPTDKILLNCGGPAVSTDPDGREWTTDNGSKFGSSAVKSTTSQAATQDPAVPQIPFMT  84

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR FQS +TYSFPVASG KFLRLYFY ASY GLNA+++ F V    YT+L+NFS  +T  
Sbjct  85    ARVFQSPYTYSFPVASGWKFLRLYFYSASYGGLNASDARFGVTAQSYTVLRNFSVSETAL  144

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
              LN+D++VKE+ ++V   TLNVTFTPS N+  + AFVNGIEVVS PDIY + DG+TMIVG
Sbjct  145   GLNYDYIVKEYCIHVDEGTLNVTFTPSANASKAYAFVNGIEVVSMPDIYTSTDGTTMIVG  204

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
               +   IDNSTALE++YR+NVGGN ISPS DTGMFRSW +D +YI+ A  GVTETAD   
Sbjct  205   TGTTFTIDNSTALENVYRLNVGGNDISPSKDTGMFRSWTDDVRYIYGAAFGVTETADP-E  263

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             + + YPPG P+Y+AP +VY T RSMGPN +++ N+NLTW F +DSGF YLVRLHFCE TT
Sbjct  264   VKLEYPPGTPSYIAPSDVYVTARSMGPNPNISLNWNLTWIFSIDSGFSYLVRLHFCEGTT  323

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWA------GKNGVP  1355
              IT++N+RVF I+L NQTA+ GAD IAWA        NGVP
Sbjct  324   TITKVNQRVFDIFLGNQTAQDGADVIAWADSFDLPHSNGVP  364



>ref|NP_001237656.1| FERONIA receptor-like kinase precursor [Glycine max]
 gb|ACM89524.1| FERONIA receptor-like kinase [Glycine max]
Length=892

 Score =   433 bits (1114),  Expect = 4e-139, Method: Compositional matrix adjust.
 Identities = 208/341 (61%), Positives = 264/341 (77%), Gaps = 7/341 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             D+ PTDKILLNCGGP   TD D R+WTTD GSKF   T KS+TS A +Q P+VPQVP+MT
Sbjct  25    DFQPTDKILLNCGGPPSSTDTDGREWTTDNGSKFGSSTAKSATSPAATQDPAVPQVPYMT  84

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F + +TY+FPVASG KFLRL+FY ASY+ LNA++++F+V    YT+L+NFS  QTT 
Sbjct  85    ARVFHAPYTYTFPVASGWKFLRLHFYSASYSSLNASDALFAVAANSYTVLRNFSVAQTTL  144

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ ++++EF+++V GE+LNVTFTPS N+ N+ AFVNGIE+VS P+IY + DG+ M+VG
Sbjct  145   ALNYAYIMREFAIHVEGESLNVTFTPSTNASNAYAFVNGIEIVSMPEIYTSTDGTLMMVG  204

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              NSP  IDNSTALE +YR+NVGGN ISPS DTGMFRSW +D  +++ A  GVTE AD  +
Sbjct  205   SNSPFPIDNSTALECVYRLNVGGNDISPSHDTGMFRSWSDDMPFLYGAAFGVTEPADP-D  263

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +   YPPG P+Y+AP++VY T R+MGPN  +N NYNL+W F +DSGF YLVRLHF E ++
Sbjct  264   VKFEYPPGTPSYIAPLDVYSTARTMGPNPEINTNYNLSWIFNIDSGFSYLVRLHFAEVSS  323

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGK------NGVP  1355
              IT+IN+RVF I+LNNQTA P AD IAWA +      NGVP
Sbjct  324   NITKINQRVFDIFLNNQTAMPQADVIAWAKEFDLSHSNGVP  364



>gb|KHN29489.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=896

 Score =   433 bits (1113),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 208/341 (61%), Positives = 264/341 (77%), Gaps = 7/341 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             D+ PTDKILLNCGGP   TD D R+WTTD GSKF   T KS+TS A +Q P+VPQVP+MT
Sbjct  29    DFQPTDKILLNCGGPPSSTDTDGREWTTDNGSKFGSSTAKSATSPAATQDPAVPQVPYMT  88

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F + +TY+FPVASG KFLRL+FY ASY+ LNA++++F+V    YT+L+NFS  QTT 
Sbjct  89    ARVFHAPYTYTFPVASGWKFLRLHFYSASYSSLNASDALFAVAANSYTVLRNFSVAQTTL  148

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ ++++EF+++V GE+LNVTFTPS N+ N+ AFVNGIE+VS P+IY + DG+ M+VG
Sbjct  149   ALNYAYIMREFAIHVEGESLNVTFTPSTNASNAYAFVNGIEIVSMPEIYTSTDGTLMMVG  208

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              NSP  IDNSTALE +YR+NVGGN ISPS DTGMFRSW +D  +++ A  GVTE AD  +
Sbjct  209   SNSPFPIDNSTALECVYRLNVGGNDISPSHDTGMFRSWSDDMPFLYGAAFGVTEPADP-D  267

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +   YPPG P+Y+AP++VY T R+MGPN  +N NYNL+W F +DSGF YLVRLHF E ++
Sbjct  268   VKFEYPPGTPSYIAPLDVYSTARTMGPNPEINTNYNLSWIFNIDSGFSYLVRLHFAEVSS  327

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGK------NGVP  1355
              IT+IN+RVF I+LNNQTA P AD IAWA +      NGVP
Sbjct  328   NITKINQRVFDIFLNNQTAMPQADVIAWAKEFDLSHSNGVP  368



>gb|KJB38065.1| hypothetical protein B456_006G235700 [Gossypium raimondii]
Length=895

 Score =   432 bits (1112),  Expect = 8e-139, Method: Compositional matrix adjust.
 Identities = 218/335 (65%), Positives = 260/335 (78%), Gaps = 3/335 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DYVPT+KILLNCG    ++D DNRKWT DVGSKFL GT KS TS A SQ P+VP+VP+MT
Sbjct  31    DYVPTEKILLNCGEKSDLSDNDNRKWTPDVGSKFLTGTEKSVTSPASSQDPAVPEVPYMT  90

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F S FTYSFPV SGRKF+RLYFY  SY+G NATN++FSV  G YTLLKNFSA QT+E
Sbjct  91    ARVFHSNFTYSFPVVSGRKFVRLYFYANSYDGQNATNALFSVTSGSYTLLKNFSAAQTSE  150

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ F++KE+S+NV G+ LN+TF+PS    N+ AFVNGIEV+S PD+Y+ +DG   IVG
Sbjct  151   ALNYAFVIKEYSINVDGDHLNLTFSPSSTPSNAYAFVNGIEVLSMPDLYSNSDG-VPIVG  209

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q  PL IDN+TALE++YR+NVGG+ ISPS DTG+FRSW +D  Y+F A  GV+  AD  N
Sbjct  210   QQVPLTIDNATALENVYRLNVGGSDISPSGDTGLFRSWYDDQPYLFGAAFGVSAAADP-N  268

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +TI Y   M TY APV VY + RSMGPNA +N NYNLTW F +DSGF YLVRLHFCEFT 
Sbjct  269   VTIDYGT-MATYTAPVNVYTSARSMGPNAPINDNYNLTWLFSIDSGFSYLVRLHFCEFTD  327

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT+IN+RVF I++NNQTAE G D IA A +  VP
Sbjct  328   NITKINQRVFNIFINNQTAELGFDVIAAAEQVDVP  362



>ref|XP_010252026.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score =   429 bits (1103),  Expect = 1e-137, Method: Compositional matrix adjust.
 Identities = 212/334 (63%), Positives = 252/334 (75%), Gaps = 4/334 (1%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             YVPTDKILLNCG     TD D +KWT DVGSKF   T  +  S+A +Q PSVP VP+MTA
Sbjct  29    YVPTDKILLNCGSTSETTDTDGQKWTGDVGSKFAPSTANTLISTAATQGPSVPDVPYMTA  88

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R F+SEFTY+FPVASGRKF+RLYFYPASYNGLNA+N++FSV  G YTLL NFSA QT EA
Sbjct  89    RIFRSEFTYTFPVASGRKFVRLYFYPASYNGLNASNALFSVTSGPYTLLNNFSASQTAEA  148

Query  714   LNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQ  893
             +NF  + KEFS+    E+LN+TF PS N  N+ AFVNGI+V+S PDIYN A+G+  +VG 
Sbjct  149   INFAVIFKEFSLIAEDESLNITFKPSSNISNAYAFVNGIQVLSMPDIYNDANGA-FLVGL  207

Query  894   NSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNM  1073
             NS   IDNSTALE++ R+NVGGN I PS DTG+ RSW +D  YIFSA  GVT+  D   +
Sbjct  208   NSQFPIDNSTALENVIRLNVGGNDIPPSEDTGLLRSWYDDMPYIFSAAIGVTDLTD---L  264

Query  1074  TISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTI  1253
             TI YP  +P Y AP+ VY T R+MGPNASVN NYNLTW F VD GF YLVRLHFCE  ++
Sbjct  265   TIHYPSNVPNYTAPMNVYATARTMGPNASVNVNYNLTWIFQVDPGFSYLVRLHFCEIQSV  324

Query  1254  ITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             I +INERVF I++NNQTA+ GAD + WA  NG+P
Sbjct  325   INKINERVFQIFINNQTADDGADVVGWANGNGIP  358



>ref|XP_002279218.3| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=893

 Score =   429 bits (1103),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 211/335 (63%), Positives = 250/335 (75%), Gaps = 1/335 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +YV TDKILLNCG     TD D   WTTD+GSKF++    S TS AD+Q PSVP VP+MT
Sbjct  27    NYVATDKILLNCGASSSTTDTDGLVWTTDIGSKFMVAAENSLTSEADTQDPSVPTVPYMT  86

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR  +SEF+Y FP+A GRKF+RLYFYPASY+ L+A++++FSV  G YTLLKNFS  QTTE
Sbjct  87    ARISKSEFSYRFPLAMGRKFVRLYFYPASYSNLSASDALFSVTAGSYTLLKNFSVAQTTE  146

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ F++KE+S+NV  E LN+TF+PSP+  N  AFVNGIE+VS PDIYNT DGS+MIVG
Sbjct  147   ALNYAFIMKEYSINVDSEALNITFSPSPSGKNFYAFVNGIEIVSMPDIYNTEDGSSMIVG  206

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              + P  I N TALE  YR+NVGG+ ISPS DTGM RSW  D+ Y+F A  GVTETA   N
Sbjct  207   ADIPYTIGNDTALECAYRLNVGGSDISPSHDTGMLRSWSIDTAYMFGAAWGVTETASP-N  265

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MT      +P + APV+VY T RSMGPNA +N NYNLTW F VDSGF YLVRLH CE   
Sbjct  266   MTNKISSKVPDFAAPVDVYATARSMGPNAYINLNYNLTWVFAVDSGFSYLVRLHLCEVFD  325

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
               T+IN+RVF I+LNNQTA  GAD  AWAG NG+P
Sbjct  326   NFTKINQRVFDIFLNNQTAFGGADVFAWAGSNGIP  360



>ref|XP_004302537.1| PREDICTED: receptor-like protein kinase FERONIA [Fragaria vesca 
subsp. vesca]
Length=883

 Score =   429 bits (1102),  Expect = 2e-137, Method: Compositional matrix adjust.
 Identities = 219/335 (65%), Positives = 261/335 (78%), Gaps = 2/335 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +Y+P+DKI LNCGGP   TD D +KWT+DVGSKF  G   S+TS A +Q PSVP+ PFMT
Sbjct  21    NYIPSDKIFLNCGGPQESTDADGQKWTSDVGSKFASG-ANSTTSPAATQDPSVPETPFMT  79

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F S++TY FPVASGR F+RL FYPASY GLNA+ +VFSV V  YT+LKNFS  QTTE
Sbjct  80    ARVFHSDYTYKFPVASGRIFVRLSFYPASYAGLNASGAVFSVMVESYTVLKNFSVVQTTE  139

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL++ F+ KEF VNV GE+L+VTF PS + PN+ AFVNGIEVVS PDIY++ DG+TMIVG
Sbjct  140   ALDYAFVTKEFVVNVEGESLDVTFKPSSSVPNAYAFVNGIEVVSMPDIYSSTDGTTMIVG  199

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q+SP  IDNSTALE++YR+NVGGN ISPS DTG+ RSW +D+ Y+F A  GV E AD  N
Sbjct  200   QSSPFYIDNSTALENVYRLNVGGNDISPSKDTGLLRSWYDDTAYLFGAAFGVPEFADG-N  258

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             M+I+YP  MPTYVAP +VYKT RSMGPN ++N NYNLTW F +DSGF YLVRLHFCE   
Sbjct  259   MSIAYPKDMPTYVAPEDVYKTARSMGPNNNINLNYNLTWVFSIDSGFMYLVRLHFCEVAA  318

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT++N+RVF IYLNNQTAE G D       NG+P
Sbjct  319   NITKLNQRVFDIYLNNQTAESGFDVAGITQGNGIP  353



>gb|KJB71482.1| hypothetical protein B456_011G124900 [Gossypium raimondii]
Length=893

 Score =   427 bits (1098),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 214/335 (64%), Positives = 257/335 (77%), Gaps = 3/335 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DYVPT+KILLNCG    +TD DNRKWT D GSKFL+GTG S  S A +Q P+VP+VP++T
Sbjct  31    DYVPTEKILLNCGEKSELTDNDNRKWTPDFGSKFLVGTGNSVISRAATQDPAVPEVPYLT  90

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTYSFPV +GRKF+RLYFY  SY+  N++N++FSV  G YTLLKNFSA QT+E
Sbjct  91    ARVFRSNFTYSFPVVAGRKFVRLYFYANSYDDRNSSNALFSVTSGSYTLLKNFSAAQTSE  150

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             A+N+ F+VKE+S+NV G+ LN+TF+      N+ AFVNGIEV+S PDIY+  DG T IVG
Sbjct  151   AMNYAFIVKEYSINVDGDRLNLTFSLGSTPSNAYAFVNGIEVLSMPDIYSNTDGIT-IVG  209

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             QNS   IDNST LE+IYR+NVGGN ISPS DTG+FRSW +D  Y+F A  GV+  AD  N
Sbjct  210   QNSQFTIDNSTTLENIYRLNVGGNDISPSGDTGLFRSWYDDQPYLFGAAHGVSGAADP-N  268

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +TI Y   MP Y+AP +VY T RSMGPNA VN NYNLTW F VDSGF YLVRLHFCEFT 
Sbjct  269   VTIDYGT-MPRYIAPQDVYTTARSMGPNAQVNYNYNLTWLFSVDSGFSYLVRLHFCEFTD  327

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT++N+RVF ++LNNQTAE G D IA A +  VP
Sbjct  328   NITKVNQRVFDVFLNNQTAEQGVDVIALADEVDVP  362



>ref|XP_010252025.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=886

 Score =   427 bits (1097),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 207/334 (62%), Positives = 251/334 (75%), Gaps = 5/334 (1%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             YVPTDKILLNCG     TD D +KW+ DVGSKFL  +  + TS A +Q PSVP+VP+MTA
Sbjct  29    YVPTDKILLNCGAASETTDTDGQKWSGDVGSKFLPSSDNTLTSRAATQGPSVPEVPYMTA  88

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R F SEFTY+FPV SGRKF+RLYFYP SYNGLN +N++FSV  G YTLL NFSA QT EA
Sbjct  89    RIFHSEFTYTFPVTSGRKFVRLYFYPTSYNGLNESNALFSVTSGPYTLLHNFSASQTAEA  148

Query  714   LNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQ  893
             LN+  + KEFS+NV  ++LN+TF PS N+ NS AFVNGIE+VS PDIYN+A+G+ ++VG 
Sbjct  149   LNYAVIPKEFSLNVENQSLNLTFKPSSNASNSYAFVNGIEIVSMPDIYNSANGA-LLVGH  207

Query  894   NSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNM  1073
             N+    DNSTALE++YR+NVGGN I PS DTG+ R W +D  YIF   +GVT+    + +
Sbjct  208   NTQFPFDNSTALENVYRLNVGGNDIPPSEDTGLLRYWRDDFIYIFGGASGVTQ----FGI  263

Query  1074  TISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTI  1253
             TI YP  +P Y AP  VY T R+MGPNA+VN NYNLTW F VD GFFYLVRLHFCE    
Sbjct  264   TIHYPSNVPNYTAPTNVYATARTMGPNANVNVNYNLTWIFQVDPGFFYLVRLHFCEILAD  323

Query  1254  ITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             IT+IN+RVF I++NNQTAE GAD + W   NG+P
Sbjct  324   ITKINQRVFQIFINNQTAEDGADVVGWTNGNGIP  357



>ref|XP_007140079.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
 gb|ESW12073.1| hypothetical protein PHAVU_008G082400g [Phaseolus vulgaris]
Length=898

 Score =   425 bits (1093),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 212/342 (62%), Positives = 261/342 (76%), Gaps = 8/342 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQVPFM  527
             D+ PTD ILL+CGGP   TD D R WTTDVGSKF   + KS+T S A +Q P+VPQVP+M
Sbjct  28    DFQPTDNILLDCGGPSSSTDTDGRVWTTDVGSKFDSSSAKSTTVSPAATQDPAVPQVPYM  87

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F + FTY+FPVASG KFLRL+FYPASY+ LNA+++ F+V    YTLL+NFS  QTT
Sbjct  88    TARVFHAPFTYAFPVASGWKFLRLHFYPASYSNLNASDARFAVTANSYTLLRNFSVAQTT  147

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
              ALN+ +++KEF++ V G+TLNVTFTPS N+ N+ AFVNGIEVVS PDIY + DG+TMIV
Sbjct  148   LALNYAYILKEFAIYVEGKTLNVTFTPSTNASNAYAFVNGIEVVSMPDIYTSTDGTTMIV  207

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             G N+   IDNSTALE++YR+NVGGN ISPS DTGMFRSW +D  ++F A  GVTE AD  
Sbjct  208   GTNTAYTIDNSTALENVYRLNVGGNDISPSHDTGMFRSWSDDVPFLFGAAFGVTEPADP-  266

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             ++   YPPG P+Y+AP++VY T RSMGPN  +N NYNL+W F +DSGF YLVRLHF E +
Sbjct  267   DVKFEYPPGTPSYIAPLDVYTTARSMGPNPKINTNYNLSWIFNIDSGFSYLVRLHFAEVS  326

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGK------NGVP  1355
             + IT+ N+RVF I+LNNQTA   AD IAWA +      NGVP
Sbjct  327   SNITKNNQRVFDIFLNNQTATQEADVIAWAKEFGLSHSNGVP  368



>ref|XP_012091030.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=891

 Score =   425 bits (1092),  Expect = 6e-136, Method: Compositional matrix adjust.
 Identities = 215/336 (64%), Positives = 256/336 (76%), Gaps = 6/336 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             YVPTD+ILL+CG     +D D +KWT D  SKFLL +  SS S A +Q  +V QVP+MTA
Sbjct  28    YVPTDRILLDCGATSDSSDSDGQKWTADKNSKFLLSS-NSSISPAATQNSAVSQVPYMTA  86

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R F+S FTYSFPV SGRKF+RLYFYPASY+GLNA++++FSV  G YTLLKNFS  QTTEA
Sbjct  87    RIFRSNFTYSFPVGSGRKFVRLYFYPASYSGLNASDALFSVTAGSYTLLKNFSVAQTTEA  146

Query  714   LNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQ  893
             LN+ F+VKE+S+NV G TLN+TF+P+ N   + AFVNGIE+VS PDIY++ DG+ M+VG 
Sbjct  147   LNYAFIVKEYSINVDGGTLNITFSPASNPSKAYAFVNGIEIVSMPDIYSSTDGTLMMVGD  206

Query  894   -NSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +SP  IDNSTALE++YR+NVGGN ISPS DTGM RSW +D  YI+ AG GV E+AD  N
Sbjct  207   VSSPFYIDNSTALENVYRINVGGNDISPSGDTGMLRSWYDDQPYIYGAGLGVPESADP-N  265

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI  P   P Y+AP +VY T RSMGP   VN NYNLTW F VDSGF YLVRLHFCE + 
Sbjct  266   MTIKDP--TPPYLAPHDVYSTARSMGPTPKVNLNYNLTWIFSVDSGFSYLVRLHFCEVSQ  323

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWA-GKNGVP  1355
              IT IN+RVF I+LNNQTAE  AD +AWA G NG P
Sbjct  324   NITNINQRVFSIFLNNQTAEEQADVVAWANGHNGTP  359



>ref|XP_007033491.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY04417.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=892

 Score =   423 bits (1088),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 210/333 (63%), Positives = 257/333 (77%), Gaps = 4/333 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST-SSADSQKPSVPQVPFM  527
             DYVPT+KILLNCG    +TD DNRKWT DVGSKFL+G G +S  S A +Q P+VP+VP++
Sbjct  28    DYVPTEKILLNCGEKSELTDDDNRKWTPDVGSKFLVGGGTNSVPSQAATQDPAVPEVPYL  87

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F S FTYSFPV +GRKF+RLYF+  SY+G NATN++FSV  G YTLLKNFSA QT+
Sbjct  88    TARVFLSNFTYSFPVVAGRKFVRLYFHANSYDGQNATNALFSVTCGSYTLLKNFSAAQTS  147

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
             EALN+ F++KE+S+NV G+ LN+TF+PS    N+ AFVNGIEV+S PDIY+  DG T IV
Sbjct  148   EALNYAFIIKEYSINVDGDHLNLTFSPSSTPSNAYAFVNGIEVLSMPDIYSNTDGIT-IV  206

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             GQN+   IDNSTALE++YR+NVGGN ISPS DTG+FRSW +D  Y+F A  GV+  AD  
Sbjct  207   GQNNQFTIDNSTALENVYRLNVGGNDISPSGDTGLFRSWYDDQPYLFGAAYGVSGAADP-  265

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             N+T+ Y    PTY+AP  VY T R+MGP A +N  YNLTW F +DSGF +LVRLHFCEFT
Sbjct  266   NVTLDYGT-TPTYIAPKNVYATARAMGPRAEINIKYNLTWMFSIDSGFSFLVRLHFCEFT  324

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKN  1346
               IT+IN+RVF ++LNNQTAE G D IA AG+ 
Sbjct  325   ENITKINQRVFDVFLNNQTAETGVDVIALAGEQ  357



>ref|XP_006429617.1| hypothetical protein CICLE_v10011034mg [Citrus clementina]
 ref|XP_006481221.1| PREDICTED: receptor-like protein kinase FERONIA-like [Citrus 
sinensis]
 gb|ESR42857.1| hypothetical protein CICLE_v10011034mg [Citrus clementina]
Length=895

 Score =   422 bits (1084),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 204/335 (61%), Positives = 251/335 (75%), Gaps = 2/335 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY+P+++ILLNCG    ++D D R WT D+GSKFLL T  S+TS A +Q PS P +P+MT
Sbjct  31    DYIPSEQILLNCGESSILSDDDKRSWTPDIGSKFLLSTKDSTTSKAATQDPSTPTIPYMT  90

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+SEFTYSFPV +GRKF+RLYFYP SYN LNAT+++FSV  G +TLLKNFS  QT E
Sbjct  91    ARVFRSEFTYSFPVVAGRKFVRLYFYPNSYNRLNATDALFSVSTGPFTLLKNFSVAQTAE  150

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ +++KE+++ V GETLN+TF+P  N  N+ AFVNGIEV+S PDIY   DG  MIVG
Sbjct  151   ALNYAYVIKEYAIPVDGETLNITFSPM-NVSNAYAFVNGIEVMSMPDIYKNTDGDLMIVG  209

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q+SP++IDN+TALE++YR+NVGG  ISPS DTG+FRSW +D  YIF A  GV  T    N
Sbjct  210   QSSPISIDNTTALENVYRLNVGGKDISPSGDTGLFRSWYDDQPYIFGAALGVPVTIGP-N  268

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MT+ YP  +P+YVAPV+VY T R MGPN  +N NY L+W F VDSGF YLVRLHFCE   
Sbjct  269   MTVRYPSNIPSYVAPVDVYATARQMGPNPQINLNYELSWVFSVDSGFSYLVRLHFCEVLP  328

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT+IN+RVF I LNNQTA P  D       NG+P
Sbjct  329   EITKINQRVFDILLNNQTAFPAFDVAGLTNGNGIP  363



>ref|XP_010098025.1| Receptor-like protein kinase FERONIA [Morus notabilis]
 gb|EXB74408.1| Receptor-like protein kinase FERONIA [Morus notabilis]
Length=888

 Score =   421 bits (1083),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 211/335 (63%), Positives = 257/335 (77%), Gaps = 5/335 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +YVP ++I LNCGGP    + D +KWT+D GS +L    KS+TS A SQ PSV  +PFMT
Sbjct  30    NYVPAEQIFLNCGGP--TEEADGKKWTSDKGSLYLSKAAKSTTSEASSQDPSVSTIPFMT  87

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR FQS+FTYS  VA GRKF+RLYFYP+SY+GLNA+N+VF V    YTLLKNFS  QTTE
Sbjct  88    ARVFQSDFTYSISVAPGRKFIRLYFYPSSYSGLNASNAVFDVTAQSYTLLKNFSVAQTTE  147

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+  +VKE+SVNV G+TL +TF PS + PN+ AFVNGIE+VS PD+Y +ADG+TMIV 
Sbjct  148   ALNYVSIVKEYSVNVEGDTLALTFKPSSSIPNAYAFVNGIELVSMPDMY-SADGTTMIVS  206

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q+ P  IDN TALE++YR+NVGGN ISPS DTG+FRSW +D+ Y++ A  GV ETAD  N
Sbjct  207   QSVPFIIDNGTALENVYRLNVGGNDISPSKDTGLFRSWYDDTVYLYGAAFGVPETADP-N  265

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI+Y  G+P+YVAPV+VY T RSMGP+  +N NYNLTW   +DSGF YLVRLHFCE   
Sbjct  266   MTITYLDGVPSYVAPVDVYSTARSMGPDWHINLNYNLTWILSIDSGFSYLVRLHFCEVAE  325

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGK-NGV  1352
              IT  N+RVF I+LNNQTA+  AD  AWAG+ NGV
Sbjct  326   NITHSNQRVFTIFLNNQTAQNEADVAAWAGEHNGV  360



>ref|XP_008463270.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463271.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
 ref|XP_008463272.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=897

 Score =   420 bits (1080),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 201/335 (60%), Positives = 251/335 (75%), Gaps = 1/335 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +Y+P D ILL+CGGP    D D+RKW TD  SKF+   G S+ S A +Q PSVP +PFMT
Sbjct  33    NYIPRDVILLDCGGPSTANDIDSRKWNTDDKSKFVPAAGDSTVSKAATQDPSVPDIPFMT  92

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F S FTYSFPVA  R F+RLYFYP+SY GL+A++++FSV    YTLLKNFSA QT  
Sbjct  93    ARVFSSNFTYSFPVAPSRLFVRLYFYPSSYGGLDASDALFSVSTQSYTLLKNFSASQTAA  152

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ +++KE+S++V  + LN+TF PS   P + AFVNGIE+VS PDIY+   GST+IVG
Sbjct  153   ALNYAYIIKEYSIHVDDDRLNLTFIPSSTHPKAYAFVNGIEIVSMPDIYSDTSGSTLIVG  212

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              ++P  +DNSTALE++YR+NVGGN ISPS DTGM+RSW +D+ +++ A  GVT + D  N
Sbjct  213   PSTPFTVDNSTALENVYRLNVGGNDISPSVDTGMYRSWFDDTPFLYGAAQGVTMSTDQ-N  271

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
              T++YPPG PTYVAP  VY T R+MGP+ +VN NYNLTW FPVDS FFYLVRLHFCE   
Sbjct  272   TTLNYPPGFPTYVAPENVYSTARAMGPDNNVNLNYNLTWIFPVDSEFFYLVRLHFCEIAA  331

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT+IN+RVF I+L N+TA   AD IAWAG N  P
Sbjct  332   NITKINQRVFDIFLYNKTAMDSADVIAWAGSNDTP  366



>gb|KDO64141.1| hypothetical protein CISIN_1g036624mg [Citrus sinensis]
Length=893

 Score =   420 bits (1080),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 204/335 (61%), Positives = 250/335 (75%), Gaps = 2/335 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY+P+++ILLNCG    ++D D R WT D+GSKFLL T  S+TS A +Q PS P +P+MT
Sbjct  29    DYIPSEQILLNCGESSILSDDDKRSWTPDIGSKFLLSTKDSTTSKAATQDPSTPTIPYMT  88

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+SEFTYSFPV +GRKF+RLYFYP SYN LNAT+++FSV  G YTLLKNFS  QT E
Sbjct  89    ARVFRSEFTYSFPVVAGRKFVRLYFYPNSYNRLNATDALFSVSTGPYTLLKNFSVAQTAE  148

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ +++KE+++ V GETLN+TF+P  N  N+ AFVNGIEV+S PDIY   DG  MIVG
Sbjct  149   ALNYAYVIKEYAIPVDGETLNITFSPM-NVSNAYAFVNGIEVMSMPDIYKNTDGDLMIVG  207

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q+SP++IDN+TALE++YR+NVGG  ISPS DT +FRSW +D  YIF A  GV  T    N
Sbjct  208   QSSPISIDNTTALENVYRLNVGGKDISPSGDTDLFRSWYDDQPYIFGAALGVPVTIGP-N  266

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MT+ YP  +P+YVAPV+VY T R MGPN  +N NY L+W F VDSGF YLVRLHFCE   
Sbjct  267   MTVRYPSNIPSYVAPVDVYATARQMGPNPQINLNYELSWVFSVDSGFSYLVRLHFCEVLP  326

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT+IN+RVF I LNNQTA P  D       NG+P
Sbjct  327   EITKINQRVFDILLNNQTAFPAFDVAGLTKGNGIP  361



>ref|XP_004142677.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis sativus]
 ref|XP_011653725.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis sativus]
 gb|KGN54458.1| hypothetical protein Csa_4G334690 [Cucumis sativus]
Length=897

 Score =   419 bits (1077),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 200/335 (60%), Positives = 252/335 (75%), Gaps = 1/335 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +Y+P D ILL+CGGP    D DNRKW TD  SKF+  TG SS S A +Q PSVP +PFMT
Sbjct  33    NYIPRDVILLDCGGPSTANDIDNRKWNTDDKSKFVPATGDSSVSKAATQDPSVPDIPFMT  92

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F S FTYSFPVA  R F+RLYFYP+SY GL+A++++FSV    YTLLKNFSA QT  
Sbjct  93    ARVFSSSFTYSFPVAPSRLFVRLYFYPSSYGGLDASDALFSVSTQSYTLLKNFSASQTAA  152

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+ +++KE+S++V  + LN+TFTPS   P + AFVNGIE+VS  DIY+   GST+IVG
Sbjct  153   ALNYAYIIKEYSIHVDDDRLNLTFTPSSTHPKAYAFVNGIEIVSMADIYSDTSGSTLIVG  212

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              ++P  +DNSTALE+++R+NVGGN ISPS DTGM+RSW +D+ +++ A  GVT + D  N
Sbjct  213   PSTPFIVDNSTALENVFRLNVGGNDISPSDDTGMYRSWFDDTPFLYGAAQGVTMSTDQ-N  271

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
              T++YPPG P+YVAP  VY T R+MGP+ +VN NYNLTW FPVDSGFFYLVRLHFCE   
Sbjct  272   TTLNYPPGFPSYVAPENVYSTARAMGPDNNVNLNYNLTWIFPVDSGFFYLVRLHFCEIAA  331

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT++N+RVF I+L N+TA   AD IAW+  N  P
Sbjct  332   NITKVNQRVFDIFLYNKTAMDSADVIAWSKSNDTP  366



>gb|ABT18098.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=892

 Score =   419 bits (1077),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 206/334 (62%), Positives = 252/334 (75%), Gaps = 5/334 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY+PTDKILLNCG     +D D R W+ D  +KFL  +G S TS A +Q PSV ++P+MT
Sbjct  32    DYIPTDKILLNCGASSNSSDADKRAWSADNINKFL-SSGDSKTSPAATQDPSVSEIPYMT  90

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR  +S FTYSFPVA+GRKF+RLYFYP +Y+GLNAT+++FSV  G YTLLKNFSA QT E
Sbjct  91    ARVSRSPFTYSFPVATGRKFVRLYFYPNTYDGLNATDALFSVSFGPYTLLKNFSAAQTAE  150

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL +  +VKEF VNV G +LN+TFTP     N+ AFVNGIEV S PDIY++ DG+  +VG
Sbjct  151   ALTYAVIVKEFIVNVEGGSLNMTFTP---ESNAYAFVNGIEVTSMPDIYSSTDGTLTMVG  207

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +    IDNSTALE+++R+NVGGN ISPS+DTG++RSW +D  Y+F A  G+  TA D N
Sbjct  208   SSGAFTIDNSTALENVFRLNVGGNDISPSADTGLYRSWYDDEPYVFGAAIGIPYTA-DAN  266

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI YP   PTYVAP +VY T R+MGPNA++N NYNLTW F +DSGF YLVRLHFCE  +
Sbjct  267   MTIKYPADTPTYVAPEDVYSTARTMGPNATININYNLTWVFSIDSGFSYLVRLHFCEVAS  326

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
               T+IN+RVF IYLNNQTAEP AD I W G NG+
Sbjct  327   NNTKINQRVFTIYLNNQTAEPEADVIGWVGGNGI  360



>ref|XP_002323088.2| kinase family protein [Populus trichocarpa]
 gb|EEF04849.2| kinase family protein [Populus trichocarpa]
Length=894

 Score =   409 bits (1050),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 209/333 (63%), Positives = 259/333 (78%), Gaps = 3/333 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +YVPT+K LL+CG    + D D R WT+D GS FL  +GKSST++A +Q P+VPQVP++T
Sbjct  29    NYVPTEKTLLDCGANSDLPDSDGRGWTSDKGSSFLSSSGKSSTATASTQDPAVPQVPYLT  88

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR FQS FTYSFPV SG KF+RLYFYP+SYNGLNA++++FSV  G YTLL NFS  QTT+
Sbjct  89    ARIFQSSFTYSFPVVSGHKFVRLYFYPSSYNGLNASDALFSVTAGSYTLLSNFSVAQTTD  148

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+  ++KE+ +NV  +TLN+TF+PS N  ++ AFVNGIE+VS PDIY+ A+G  MIVG
Sbjct  149   ALNYVSIMKEYLINVNDDTLNITFSPSSNPSSAYAFVNGIEIVSMPDIYSNANG-VMIVG  207

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q  P  IDN+TALE++YR+NVGGN I+PS DTG+FRSW +D  Y++ +  GV E+AD  N
Sbjct  208   QGVPYVIDNTTALENVYRLNVGGNSITPSGDTGLFRSWSDDQIYLYGSAFGVPESADP-N  266

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             + I YPPGMP+YVAP  VY T RSMGP  +VN NYNLTW F VDSGF YLVRLHFCE + 
Sbjct  267   VKIRYPPGMPSYVAPDNVYLTARSMGPAPNVNLNYNLTWIFSVDSGFNYLVRLHFCEISN  326

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
              IT+IN+RVF I+LNNQT E  AD IAWAG NG
Sbjct  327   -ITKINQRVFDIFLNNQTVEEAADVIAWAGGNG  358



>ref|XP_002308259.1| kinase family protein [Populus trichocarpa]
 gb|EEE91782.1| kinase family protein [Populus trichocarpa]
Length=893

 Score =   409 bits (1050),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 206/333 (62%), Positives = 260/333 (78%), Gaps = 3/333 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +YVPT+KILL+CG     +D D R WT+D GS FL  +  SST++A +Q PSVPQVP++T
Sbjct  26    NYVPTEKILLDCGANSDQSDSDGRDWTSDRGSSFLSSSTNSSTATASTQDPSVPQVPYLT  85

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTYSFPV SGRKF+RLYFYP+SY+GLNA+N++FSV  G YTLL NFS  QT E
Sbjct  86    ARIFRSSFTYSFPVVSGRKFIRLYFYPSSYSGLNASNALFSVTAGSYTLLSNFSVAQTAE  145

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+  ++KE+ VNV G+TL +TF+PS N  ++ AFVNGIE+VS PDIY+  DG  MIVG
Sbjct  146   ALNYVSIMKEYLVNVDGDTLKITFSPSSNPSSAYAFVNGIEIVSMPDIYSNVDG-VMIVG  204

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q++P  I N+TALE++YR+NVGGN I+PS+DTG+FRSW +D  Y++ A  G+T++AD  N
Sbjct  205   QDAPFTIYNTTALENVYRLNVGGNSITPSADTGLFRSWSDDQIYLYGAAYGLTQSADP-N  263

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI YP GM +YVAP +VY T RSMG +  +N NYNLTW F VDS F YLVRLHFCE + 
Sbjct  264   MTIRYPAGMSSYVAPSDVYATARSMGTDPRINMNYNLTWVFSVDSNFNYLVRLHFCEVSN  323

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
              IT++N++VF I+LNNQTAE GAD IAWAG NG
Sbjct  324   -ITKVNQQVFDIFLNNQTAEDGADVIAWAGGNG  355



>ref|XP_011001679.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=894

 Score =   406 bits (1043),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 210/338 (62%), Positives = 260/338 (77%), Gaps = 6/338 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +YVPT+K LL+CG      D D R WT+D GS FL  +GKSST++A +Q P+VPQVP++T
Sbjct  29    NYVPTEKTLLDCGANSDRPDSDGRDWTSDKGSSFLSSSGKSSTATASTQDPAVPQVPYLT  88

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR FQS FTYSFPV SG KF+RLYFYP+SYNGLNA++++FSV  G YTLL NFS  QTT+
Sbjct  89    ARIFQSNFTYSFPVISGHKFVRLYFYPSSYNGLNASDALFSVTAGSYTLLSNFSVAQTTD  148

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+  ++KE+ +NV G+TLN+TF+PS N  ++ AFVNGIE+VS PDIY+ A+G  MIVG
Sbjct  149   ALNYVSIMKEYLINVNGDTLNITFSPSSNPSSAYAFVNGIEIVSMPDIYSNANG-VMIVG  207

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q  P  IDN+TALE++YR+NVGGN I+PS DTG+FRSW +D  Y++ +  GV E+AD  N
Sbjct  208   QGVPYVIDNTTALENVYRLNVGGNSITPSGDTGLFRSWSDDQIYLYGSAFGVPESADS-N  266

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             + I YP GMP+Y AP  VY T RSMGP  +VN NYNLTW F VD+GF YLVRLHFCE + 
Sbjct  267   VKIRYPQGMPSYDAPDNVYLTARSMGPTPNVNVNYNLTWIFSVDAGFNYLVRLHFCEISN  326

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWA---GKNGVP  1355
              IT+IN+RVF I+LNNQTAE  AD IAWA   G NGVP
Sbjct  327   -ITKINQRVFDIFLNNQTAEEAADVIAWAGGSGNNGVP  363



>ref|XP_007140062.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
 gb|ESW12056.1| hypothetical protein PHAVU_008G081000g [Phaseolus vulgaris]
Length=899

 Score =   405 bits (1041),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 210/342 (61%), Positives = 262/342 (77%), Gaps = 9/342 (3%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQVPFM  527
             D+ PTD ILL+CGGP   TD D R+WTTDVGSKF   + KS+T S A +Q P+VPQVP+M
Sbjct  28    DFQPTDNILLDCGGPPSSTDTDGREWTTDVGSKFDSSSSKSTTVSPAATQDPAVPQVPYM  87

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F + FTY+FPVASG KFLRL+FYPASY+ LNA+N++F+V    YTLL+NFS  QTT
Sbjct  88    TARVFHAPFTYAFPVASGWKFLRLHFYPASYSNLNASNALFAVTANSYTLLRNFSVAQTT  147

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
              ALN+ +++KEF++ V  +TLNVTFTPS N+ N+ AFVNGIEVVS PDIY + DG+TMIV
Sbjct  148   LALNYAYILKEFAIYVERKTLNVTFTPSTNASNAYAFVNGIEVVSMPDIYTSTDGTTMIV  207

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             G ++   IDNSTALE++YR+NVGGN ISPS DTGMFRSW +D  ++F A  GVT+ AD  
Sbjct  208   GTDTAYTIDNSTALENVYRLNVGGNDISPSHDTGMFRSWYDDVPFLFGAAFGVTQPADP-  266

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             ++   YPP  P+Y+AP++VY T RSMGP+ ++N NYNLTW F +DSGF YLVRLHF E +
Sbjct  267   DVKFEYPPSTPSYIAPLDVYTTARSMGPDENINMNYNLTWIFNIDSGFSYLVRLHFAEVS  326

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAG------KNGVP  1355
             + IT +N+RVF I+LNNQTA P AD IAWA        NGVP
Sbjct  327   SNITMVNQRVFDIFLNNQTAAP-ADVIAWAKDFGLSHSNGVP  367



>gb|ABT18099.1| FERONIA receptor-like kinase [Cardamine flexuosa]
Length=898

 Score =   404 bits (1039),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 198/333 (59%), Positives = 243/333 (73%), Gaps = 1/333 (0%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +Y PTD+ILLNCG     +D D R W+ D  +KFL  +G S TS A +Q  SV ++P+MT
Sbjct  32    NYTPTDQILLNCGASSNSSDADKRAWSADDNNKFLSSSGDSKTSPAATQGSSVSEIPYMT  91

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR  QS FTYSF VA+GRK +RLYFYP++Y+GLNAT+ +FS   G YTLLKNFSA QT E
Sbjct  92    ARISQSPFTYSFSVAAGRKIVRLYFYPSTYDGLNATDGLFSFSFGPYTLLKNFSAAQTVE  151

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL +  +VKEF VNV G +LN+TFTP     N+ AFVNGIEV S PDIY+  DG+  +VG
Sbjct  152   ALPYAVIVKEFIVNVEGGSLNMTFTPESTPSNAYAFVNGIEVTSMPDIYSNTDGTLTMVG  211

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +    IDNSTALE+++R+NVGG+ ISPS+DTG++RSW +D  Y+F A  G+   AD   
Sbjct  212   SSGAFTIDNSTALENVFRLNVGGSDISPSADTGLYRSWYDDQPYLFGAAIGIPYPADP-T  270

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             M I+YP G PTYVAP +VY T R+MGPNA +N NYNLTW F +DSGF YLVRLHFCE +T
Sbjct  271   MNITYPTGTPTYVAPKDVYSTARTMGPNARININYNLTWVFSIDSGFSYLVRLHFCEVST  330

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
               T+ N+RVF IYLNNQTAEP AD IAW G  G
Sbjct  331   NTTKSNQRVFAIYLNNQTAEPEADVIAWTGNQG  363



>ref|XP_011016728.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=893

 Score =   403 bits (1036),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 205/333 (62%), Positives = 258/333 (77%), Gaps = 3/333 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             +YVPT+KILL+CG      D D R WT+D GS FL  +  SST++A +Q PSVPQVP++T
Sbjct  26    NYVPTEKILLDCGANSDQPDSDGRDWTSDRGSSFLSSSANSSTATASTQDPSVPQVPYLT  85

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S FTYSFPV SGRKF+RLYFYP+SY+GLNA+N++FSV  G YTLL NFS  QT E
Sbjct  86    ARIFRSNFTYSFPVVSGRKFIRLYFYPSSYSGLNASNALFSVTSGSYTLLSNFSVAQTAE  145

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALN+  ++KE+ V+V G+TLN+TF+PS N  ++ AFVNGIE+VS PDIY+  DG  MIVG
Sbjct  146   ALNYVSIMKEYLVSVDGDTLNITFSPSSNPTSAYAFVNGIEIVSMPDIYSNVDG-VMIVG  204

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q +P  IDN+TALE++YR+NVGGN I+PS+DTG+FRSW +D  Y++ A  G+ ++AD  N
Sbjct  205   QLAPFTIDNTTALENVYRLNVGGNSITPSADTGLFRSWSDDQIYLYGAAFGLPQSADP-N  263

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTI YP GM +YVAP +VY T R+MG +  +N NYNLTW F VDS F YLVRLHFCE + 
Sbjct  264   MTIRYPAGMSSYVAPSDVYATARTMGTDPRINMNYNLTWVFSVDSNFNYLVRLHFCEVSK  323

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
              IT++N+RVF I+LNNQTA  GAD IAWAG NG
Sbjct  324   -ITKVNQRVFDIFLNNQTAGDGADVIAWAGGNG  355



>gb|EYU42039.1| hypothetical protein MIMGU_mgv1a001343mg [Erythranthe guttata]
Length=837

 Score =   400 bits (1028),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 201/336 (60%), Positives = 236/336 (70%), Gaps = 50/336 (15%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DYV TD+  LNCGGP   TD D RKWT+D+GSKF L T KSSTS A +QKPSVP+VP+MT
Sbjct  27    DYVATDQFFLNCGGPPDSTDPDGRKWTSDIGSKFALSTTKSSTSPAATQKPSVPEVPYMT  86

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR FQSEFTYSFPVA GRKF+RLYFYPA+YN                             
Sbjct  87    ARIFQSEFTYSFPVAPGRKFVRLYFYPATYN-----------------------------  117

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
                                LNVTFTPSPN+ NS AFVNGIEVVSHPDIY+T DG+  +VG
Sbjct  118   ------------------VLNVTFTPSPNTSNSYAFVNGIEVVSHPDIYST-DGTVKVVG  158

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q +  NIDN TALE++YR+NVGGN ISPS DTG+FRSW +DS YI+ A  GVTE  D  N
Sbjct  159   QTTGFNIDNGTALENVYRLNVGGNDISPSRDTGLFRSWRDDSSYIYGAANGVTEVPDS-N  217

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +T+ YP G P+Y+AP++VY+TLRSMGP  +VN NYNLTW F VD+GF YLVRLHFCE T 
Sbjct  218   VTVGYPSGSPSYIAPIDVYRTLRSMGPTTAVNQNYNLTWQFNVDTGFSYLVRLHFCEITD  277

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAW-AGKNGVP  1355
             +IT++N+RVFII++ NQTAE  AD IAW  GKNG+P
Sbjct  278   VITKVNQRVFIIFMGNQTAEKEADVIAWGGGKNGIP  313



>emb|CDY29022.1| BnaC07g32280D [Brassica napus]
Length=803

 Score =   399 bits (1024),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 204/336 (61%), Positives = 240/336 (71%), Gaps = 27/336 (8%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY PTDKILLNCGG   +TD DNR W  DV SK    +G S TS A +Q PSVP+VP+MT
Sbjct  27    DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKLFSSSGDSKTSPAATQDPSVPEVPYMT  86

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG-EYTLLKNFSAGQTT  707
             AR F+S FTYSFPVASGRKF+RLYF+P SY+GLNATNS+FSV +G  YTLLKNFSA QT 
Sbjct  87    ARIFRSPFTYSFPVASGRKFVRLYFHPNSYDGLNATNSLFSVTLGSSYTLLKNFSAAQTA  146

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
             +AL++                         S  + AFVNGIEV S PD+Y+  DG+  IV
Sbjct  147   QALSY-------------------------SSIAYAFVNGIEVTSMPDLYSNTDGTLSIV  181

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             G ++ ++IDNSTALE++YR+NVGGN ISPS DTG++RSW +DS YIF+AG GV +TAD  
Sbjct  182   GSSTAVDIDNSTALENVYRLNVGGNDISPSEDTGLYRSWYDDSPYIFAAGIGVVDTADP-  240

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             NMTI YP   PTY+APV+VY T RSM P A +N N NLTW F VDSGF YLVRLHFCE  
Sbjct  241   NMTIKYPADTPTYIAPVDVYSTARSMTPTAQINLNSNLTWVFSVDSGFTYLVRLHFCEVL  300

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
               IT+IN+RVF IYLNNQTAE  AD   W G NG+P
Sbjct  301   PNITKINQRVFTIYLNNQTAESEADVAGWTGGNGIP  336



>emb|CDX90645.1| BnaA03g41360D [Brassica napus]
Length=814

 Score =   396 bits (1017),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 201/337 (60%), Positives = 239/337 (71%), Gaps = 30/337 (9%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY PTDKILLNCGG   +TD DNR W  DV SKFL  +G S TS A +Q PSVP+VP+MT
Sbjct  30    DYTPTDKILLNCGGSSDLTDTDNRTWIPDVKSKFLSSSGDSKTSPAATQDPSVPEVPYMT  89

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG--EYTLLKNFSAGQT  704
             AR F+S FTYSFPVASGRKF+RLYF+P SY+GLNAT S+FSV +G   YTLLKNFSA QT
Sbjct  90    ARIFRSPFTYSFPVASGRKFVRLYFHPNSYDGLNATTSLFSVTLGSSSYTLLKNFSAAQT  149

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMI  884
              +AL++  +VKEF VN                           V S PD+Y+  DG+  I
Sbjct  150   AQALSYSSIVKEFIVN---------------------------VTSMPDLYSNTDGTLSI  182

Query  885   VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
             VG ++ ++IDNSTALE++YR+NVGGN ISPS DTG++RSW +DS YIF+AG GV ET D 
Sbjct  183   VGSSTAVDIDNSTALENVYRLNVGGNDISPSEDTGLYRSWYDDSPYIFTAGIGVVETVDP  242

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              N+TI YP   PTY+APV+VY T RSM P A +N N+NLTW F +DSGF YLVRLHFCE 
Sbjct  243   -NVTIKYPTDTPTYIAPVDVYSTARSMTPTAQINLNFNLTWVFSIDSGFTYLVRLHFCEV  301

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                IT+IN+RVF IYLNNQTAE  AD   W G NG+P
Sbjct  302   LPDITKINQRVFTIYLNNQTAESEADVAGWTGGNGIP  338



>ref|XP_010683454.1| PREDICTED: receptor-like protein kinase FERONIA [Beta vulgaris 
subsp. vulgaris]
Length=881

 Score =   389 bits (998),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 196/335 (59%), Positives = 244/335 (73%), Gaps = 3/335 (1%)
 Frame = +3

Query  354   YVPTDKILLNCGGPD-GVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             Y P D ILLNCG  D   TD D R W +D GSKF+  T  SS ++A +Q P V +VP+MT
Sbjct  23    YTPHDNILLNCGASDRQSTDVDGRNWNSDDGSKFMSTTRGSSMATAATQAPDVGEVPYMT  82

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F S FTYS  VA GRKFLRLYFYP +Y+G N+TN +FSV  G +TLL NFSA QTTE
Sbjct  83    ARIFDSNFTYSIAVAPGRKFLRLYFYPNTYSGRNSTNGIFSVTAGPFTLLSNFSAAQTTE  142

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ALNFD+L+KE+S++V GETL++TF+PS N  +S AFVNGIEVVS PDIY++A G T +VG
Sbjct  143   ALNFDYLIKEYSLHVEGETLSLTFSPSSNYSDSFAFVNGIEVVSMPDIYDSATGVT-VVG  201

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +SP  IDNSTALE +YR+NVGGN I P +DTG+FRSW +D+ YIF A TG T   D   
Sbjct  202   VDSPFTIDNSTALEGLYRLNVGGNYIPPDNDTGIFRSWSDDTPYIFGAATGTTNVIDP-E  260

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             + +++P  +P+Y APV VY T R M  N +VN N+NLTW F VD+GF YLVRLHFC+  +
Sbjct  261   LNVTFPSSLPSYTAPVTVYSTARFMTMNNTVNQNFNLTWLFTVDTGFSYLVRLHFCQIFS  320

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              I+++N+ VF +YLNNQTA P  D I  A  NG+P
Sbjct  321   NISKVNQMVFDVYLNNQTAFPAYDIIPLADGNGIP  355



>ref|XP_010553161.1| PREDICTED: receptor-like protein kinase FERONIA [Tarenaya hassleriana]
Length=852

 Score =   382 bits (982),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 195/338 (58%), Positives = 237/338 (70%), Gaps = 7/338 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             DY P DKI L+CG     TD D R+W  DV SKFL   G S  + A +Q P VPQVPFMT
Sbjct  34    DYSPIDKIFLSCGESSQRTDSDQRQWIPDVNSKFL-SPGSSKPAKAATQDPGVPQVPFMT  92

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F S FTYSFPV  GRKFLRLYFY  SY+ LNAT+++FSV  G Y LL NFS  QT+E
Sbjct  93    ARIFHSAFTYSFPVEPGRKFLRLYFYANSYDALNATDALFSVSSGPYQLLHNFSVSQTSE  152

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             AL++ ++ KE+ +NV    LNVTF P+  +  S AFVNGIE+VS PDIY    G+ M+VG
Sbjct  153   ALSYAYITKEYVLNVDDGPLNVTFLPA--AAASFAFVNGIEIVSMPDIYRNIRGNLMVVG  210

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              ++   IDNSTALE+++R+NVGGN IS S DTG+ RSW +D  YIF+A  G+T+ AD  +
Sbjct  211   SSTAFTIDNSTALENVFRLNVGGNDISASGDTGLMRSWFDDQPYIFAAAQGMTQMADP-S  269

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             + I+YPP +P Y+AP  VY T R M  NA +N N NLTW F V S F YLVRLHFCE + 
Sbjct  270   LNITYPPQVPPYIAPRNVYATARLMTRNAQINLNSNLTWTFSVHSDFAYLVRLHFCEISE  329

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWA---GKNGVP  1355
              +T+IN+RVF I+LNNQTAE  AD IAWA   GKNGVP
Sbjct  330   FVTKINQRVFSIFLNNQTAEAEADVIAWAGGDGKNGVP  367



>ref|XP_008810848.1| PREDICTED: receptor-like protein kinase FERONIA [Phoenix dactylifera]
Length=891

 Score =   380 bits (975),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/337 (56%), Positives = 243/337 (72%), Gaps = 10/337 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  524
             YVP D ILLNCG      D D R WT D GSK+   + G G +    A SQ  SVPQVP+
Sbjct  35    YVPRDNILLNCGASGQDKDTDGRIWTADAGSKYAPSINGVGLT----ASSQDSSVPQVPY  90

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             +TAR F S +TY+FP+ +GRKF+RLYFYP++Y+G  A+++ FSV     TLL+NFSA  T
Sbjct  91    LTARFFTSPYTYTFPLGAGRKFIRLYFYPSNYSGHAASDAFFSVTAASSTLLQNFSAYLT  150

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMI  884
              +ALNF +LV+EFSVNV    LN+TFTPS + P+S AFVNGIE+VS PDI+ T  GS ++
Sbjct  151   ADALNFAYLVREFSVNVSSSGLNLTFTPSADHPHSYAFVNGIEIVSIPDIFTT--GSALL  208

Query  885   VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
              G ++   ID   A+E+++R+NVGG  ISP  D+G+FRSWD+DS YI+ A  GV+ + +D
Sbjct  209   AGTSTEYPIDQDWAIETVHRLNVGGQAISPIQDSGLFRSWDDDSPYIYGAAIGVSYS-ND  267

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              N+TI YP  +P Y+APV+VY T RSMGP+A VN NYNLTW  PVD+GF++LVRLHFCE 
Sbjct  268   PNVTIKYPTTLPAYIAPVDVYSTARSMGPDAQVNLNYNLTWILPVDAGFYHLVRLHFCEI  327

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                 T+IN+RVF IYLNNQTA+ GAD IAW+   G+P
Sbjct  328   QYPTTKINQRVFDIYLNNQTAQDGADVIAWSNGIGIP  364



>ref|XP_010938035.1| PREDICTED: receptor-like protein kinase FERONIA [Elaeis guineensis]
Length=891

 Score =   373 bits (958),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 186/337 (55%), Positives = 243/337 (72%), Gaps = 10/337 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  524
             YVP D ILLNCG      D D R WT D GSK+   + G G +    A SQ  SVPQVP+
Sbjct  36    YVPRDNILLNCGASGQDKDTDGRIWTGDAGSKYAPSINGVGLT----APSQDSSVPQVPY  91

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             +TAR F S +TY+FP+ +GRKF+RLYFYP++Y+   A+++ FSV  G +TLL+NFSA  T
Sbjct  92    LTARFFTSPYTYTFPLGAGRKFIRLYFYPSNYSDRAASDAFFSVTAGSHTLLQNFSAYLT  151

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMI  884
              +ALNF +L++EFSVNV    LN+TFTPS + PNS AFVNGIE+VS PDI+ T   S ++
Sbjct  152   ADALNFAYLIREFSVNVSSSGLNLTFTPSADHPNSYAFVNGIEIVSIPDIFTTT--SAVL  209

Query  885   VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
             VG ++   ID  +A+E++YR+NVGG  +SP+ D+G+FRSWD+DS YI+ A  GV+  ++D
Sbjct  210   VGTSTDFPIDQDSAIETVYRLNVGGQALSPTQDSGLFRSWDDDSPYIYGAAFGVS-YSND  268

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              N+TI Y   +P Y+APV+VY T RSMGP+A VN NYNLTW  PVD+GF+YLVRLHFCE 
Sbjct  269   PNVTIKYSTTLPEYIAPVDVYSTARSMGPDARVNMNYNLTWILPVDAGFYYLVRLHFCEI  328

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                +T++N+RVF IYLNN TA  GAD I W+   G+P
Sbjct  329   QYPMTKVNQRVFDIYLNNLTAFGGADVIGWSQGIGIP  365



>ref|XP_010667956.1| PREDICTED: receptor-like protein kinase FERONIA [Beta vulgaris 
subsp. vulgaris]
Length=412

 Score =   355 bits (912),  Expect = 7e-115, Method: Compositional matrix adjust.
 Identities = 181/336 (54%), Positives = 233/336 (69%), Gaps = 6/336 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDG-VTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFM  527
             D++  D ILLNCG  D   TD D R WT+D GSKFL  +  S  +SA ++ P V  +P+M
Sbjct  22    DFIAKDNILLNCGSFDAKTTDSDGRNWTSDNGSKFLQSSKGSFRASATTEAPDVGNIPYM  81

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             +AR F S  TYSFPV+ GR FLRLYFYP  Y+  N+ N+VFSV  G YTLL+NF+A QT 
Sbjct  82    SARIFHSNATYSFPVSPGRIFLRLYFYPNVYSRSNSANAVFSVTAGPYTLLRNFNASQTA  141

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
             + L+  F++KE+S+NV G  L +TF P   SP S AFVNGIEVVS P IY+   G+  IV
Sbjct  142   KKLDAHFIIKEYSINVDGGVLTITFIP---SPKSFAFVNGIEVVSMPSIYDNDVGAN-IV  197

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             G +SP  IDNSTALE++YR+NVGGN I P+ DTG+FRSW +D+ Y F    G T  AD  
Sbjct  198   GTSSPFQIDNSTALENLYRLNVGGNHIPPTQDTGLFRSWYDDTPYKFGTEIGFTAIADP-  256

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             N+TI++P  + +Y APV+VY T R M P++ VN N+NLTW FP+D+GF YL+R+HFC+  
Sbjct  257   NVTITFPKSIESYTAPVDVYATARFMTPDSMVNLNFNLTWLFPIDTGFAYLIRMHFCQIF  316

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
               I +IN+ VF +YLNNQTA PG D +A    NG+P
Sbjct  317   FNIDKINQIVFNVYLNNQTAFPGFDVVALTSSNGIP  352



>ref|XP_004984479.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=884

 Score =   368 bits (944),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 187/335 (56%), Positives = 236/335 (70%), Gaps = 5/335 (1%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             +VP D ILL+CG      D D R W  D GSK+   +  ++ + A  Q PSVPQVP++TA
Sbjct  30    FVPRDDILLDCGAKGQGNDTDGRMWGGDEGSKYAPPSNLAAAAPASGQDPSVPQVPYLTA  89

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R   S FTYSFP+  GRKFLRL+FYPA+Y+  +A + VFSV VG+ TLL NFSA QT  A
Sbjct  90    RVSASPFTYSFPLGPGRKFLRLHFYPANYSNRDAADGVFSVSVGKLTLLSNFSAYQTAAA  149

Query  714   LNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQ  893
             + F +LV+EFSVNV   TL++TFTP  + PN+ AFVNGIEVVS PD++       M+ G 
Sbjct  150   ITFSYLVREFSVNV-SSTLDLTFTPEKSHPNAYAFVNGIEVVSSPDLFGLTP-PNMVTGD  207

Query  894   --NSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
               N P +ID S A++++YR+NVGG  ISPS DTG +RSWD+DS YIF A  GV+  +D  
Sbjct  208   GNNQPFSIDASVAMQTMYRLNVGGQAISPSKDTGGYRSWDDDSPYIFGASFGVSYPSDP-  266

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             N+TI+YP  +P YVAP++VY T RSMGP+ +VN NYNLTW   VD+GF YLVR+HFCE  
Sbjct  267   NVTITYPSNVPEYVAPMDVYSTARSMGPDKNVNLNYNLTWMLQVDAGFNYLVRMHFCEIQ  326

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
               IT+IN+RVF IY+NNQTA  GAD IAWA  +G 
Sbjct  327   YPITKINQRVFDIYINNQTAMNGADVIAWASVSGA  361



>ref|XP_003557976.1| PREDICTED: receptor-like protein kinase FERONIA [Brachypodium 
distachyon]
Length=898

 Score =   368 bits (944),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 185/336 (55%), Positives = 237/336 (71%), Gaps = 6/336 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             +VP D ILL+CG      D D R+W  D GSK+      S+ + A  Q PSVPQVP++TA
Sbjct  45    FVPRDDILLDCGATGNGNDTDGREWGGDAGSKYAPANLGSAIAGA--QDPSVPQVPYLTA  102

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV--GEYTLLKNFSAGQTT  707
             R   + FTYSFP+  GRKFLRL+FYPA+Y+  NA ++ FSV V   + TLL NFSA QT+
Sbjct  103   RVSAAPFTYSFPLGPGRKFLRLHFYPANYSNRNAADAFFSVTVPAAKVTLLSNFSAYQTS  162

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGS-TMI  884
              ALNF +L++EFSVNV G+TL++TFTP    PN+ AF+NGIEVVS PD+++ +     M 
Sbjct  163   TALNFAYLIREFSVNVTGQTLDLTFTPEKGHPNAYAFINGIEVVSSPDLFDLSTPELVMG  222

Query  885   VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
              G N P  ++  TAL+++YR+NVGG  ISPS DTG +RSWD+D+ YI+ AG GV+   +D
Sbjct  223   DGNNQPYTMEAGTALQTMYRLNVGGQAISPSKDTGGYRSWDDDTPYIWGAGAGVS-YQND  281

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              N+TI+YP  +P YVAP +VY T RSMGP+  VN  YNLTW   VD+GFFYLVRLHFCE 
Sbjct  282   ANVTITYPDNVPGYVAPTDVYATARSMGPDKDVNLAYNLTWIMQVDAGFFYLVRLHFCEI  341

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
              + IT+ N+RVF IY+NNQTA  GAD I WA  NG+
Sbjct  342   QSPITKPNQRVFDIYINNQTAMAGADVILWASPNGI  377



>ref|XP_008660180.1| PREDICTED: receptor-like protein kinase FERONIA [Zea mays]
 gb|AFW88468.1| putative receptor-like protein kinase family protein [Zea mays]
Length=888

 Score =   364 bits (935),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 185/339 (55%), Positives = 234/339 (69%), Gaps = 8/339 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             +VP D ILL+CG      D D R WT D GSKF      +S +SA  Q PSVPQVP++TA
Sbjct  27    FVPRDDILLDCGAKGQGNDTDGRVWTGDAGSKFAPPDNLASVASASGQDPSVPQVPYLTA  86

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV----GEYTLLKNFSAGQ  701
             R   S FTYSFP+  GRKFLRL+FYPA+Y+  +A + +FSV V    G+ TLL NFSA Q
Sbjct  87    RVSASPFTYSFPLGPGRKFLRLHFYPANYSNHDAADGLFSVSVAVPGGKLTLLSNFSAYQ  146

Query  702   TTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTM  881
             T  A+ + +L++EFSVNV   TL++TFTP    PN+ AFVNGIEVVS PD+++ +    M
Sbjct  147   TAAAITYSYLIREFSVNVSSATLDLTFTPEKGHPNAYAFVNGIEVVSSPDLFDIST-PNM  205

Query  882   IVGQN--SPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTET  1055
             + G     P  ID  TA++++YR+NVGG  ISPS DTG +RSWD+D+ YIF AG GV+  
Sbjct  206   VTGDGNLQPFPIDAGTAVQTMYRLNVGGQAISPSKDTGGYRSWDDDTAYIFGAGFGVSYP  265

Query  1056  ADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHF  1235
              D+ N+TI+YP  +P YVAP +VY T RSMGP+ +VN NYNLTW   VD+GF YL+RLHF
Sbjct  266   KDN-NVTITYPSNVPEYVAPEDVYGTARSMGPDKNVNMNYNLTWMLQVDAGFMYLIRLHF  324

Query  1236  CEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
             CE    IT+IN+RVF IY+NNQTA   AD  AWA  +G 
Sbjct  325   CEIQYPITKINQRVFSIYINNQTAVKDADVNAWATMSGA  363



>ref|XP_002467915.1| hypothetical protein SORBIDRAFT_01g036260 [Sorghum bicolor]
 gb|EER94913.1| hypothetical protein SORBIDRAFT_01g036260 [Sorghum bicolor]
Length=895

 Score =   364 bits (935),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 186/339 (55%), Positives = 233/339 (69%), Gaps = 8/339 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             +VP D ILL+CG      D D R WT D GSK+      +S +SA  Q PSVPQVP++TA
Sbjct  34    FVPRDDILLDCGAKGQGNDTDGRVWTGDAGSKYAPPDNLASVASASGQDPSVPQVPYLTA  93

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV----GEYTLLKNFSAGQ  701
             R   S FTYSFP+  GRKFLRL+FYPA+Y+  +A + +FSV V    G+ TLL NFSA Q
Sbjct  94    RVSASPFTYSFPLGPGRKFLRLHFYPANYSNRDAADGLFSVSVAIPGGKLTLLSNFSAYQ  153

Query  702   TTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTM  881
             T  A+ + +LV+EFSVNV  +TL++TFTP    PN+ AFVNGIEVVS PD+++ +    M
Sbjct  154   TAAAITYSYLVREFSVNVSSQTLDLTFTPEKGHPNAYAFVNGIEVVSSPDLFDLSI-PNM  212

Query  882   IVGQNS--PLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTET  1055
             + G  S     ID  TA++++YR+NVGG  ISPS DTG +RSWD+DS YIF A  GV+  
Sbjct  213   VAGDGSLQQFEIDPGTAMQTMYRLNVGGQAISPSKDTGGYRSWDDDSTYIFGASFGVSYP  272

Query  1056  ADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHF  1235
              D+ N+TI+YP  +P YVAP +VY T RSMGP   VN N+NLTW   VD+GF YL+RLHF
Sbjct  273   KDN-NVTITYPSNVPEYVAPEDVYGTARSMGPTKEVNMNFNLTWMLQVDAGFLYLIRLHF  331

Query  1236  CEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
             CE    IT IN+RVF IY+NNQTA  GAD IAWA  +G 
Sbjct  332   CEIQYPITMINQRVFNIYINNQTAVKGADVIAWAAVSGA  370



>gb|EAY75971.1| hypothetical protein OsI_03893 [Oryza sativa Indica Group]
Length=859

 Score =   363 bits (931),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 233/336 (69%), Gaps = 6/336 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             +VP D ILL+CG      D D R W+ D GSK+        ++SA  Q PSVPQVP++TA
Sbjct  44    FVPRDDILLDCGATGKGNDTDGRVWSGDAGSKY--APASLGSASAAGQDPSVPQVPYLTA  101

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV--GEYTLLKNFSAGQTT  707
             R   + FTYSFP+ +GRKFLRL+FYPA+Y+  +A ++ FSV V     TLL NFSA QT 
Sbjct  102   RVSAAPFTYSFPLGAGRKFLRLHFYPANYSSRDAADARFSVSVPAANVTLLSNFSAYQTA  161

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
              ALNF ++V+EFSVNV   T+ +TFTP    PN+ AFVNGIEVVS PD+++ +  + +  
Sbjct  162   TALNFAYIVREFSVNVTTPTMELTFTPEKGHPNAYAFVNGIEVVSSPDLFDISTPNLVTG  221

Query  888   -GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
              G N P  ID  TAL+++YR+NVGG  ISPS DTG +RSWD+DS Y+F A  GV+   DD
Sbjct  222   DGNNQPFPIDAGTALQTMYRLNVGGQAISPSKDTGGYRSWDDDSPYVFGAAFGVSYPKDD  281

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              N+TI+YP  +P YVAPV+VY T RSMGP+ +VN  YNLTW   VD+GF YLVRLHFCE 
Sbjct  282   -NVTIAYPSNVPEYVAPVDVYATARSMGPDKNVNLAYNLTWIMQVDAGFTYLVRLHFCEI  340

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
                IT IN+RVF IY+NNQTA  GAD IAW   NG+
Sbjct  341   QYPITMINQRVFNIYINNQTAFQGADVIAWTNNNGI  376



>ref|NP_001044372.1| Os01g0769700 [Oryza sativa Japonica Group]
 dbj|BAB56062.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAD53342.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF06286.1| Os01g0769700 [Oryza sativa Japonica Group]
 gb|EEE55446.1| hypothetical protein OsJ_03602 [Oryza sativa Japonica Group]
Length=896

 Score =   363 bits (931),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 186/336 (55%), Positives = 233/336 (69%), Gaps = 6/336 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             +VP D ILL+CG      D D R W+ D GSK+        ++SA  Q PSVPQVP++TA
Sbjct  44    FVPRDDILLDCGATGKGNDTDGRVWSGDAGSKY--APASLGSASAAGQDPSVPQVPYLTA  101

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV--GEYTLLKNFSAGQTT  707
             R   + FTYSFP+ +GRKFLRL+FYPA+Y+  +A ++ FSV V     TLL NFSA QT 
Sbjct  102   RVSAAPFTYSFPLGAGRKFLRLHFYPANYSSRDAADARFSVSVPAANVTLLSNFSAYQTA  161

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
              ALNF ++V+EFSVNV   T+ +TFTP    PN+ AFVNGIEVVS PD+++ +  + +  
Sbjct  162   TALNFAYIVREFSVNVTTPTMELTFTPEKGHPNAYAFVNGIEVVSSPDLFDISTPNLVTG  221

Query  888   -GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
              G N P  ID  TAL+++YR+NVGG  ISPS DTG +RSWD+DS Y+F A  GV+   DD
Sbjct  222   DGNNQPFPIDAGTALQTMYRLNVGGQAISPSKDTGGYRSWDDDSPYVFGAAFGVSYPKDD  281

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              N+TI+YP  +P YVAPV+VY T RSMGP+ +VN  YNLTW   VD+GF YLVRLHFCE 
Sbjct  282   -NVTIAYPSNVPEYVAPVDVYATARSMGPDKNVNLAYNLTWIMQVDAGFTYLVRLHFCEI  340

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
                IT IN+RVF IY+NNQTA  GAD IAW   NG+
Sbjct  341   QYPITMINQRVFNIYINNQTAFQGADVIAWTNNNGI  376



>ref|XP_009391670.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   362 bits (929),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 182/337 (54%), Positives = 237/337 (70%), Gaps = 8/337 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSK---FLLGTGKSSTSSADSQKPSVPQVPF  524
             YVP D ILL+CG     TD + R WT D GSK   FL G G     +A  Q  SVPQVP+
Sbjct  34    YVPRDHILLDCGASGQATDANGRSWTADSGSKYAPFLNGGG----FTAPLQDSSVPQVPY  89

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             +TAR F S +TYSFP+ +GRKF+RL+FYP++Y+   A+++ FSV  G YTLL NFSA QT
Sbjct  90    LTARVFTSPYTYSFPLGAGRKFIRLHFYPSNYSNHAASDAFFSVTAGPYTLLHNFSAYQT  149

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMI  884
              +ALNF +L +EFSVNV    LN+TFTPS    NS AFVNGIE+VS PD +++A    + 
Sbjct  150   ADALNFAYLTREFSVNVSTGGLNLTFTPSTGRANSYAFVNGIEIVSIPDFFSSARPVLLN  209

Query  885   VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
              G      +D   ALE++YR+NVGG  I P+ D+ +FR+W +DS YI+ A  GVT  ++D
Sbjct  210   GGTPIVYTVDQDQALETVYRLNVGGQAIPPTKDSSLFRTWGDDSPYIYGAAFGVT-YSND  268

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              N++I+YP  +P Y+AP++VY T RSMGP++ VN NYNLTW  PVD+GF+YLVRLHFCE 
Sbjct  269   PNVSITYPTTVPNYIAPLDVYSTARSMGPDSQVNLNYNLTWILPVDAGFYYLVRLHFCEI  328

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                IT++N+RVF IY+NNQTA+  AD IAW+G  G+P
Sbjct  329   QYPITKMNQRVFDIYINNQTAQLQADVIAWSGGIGIP  365



>ref|XP_009419820.1| PREDICTED: receptor-like protein kinase FERONIA isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=531

 Score =   350 bits (899),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 179/339 (53%), Positives = 233/339 (69%), Gaps = 11/339 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  524
             YVP D ILLNCG     +  D R WT D G+++   L G G      A  Q PSV  VP+
Sbjct  31    YVPRDDILLNCGASGQASSFDGRSWTGDTGTRYAPSLNGDGFD----ALRQDPSVSTVPY  86

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
              TAR F S FTY FP+++GRKF+RL+FYP+ Y+    +++ FSV  G YTLL NFS+  T
Sbjct  87    STARVFTSPFTYRFPLSAGRKFIRLHFYPSDYSNHAVSDAFFSVTSGPYTLLHNFSSYLT  146

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMI  884
              +ALNF +L++E+SVNV    LN+TF PS   PNS AF+NGIE+VS PD++++A    ++
Sbjct  147   ADALNFAYLIREYSVNVSTGGLNLTFIPSTTHPNSYAFINGIEIVSIPDLFSSAT-PLLV  205

Query  885   VGQNSPL--NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETA  1058
              G +  +   ID   ALE++YR+NVGG  I P  D+G+FRSWD+DS YI+ A  GVT + 
Sbjct  206   DGDDGHIVYTIDPDQALETVYRLNVGGQAIPPIEDSGLFRSWDDDSPYIYGAAFGVTYS-  264

Query  1059  DDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFC  1238
             +D N+TI+YP  +P+Y+AP +VY T RSMGPNA VN NYNLTW  PVD+GF++LVRLHFC
Sbjct  265   NDPNVTITYPTSVPSYIAPPDVYSTARSMGPNAQVNLNYNLTWILPVDAGFYFLVRLHFC  324

Query  1239  EFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             E    I +IN+RVF IYLNNQTA   AD I W+G  G+P
Sbjct  325   EIQYPIVKINQRVFDIYLNNQTATEEADVIGWSGGIGIP  363



>ref|XP_009419819.1| PREDICTED: receptor-like protein kinase FERONIA isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=545

 Score =   350 bits (899),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 179/339 (53%), Positives = 233/339 (69%), Gaps = 11/339 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  524
             YVP D ILLNCG     +  D R WT D G+++   L G G      A  Q PSV  VP+
Sbjct  45    YVPRDDILLNCGASGQASSFDGRSWTGDTGTRYAPSLNGDGFD----ALRQDPSVSTVPY  100

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
              TAR F S FTY FP+++GRKF+RL+FYP+ Y+    +++ FSV  G YTLL NFS+  T
Sbjct  101   STARVFTSPFTYRFPLSAGRKFIRLHFYPSDYSNHAVSDAFFSVTSGPYTLLHNFSSYLT  160

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMI  884
              +ALNF +L++E+SVNV    LN+TF PS   PNS AF+NGIE+VS PD++++A    ++
Sbjct  161   ADALNFAYLIREYSVNVSTGGLNLTFIPSTTHPNSYAFINGIEIVSIPDLFSSAT-PLLV  219

Query  885   VGQNSPL--NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETA  1058
              G +  +   ID   ALE++YR+NVGG  I P  D+G+FRSWD+DS YI+ A  GVT + 
Sbjct  220   DGDDGHIVYTIDPDQALETVYRLNVGGQAIPPIEDSGLFRSWDDDSPYIYGAAFGVTYS-  278

Query  1059  DDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFC  1238
             +D N+TI+YP  +P+Y+AP +VY T RSMGPNA VN NYNLTW  PVD+GF++LVRLHFC
Sbjct  279   NDPNVTITYPTSVPSYIAPPDVYSTARSMGPNAQVNLNYNLTWILPVDAGFYFLVRLHFC  338

Query  1239  EFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             E    I +IN+RVF IYLNNQTA   AD I W+G  G+P
Sbjct  339   EIQYPIVKINQRVFDIYLNNQTATEEADVIGWSGGIGIP  377



>ref|XP_008813242.1| PREDICTED: receptor-like protein kinase FERONIA [Phoenix dactylifera]
Length=894

 Score =   360 bits (924),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 183/336 (54%), Positives = 239/336 (71%), Gaps = 11/336 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  524
             Y   DKI LNCG    VTD D   WT D GSK+   + G G    +SA SQ  SVPQ+P+
Sbjct  38    YNARDKIFLNCGASGQVTDTDGLNWTGDAGSKYAPSINGAG----ASASSQDSSVPQIPY  93

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR F S +TY+FP+  G KF+RLYFYP++Y+   A+++ FSV  G  TLL+NFSA  T
Sbjct  94    MTARVFTSPYTYTFPLGPGGKFVRLYFYPSNYSSRAASDAFFSVTAGSNTLLQNFSAYLT  153

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTM  881
               ALNF++LV+E+SVNV    LN+TFTPSP+ PNS AFVNGIE+VS P DI+N  +   +
Sbjct  154   ANALNFNYLVREYSVNVSSGALNLTFTPSPDHPNSYAFVNGIEIVSIPDDIFNPVN--PL  211

Query  882   IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
             +VG ++   +++ +A +++YR+NVGG  ISP+ D+G+FRSWD+D+ YI+ A  GVT + +
Sbjct  212   LVGTSTSYTMEDGSATQTVYRLNVGGQAISPTQDSGLFRSWDDDTPYIYGAAFGVTYS-N  270

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
             D N++I YP  +P Y+AP +VY T RSMGP+A +N NYNLTW  PVD+GF+YLVRLHFCE
Sbjct  271   DPNVSIQYPASVPEYIAPEDVYSTARSMGPDAHINLNYNLTWILPVDAGFYYLVRLHFCE  330

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
                 IT  N+RVF IYLNN TA  GAD IAW+G  G
Sbjct  331   IQYPITLPNQRVFNIYLNNLTAVEGADVIAWSGGIG  366



>ref|XP_009388012.1| PREDICTED: receptor-like protein kinase FERONIA, partial [Musa 
acuminata subsp. malaccensis]
Length=532

 Score =   349 bits (896),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 176/336 (52%), Positives = 228/336 (68%), Gaps = 4/336 (1%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             YVP D ILLNCG     +  D R WT D G+++      S    A    PSV  VP+ TA
Sbjct  45    YVPRDDILLNCGASGQASSFDRRSWTGDTGTRYAPSLNGSGGFDALRLDPSVSTVPYSTA  104

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R F S FTY FP+++G  F+RL+FYP+ Y+   A+++ FSV  G Y LL NFSA  T +A
Sbjct  105   RVFTSPFTYRFPLSAGPIFIRLHFYPSDYSNHAASDAFFSVTSGPYILLHNFSAYLTADA  164

Query  714   LNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG-  890
             LNF +L++E+SVNV    LN+TFTPS   PNS AF+NGIE++S PD++++A    ++ G 
Sbjct  165   LNFAYLIREYSVNVSTGGLNLTFTPSTTHPNSYAFINGIEILSIPDLFSSAT-PLLVYGD  223

Query  891   -QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
               N    ID   ALE++YR+NVGG  I P  D+G+FRSWD+DS YI+ A  GVT++ +D 
Sbjct  224   DDNHAYTIDPDQALETVYRLNVGGQAIPPIEDSGLFRSWDDDSPYIYGAAFGVTDS-NDP  282

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             N+TI+YP  +P Y+AP +VY T RSMGPNA VN NYNLTW  PVD+GF+YLVRLHFCE  
Sbjct  283   NVTITYPTSVPNYIAPPDVYSTARSMGPNAQVNLNYNLTWILPVDAGFYYLVRLHFCEIQ  342

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
               I + N+RVF IYLNNQTA+  AD I W+G  G+P
Sbjct  343   YPIVKKNQRVFDIYLNNQTAKEKADVIGWSGGIGIP  378



>tpg|DAA45217.1| TPA: putative receptor-like protein kinase family protein [Zea 
mays]
Length=886

 Score =   357 bits (916),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 182/339 (54%), Positives = 229/339 (68%), Gaps = 8/339 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             +VP D I L+CG      D D R WT D GSK+      +S +SA  Q PSVPQVP++TA
Sbjct  27    FVPRDDIRLDCGAKGQGNDTDGRVWTGDAGSKYAPPDNLASVASASGQDPSVPQVPYLTA  86

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV----GEYTLLKNFSAGQ  701
             R   S FTYSFP+  GRKFLRL+FYPA+Y   +A + +FSV V    G  TLL NFSA Q
Sbjct  87    RVSASPFTYSFPLGPGRKFLRLHFYPANYTDRDAADGLFSVSVAAPGGNLTLLSNFSAYQ  146

Query  702   TTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTM  881
             T  A+ + +L++EFSVNV   TL++TFTP    PN+ AFVNGIEVVS PD+++ +    M
Sbjct  147   TAAAITYSYLIREFSVNVSSPTLDLTFTPEKAHPNAYAFVNGIEVVSSPDLFDIST-PNM  205

Query  882   IVGQN--SPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTET  1055
             + G     P  ID  TA++++YR+NVGG  ISPS DTG +RSWD+DS YIF A  GV+  
Sbjct  206   LAGDGNLQPFPIDAGTAMQTMYRLNVGGQAISPSKDTGGYRSWDDDSSYIFGASFGVSYP  265

Query  1056  ADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHF  1235
              D   +TI+YP  +P YVAP +VY T RSMGP+ +VN NYNLTW   VD+GF YL+R+HF
Sbjct  266   KDS-KVTITYPSNVPEYVAPEDVYGTARSMGPDKNVNMNYNLTWMLEVDAGFMYLIRMHF  324

Query  1236  CEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
             CE    IT+IN+RVF IY+NNQTA  GAD  AWA  +G 
Sbjct  325   CEIQYPITKINQRVFNIYINNQTAVKGADVNAWAAVSGA  363



>gb|EMT17007.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=890

 Score =   357 bits (916),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 181/336 (54%), Positives = 235/336 (70%), Gaps = 6/336 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             +VP D ILL+CG      D D R+W  D GSK+     K +++SA +Q PSVPQVP++TA
Sbjct  38    FVPRDDILLDCGATGKGNDTDGRQWDGDAGSKY--APPKLASASAGAQDPSVPQVPYLTA  95

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV--GEYTLLKNFSAGQTT  707
             R   + FTYSFP+  GRKFLRL+FYPA+Y+  NA ++ FSV V   + TLL NFSA QTT
Sbjct  96    RVSAAPFTYSFPLGPGRKFLRLHFYPANYSNRNAADAFFSVSVPAAKVTLLSNFSAYQTT  155

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
              ALNF ++V+EFSVNV G+ L++TFTP    PN+ AF+NGIEVVS PD+++ A    +  
Sbjct  156   TALNFAYIVREFSVNVTGQNLDLTFTPEKGHPNAYAFINGIEVVSSPDLFDLATPQLVTG  215

Query  888   GQNS-PLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
               NS P  +D + AL+++YR+NVGG  ISPS D+G  RSWD+D+ YI+ AG GV+   +D
Sbjct  216   DGNSQPYEMDPAAALQTMYRLNVGGQAISPSKDSGGARSWDDDTPYIYGAGAGVSYQ-ND  274

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              ++ I+YP  +P YVAP +VY T RSMGP+  VN  YNLTW   VD+G+ YLVRLHFCE 
Sbjct  275   PSVAITYPDNVPGYVAPSDVYATARSMGPDKGVNMAYNLTWILQVDAGYQYLVRLHFCEI  334

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
              +  T+ N+RVF IYLNNQTA  GAD I WA  NG+
Sbjct  335   QSPYTKPNQRVFNIYLNNQTAMQGADVIQWADPNGI  370



>ref|XP_009416326.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416327.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=882

 Score =   356 bits (914),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 178/337 (53%), Positives = 238/337 (71%), Gaps = 8/337 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS---SADSQKPSVPQVPF  524
             YVP D ILLNCG      D D++ WT D GSK+    G S  +   +A  Q  SVP+VP+
Sbjct  28    YVPRDYILLNCGASGKAIDTDSQTWTGDAGSKY----GPSLNAVGFTAPQQDSSVPEVPY  83

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             +TAR F S +TYSFPV  GRK++RL+FYP++Y+   A+++ FSV    +TLL NFSA  T
Sbjct  84    LTARVFTSPYTYSFPVGPGRKYVRLHFYPSNYSNHVASDAFFSVTSDTHTLLSNFSAYLT  143

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMI  884
              ++LN+ +L +EFSVNV    LN+TFTPS   PN+ AF+NGIE+VS PDI+++A+   ++
Sbjct  144   ADSLNYAYLAREFSVNVSTGGLNLTFTPSTTHPNAFAFINGIEIVSIPDIFSSANPMLVM  203

Query  885   VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
              G   P  ID   ALE++YR+NVGG  +SP+ D+G+FRSW++DS YI+ +  GVT + +D
Sbjct  204   GGSALPYTIDQDWALETVYRLNVGGQSLSPTQDSGLFRSWNDDSPYIYGSSFGVTYS-ND  262

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              N+TISY   +P Y APV+VY T RSMGPNA+VN NYNLTW   VD+GF+YLVR HFCE 
Sbjct  263   PNVTISYTDNVPNYTAPVDVYSTARSMGPNANVNLNYNLTWILTVDAGFYYLVRFHFCEI  322

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                IT++N+RVF IY+NNQTA+ GAD I W+   G+P
Sbjct  323   QYPITKLNQRVFDIYINNQTAQEGADVIGWSTGIGIP  359



>ref|NP_001050022.1| Os03g0333200 [Oryza sativa Japonica Group]
 gb|ABF95782.1| protein kinase family protein, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11936.1| Os03g0333200 [Oryza sativa Japonica Group]
 gb|EEE59005.1| hypothetical protein OsJ_10725 [Oryza sativa Japonica Group]
Length=893

 Score =   356 bits (914),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 183/337 (54%), Positives = 240/337 (71%), Gaps = 6/337 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             +VP D ILL+CG      D D R WT D GSK+L      + ++A +Q PSVPQVP++TA
Sbjct  41    FVPRDNILLDCGATGQANDTDGRLWTGDTGSKYL--PANLAAAAATAQDPSVPQVPYLTA  98

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGE--YTLLKNFSAGQTT  707
             R   + FTYSFPV +GRKFLRL+FYPA+Y+  NA +++FSV + +   TLL NFSA QT 
Sbjct  99    RFSAAPFTYSFPVGAGRKFLRLHFYPANYSNRNAADALFSVSIPDPNITLLSNFSAYQTA  158

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
              ALNFD+LV+EFSVNV   TL++TFTP    PN+ AFVNGIEVVS PD++ +++   +  
Sbjct  159   LALNFDYLVREFSVNVTASTLDLTFTPEKGHPNAFAFVNGIEVVSSPDLFGSSNPMEVTG  218

Query  888   -GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
              G  +P  ID  TA++++YR+NVGGN ISPS DTG +RSW++D+ YI  A  GV+  A+D
Sbjct  219   DGSGTPFPIDAGTAMQTMYRLNVGGNAISPSKDTGGYRSWEDDTPYIPFASFGVS-YAND  277

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              N+ I+YP  +P YVAP +VY T RSMGP+ +VN  YNLTW   VD+G+ YLVRLHFCE 
Sbjct  278   TNVPINYPDSIPQYVAPADVYSTARSMGPDNNVNLQYNLTWAMQVDAGYQYLVRLHFCEI  337

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              + I++IN+R F IY+NNQTA  GAD IAW+   G+P
Sbjct  338   QSGISKINQRTFDIYINNQTAFSGADVIAWSTGLGIP  374



>gb|EEC75192.1| hypothetical protein OsI_11431 [Oryza sativa Indica Group]
Length=893

 Score =   356 bits (914),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 183/337 (54%), Positives = 240/337 (71%), Gaps = 6/337 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             +VP D ILL+CG      D D R WT D GSK+L      + ++A +Q PSVPQVP++TA
Sbjct  41    FVPRDNILLDCGATGQANDTDGRLWTGDTGSKYL--PANLAAAAATAQDPSVPQVPYLTA  98

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGE--YTLLKNFSAGQTT  707
             R   + FTYSFPV +GRKFLRL+FYPA+Y+  NA +++FSV + +   TLL NFSA QT 
Sbjct  99    RFSAAPFTYSFPVGAGRKFLRLHFYPANYSNRNAADALFSVSIPDPNITLLSNFSAYQTA  158

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
              ALNFD+LV+EFSVNV   TL++TFTP    PN+ AFVNGIEVVS PD++ +++   +  
Sbjct  159   LALNFDYLVREFSVNVTASTLDLTFTPEKGHPNAFAFVNGIEVVSSPDLFGSSNPMEVTG  218

Query  888   -GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
              G  +P  ID  TA++++YR+NVGGN ISPS DTG +RSW++D+ YI  A  GV+  A+D
Sbjct  219   DGSGTPFPIDAGTAMQTMYRLNVGGNAISPSKDTGGYRSWEDDTPYIPFASFGVS-YAND  277

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              N+ I+YP  +P YVAP +VY T RSMGP+ +VN  YNLTW   VD+G+ YLVRLHFCE 
Sbjct  278   TNVPINYPDSIPQYVAPADVYSTARSMGPDNNVNLQYNLTWAMQVDAGYQYLVRLHFCEI  337

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              + I++IN+R F IY+NNQTA  GAD IAW+   G+P
Sbjct  338   QSGISKINQRTFDIYINNQTAFSGADVIAWSTGLGIP  374



>ref|XP_009412649.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412650.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=889

 Score =   352 bits (903),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 177/338 (52%), Positives = 237/338 (70%), Gaps = 9/338 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKS---STSSADSQKPSVPQVPF  524
             YVP D ILLNCG      D D+R WT D GSK+    G S   +  +A  Q  SVPQVP+
Sbjct  33    YVPRDNILLNCGASGQAKDTDSRIWTGDTGSKY----GPSLNVAGLTASLQDSSVPQVPY  88

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR F S +T+SFP+  GRK++RL+FYP +Y+   A++++FSV    +TLL NFSA  T
Sbjct  89    MTARVFTSPYTFSFPLGPGRKYIRLHFYPCNYSTHAASDALFSVTSDSHTLLSNFSAYLT  148

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMI  884
              ++LN+ +L +EFSVNV    LN+TFTPS   P + AFVNGIEVVS PDI+ +A+   ++
Sbjct  149   ADSLNYAYLTREFSVNVSTGGLNLTFTPSTAHPQAYAFVNGIEVVSIPDIFGSANPMLVV  208

Query  885   VGQNS-PLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
              G  S   +ID   ALE++YR+NVGG  +SP+ D+G+FRSW++DS YI+ A  GVT ++D
Sbjct  209   GGGTSVQYSIDQDWALETMYRLNVGGQSLSPTQDSGLFRSWNDDSPYIYGAAFGVTYSSD  268

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
               N+TISYP  + +Y+AP  VY T RSMGP+A VN NYNLTW  PVD+GF+YL+R HFCE
Sbjct  269   P-NVTISYPSALASYIAPSNVYSTARSMGPDAHVNLNYNLTWILPVDAGFYYLLRFHFCE  327

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                 +T++N+RVF I+++NQT + GAD IAW+   GVP
Sbjct  328   IQYPMTKVNQRVFDIFVDNQTVQRGADVIAWSSGIGVP  365



>ref|XP_010921184.1| PREDICTED: receptor-like protein kinase FERONIA [Elaeis guineensis]
Length=895

 Score =   348 bits (892),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 174/335 (52%), Positives = 232/335 (69%), Gaps = 5/335 (1%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             Y P DKILLNCG      D D R WT D  SK+      ++ + A SQ  SVPQVP+++ 
Sbjct  35    YQPRDKILLNCGFSGTANDTDGRTWTGDAASKYAPSMNGAAVT-ATSQDSSVPQVPYLSG  93

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R F S +TY+FP+ +GRKF+RLYFYP++Y+   A+++ F+V    YTLL+NFSA  T  A
Sbjct  94    RVFTSPYTYTFPLGAGRKFIRLYFYPSNYSTHAASDAFFTVTADSYTLLQNFSAYLTAGA  153

Query  714   LNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTMIVG  890
             LN+ +LV+EFSVNV    L +TFTPS +  NS AFVNGIE+VS P DI+   +   ++VG
Sbjct  154   LNYAYLVREFSVNVSSSGLKLTFTPSTDHHNSYAFVNGIEIVSIPDDIFTPVNA--LLVG  211

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              N+   ID   A E++YR+NVGG  ISP+ D+G+FRSW +D+ YI+ A  GVT + +D N
Sbjct  212   TNTDYTIDQDGAFETVYRLNVGGQAISPTQDSGLFRSWADDTPYIYGAAFGVTYS-NDPN  270

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             ++I YP  +P Y+AP +VY T RSMGP+  +N NYNLTW  PVD+ F++LVRLHFCE   
Sbjct  271   VSIKYPATIPEYIAPPDVYSTARSMGPDPRINLNYNLTWILPVDAAFYHLVRLHFCEIQY  330

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT+ N+RVF IYL+N TA+ GAD IAW+G  G+P
Sbjct  331   PITKPNQRVFDIYLSNLTAQQGADVIAWSGGIGIP  365



>ref|XP_009414253.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414254.1| PREDICTED: receptor-like protein kinase FERONIA [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   346 bits (887),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 177/337 (53%), Positives = 225/337 (67%), Gaps = 9/337 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPSVPQVPF  524
             Y P D ILLNCG    VTD D   WT D GSK+   L G G     SA  Q PSV  VP+
Sbjct  33    YKPRDHILLNCGASGQVTDLDGLNWTGDAGSKYAPSLNGGG-----SAARQDPSVSSVPY  87

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             +TAR F S +TY+FP+ +GR F+RL+FYP +Y+  +A+++ FSV  G YT L+NFSA  T
Sbjct  88    LTARVFTSPYTYTFPLGAGRIFIRLHFYPTTYSNHSASDAFFSVTSGHYTFLQNFSASLT  147

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMI  884
              +ALNF +   E+SVNV    LN+TFTPS    NS AF+NGIE+VS PD +++A    + 
Sbjct  148   ADALNFAYFSLEYSVNVSTGGLNLTFTPSTTHANSYAFINGIEIVSIPDFFSSASPVLVN  207

Query  885   VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
              G + P  ID   AL+++YR NVGG  ISP  D+G+FRSWD+D+ YI+ A  GV+ +AD 
Sbjct  208   GGDSFPFPIDPDQALQTVYRFNVGGQAISPVRDSGLFRSWDDDTPYIYGAAFGVSYSADP  267

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              N+TI Y   +P Y+AP  VY T RSMGPNA VN  YNL+W   VD+GF+YLVRLHFCE 
Sbjct  268   -NVTIEYTAAVPNYIAPSTVYSTARSMGPNAQVNLRYNLSWILTVDAGFYYLVRLHFCEI  326

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                IT+IN+R F IYLNN TA+  AD I W+G  G+P
Sbjct  327   QYPITKINQRAFDIYLNNLTAQEEADVIVWSGGIGIP  363



>ref|XP_004499646.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=1333

 Score =   350 bits (898),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 180/336 (54%), Positives = 232/336 (69%), Gaps = 5/336 (1%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             D+ PTD+ILLNCGGP    D D R W+TD GS F  G+GKS+     +  P++PQVPFMT
Sbjct  18    DFKPTDEILLNCGGPILSLDLDGRSWSTDRGSNF--GSGKSNMLEVATNDPALPQVPFMT  75

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
              + F+S +TYSFPVASG  FLRLYFY ASY+GLN +++ F V    YTLL NFS  +TT 
Sbjct  76    VQIFESPYTYSFPVASGWIFLRLYFYLASYSGLNISDARFGVTSQSYTLLWNFSVLETTL  135

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIY-NTADGSTMIV  887
               N  ++VKE+S+++ G TLN+TFTPS  + N+ AFVNGIEV+S P+IY +T D   +IV
Sbjct  136   GSNDHYVVKEYSIHIDGGTLNLTFTPSTTAINAYAFVNGIEVMSMPNIYTSTDDDVHVIV  195

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
                S  N+DN TALE++YR+NVGG+ I  S DTGMFRSW  D+ +I     G      + 
Sbjct  196   CIRSVFNVDNRTALENVYRLNVGGSNIPGSRDTGMFRSWSADASFILGTAFGAVNGGIEV  255

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             N  I YPPG P+Y+AP  V+ + RSMG N ++N +YNLTW F +DSGF YLVRLHFCE T
Sbjct  256   N--IEYPPGTPSYIAPTIVFSSARSMGANTNINLSYNLTWTFSIDSGFAYLVRLHFCEGT  313

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             T+I ++N+RVF I+L NQ+A    D IAWA    +P
Sbjct  314   TVIIKVNQRVFQIFLANQSAFNTTDVIAWASTFNLP  349


 Score =   272 bits (695),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 151/335 (45%), Positives = 196/335 (59%), Gaps = 52/335 (16%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             D+ PT +ILL+CGGP    D D R  + D GS F  G+GKS+ S   +  P VPQVPFMT
Sbjct  354   DFKPTHEILLHCGGPILSLDLDGRSMSIDRGSNF--GSGKSTMSEVATNDPPVPQVPFMT  411

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S +TYSF VASG                             +  L NFS  +TT 
Sbjct  412   ARIFESPYTYSFLVASG-----------------------------WIFLMNFSVLETTL  442

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
                  ++VKE+S+++ G TLN+TFTPS  + N  AFVNGIEV+S                
Sbjct  443   GSKDHYVVKEYSIHIDGGTLNLTFTPSTTAINKDAFVNGIEVIS----------------  486

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
                   I+N T LE++YR+NVGG+ I  S DTGMFRSW  D+ +I     G      + N
Sbjct  487   ---VFTIENRTTLENVYRLNVGGSNIPGSRDTGMFRSWSADASFILGTAFGAVNGGIEVN  543

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
               I YPPG P+Y+AP  V+ + RSMGPNA++N +YNLTW F +DSGF YLVRLHFCE TT
Sbjct  544   --IEYPPGTPSYIAPTIVFSSARSMGPNANINLSYNLTWTFSIDSGFAYLVRLHFCEGTT  601

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +IT++N+RVF I+L NQ+A    D I+W  ++  P
Sbjct  602   VITKVNQRVFKIFLANQSAFNTVDVISWPTEDFKP  636


 Score =   115 bits (287),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 93/182 (51%), Gaps = 56/182 (31%)
 Frame = +3

Query  351  DYVPTDKILLNCGGPDGV-------------------------TDQDNRKWTTDVGSKFL  455
            D+ PTD+ILLNCGGP  V                          D D R W+TD GS F 
Sbjct  633  DFKPTDEILLNCGGPILVWILMAVHGPLIVARILVLENPPCQSLDLDGRSWSTDRGSNF-  691

Query  456  LGTGKSSTSSADSQKPSVPQVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNA  635
             G+GKS+ S   S  P+VPQ PFMTAR F+S +TYSFPVAS                   
Sbjct  692  -GSGKSTMSEVASNDPAVPQNPFMTARIFESPYTYSFPVAS-------------------  731

Query  636  TNSVFSVRVGEYTLLKNFSAGQTTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLA  815
                      ++  L+NFS  +TT   N  ++VKE+S+++ G TLNVTFTPS  + N+ A
Sbjct  732  ----------DWIFLRNFSVLETTLDSNDHYVVKEYSIHIDGGTLNVTFTPSTTAINAYA  781

Query  816  FV  821
            F+
Sbjct  782  FI  783



>ref|XP_006646366.1| PREDICTED: receptor-like protein kinase FERONIA-like, partial 
[Oryza brachyantha]
Length=824

 Score =   339 bits (870),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 171/295 (58%), Positives = 218/295 (74%), Gaps = 4/295 (1%)
 Frame = +3

Query  477   TSSADSQKPSVPQVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSV  656
             +++A  Q PSVPQVP++TAR   + FTYSFP+ +GRKFLRL+FYPA+Y+  +A ++ FSV
Sbjct  10    SATAAGQDPSVPQVPYLTARVSAAPFTYSFPLGAGRKFLRLHFYPANYSSRDAADARFSV  69

Query  657   RV--GEYTLLKNFSAGQTTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGI  830
              V     TLL NFSA QTT ALNF ++V+EFSVNV   TL++TFTP    PN+ AFVNGI
Sbjct  70    SVPAANVTLLSNFSAYQTTTALNFAYIVREFSVNVTTATLDLTFTPEKAHPNAYAFVNGI  129

Query  831   EVVSHPDIYNTADGSTMIV-GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWD  1007
             EVVS PD+++ +  + +   G N P  ID  T+L+++YR+NVGG  ISPS DTG FRSWD
Sbjct  130   EVVSSPDLFDISTPNRVTGDGNNQPFPIDPGTSLQTMYRLNVGGQAISPSKDTGGFRSWD  189

Query  1008  EDSKYIFSAGTGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTW  1187
             +DS Y+F A  GV+   DD N+TI+YP  +P Y+APV+VY T RSMGP+ +VN  YNLTW
Sbjct  190   DDSPYVFGAAFGVSYPKDD-NVTITYPSNVPQYMAPVDVYGTARSMGPDKNVNLAYNLTW  248

Query  1188  YFPVDSGFFYLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
                VD+GF YLVRLHFCE  + IT+ N+RVF IY+NNQTA  GAD IAWAG NG+
Sbjct  249   IMQVDAGFTYLVRLHFCEIQSPITKPNQRVFNIYINNQTAFQGADVIAWAGSNGI  303



>gb|EMT01093.1| hypothetical protein F775_16963 [Aegilops tauschii]
Length=509

 Score =   318 bits (816),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 160/335 (48%), Positives = 213/335 (64%), Gaps = 4/335 (1%)
 Frame = +3

Query  360   PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTAR  536
             P  ++ L+CG     TD D R W  D  S FL  T     + A  Q PS+P  VP+MTAR
Sbjct  35    PAGQVRLSCGSSASATDSDGRAWDGDSASMFLPSTNAGVAARASYQDPSLPSTVPYMTAR  94

Query  537   TFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  716
              F S  TY+F V  GR FLRLYFYPA Y   +A+ ++F V  G  TLL++F+A QT  AL
Sbjct  95    VFASSHTYTFLVRPGRVFLRLYFYPADYGNRSASGALFGVTAGGVTLLQDFNASQTALAL  154

Query  717   NFDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQ  893
             +  +LV+EFS+NV     L VTF PSP + +  AFVNGIE++  PD++     +    G+
Sbjct  155   DAAYLVREFSLNVNSSGRLEVTFAPSPGASSHYAFVNGIEILPTPDVFTKPVPTFANGGR  214

Query  894   NSPLNIDNSTALESIYRVNVGGNVISPSSDTGMF-RSWDEDSKYIFSAGTGVTETADDYN  1070
               P+ +   TA +++YR+NVGG  +SP+ D+G F R+WD D  YIF A  GV+   D  +
Sbjct  215   PDPMPVRADTAFQTMYRLNVGGEAVSPADDSGRFYRTWDTDIPYIFGAAGGVSFEKDS-D  273

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +TI YPP +P ++AP  VY + RSMGP A +N NYNLTW  PVD+GF+YL+R HFCE   
Sbjct  274   VTIRYPPSVPPHIAPEGVYASARSMGPTAQINLNYNLTWILPVDAGFYYLLRFHFCEIQD  333

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT +N+R F IY+NNQTA+   D IAW+G+ GVP
Sbjct  334   PITRVNQRSFFIYINNQTAQEQMDVIAWSGRIGVP  368



>dbj|BAK00988.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   318 bits (815),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 159/332 (48%), Positives = 213/332 (64%), Gaps = 4/332 (1%)
 Frame = +3

Query  369   KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  545
             ++ L+CG P   TD D R W  D  SKFL  T     + A  Q PS+P  VP++TAR F 
Sbjct  36    QVRLSCGAPASATDSDGRAWDGDSASKFLPSTNAGVAARASYQDPSLPSSVPYVTARVFA  95

Query  546   SEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFD  725
             S  TY+FP+  GR FLRLYFYPA Y   +A  ++F V  G  TLL++F+A QT  AL+  
Sbjct  96    SSHTYTFPLRPGRVFLRLYFYPADYGNHSAYGALFGVTAGGVTLLRDFNASQTALALDAA  155

Query  726   FLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSP  902
             +LV+EFSVNV     L VTF PS  + +  AFVNGIE+V  PD++     +    G    
Sbjct  156   YLVREFSVNVSSSGRLEVTFAPSSGASSHYAFVNGIEIVPTPDVFTKPVPTFANGGGPDR  215

Query  903   LNIDNSTALESIYRVNVGGNVISPSSDTG-MFRSWDEDSKYIFSAGTGVTETADDYNMTI  1079
             + I   TA +++YR+NVGG  +SP+ D+G ++R+WD D  Y+F A  GV+   D  N++I
Sbjct  216   MPIRADTAFQTMYRLNVGGTAVSPAEDSGRLYRTWDTDVPYVFGAAVGVSFEKDS-NVSI  274

Query  1080  SYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIIT  1259
              YPP +P ++AP +VY + RSMGPNA +N NYNLTW  PVD+GF+YL+R HFCE    IT
Sbjct  275   RYPPAVPPHIAPEDVYASARSMGPNAQINLNYNLTWILPVDAGFYYLLRFHFCEIQYPIT  334

Query  1260  EINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             ++N+R F IY+NNQTA+   D I W+G  GVP
Sbjct  335   KVNQRSFFIYINNQTAQEQMDVIVWSGGIGVP  366



>ref|XP_004976623.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=509

 Score =   316 bits (809),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 166/332 (50%), Positives = 214/332 (64%), Gaps = 11/332 (3%)
 Frame = +3

Query  369   KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  545
             +I +NCG      D D R W  D  S      G    + A  + PS+P  VP+MTAR F 
Sbjct  34    QIRVNCGASVSAADSDGRTWDRDAPS-----VGGGVAAGAPYEDPSLPSAVPYMTARVFG  88

Query  546   SEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFD  725
             S  TYSFPV  GR FLRL+FYPA Y G  A +++F V  G  TLL++F+A QT  ALN  
Sbjct  89    SAHTYSFPVRPGRVFLRLFFYPADYGGRGAGDALFGVAAGGVTLLRDFNASQTALALNAA  148

Query  726   FLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTMIVGQNSP  902
              LV+EFS+NV    L+VTFTPS  S    AFVNGIE+V  P D+      +    G+ +P
Sbjct  149   CLVREFSLNVSAGGLDVTFTPS--SSAHYAFVNGIEIVPTPADVVAKPVPTFANGGRTAP  206

Query  903   LNIDNSTALESIYRVNVGGNVISPSSDTGM-FRSWDEDSKYIFSAGTGVTETADDYNMTI  1079
             + I   TA +++YR+NVGG  +SP +D+G+ +RSWDEDS YI+ A  GV+   D  N+TI
Sbjct  207   MPIRADTAFQTMYRLNVGGTAVSPGNDSGLLYRSWDEDSAYIYGAAFGVSYPKDS-NVTI  265

Query  1080  SYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIIT  1259
              YPP +P YVAP  +Y + RSMGP+A VN NYNLTW  PVD+GF+Y++RLHFCE    IT
Sbjct  266   QYPPSVPPYVAPKGMYASARSMGPSAQVNLNYNLTWILPVDAGFYYILRLHFCEIQYPIT  325

Query  1260  EINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              +N+RVF +Y+NNQTA+ G D IAW+G  G P
Sbjct  326   RVNQRVFYVYINNQTAQAGMDVIAWSGGIGRP  357



>ref|XP_010246590.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=836

 Score =   323 bits (828),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 172/342 (50%), Positives = 225/342 (66%), Gaps = 13/342 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGP-DGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  524
             Y P ++ILLNCG P   +  QD R WT DVGS F  +     S+TS+A  Q  SVPQ+P+
Sbjct  38    YTP-EEILLNCGSPLKSIQSQDGRNWTGDVGSNFAPMDRFNLSTTSTASQQDSSVPQIPY  96

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR F S F Y+F V  G KF+RLYFYPASY+GL+ TN+ F V  G YTLL+NFSA  T
Sbjct  97    MTARVFHSPFVYTFLVQPGPKFIRLYFYPASYSGLDKTNAFFDVYAGSYTLLRNFSAFLT  156

Query  705   TEALNFDFLVKEFSVNVPGETL-NVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGST  878
              + L     VKEF VN    +L ++TF+P+PN+  +  FVNGIE+VS P  +Y   D  +
Sbjct  157   ADTLKQASFVKEFCVNTENSSLLDITFSPTPNAFETYGFVNGIEIVSMPAGLYIEGDDVS  216

Query  879   M-IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTET  1055
             + +VGQ +  +I   TA E+++R+NVGG+ ISP +DTG++RSW +D+ YI  +  GV  +
Sbjct  217   LPLVGQKNSFSIAKMTAFETVHRLNVGGSDISPQNDTGLYRSWYDDTDYILGSEKGVLPS  276

Query  1056  ADDYNMTIS--YPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRL  1229
                 NMTI   YPP +P Y AP  VY++ R+MG + S N  YNLTW+F VDSGF+YL RL
Sbjct  277   ----NMTIQIHYPPSVPNYTAPDSVYRSARTMGMDRSHNVKYNLTWHFIVDSGFYYLFRL  332

Query  1230  HFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             HFCEF   IT   +R+F I + NQTAE  AD I W+  NG+P
Sbjct  333   HFCEFQFEITMQGQRLFSILIGNQTAEKEADVIMWSSGNGIP  374



>ref|XP_003580431.1| PREDICTED: receptor-like protein kinase FERONIA [Brachypodium 
distachyon]
Length=514

 Score =   313 bits (802),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 165/336 (49%), Positives = 217/336 (65%), Gaps = 9/336 (3%)
 Frame = +3

Query  369   KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTF-  542
             +I LNCG     TD D R W  D  SKF      ++ +SA  + PS+P  VP+ TAR F 
Sbjct  34    QIRLNCGESGSATDADGRAWAGDAASKFAPSMPDAAAASASYKDPSLPSLVPYTTARVFA  93

Query  543   QSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNF  722
              S +TYSF V  GR FLRLYFYP++Y    A++++F V  G  TLL+ F+A QT  ALN+
Sbjct  94    SSSYTYSFLVRPGRAFLRLYFYPSNYGTHAASDALFGVTAGGVTLLRGFNASQTALALNY  153

Query  723   DFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNS  899
              +LV+EFSVNV    TLNVTF PS +S +  AF+NGIE+V  PD+  +A      +   +
Sbjct  154   AYLVREFSVNVSATGTLNVTFIPSSSS-SHYAFINGIEIVPTPDMLTSAAPVVPTLANGA  212

Query  900   ---PLNIDNSTALESIYRVNVGGNVISPSSDTG-MFRSWDEDSKYIFSAGTGVTETADDY  1067
                P+ I   TA +++YR+NVGG  +SP+ D+  ++RSWD D+ YIF A  GV+    D 
Sbjct  213   RPDPMPIRADTAFQTMYRLNVGGESLSPTDDSARLYRSWDNDAPYIFGAAAGVSY-GKDA  271

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             N+TI YP  +P YVAP  VY + RSMGP A +N NYNLTW  PVD+GFFYLVRLHFCE  
Sbjct  272   NVTIRYPASVPRYVAPEAVYASARSMGPTAQINLNYNLTWILPVDAGFFYLVRLHFCEIQ  331

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
               IT++N+R F +Y++N+TA    D IAW+G  GVP
Sbjct  332   YPITKVNQRSFDVYISNETAREQMDVIAWSGGIGVP  367



>ref|XP_002272797.2| PREDICTED: receptor-like protein kinase ANXUR1 [Vitis vinifera]
 emb|CBI22880.3| unnamed protein product [Vitis vinifera]
Length=857

 Score =   320 bits (820),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 167/332 (50%), Positives = 234/332 (70%), Gaps = 18/332 (5%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  551
             +L+CG   G  D D RKW  D  +KFL   GKS +++A  Q PS+P  VP+M+AR F SE
Sbjct  36    ILSCGDSSGGADADGRKWVPD--TKFLASPGKSISATAQLQDPSLPSPVPYMSARIFTSE  93

Query  552   FTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              TY F V+   R ++RL+FYP+ Y+ LNA++S FSV  G +TLL NFSA  T +AL   +
Sbjct  94    STYQFSVSPKNRLWVRLHFYPSFYSALNASDSFFSVTAGGFTLLNNFSASTTAQALTQAY  153

Query  729   LVKEFSVNVPGET--LNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSP  902
             ++K+FS+ +P E+  LN+TF PSPN   S AF+NGIEV+S PDI+    GS  +VG +  
Sbjct  154   IIKDFSL-MPPESGHLNITFKPSPNHNGSYAFINGIEVISMPDIF----GSATMVGYS--  206

Query  903   LNIDNS-TALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTI  1079
              ++D + ++L+++YR+NVGG  I+ ++D+G+ R+W +DS Y++ A  GVT  AD  N+TI
Sbjct  207   -DLDAAGSSLQTMYRLNVGGQYIAANNDSGLSRTWYDDSPYLYGAAFGVTSEADS-NVTI  264

Query  1080  SYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIIT  1259
              YP  +P Y+APV+VY+T R+MGP+  +N NYNLTW F VD+ F Y+VR HFCEF  +++
Sbjct  265   QYPSHVPEYIAPVDVYRTARTMGPDPKINQNYNLTWVFQVDANFTYIVRFHFCEF--LLS  322

Query  1260  EINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +IN+RVF IY+NNQTA+P AD IAWA   GVP
Sbjct  323   KINQRVFDIYVNNQTAQPAADLIAWAESEGVP  354



>ref|XP_012072597.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=453

 Score =   306 bits (784),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 217/342 (63%), Gaps = 15/342 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQ-DNRKWTTDVGSKFLLGTGKSSTSS---ADSQKPSVPQVP  521
             Y P + I L+CG PD  T   D R WT+D      +   KS+ +    + S +P VPQVP
Sbjct  23    YEPLENIALDCGSPDLRTLPFDGRNWTSDAS---FISQSKSTVAPIMVSSSIEPGVPQVP  79

Query  522   FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  701
             + TAR F SEFTY+F +  G KFLRL+FYP SY G +A+    SV  G +TLL NFSA  
Sbjct  80    YKTARLFFSEFTYTFNLTPGPKFLRLHFYPTSYPGFDASKEFLSVMEGNHTLLSNFSASL  139

Query  702   TTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGST  878
                  N   L+KEF V V   +L +TF+PS  S ++ AFVNGIE+VS P ++Y   +   
Sbjct  140   AANCKNVTTLIKEFIVAVQNHSLRLTFSPS--SSDAFAFVNGIELVSMPLNLYKRGENFP  197

Query  879   M-IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTET  1055
             +  VG +  + +D++   E++YR+NVGG+ I P SD+GMFR+W  D +YIF AG G  + 
Sbjct  198   LPFVGYSQVIRLDSTYVFETVYRINVGGDDIPPKSDSGMFRTWTRDDQYIFGAGVG--QL  255

Query  1056  ADDYNMTISYPPGMPTYVAPVEVYKTLRSMG--PNASVNANYNLTWYFPVDSGFFYLVRL  1229
             A DY++ + Y P +P Y AP  VY+T R MG   N  +  N+NLTWYFPV++GF YLVRL
Sbjct  256   AFDYDLQVKYTPSVPAYTAPDLVYRTARFMGVFDNPRITLNFNLTWYFPVETGFLYLVRL  315

Query  1230  HFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             HFCE    IT+IN++VF IY+NNQTAE  AD I W+G  GVP
Sbjct  316   HFCELDRSITKINQKVFSIYINNQTAEDEADVIGWSGGQGVP  357



>gb|KDP37883.1| hypothetical protein JCGZ_05765 [Jatropha curcas]
Length=441

 Score =   306 bits (783),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 217/342 (63%), Gaps = 15/342 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQ-DNRKWTTDVGSKFLLGTGKSSTSS---ADSQKPSVPQVP  521
             Y P + I L+CG PD  T   D R WT+D      +   KS+ +    + S +P VPQVP
Sbjct  11    YEPLENIALDCGSPDLRTLPFDGRNWTSDAS---FISQSKSTVAPIMVSSSIEPGVPQVP  67

Query  522   FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  701
             + TAR F SEFTY+F +  G KFLRL+FYP SY G +A+    SV  G +TLL NFSA  
Sbjct  68    YKTARLFFSEFTYTFNLTPGPKFLRLHFYPTSYPGFDASKEFLSVMEGNHTLLSNFSASL  127

Query  702   TTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGST  878
                  N   L+KEF V V   +L +TF+PS  S ++ AFVNGIE+VS P ++Y   +   
Sbjct  128   AANCKNVTTLIKEFIVAVQNHSLRLTFSPS--SSDAFAFVNGIELVSMPLNLYKRGENFP  185

Query  879   M-IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTET  1055
             +  VG +  + +D++   E++YR+NVGG+ I P SD+GMFR+W  D +YIF AG G  + 
Sbjct  186   LPFVGYSQVIRLDSTYVFETVYRINVGGDDIPPKSDSGMFRTWTRDDQYIFGAGVG--QL  243

Query  1056  ADDYNMTISYPPGMPTYVAPVEVYKTLRSMG--PNASVNANYNLTWYFPVDSGFFYLVRL  1229
             A DY++ + Y P +P Y AP  VY+T R MG   N  +  N+NLTWYFPV++GF YLVRL
Sbjct  244   AFDYDLQVKYTPSVPAYTAPDLVYRTARFMGVFDNPRITLNFNLTWYFPVETGFLYLVRL  303

Query  1230  HFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             HFCE    IT+IN++VF IY+NNQTAE  AD I W+G  GVP
Sbjct  304   HFCELDRSITKINQKVFSIYINNQTAEDEADVIGWSGGQGVP  345



>gb|EMT27425.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=841

 Score =   316 bits (810),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 168/329 (51%), Positives = 211/329 (64%), Gaps = 38/329 (12%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             +VP D ILL+CG      D D R+W  D GSK+       +++ A +Q PSVPQVP++TA
Sbjct  22    FVPRDDILLDCGATGKGNDTDGREWRGDAGSKY--APPNLASADAGAQDPSVPQVPYLTA  79

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV--GEYTLLKNFSAGQTT  707
             R   + FTYSFP+  GRKFLRL+FYPA+Y+  +A ++ FSV V   + TLL NFSA QT 
Sbjct  80    RVSAAAFTYSFPLGPGRKFLRLHFYPANYSNRDAADAFFSVSVPAAKVTLLSNFSAYQTA  139

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
              ALNF +LV+EFSVNV G TL++TFTP    PN+ AF+NGI                   
Sbjct  140   TALNFAYLVREFSVNVTGPTLDLTFTPEKGRPNAYAFINGI-------------------  180

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
                           E++YR+NVGG  ISPS D+G  RSWD+D+ YI+ AG GVT   +D 
Sbjct  181   --------------ETMYRLNVGGQAISPSKDSGGARSWDDDTPYIYGAGAGVT-YPNDP  225

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             N+TI+YP  +P YVAP +VY T RSMG + +VN  YNLTW   VD+GF YLVRLHFCE  
Sbjct  226   NVTITYPDNVPGYVAPSDVYATARSMGIDKNVNLAYNLTWIVQVDAGFTYLVRLHFCEIQ  285

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAW  1334
             + IT+ N+RVF IYLNNQTA  GAD I W
Sbjct  286   SPITKPNQRVFNIYLNNQTAVEGADVIQW  314



>ref|XP_011623570.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Amborella trichopoda]
Length=882

 Score =   317 bits (811),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 230/338 (68%), Gaps = 7/338 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDV-GSKFLLGTGKSSTSSADSQKPSVPQ-VPF  524
             +Y P+D IL+NCG      D D R W  DV GS++ L +  +  + A++Q PS+P  +P+
Sbjct  36    NYAPSDAILVNCGSSSDGVDADGRSWKGDVHGSRYTLDSENTVPARAETQDPSLPSTIPY  95

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV-GEYTLLKNFSAGQ  701
             M+AR F S  TY F V  GR ++RL+FYP+SY+GL+  +++FSV   G + LL+NFSA  
Sbjct  96    MSARIFSSRSTYEFSVTPGRHWVRLHFYPSSYSGLSPDDALFSVEASGGFMLLRNFSASI  155

Query  702   TTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTM  881
             T  AL   ++++EFSVNV G++L++TF PS    ++ AFVNGIE+VS PDIY ++     
Sbjct  156   TATALTQAYIIREFSVNVTGKSLSLTFEPSVKHRSAYAFVNGIEIVSMPDIYVSSSELPS  215

Query  882   IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
             +VG  S     +++AL++++R+NVGG  I+  +DTGM R+W +D+ YI+ AG GVT +AD
Sbjct  216   LVGHPSD-GGSSTSALQTMFRLNVGGQYIAAGNDTGMSRTWYDDTPYIYGAGVGVTYSAD  274

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
               ++ I Y   +P Y APV+VY T RSMGP++ VN N NLTW F VDS F Y+VRLHFCE
Sbjct  275   P-DVKIRYLDSIPEYTAPVDVYSTARSMGPDSRVNVNTNLTWVFQVDSNFTYIVRLHFCE  333

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                 +T+IN+RVF I+LNN+TAE  AD +AWA    VP
Sbjct  334   LQ--LTKINQRVFDIFLNNKTAEGAADVLAWAESRAVP  369



>gb|EMT13360.1| hypothetical protein F775_08521 [Aegilops tauschii]
Length=499

 Score =   306 bits (785),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 155/334 (46%), Positives = 208/334 (62%), Gaps = 4/334 (1%)
 Frame = +3

Query  363   TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  539
             + ++ L+CG     TD D R W  D  SKFL        + A  Q PS+P  VP+M AR 
Sbjct  31    SGQVRLSCGASASATDSDGRAWDGDSASKFLTSANAGVAARASYQDPSLPSSVPYMMARV  90

Query  540   FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  719
             F S  TY+F V  GR FLRL+FYP  Y   NA++++F V  G  TLL++F+A Q+  AL+
Sbjct  91    FASSHTYTFLVRPGRAFLRLFFYPTDYGNRNASSALFGVTAGGVTLLRDFNASQSALALD  150

Query  720   FDFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQN  896
               +LV+EFSV V     L+VTF PS  + +  AFVNGIE+V  PD++     +    G+ 
Sbjct  151   AAYLVREFSVIVNSSGRLDVTFAPSTGAGSHYAFVNGIEIVPTPDVFTAPVPTFANGGRP  210

Query  897   SPLNIDNSTALESIYRVNVGGNVISPSSDTGMF-RSWDEDSKYIFSAGTGVTETADDYNM  1073
              P+ I   TA +++YR+NVGG  +SP+ D+G F R+WD D  YIF A  GV+   D  ++
Sbjct  211   DPMPIRADTAFQTMYRLNVGGTAVSPADDSGRFYRAWDTDFPYIFGAAVGVSSKKDS-DV  269

Query  1074  TISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTI  1253
             TI YPP +P Y+AP  VY + RSMGP+  +N  YNLTW  PVD GF+YL+R HFCE    
Sbjct  270   TIRYPPSVPPYIAPEGVYASARSMGPDPQINLKYNLTWILPVDEGFYYLLRFHFCEIQYP  329

Query  1254  ITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             IT++N+R F IY+NNQTA+   D I W+G  GVP
Sbjct  330   ITKVNQRSFYIYINNQTAQEQMDVITWSGGIGVP  363



>ref|XP_010250338.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=790

 Score =   314 bits (805),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 169/346 (49%), Positives = 222/346 (64%), Gaps = 15/346 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFL----LGTGKSSTSSADSQKPSVPQVP  521
             Y P ++ILL+CG      D D R WT DVGS F       T   ST+ A  Q  SVP +P
Sbjct  39    YTPNEQILLDCGSSALKADGDGRNWTGDVGSDFATSARFNTSTVSTALALYQGSSVPLIP  98

Query  522   FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  701
             ++TAR F S FTY+FPVA+G K +RLYFYP SY+GL+ T + F V  G YTLL NFSA  
Sbjct  99    YVTARIFHSPFTYTFPVAAGPKLIRLYFYPVSYSGLDKTKAFFDVSAGPYTLLHNFSAFF  158

Query  702   TTEALNFDFLVKEFSVNVPG-ETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGS  875
             T EAL   FLVKEFS+N+     L + FTP+PN+  +  FVNGIE++S P D+Y   +  
Sbjct  159   TVEALKTAFLVKEFSINIENLSLLEIIFTPTPNTFETYGFVNGIEILSMPEDLYVRGEQI  218

Query  876   TM-IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTE  1052
             ++ ++GQ +P  I   TALE++YR+N+GG  IS   DTGM+R+W +D++YI   G+   +
Sbjct  219   SIPLIGQRTPFYIAKDTALETVYRLNIGGRTISSQDDTGMYRTWYDDTEYILGTGSSDYQ  278

Query  1053  TADDY-NMTI--SYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLV  1223
                 Y NMTI  +YPP +P Y AP  VY+T RSMGP+A     YNLTW+F VD GF +L 
Sbjct  279   KGVTYSNMTIDVNYPPTLPNYTAPDTVYRTARSMGPHA---LQYNLTWHFLVDLGFQFLF  335

Query  1224  RL--HFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             RL  HFCE    IT +N+RVF I++ NQTA+   D +  +G NG+P
Sbjct  336   RLHFHFCELAPEITLVNQRVFSIFIGNQTADNMFDVVGSSGGNGIP  381



>emb|CBI27305.3| unnamed protein product [Vitis vinifera]
Length=762

 Score =   311 bits (798),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 170/337 (50%), Positives = 214/337 (64%), Gaps = 11/337 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             Y P + I L+CG     T  D RKWT+D GSKF+     +S+ S  S + SVP VP+MTA
Sbjct  139   YTPVENIALDCGSHGHSTAPDGRKWTSDTGSKFICSQLNASSISMASTQDSVPLVPYMTA  198

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R F S+FTY+FP++ G KFLRL+F+PASY+ L+ +++ FSV    YTLL NFSA  T   
Sbjct  199   RIFTSQFTYAFPLSPGPKFLRLHFHPASYSNLDPSHAFFSVTANHYTLLHNFSAWLTAGF  258

Query  714   LNFDFLVKEFSVNVPGET-LNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTMIV  887
             LN     KE+ V V  E  LN+TF P      + AFVNGIEVVS P D+Y   +  +M  
Sbjct  259   LNQTHFSKEYCVWVSSEQLLNLTFAP---VAGAFAFVNGIEVVSMPTDLYLKGEDISM-A  314

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             GQ+ P  I+N TALE +YR+NV G  IS   DTGMFR W +D  +IF    G     D +
Sbjct  315   GQSQPFTINNGTALEMVYRLNVDGQAISAVDDTGMFREWSQDDSFIFGPAAG----QDPF  370

Query  1068  NMTISYP-PGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
             ++TI      +P Y AP  +Y+T RSMG N +VN NYNLTW FPVDSGF+YLVRLHFCE 
Sbjct  371   HLTIKIKFTKVPPYTAPEILYRTARSMGMNRNVNENYNLTWIFPVDSGFYYLVRLHFCEI  430

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                IT IN+RVF I+LNNQTA+   D + +A   GVP
Sbjct  431   APEITGINQRVFEIFLNNQTADDQMDIMVYADGIGVP  467



>ref|XP_007045784.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY01616.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=822

 Score =   312 bits (799),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 214/338 (63%), Gaps = 17/338 (5%)
 Frame = +3

Query  354   YVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKFLLGTGKSS--TSSADSQKPSVPQVPF  524
             Y P + ILL+CG         D R W++D+ S F+     SS   S A S   SVP+VP+
Sbjct  42    YFPLENILLDCGSLASQAVSYDGRNWSSDIRSHFVASNPDSSFTVSRASSAGTSVPEVPY  101

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR F S+FTYSF V+ G KF+RL+FY  SY  LNA+ +  SV  G +TLL+NFSA  T
Sbjct  102   MTARLFHSQFTYSFNVSPGPKFIRLHFYDDSYMSLNASKAFLSVTAGHFTLLRNFSAYLT  161

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTM  881
                +   +  KEF V+V   TL++TF+PS N+ +  AF+NGIE+VS P ++YN  +  + 
Sbjct  162   ARYMKSAYFFKEFIVHVENHTLDLTFSPSTNASDGYAFLNGIEIVSMPLNLYNQGNNVS-  220

Query  882   IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
                        NSTA+E++YRVNVGG  I P+ DTGM RSW  DS Y+F +  G+     
Sbjct  221   ----------GNSTAMETMYRVNVGGQSIPPNQDTGMSRSWTIDSTYLFGSAVGLANYGL  270

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
             D  ++I+YPP +P Y AP  VY T RSMG  + +N NYNL+W+FPVDS F YLVRLHFCE
Sbjct  271   D--VSITYPPEVPAYTAPKVVYDTARSMGSFSQINKNYNLSWFFPVDSSFMYLVRLHFCE  328

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                 IT+IN+RVF I++NNQ  E G D IA +  NG+P
Sbjct  329   IDGKITKINQRVFDIFINNQIVESGVDVIALSQGNGIP  366



>ref|XP_004499647.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=575

 Score =   305 bits (782),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 165/308 (54%), Positives = 213/308 (69%), Gaps = 6/308 (2%)
 Frame = +3

Query  438   VGSKFLLGTGKSSTSSADSQKPSVPQVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPAS  617
              GS F  G+GKS+ S   +  P++PQVPFMTAR F+S +TYSF V+SG  FLRLYFYPAS
Sbjct  4     CGSNF--GSGKSTMSVVATNDPAIPQVPFMTARIFESPYTYSFLVSSGWIFLRLYFYPAS  61

Query  618   YNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDFLVKEFSVNVPGETLNVTFTPSPN  797
             Y+GLN +++ F V    YTLL+NF+  +TT      ++V E+ +++ G TLNVTFTPS  
Sbjct  62    YSGLNISDARFGVTSQSYTLLRNFNVLETTLGSKDHYVVTEYFIHIDGGTLNVTFTPSTT  121

Query  798   SPNSLAFVNGIEVVSHPDIY-NTADGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISP  974
             + N+ AFVNGIEV+S P+IY +T D   +IVG  S   IDN TALE+IYR+NVGG+ I  
Sbjct  122   AINAYAFVNGIEVMSMPNIYTSTDDDVHVIVGIRSVFTIDNITALENIYRLNVGGSNIPG  181

Query  975   SSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPN  1154
             S DTGMFRS   D+ +I     GV   A + N  I YPP   +Y+AP  V+ + RSMGPN
Sbjct  182   SRDTGMFRSCSADASFILQTAFGVVNGAIEVN--IEYPPRTSSYIAPTIVFSSARSMGPN  239

Query  1155  ASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAW  1334
             A++   YNLTW F +DSGF YLVRLHFCE TT+IT++N+RVF I+L NQ+A   AD IAW
Sbjct  240   ANIKMGYNLTWTFSIDSGFAYLVRLHFCEGTTVITKVNQRVFKIFLANQSAFNTAD-IAW  298

Query  1335  AGKNGVPK  1358
             A    +P+
Sbjct  299   ANTFNLPQ  306


 Score =   253 bits (647),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 137/264 (52%), Positives = 175/264 (66%), Gaps = 5/264 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             D+ PTD+ILL CGGP    + D R W+TD GS F   +GKS+ S   +  P VPQVPFMT
Sbjct  316   DFKPTDEILLYCGGPFLSLNLDGRSWSTDRGSNFR--SGKSTMSEVATNDPPVPQVPFMT  373

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             A+ F+S +TYSFPV SG  FLRLYFYPASY+GLN +++ F V    YTLL+NFS  +TT 
Sbjct  374   AQIFESPYTYSFPVPSGWIFLRLYFYPASYSGLNISDTRFGVTSQSYTLLRNFSVLETTL  433

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGST-MIV  887
                  ++VKE+S+++ G TLNVTFTPS  + NS AFVN IEV+S P+IY + D    +IV
Sbjct  434   GSKDYYVVKEYSIHIDGGTLNVTFTPSTTAINSYAFVNWIEVMSMPNIYTSTDDDVYVIV  493

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             G  S   IDN TALE+ YR+NVG + I  S DTGMFRSW  D+ +I   GT      D  
Sbjct  494   GIRSVFTIDNRTALENFYRLNVGESNIPSSRDTGMFRSWSADASFIL--GTAFRAVNDGI  551

Query  1068  NMTISYPPGMPTYVAPVEVYKTLR  1139
              + I YPPG P+Y+AP  ++ + R
Sbjct  552   EVNIEYPPGTPSYIAPTILFSSGR  575



>gb|KDP27678.1| hypothetical protein JCGZ_20098 [Jatropha curcas]
Length=464

 Score =   302 bits (773),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 171/343 (50%), Positives = 215/343 (63%), Gaps = 13/343 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVG--SKFL-LGTGKSSTSSADSQKPSVPQVPF  524
             Y PTD ILLN G P G    D RKW  D    SK+  + +  SS S A  Q PSV QVP+
Sbjct  27    YTPTDLILLNSGAPSGDQSMDRRKWEGDADQQSKYCPMNSETSSASKASQQDPSVTQVPY  86

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR  +S++T  FPV+ G KF+RLYFYP SY+GL+ + S FSV    YTLL NFS+  T
Sbjct  87    MTARIIRSKYTCMFPVSMGPKFIRLYFYPNSYSGLDTSTSFFSVTANGYTLLSNFSSYLT  146

Query  705   TEALN--FDFLVKEFSVNV--PGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTA-  866
               A+     + VKEF + V      +N+TFTPSPN     AF+NGIE+VS P ++Y+   
Sbjct  147   VSAMQPRVAYFVKEFIITVWDNQAVINLTFTPSPNC---FAFINGIEIVSRPTNLYSKDN  203

Query  867   DGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGV  1046
             D +   V  N   N DN+TALE++ R+NVGG  I    DTGMFR+W +DS Y+F   +GV
Sbjct  204   DYAYPFVNDNMIFNFDNTTALETVCRLNVGGGDIENVDDTGMFRTWFDDSSYLFGGLSGV  263

Query  1047  TETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVR  1226
              E     N+TI Y    P YVAP  VY + R+MGP++ +N NYNLTW+F VDSGF YL+R
Sbjct  264   -EHMGRGNVTIKYSKDTPAYVAPEAVYISKRTMGPDSMINRNYNLTWHFLVDSGFNYLLR  322

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             LHFCE    IT   +RVF I++NN TAE  AD I W+G N  P
Sbjct  323   LHFCETEKEITHEGQRVFSIFINNMTAEAQADVIHWSGGNSNP  365



>ref|XP_002447000.1| hypothetical protein SORBIDRAFT_06g026735 [Sorghum bicolor]
 gb|EES11328.1| hypothetical protein SORBIDRAFT_06g026735, partial [Sorghum bicolor]
Length=504

 Score =   303 bits (776),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 163/336 (49%), Positives = 213/336 (63%), Gaps = 9/336 (3%)
 Frame = +3

Query  369   KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  545
             +I +NCG     TD D R W  D  SKF    G  + + A  + PS+P  VP+MTAR F 
Sbjct  36    QIRVNCGASVSATDSDGRAWDGDAASKFAPSVGGVA-AGASYKDPSLPSPVPYMTARVFD  94

Query  546   SEFTYSFPVASG---RKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  716
             S +TYSFP   G   R FLRL+FYP++Y    A +++F V  G  TLL++F+A QT  AL
Sbjct  95    SSYTYSFPTRPGSPRRVFLRLFFYPSAYGDRAAGDALFGVTAGGVTLLRDFNASQTAFAL  154

Query  717   NFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTMI-VG  890
             +  +LV+EFS+N+ G  L+VTF PS +S    AFVNGIE+V  P D+  T    T    G
Sbjct  155   DQAYLVREFSLNISGARLDVTFAPSSSSNGYYAFVNGIEIVPTPGDMVITKPVPTFANGG  214

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGM-FRSWDEDSKYIFSAGTGVTETADDY  1067
                P+ I   TA +++YR+NVGG  +SP  D+G+ +RSWD+DS YIF A  GV+    D 
Sbjct  215   LPDPMPIRADTAFQTMYRLNVGGTAVSPGDDSGLLYRSWDDDSPYIFGAAFGVSY-GKDS  273

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             N+TI Y   +P YVAP  VY + RSMGP+A +N NYNLTW  PVD+GF+Y++R HFCE  
Sbjct  274   NVTIQYTASVPAYVAPESVYASARSMGPSAHINLNYNLTWILPVDAGFYYMLRFHFCEIQ  333

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
               IT +N+RVF IY+NNQTA+   D IAW G  G P
Sbjct  334   YPITRLNQRVFDIYINNQTAQSQMDVIAWGGGIGRP  369



>ref|XP_012087729.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=565

 Score =   304 bits (778),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 171/341 (50%), Positives = 215/341 (63%), Gaps = 13/341 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS--ADSQKPSVPQVPFM  527
             Y P D ILLNCG     T  D R W +D  SKF   T ++S+ +  A  Q  SV QVP+M
Sbjct  123   YTPPDIILLNCGESSLTTSPDGRNWVSDARSKFGASTSQNSSFAFKASRQDTSVTQVPYM  182

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F S+FTYSFPV+ G KF+RLYFYP +Y+ L+ + S FSV   +YTLL NFSA  T 
Sbjct  183   TARIFLSKFTYSFPVSLGSKFVRLYFYPVAYSNLDISKSFFSVEANDYTLLSNFSAFLTV  242

Query  708   EALN--FDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNTADGS  875
              A+      +VKEF V +   + LNVTF PS  S    AF+NGIE++S P+ +Y   + S
Sbjct  243   SAMQPPAAAIVKEFVVTIQEKQMLNVTFNPSLKS---FAFINGIEIISMPEGLYIHGNDS  299

Query  876   TMI-VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTE  1052
              ++ VG + P  +DN TALE++YR+NVGG  I  S DTGM+R W +DS YIF A  GVT 
Sbjct  300   PLVNVGIDYPFYLDNKTALETVYRLNVGGRDIDSSGDTGMYRKWVQDSNYIFGAAFGVTS  359

Query  1053  TADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLH  1232
              +    + I+Y    P +VAP  VY T+RSMG    VN  YNLTW FPVD+GF YLVRLH
Sbjct  360   IS---KVKINYTKITPAWVAPELVYSTMRSMGSQRKVNIKYNLTWIFPVDTGFNYLVRLH  416

Query  1233  FCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             FCE    +T   + VF I++NNQTA   AD I W+G  GVP
Sbjct  417   FCETRLEVTGALQLVFSIFINNQTAVAQADVIYWSGGRGVP  457



>ref|XP_002273707.2| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=924

 Score =   312 bits (799),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 170/337 (50%), Positives = 214/337 (64%), Gaps = 11/337 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             Y P + I L+CG     T  D RKWT+D GSKF+     +S+ S  S + SVP VP+MTA
Sbjct  95    YTPVENIALDCGSHGHSTAPDGRKWTSDTGSKFICSQLNASSISMASTQDSVPLVPYMTA  154

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R F S+FTY+FP++ G KFLRL+F+PASY+ L+ +++ FSV    YTLL NFSA  T   
Sbjct  155   RIFTSQFTYAFPLSPGPKFLRLHFHPASYSNLDPSHAFFSVTANHYTLLHNFSAWLTAGF  214

Query  714   LNFDFLVKEFSVNVPGET-LNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTMIV  887
             LN     KE+ V V  E  LN+TF P      + AFVNGIEVVS P D+Y   +  +M  
Sbjct  215   LNQTHFSKEYCVWVSSEQLLNLTFAP---VAGAFAFVNGIEVVSMPTDLYLKGEDISM-A  270

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             GQ+ P  I+N TALE +YR+NV G  IS   DTGMFR W +D  +IF    G     D +
Sbjct  271   GQSQPFTINNGTALEMVYRLNVDGQAISAVDDTGMFREWSQDDSFIFGPAAG----QDPF  326

Query  1068  NMTISYP-PGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
             ++TI      +P Y AP  +Y+T RSMG N +VN NYNLTW FPVDSGF+YLVRLHFCE 
Sbjct  327   HLTIKIKFTKVPPYTAPEILYRTARSMGMNRNVNENYNLTWIFPVDSGFYYLVRLHFCEI  386

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                IT IN+RVF I+LNNQTA+   D + +A   GVP
Sbjct  387   APEITGINQRVFEIFLNNQTADDQMDIMVYADGIGVP  423



>ref|NP_001053685.1| Os04g0586500 [Oryza sativa Japonica Group]
 emb|CAE03769.2| OSJNBa0013K16.18 [Oryza sativa Japonica Group]
 dbj|BAF15599.1| Os04g0586500 [Oryza sativa Japonica Group]
 gb|EAZ15355.1| hypothetical protein OsJ_30771 [Oryza sativa Japonica Group]
 dbj|BAG97723.1| unnamed protein product [Oryza sativa Japonica Group]
Length=513

 Score =   301 bits (772),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 163/341 (48%), Positives = 214/341 (63%), Gaps = 16/341 (5%)
 Frame = +3

Query  369   KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  545
             +I L+CG     TD D R W  D  S F         + A  Q PS+P  VP+MTAR F 
Sbjct  36    QIRLSCGASASATDGDGRAWDGDAVSTFAPSV-TGVAADASYQDPSLPSPVPYMTARVFS  94

Query  546   SEFTYSFPVASGRKFLRLYFYPASYNGLNATNS----VFSVRVGEYTLLKNFSAGQTTEA  713
             S +TYSFPV  GR FLRLYFYP++Y  L A  +    +F V  G  TLL++F+A QT  A
Sbjct  95    SSYTYSFPVKPGRVFLRLYFYPSAYGNLGAAAAAADALFGVTAGGITLLRDFNASQTALA  154

Query  714   LNFDFLVKEFSVNVP--GETLNVTFTPSP-----NSPNSLAFVNGIEVVSHPDIYNTADG  872
             + + ++V+EFS+NV     +LNVTF PSP     +  +  AFVNGIEVV  PD++ T   
Sbjct  155   VGYAYIVREFSLNVSSGATSLNVTFAPSPRGAPGHGSHHYAFVNGIEVVPTPDMFTTPVP  214

Query  873   STMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMF-RSWDEDSKYIFSAGTGVT  1049
             +    G+ +P+ +   TA +++YR+NVGG  I+P  D G F R+WD D+ YIF A  GVT
Sbjct  215   AFANGGRPNPMPLRADTAFQTMYRLNVGGEAITPRDDAGGFYRTWDNDAPYIFGAAFGVT  274

Query  1050  ETADDYNMTISY-PPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVR  1226
               A D N+++ Y PP +P Y AP +VY T RSMGPNA +N NYNLTW  PVD+GF+YL+R
Sbjct  275   -FAKDSNVSVRYNPPSVPKYAAPEDVYATARSMGPNAQINLNYNLTWILPVDAGFYYLLR  333

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
              HFCE    IT++N+R F IY+NNQTA+   D I W+G  G
Sbjct  334   FHFCEIQYPITKVNQRSFFIYINNQTAQSQMDVIVWSGGIG  374



>gb|EMT16871.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=883

 Score =   311 bits (796),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 170/333 (51%), Positives = 215/333 (65%), Gaps = 9/333 (3%)
 Frame = +3

Query  363   TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  539
             T  IL+NCG      D   R W  D GSKF     K   ++A +Q PS+P  VPFMTAR 
Sbjct  30    TGLILVNCGASVQGDDDSGRTWDGDTGSKFAPSL-KGVAATAPNQDPSLPSTVPFMTARI  88

Query  540   FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  719
             F S +TYSF V  GR FLRLYFYP +Y     +++ FSV   +  LL +FSA QT +A+ 
Sbjct  89    FTSNYTYSFSVKPGRMFLRLYFYPVAYPNYAVSDAFFSVTTPKLVLLNDFSASQTAQAIT  148

Query  720   FDFLVKEFSVNVP-GETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQN  896
               FLV+EFSVNV  G +L++TF PS +   S AFVNGIE+V  PDI+   D  T  VG N
Sbjct  149   SAFLVREFSVNVSSGSSLDLTFAPSAHRNGSYAFVNGIEIVPTPDIFTAPD--TRNVGDN  206

Query  897   -SPLNIDNSTALESIYRVNVGGNVISPSSDTGMF-RSWDEDSKYIFSAGTGVTETADDYN  1070
              +P + D S++L+++YR+NVGG  ISP  D G F RSW  D+ YI + G+GVT + DD N
Sbjct  207   TAPFSFDTSSSLQTMYRLNVGGQAISPKGDLGGFYRSWANDAPYI-AGGSGVTFSKDD-N  264

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +TI+Y   +P Y AP +VY T RSMGP A +N NYNLTW  PVD+GFFYL+R HFCE   
Sbjct  265   LTITYTSKVPKYTAPPDVYGTARSMGPTAQINLNYNLTWILPVDAGFFYLLRFHFCEIQY  324

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
              I +IN+R F IY+NNQTA+   D I W+G  G
Sbjct  325   PIIKINQRSFFIYINNQTAQEQMDVIVWSGGIG  357



>gb|KJB80427.1| hypothetical protein B456_013G096600 [Gossypium raimondii]
Length=811

 Score =   309 bits (792),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 161/339 (47%), Positives = 216/339 (64%), Gaps = 13/339 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ---VPF  524
             Y+ T+ I L+CG     +    R W++D+GS+F+     +S S +DS   +  +   VP+
Sbjct  42    YLRTESIFLDCGSSAKQSLSLGRNWSSDIGSQFI-----ASNSDSDSIITTASKGMTVPY  96

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             +TAR F ++F+Y+F V  G KF+RL+FY  SY GLNA+ S  ++  G YTLL+NFS   T
Sbjct  97    ITARLFYTKFSYTFNVTPGPKFIRLHFYSDSYQGLNASQSFLTITAGRYTLLRNFSCYLT  156

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTM  881
              + L  D   KEF V V   TL + F+P+ N PN+  FVNGIEVVS P  +Y   D  ++
Sbjct  157   AKYLKTDHFFKEFIVYVENHTLELIFSPTSNPPNAYGFVNGIEVVSMPLQLYIRGDDVSL  216

Query  882   -IVG-QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTET  1055
               VG  N+ L IDN  ALE +YR NVGG  ISP  DTGMFR+W++D+ YIF A  G  + 
Sbjct  217   PFVGFHNNMLAIDNKFALEMVYRANVGGQTISPDQDTGMFRTWNDDASYIFGAAFGQLDY  276

Query  1056  ADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHF  1235
               D  ++I YP  +P Y AP +VY+T RSMG    +N NYNL+W+FPVD+GF YLVRLHF
Sbjct  277   --DTTVSIQYPKTVPAYTAPEDVYRTARSMGQYNEINMNYNLSWFFPVDTGFLYLVRLHF  334

Query  1236  CEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
             CE    +T  N+RVF I++NNQTAE  AD I W+  +GV
Sbjct  335   CEIVPDMTLGNQRVFFIFINNQTAETQADVIVWSKGHGV  373



>ref|XP_008668826.1| PREDICTED: receptor-like protein kinase FERONIA [Zea mays]
 tpg|DAA35839.1| TPA: putative receptor-like protein kinase family protein [Zea 
mays]
Length=897

 Score =   311 bits (796),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 163/330 (49%), Positives = 212/330 (64%), Gaps = 5/330 (2%)
 Frame = +3

Query  369   KILLNCGGPDGV-TDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTF  542
             +I L+CG      TD D R W +D  SKF         ++A SQ PS+P   P+MTAR F
Sbjct  34    QIRLDCGASSSTSTDADGRSWDSDASSKFAPSL-NGVAATASSQDPSLPSPTPYMTARVF  92

Query  543   QSEFTYSFPVASGRKFLRLYFYPASYNGLNA-TNSVFSVRVGEYTLLKNFSAGQTTEALN  719
              S +TYSFPV  GR F+RLYFYP  Y G +A  ++ F V     TLL++F+A QT+ +L 
Sbjct  93    TSNYTYSFPVTPGRMFVRLYFYPTIYGGNHAPADAYFGVTAANLTLLQSFNASQTSLSLG  152

Query  720   FDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNS  899
               F V+E+SVNV   +L++TF+PS +   S AF+NGIE+V  PD++ T   +    G   
Sbjct  153   VAFFVREYSVNVTEGSLDLTFSPSTHHNGSYAFINGIEIVPTPDLFTTPTPTLSNGGNPD  212

Query  900   PLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTI  1079
             P  I   T  E++YR+NVGG  ISP  DTG +RSW  D  YI++AG GV    DD N+TI
Sbjct  213   PFPILAGTGFETMYRLNVGGQAISPGGDTGFYRSWVNDVPYIYAAGFGVAFGKDD-NLTI  271

Query  1080  SYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIIT  1259
             SY P +P Y APV+VY T RSMGPNA +N NYNLTW  PVD+GF+YL+R HFCE    IT
Sbjct  272   SYTPTVPNYTAPVDVYATARSMGPNAQINLNYNLTWILPVDAGFYYLLRFHFCEIQYPIT  331

Query  1260  EINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
             ++N+R F IY+NNQTA+   D IA++G  G
Sbjct  332   KVNQRSFFIYINNQTAQQEMDVIAFSGGIG  361



>gb|EMS52253.1| Receptor-like protein kinase FERONIA [Triticum urartu]
Length=827

 Score =   310 bits (793),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 160/336 (48%), Positives = 216/336 (64%), Gaps = 7/336 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFM  527
             D + +  +LLNCG      D   R W  D GSKF+  + K   ++A  Q PS+P  VP+M
Sbjct  28    DSMDSGLVLLNCGESKQDNDSSGRMWDGDTGSKFMT-SFKGIAANASYQDPSLPSMVPYM  86

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             +AR F S + YSFPV   R FLRLYFYP SY     +++ F V +G   LL +F+A QT 
Sbjct  87    SARIFTSNYKYSFPVNPDRMFLRLYFYPISYGNYTMSDAFFGVTLGNLVLLNSFNASQTA  146

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
             +A N+ +LV+EFSV +   +L++TF PS +  +S AFVNGIE+V  PDI+ TAD  T+ V
Sbjct  147   QAANYAYLVREFSVYISSRSLDITFAPSTHQNSSYAFVNGIEIVPTPDIFTTAD--TIFV  204

Query  888   GQN--SPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
               +  +P     +T  +++YR NVGG  ISP +D+G +R W +DS YIF A +GVT + D
Sbjct  205   HHDYIAPFTFPANTGFQTMYRFNVGGQAISPENDSGFYRLWADDSPYIFGASSGVTYSKD  264

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
             + N+TI Y P +  Y+AP++VY T RSMGP A VN NYNLTW  PVD+GF YL+R HFCE
Sbjct  265   N-NVTIRYTPVVTKYIAPLDVYDTARSMGPTAQVNLNYNLTWILPVDAGFIYLLRFHFCE  323

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
                 IT+ N+R F IY+NNQTA+   D I+ +G  G
Sbjct  324   IQYPITKENQRTFYIYINNQTAQWAMDVISLSGGLG  359



>ref|XP_003568697.1| PREDICTED: receptor-like protein kinase FERONIA [Brachypodium 
distachyon]
Length=878

 Score =   310 bits (795),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 160/328 (49%), Positives = 209/328 (64%), Gaps = 4/328 (1%)
 Frame = +3

Query  369   KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  545
              + LNCG      D + R W  D  SKF     K  T+ A  Q PS+P  VPFMTAR F 
Sbjct  32    HVALNCGASGQNNDDNGRTWDGDTSSKFAPLV-KGVTAPASYQHPSLPSTVPFMTARIFT  90

Query  546   SEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFD  725
             S +TYSFPV++GR F+RLYFYP +Y     +++ FSV     +LL +F+A QT +A+N  
Sbjct  91    SNYTYSFPVSAGRMFVRLYFYPIAYGNYAVSDAFFSVTTRNLSLLNDFNASQTAQAINVA  150

Query  726   FLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPL  905
             +LV+EFS+NV   +L++TF PS +   S AFVNGIE+V  PDI+ TAD   +  G  +P 
Sbjct  151   YLVREFSLNVSSGSLDLTFAPSKHWNGSYAFVNGIEIVPTPDIFTTADTRFVNGGTPAPF  210

Query  906   NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISY  1085
              I+     ++++R+NVGG  I P  D   +RSW  DS YIF  G+GV  + D+ N+TI Y
Sbjct  211   QINTDRGFQTMHRLNVGGQAIPPKDDLSFYRSWANDSPYIF-GGSGVAFSRDN-NLTIKY  268

Query  1086  PPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEI  1265
                +P Y AP+ VY T RSMG NA VN NYNLTW  PVD+GFFYL+R HFCE    IT++
Sbjct  269   TSTVPNYTAPIGVYGTARSMGTNAQVNLNYNLTWILPVDAGFFYLLRFHFCEIQYPITKV  328

Query  1266  NERVFIIYLNNQTAEPGADAIAWAGKNG  1349
             N+R F IY+NNQTA+   D IAW+G  G
Sbjct  329   NQRSFFIYINNQTAQRQMDVIAWSGGIG  356



>ref|XP_012084847.1| PREDICTED: LOW QUALITY PROTEIN: putative receptor-like protein 
kinase At5g39000 [Jatropha curcas]
Length=893

 Score =   310 bits (794),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 173/343 (50%), Positives = 215/343 (63%), Gaps = 17/343 (5%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS----ADSQKPSVPQVP  521
             Y P D ILLNCG     T  D R W +D  SKF  G   S  SS    A  Q  SV QVP
Sbjct  38    YTPADIILLNCGASSLTTSPDGRNWASDARSKF--GASNSQNSSFAFKASRQDTSVTQVP  95

Query  522   FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  701
             +MTAR F S+FTYSFPV+ G KF+RLYFYP +Y+ L+ + S FSV   +YTLL NFSA  
Sbjct  96    YMTARIFLSKFTYSFPVSLGSKFVRLYFYPVAYSNLDISKSFFSVEANDYTLLSNFSAFL  155

Query  702   TTEALN--FDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNTAD  869
             T  A+      +VKEF V +   + LNVTF PS  S    AF+NGIE++S P+ +Y   +
Sbjct  156   TVSAMQPPAAAIVKEFVVTIQEKQMLNVTFNPSLKS---FAFINGIEIISMPEGLYIHGN  212

Query  870   GSTMI-VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGV  1046
              S ++ VG + P  +DN+TALE++YR+NVGG  I  S DTGM+R W +DS YIF A  GV
Sbjct  213   DSPLVNVGIDYPFYLDNTTALETVYRLNVGGRDIDGSGDTGMYRKWVQDSNYIFGAAFGV  272

Query  1047  TETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVR  1226
                +    + I+Y    P +VAPV VY T+RSMGP   VN  YNLTW FPVD+GF YLVR
Sbjct  273   VSIS---KVKINYTKTTPAWVAPVLVYITMRSMGPQRKVNIKYNLTWIFPVDTGFNYLVR  329

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             LHFCE    +T   + VF I++NN+TA   AD I W+G  GVP
Sbjct  330   LHFCETRLEVTCARQLVFSIFINNKTAGGQADVIYWSGGKGVP  372



>ref|XP_012068359.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=816

 Score =   308 bits (790),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 159/338 (47%), Positives = 220/338 (65%), Gaps = 6/338 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQ-DNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             Y P + + L+CG     T   D R WT D        T  ++TS   S +P VPQVP+ T
Sbjct  29    YEPLENVALDCGSSGLHTSSFDGRNWTNDATFISQSQTNSTATSMVSSIEPGVPQVPYKT  88

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F SEFTY+F +  G KFLRL+FYP SY G +A+ +  SV  G++TLL NFSA     
Sbjct  89    ARLFFSEFTYTFNLTPGPKFLRLHFYPTSYPGFDASKAFLSVTGGDHTLLSNFSASLAAN  148

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTM-I  884
               N     KEF V+V   +L +TF+PS N+ ++ AFVNGIE+VS P ++Y   +   +  
Sbjct  149   YKNVYVFFKEFIVHVQNHSLRLTFSPSSNASDAFAFVNGIELVSMPLNLYIRGENVPLPF  208

Query  885   VGQ-NSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
             VG   +P+ +D + ALE++YR+NVGG+ ISP SDTGMFR+W +D +Y++ A  G  + A 
Sbjct  209   VGYPYNPIRLDTTYALETVYRINVGGDDISPKSDTGMFRTWIKDDQYLYGAADG--QLAY  266

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
             DY + + Y P +P Y AP  VY+T R MG ++ +N N+NL+W+FPV++GF YLVRLHFCE
Sbjct  267   DYGLQVKYTPMVPAYTAPDLVYRTARFMGFDSRINLNFNLSWFFPVETGFLYLVRLHFCE  326

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                 +T+IN++VF IY+NN+TA+P AD I W+G  GVP
Sbjct  327   LDRNMTKINKKVFSIYMNNETAQPQADVIGWSGGQGVP  364



>ref|XP_007032832.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03758.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=807

 Score =   308 bits (789),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 178/340 (52%), Positives = 214/340 (63%), Gaps = 11/340 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS--SADSQKPSVPQVPFM  527
             Y PTD ILLNCG     T  D R W  D   K+     K+S+    A   +PSV +VP+M
Sbjct  26    YTPTDHILLNCGTSSNTTSLDGRNWVGDADYKYSSSISKASSFASKASDLEPSVTEVPYM  85

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F  +FTY FPV+ G KFLRLYFYP  Y GL+ T S FSV    YTLL+NFSA   +
Sbjct  86    TARIFHGKFTYKFPVSPGPKFLRLYFYPNEYPGLDITTSFFSVTANNYTLLRNFSAYLVS  145

Query  708   EALNFD-FLVKEFSVNVPG-ETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTAD-GS  875
                    F++KEF V V   + L+VTF+PSP S    AFVNGIEVVS P ++Y     GS
Sbjct  146   ATSPPKVFIIKEFVVPVSNNKMLHVTFSPSPYS---FAFVNGIEVVSMPTNLYTVQKYGS  202

Query  876   TMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTET  1055
               +VG N    +DN+TALE+ YR+NVGG  +S   D+GMFR+W  D  YIF A +GVT  
Sbjct  203   HRLVGTNYFFELDNNTALETAYRLNVGGGDVSNIDDSGMFRTWHGDVDYIFGAASGVTPF  262

Query  1056  ADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHF  1235
               +   TI Y    P Y AP  VYKT R+MGP  S+N NYNLTW  PVDSGF+YLVRLHF
Sbjct  263   QPE--ATIKYTLATPAYTAPEVVYKTSRTMGPTPSINLNYNLTWLCPVDSGFYYLVRLHF  320

Query  1236  CEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             CE    +T  N+RVF I++NNQTAE G D IA +G NGVP
Sbjct  321   CETEPDVTMPNQRVFNIFINNQTAEAGMDVIAVSGGNGVP  360



>gb|EAY95324.1| hypothetical protein OsI_17151 [Oryza sativa Indica Group]
Length=513

 Score =   300 bits (768),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 162/341 (48%), Positives = 214/341 (63%), Gaps = 16/341 (5%)
 Frame = +3

Query  369   KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  545
             +I L+CG     TD D R W  D  S F         + A  Q PS+P  VP+MTAR F 
Sbjct  36    QIRLSCGASASATDGDGRAWDGDAVSTFAPSV-TGVAADASYQDPSLPSPVPYMTARVFS  94

Query  546   SEFTYSFPVASGRKFLRLYFYPASYNGLNATNS----VFSVRVGEYTLLKNFSAGQTTEA  713
             S +TYSFPV  GR FLRLYFYP++Y  L A  +    +F V  G  TLL++F+A QT  A
Sbjct  95    SSYTYSFPVKPGRVFLRLYFYPSAYGNLGAAAAAADALFGVTAGGITLLRDFNASQTALA  154

Query  714   LNFDFLVKEFSVNVP--GETLNVTFTPSP-----NSPNSLAFVNGIEVVSHPDIYNTADG  872
             + + ++V+EFS+NV     +LNVTF PSP     +  +  AFVNGIEVV  PD++ T   
Sbjct  155   VGYAYIVREFSLNVSSGATSLNVTFAPSPRGAPGHGSHHYAFVNGIEVVPTPDMFTTPVP  214

Query  873   STMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMF-RSWDEDSKYIFSAGTGVT  1049
             +    G+ +P+ +   TA +++YR+NVGG  I+P  D G F R+WD D+ +IF A  GVT
Sbjct  215   AFANGGRPNPMPLRADTAFQTMYRLNVGGEAITPRDDAGGFYRTWDNDAPHIFGAAFGVT  274

Query  1050  ETADDYNMTISY-PPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVR  1226
               A D N+++ Y PP +P Y AP +VY T RSMGPNA +N NYNLTW  PVD+GF+YL+R
Sbjct  275   -FAKDSNVSVRYNPPSVPKYAAPEDVYATARSMGPNAQINLNYNLTWILPVDAGFYYLLR  333

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
              HFCE    IT++N+R F IY+NNQTA+   D I W+G  G
Sbjct  334   FHFCEIQYPITKVNQRSFFIYINNQTAQSQMDVIVWSGGIG  374



>gb|KDP24662.1| hypothetical protein JCGZ_26521 [Jatropha curcas]
Length=740

 Score =   306 bits (783),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 171/341 (50%), Positives = 215/341 (63%), Gaps = 13/341 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS--ADSQKPSVPQVPFM  527
             Y P D ILLNCG     T  D R W +D  SKF   T ++S+ +  A  Q  SV QVP+M
Sbjct  44    YTPPDIILLNCGESSLTTSPDGRNWVSDARSKFGASTSQNSSFAFKASRQDTSVTQVPYM  103

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F S+FTYSFPV+ G KF+RLYFYP +Y+ L+ + S FSV   +YTLL NFSA  T 
Sbjct  104   TARIFLSKFTYSFPVSLGSKFVRLYFYPVAYSNLDISKSFFSVEANDYTLLSNFSAFLTV  163

Query  708   EALN--FDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNTADGS  875
              A+      +VKEF V +   + LNVTF PS  S    AF+NGIE++S P+ +Y   + S
Sbjct  164   SAMQPPAAAIVKEFVVTIQEKQMLNVTFNPSLKS---FAFINGIEIISMPEGLYIHGNDS  220

Query  876   TMI-VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTE  1052
              ++ VG + P  +DN TALE++YR+NVGG  I  S DTGM+R W +DS YIF A  GVT 
Sbjct  221   PLVNVGIDYPFYLDNKTALETVYRLNVGGRDIDSSGDTGMYRKWVQDSNYIFGAAFGVTS  280

Query  1053  TADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLH  1232
              +    + I+Y    P +VAP  VY T+RSMG    VN  YNLTW FPVD+GF YLVRLH
Sbjct  281   IS---KVKINYTKITPAWVAPELVYSTMRSMGSQRKVNIKYNLTWIFPVDTGFNYLVRLH  337

Query  1233  FCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             FCE    +T   + VF I++NNQTA   AD I W+G  GVP
Sbjct  338   FCETRLEVTGALQLVFSIFINNQTAVAQADVIYWSGGRGVP  378



>ref|XP_012084348.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=904

 Score =   309 bits (792),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 173/343 (50%), Positives = 215/343 (63%), Gaps = 17/343 (5%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS----ADSQKPSVPQVP  521
             Y P D ILLNCG     T  D R W +D  SKF  G   S  SS    A  Q  SV QVP
Sbjct  38    YTPADIILLNCGASSLTTSPDGRNWASDARSKF--GASNSQNSSFAFKASRQDTSVTQVP  95

Query  522   FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  701
             +MTAR F S+FTYSFPV+ G KF+RLYFYP +Y+ L+ + S FSV   +YTLL NFSA  
Sbjct  96    YMTARIFLSKFTYSFPVSLGSKFVRLYFYPVAYSNLDISKSFFSVEANDYTLLSNFSAFL  155

Query  702   TTEALN--FDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNTAD  869
             T  A+      +VKEF V +   + LNVTF PS  S    AF+NGIE++S P+ +Y   +
Sbjct  156   TVSAMQPPAAAIVKEFVVTIQEKQMLNVTFNPSLKS---FAFINGIEIISMPEGLYIHGN  212

Query  870   GSTMI-VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGV  1046
              S ++ VG + P  +DN+TALE++YR+NVGG  I  S DTGM+R W +DS YIF A  GV
Sbjct  213   DSPLVNVGIDYPFYLDNTTALETVYRLNVGGRDIDGSGDTGMYRKWVQDSNYIFGAAFGV  272

Query  1047  TETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVR  1226
                +    + I+Y    P +VAPV VY T+RSMGP   VN  YNLTW FPVD+GF YLVR
Sbjct  273   VSIS---KVKINYTKTTPAWVAPVLVYITMRSMGPQRKVNIKYNLTWIFPVDTGFNYLVR  329

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             LHFCE    +T   + VF I++NN+TA   AD I W+G  GVP
Sbjct  330   LHFCETRLEVTCARQLVFSIFINNKTAGGQADVIYWSGGKGVP  372



>ref|XP_007045781.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 ref|XP_007045782.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY01613.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
 gb|EOY01614.1| Malectin/receptor-like protein kinase family protein, putative 
isoform 1 [Theobroma cacao]
Length=832

 Score =   307 bits (787),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 161/347 (46%), Positives = 218/347 (63%), Gaps = 23/347 (7%)
 Frame = +3

Query  354   YVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKF-LLGTGKSSTSSADSQKPSVPQVPFM  527
             YVP+++I L+CG   +     D R W++D+GS F    +  +ST S+ S   +VP+VP+M
Sbjct  43    YVPSEQIFLDCGSSAEKSLLFDGRNWSSDIGSDFTAYNSDSNSTVSSASIGTAVPRVPYM  102

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F S+F+Y+F V  G KF+RLYFYP SY GLN + S  +V  G YTLL+NFS   T 
Sbjct  103   TARLFYSKFSYTFNVTPGPKFIRLYFYPDSYRGLNVSESFLTVTSGHYTLLRNFSCYLTA  162

Query  708   EALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTMI  884
             + LN  +  KEF ++V   TL +TF+P+ ++PN+  FVNGIEVVS P  +Y        I
Sbjct  163   KYLNAAYFFKEFIIHVENHTLELTFSPTLDAPNAYGFVNGIEVVSMPLHLY--------I  214

Query  885   VGQNSPL----------NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSA  1034
              G + PL            +N++ALE++YR  +GG  IS + DTGMFR+WD D  YIF A
Sbjct  215   RGHDVPLPFIGFLPKMIMFNNNSALETVYRATMGGQTISSAHDTGMFRTWDADETYIFGA  274

Query  1035  GTGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFF  1214
               G  +   D  ++I Y   +P Y AP +VY T RSMG    +N NYNL+W+FPVD+GF 
Sbjct  275   AYGQIDI--DITLSIQYSKTVPAYTAPGDVYHTARSMGQYNEINRNYNLSWFFPVDTGFK  332

Query  1215  YLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             YL+RLHFCE    I   N+RVF I++NNQTAE  AD I W+  +G+P
Sbjct  333   YLIRLHFCEIVPGINLENQRVFFIFINNQTAESQADVIVWSKGHGIP  379



>ref|XP_010921463.1| PREDICTED: receptor-like protein kinase ANXUR2 [Elaeis guineensis]
Length=870

 Score =   308 bits (789),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 164/338 (49%), Positives = 224/338 (66%), Gaps = 10/338 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMT  530
             Y P+D  L+NCG      D D RKW+ D  SKF + T  S+T++A SQ PS+P  VP+MT
Sbjct  26    YTPSDSFLVNCGSSSDAADADGRKWSADDTSKFGVSTKNSATATAASQDPSLPSAVPYMT  85

Query  531   ARTFQSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSVRV-GEYTLLKNFSAGQT  704
             AR F SE TY F V  + R ++RL+FYP++YNGL   NS F+V   G  TLL+NFSA  T
Sbjct  86    ARVFTSESTYKFSVNKTARHWIRLHFYPSTYNGLAPENSYFAVSASGGVTLLRNFSAYIT  145

Query  705   TEALNFDFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTM  881
             T+AL   +LVKEFS+    + ++++TFTPS     S AF+NGIE++S P+I++       
Sbjct  146   TKALTQAYLVKEFSIMPSSDGSISLTFTPSDKYDGSYAFINGIEIISMPEIFSQP---AK  202

Query  882   IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
              VG +       S+AL+++YR+NVGG  I  ++D+G+ R+W +DS YI+ +G GVT +A 
Sbjct  203   TVGYSDRSTDVGSSALQTVYRLNVGGGYIPATNDSGLSRTWYDDSPYIYGSGFGVTFSAG  262

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
             D  + I Y    P Y+APV+VY+T RSMGP+ SVN NYNLTW   VD  F Y+VRLHFCE
Sbjct  263   D-KLKIKYSDSTPQYMAPVDVYRTARSMGPDNSVNMNYNLTWILQVDGNFTYMVRLHFCE  321

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                 ++++N+RVF I+++NQTAE   D IAW  K GVP
Sbjct  322   LQ--MSKVNQRVFDIFVDNQTAEASVDVIAWTSKKGVP  357



>ref|XP_004499818.1| PREDICTED: receptor-like protein kinase FERONIA-like [Cicer arietinum]
Length=312

 Score =   293 bits (749),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 156/291 (54%), Positives = 196/291 (67%), Gaps = 7/291 (2%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             ++ PT++ILLNCGG     D D R W+TD  S F  GTGKS+ S      P+VPQ+PFMT
Sbjct  23    NFKPTNEILLNCGGAS--LDLDGRSWSTDRASNF--GTGKSTMSEVAINDPAVPQIPFMT  78

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F+S +TYSFPVASG  FLRLYFY ASY GLN +++ F V    YTLL NFS  +TT 
Sbjct  79    ARIFESPYTYSFPVASGWIFLRLYFYAASYPGLNISDARFGVTSQSYTLLTNFSVLETTL  138

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIY-NTADGSTMIV  887
                  ++VKE+S+++ G TLNVTFTPS  + N+ AFVNGIEV+S P+IY +T D   +IV
Sbjct  139   GSKDHYVVKEYSIHIGGVTLNVTFTPSTTTINAYAFVNGIEVMSMPNIYTSTDDDVHVIV  198

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
             G  S   IDN  ALE++YR+NVGG+ IS S DTGMFRSW  D+ +I     G      D 
Sbjct  199   GIRSVFTIDNRAALENVYRLNVGGSNISGSRDTGMFRSWSVDASFILGTAFGAVNGGIDV  258

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYL  1220
             N  I  PPG P+Y+AP  V+ + R MGPNA++N +YNLTW F +D GF YL
Sbjct  259   N--IECPPGTPSYIAPTIVFSSARLMGPNANINLSYNLTWTFSIDYGFAYL  307



>gb|KDP24661.1| hypothetical protein JCGZ_26520 [Jatropha curcas]
Length=978

 Score =   309 bits (792),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 174/343 (51%), Positives = 218/343 (64%), Gaps = 17/343 (5%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS----ADSQKPSVPQVP  521
             Y PT+ ILL+CG     T  D R W +D  SKF  G   S  SS    A  Q  SV QVP
Sbjct  205   YTPTEIILLSCGASSLTTSPDGRNWVSDARSKF--GASISLNSSFAFKASGQDTSVTQVP  262

Query  522   FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  701
             +MTAR F S+FTYSFPV+ G KF+RLYFYP +Y+ L+ + S FSV   +YTLL NFSA  
Sbjct  263   YMTARIFLSKFTYSFPVSPGSKFVRLYFYPVAYSNLDISKSFFSVEANDYTLLSNFSAFL  322

Query  702   TTEALN--FDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNTAD  869
             T  A+      +VKEF V +   + LN+TF PS  S    AF+NGIE+VS PD +Y   +
Sbjct  323   TVSAMQPPAAAIVKEFVVTIQEKQMLNITFNPSLKS---FAFINGIEIVSMPDSLYIHGN  379

Query  870   GSTMI-VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGV  1046
              S +  VG + P  +D++TALE++YR+NVGG  I  S DTGM+R W EDS YIF A  GV
Sbjct  380   DSLLTNVGIDYPFYLDDTTALETVYRLNVGGRDIDGSGDTGMYRKWVEDSNYIFGAAFGV  439

Query  1047  TETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVR  1226
             T  +    + I+Y    P +VAP  VY ++RSMGPNA+VN NYNLTW FPVD+GF YLVR
Sbjct  440   TSIS---KVKINYTKSTPAWVAPELVYSSMRSMGPNANVNINYNLTWLFPVDTGFNYLVR  496

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             LHFCE    +T   + +F I++NNQT    AD I W+G NG P
Sbjct  497   LHFCETRLEVTGEFQLIFSIFINNQTVVAQADVILWSGGNGFP  539



>gb|EAY97521.1| hypothetical protein OsI_19449 [Oryza sativa Indica Group]
Length=859

 Score =   307 bits (786),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 165/328 (50%), Positives = 206/328 (63%), Gaps = 5/328 (2%)
 Frame = +3

Query  372   ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQS  548
             I LNCG      D  NR W  D  SKF     K + + A  Q PS+P  VP+MTAR F S
Sbjct  13    IFLNCGASGVQPDSYNRSWDGDASSKFAPSV-KGNVARASYQDPSLPSPVPYMTARFFTS  71

Query  549   EFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQTTEALNFD  725
              +TYSFPV+ GR F+RL+FYP +YNG L++ N+ F V      LL NF+A QT  A +  
Sbjct  72    NYTYSFPVSPGRMFVRLHFYPTNYNGNLDSANAYFGVTTNNLILLDNFNASQTALATSSA  131

Query  726   FLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPL  905
             +  +EFSVNV   +L +TF PS  +  S AFVNGIE+V  PDI+ T   ++   G N   
Sbjct  132   YFFREFSVNVTSSSLKLTFAPSTRN-GSYAFVNGIEIVPTPDIFTTPTPTSANGGDNVQY  190

Query  906   NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISY  1085
              ID  T L+++YR+NVGG  ISP  D+G +RSWD DS YI+ A  GVT + D  N+TI Y
Sbjct  191   GIDPVTGLQTMYRLNVGGQPISPQGDSGFYRSWDNDSPYIYGAAYGVTFSKDG-NVTIKY  249

Query  1086  PPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEI  1265
             P   P Y APV VY T RSMGP A +N NYNLTW  PVD+GF YL+R HFCE    IT++
Sbjct  250   PNTEPNYTAPVAVYATARSMGPTAQINLNYNLTWILPVDAGFTYLLRFHFCEIQYPITKV  309

Query  1266  NERVFIIYLNNQTAEPGADAIAWAGKNG  1349
             N+R F IY+NNQTA+   D I W+G  G
Sbjct  310   NQRSFFIYINNQTAQNQMDVIVWSGGIG  337



>ref|XP_012068357.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
 gb|KDP41347.1| hypothetical protein JCGZ_15754 [Jatropha curcas]
Length=478

 Score =   297 bits (760),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 158/338 (47%), Positives = 215/338 (64%), Gaps = 8/338 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQ-DNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             Y P + I L+CG  D  T   D R WT+D    F+  +  ++ S   S  P VPQVP+ T
Sbjct  29    YEPLENIALDCGSFDFQTLSFDGRNWTSD--GTFISQSNSTAASIVSSIDPGVPQVPYKT  86

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F SEFTY+F +  G KFL L+FYP SY G +A+ +  SV  G +TLL NFSA     
Sbjct  87    ARLFFSEFTYNFNLTPGPKFLSLHFYPTSYPGFDASKAFLSVTEGNHTLLSNFSASLAAN  146

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTM-I  884
               +     KEF V+V   +L +TF+PS N+ ++ AFVNGIEVVS P ++Y   +   +  
Sbjct  147   YKDVYAFSKEFIVHVKNHSLRLTFSPSSNASDAFAFVNGIEVVSMPRNLYVRGENVPLPF  206

Query  885   VGQ-NSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
             VG   +P+ +DN+ ALE++YR+NVGG  ISP SD+GMFR+W  D +YIF A  G    A 
Sbjct  207   VGYLYNPIRLDNTYALETVYRINVGGEDISPKSDSGMFRTWKRDDQYIFGANFG--HLAS  264

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
             DY++ + Y P +P + AP  VY T R MG +  +N ++NL+W+FPV++GF YLVRLHFCE
Sbjct  265   DYDLQVKYTPTVPAHTAPDLVYGTARFMGFDPRINLHFNLSWFFPVETGFLYLVRLHFCE  324

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                 IT+IN++VF IY+N +TA+  AD I W+G  GVP
Sbjct  325   LDRSITKINQKVFSIYMNEETAQGQADVITWSGGQGVP  362



>ref|XP_007227151.1| hypothetical protein PRUPE_ppa026453mg [Prunus persica]
 gb|EMJ28350.1| hypothetical protein PRUPE_ppa026453mg [Prunus persica]
Length=860

 Score =   306 bits (785),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 164/335 (49%), Positives = 227/335 (68%), Gaps = 13/335 (4%)
 Frame = +3

Query  363   TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTART  539
             TD  +++CG   G TD D RKW +D  S+FL  + KS+T++A  Q PS+P QVP+M+AR 
Sbjct  28    TDSYVISCGSSSGGTDSDGRKWASD--SQFLTSSYKSNTATAQYQDPSLPSQVPYMSARI  85

Query  540   FQSEFTYSFPVASGRKFL-RLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  716
             F S  +Y F V+  ++ L RL+FYP SYN L+ +NS F V    +TLL NFSA  T +AL
Sbjct  86    FNSASSYKFSVSPKQRLLVRLHFYPTSYNSLDPSNSYFDVVANGFTLLHNFSASITAQAL  145

Query  717   NFDFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTMIVG  890
                ++++EFS+  P    LN+TF PS     S AFVNGIEV+S P D++  A+   +I  
Sbjct  146   TQAYIMREFSLIPPQSGNLNITFIPSSPHDKSYAFVNGIEVISMPADMFKPAN---LIGF  202

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q+  + +  S++L++++R+NVGG  I  ++D+G+ R+W +DS Y+F A  GVT  A   N
Sbjct  203   QDQTVEV-QSSSLQTMFRLNVGGQFIPTTNDSGLTRTWYDDSPYLFGAAFGVTSEAGK-N  260

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             ++I YPP +P Y+AP+ VY T RSMGP+  +N NYNLTW FPVD+ F Y+VR HFCE   
Sbjct  261   VSIKYPPEVPGYIAPLNVYSTARSMGPDPKINQNYNLTWVFPVDANFTYVVRFHFCELQ-  319

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              +T+IN+RVF I+LNNQTA+  ADAIAWAG  GVP
Sbjct  320   -LTKINQRVFDIFLNNQTAQQSADAIAWAGSIGVP  353



>ref|NP_001055184.1| Os05g0318700 [Oryza sativa Japonica Group]
 dbj|BAF17098.1| Os05g0318700, partial [Oryza sativa Japonica Group]
Length=798

 Score =   305 bits (781),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 205/328 (63%), Gaps = 5/328 (2%)
 Frame = +3

Query  372   ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQS  548
             I LNCG      D  NR W  D  SKF     K + + A  Q PS+P  VP+MTAR F S
Sbjct  35    IFLNCGASGVQPDSYNRSWDGDASSKFAPSV-KGNVARASYQDPSLPSPVPYMTARFFTS  93

Query  549   EFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQTTEALNFD  725
              +TYSFPV+ GR F+RL+FYP +YNG L++ N+ F V      LL NF+A QT  A +  
Sbjct  94    NYTYSFPVSPGRMFVRLHFYPTNYNGNLDSANAYFGVTTNNLILLDNFNASQTALATSSA  153

Query  726   FLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPL  905
             +  +EFSVNV   +L +TF PS  +  S AFVNGIE+V  PDI+ T   ++   G N   
Sbjct  154   YFFREFSVNVTSSSLKLTFAPSTRN-GSYAFVNGIEIVPTPDIFTTPTPTSANGGDNVQY  212

Query  906   NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISY  1085
              ID    L+++YR+NVGG  ISP  D+G +RSWD DS YI+ A  GVT + D  N+TI Y
Sbjct  213   GIDPVMGLQTMYRLNVGGQPISPQGDSGFYRSWDNDSPYIYGAAYGVTFSKDG-NVTIKY  271

Query  1086  PPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEI  1265
             P   P Y APV VY T RSMGP A +N NYNLTW  PVD+GF YL+R HFCE    IT++
Sbjct  272   PNTEPNYTAPVAVYATARSMGPTAQINLNYNLTWILPVDAGFTYLLRFHFCEIQYPITKV  331

Query  1266  NERVFIIYLNNQTAEPGADAIAWAGKNG  1349
             N+R F IY+NNQTA+   D I W+G  G
Sbjct  332   NQRSFFIYINNQTAQNQMDVIVWSGGIG  359



>gb|KJB10568.1| hypothetical protein B456_001G207900 [Gossypium raimondii]
Length=794

 Score =   305 bits (781),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 171/342 (50%), Positives = 211/342 (62%), Gaps = 20/342 (6%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             Y+PTD ILLNCG     T  D R W  D     L     S +S+A  Q PSV QVP+MTA
Sbjct  24    YIPTDYILLNCGASSNTTSYDGRNWVAD--DDHLYANTSSFSSTASYQDPSVTQVPYMTA  81

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT--  707
             R F+ EFTY FP++ G KFLRLYFYP  Y GL+ T+S FSV    YTLL NFSA   +  
Sbjct  82    RFFRGEFTYKFPLSPGPKFLRLYFYPNQYPGLDITSSFFSVAANNYTLLSNFSAYLVSAT  141

Query  708   ---EALNFDFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTAD--  869
                +A    F+VKEF + V  E  ++VTF P   SPNS AF+NGIEVVS P    T    
Sbjct  142   SPPQA----FIVKEFVITVGKEQMMDVTFAP---SPNSFAFINGIEVVSMPANLYTGQTY  194

Query  870   GSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVT  1049
             GS  ++  N    ++NSTAL++ YR+NVGG  +    D+GMFR+W++D  YIF A +GVT
Sbjct  195   GSLRLIDTNYFFELENSTALDTAYRLNVGGRDVLDVHDSGMFRTWNQDIDYIFGAASGVT  254

Query  1050  ETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRL  1229
                D    TI Y    P Y AP  VYK+ RSMGPN  +N NY LTW F VDSGF+YLVRL
Sbjct  255   -YYDQSEATIKYTEATPVYTAPEAVYKSYRSMGPNPYINFNYYLTWLFTVDSGFYYLVRL  313

Query  1230  HFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             HFCE    + ++N+RVF I++NN  AE   D IA +  NG+P
Sbjct  314   HFCE--NDLQKVNQRVFDIFINNHAAEIAMDVIAVSEGNGIP  353



>ref|XP_006419383.1| hypothetical protein CICLE_v10004295mg [Citrus clementina]
 gb|ESR32623.1| hypothetical protein CICLE_v10004295mg [Citrus clementina]
Length=862

 Score =   305 bits (782),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 226/331 (68%), Gaps = 14/331 (4%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  551
             +L CG     TD ++RKWT+D  SKFL  +G S T++A SQ  S+P  +P+MTAR F+S 
Sbjct  37    VLACGASSDGTDSNDRKWTSD--SKFLTNSGNSITATAQSQDSSLPSTIPYMTARIFKST  94

Query  552   FTYSFPVASGRKF-LRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              +Y F V+S  +F LRL+FYPASY  L+ +N+ FSV    +TLL NFSA  T +AL   +
Sbjct  95    SSYKFTVSSKDRFWLRLHFYPASYGNLDPSNAYFSVNANGFTLLNNFSASITAKALTQAY  154

Query  729   LVKEFSVNVPGET--LNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSP  902
             +V+EFS+ VP ++  L +TFTPS +  +S AFVNGIEV+  PDI+    GS  +VG +  
Sbjct  155   IVREFSL-VPAQSGDLIITFTPSSDHKDSYAFVNGIEVIPMPDIF----GSAPLVGFSDQ  209

Query  903   LNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTIS  1082
                 NS+ L+++YR+NVGG  I  ++D+G+ R+W +DS Y+F A  GVT  AD+    I 
Sbjct  210   SVEVNSSTLQTMYRLNVGGKFIPSTNDSGLTRTWYDDSPYLFGAAFGVTSQADN-KTKIE  268

Query  1083  YPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITE  1262
             YP  +   +AP+ VY+T RSMGP+ +VN NYNLTW F +D+ F Y+VR HFCE   ++T+
Sbjct  269   YPSNLSQEIAPLSVYETARSMGPDPNVNRNYNLTWIFQIDANFTYIVRFHFCEI--LLTK  326

Query  1263  INERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             IN+RVF I++NNQTA+ GAD I WAG+ GVP
Sbjct  327   INQRVFDIFINNQTAQEGADVIGWAGEQGVP  357



>ref|XP_006488842.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Citrus sinensis]
Length=862

 Score =   305 bits (782),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 163/331 (49%), Positives = 226/331 (68%), Gaps = 14/331 (4%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  551
             +L CG     TD ++RKWT+D  SKFL  +G S T++A SQ  S+P  +P+MTAR F+S 
Sbjct  37    VLACGASSDGTDSNDRKWTSD--SKFLTNSGNSITATAQSQDSSLPSTIPYMTARIFKST  94

Query  552   FTYSFPVASGRKF-LRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              +Y F V+S  +F LRL+FYPASY  L+ +N+ FSV    +TLL NFSA  T +AL   +
Sbjct  95    SSYKFTVSSKDRFWLRLHFYPASYGNLDPSNAYFSVNANGFTLLNNFSASITAKALTQAY  154

Query  729   LVKEFSVNVPGET--LNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSP  902
             +V+EFS+ VP ++  L +TFTPS +  +S AFVNGIEV+  PDI+    GS  +VG +  
Sbjct  155   IVREFSL-VPAQSGDLIITFTPSSDHKDSYAFVNGIEVIPMPDIF----GSAPLVGFSDQ  209

Query  903   LNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTIS  1082
                 NS+ L+++YR+NVGG  I  ++D+G+ R+W +DS Y+F A  GVT  AD+    I 
Sbjct  210   SVEVNSSTLQTMYRLNVGGKFIPSTNDSGLTRTWYDDSPYLFGAAFGVTSQADN-KTKIE  268

Query  1083  YPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITE  1262
             YP  +   +AP+ VY+T RSMGP+ +VN NYNLTW F +D+ F Y+VR HFCE   ++T+
Sbjct  269   YPSNLSQEIAPLSVYETARSMGPDPNVNRNYNLTWIFQIDANFTYIVRFHFCEI--LLTK  326

Query  1263  INERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             IN+RVF I++NNQTA+ GAD I WAG+ GVP
Sbjct  327   INQRVFDIFINNQTAQEGADVIGWAGEQGVP  357



>gb|EEE63237.1| hypothetical protein OsJ_18047 [Oryza sativa Japonica Group]
Length=859

 Score =   305 bits (781),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 164/328 (50%), Positives = 205/328 (63%), Gaps = 5/328 (2%)
 Frame = +3

Query  372   ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQS  548
             I LNCG      D  NR W  D  SKF     K + + A  Q PS+P  VP+MTAR F S
Sbjct  13    IFLNCGASGVQPDSYNRSWDGDASSKFAPSV-KGNVARASYQDPSLPSPVPYMTARFFTS  71

Query  549   EFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQTTEALNFD  725
              +TYSFPV+ GR F+RL+FYP +YNG L++ N+ F V      LL NF+A QT  A +  
Sbjct  72    NYTYSFPVSPGRMFVRLHFYPTNYNGNLDSANAYFGVTTNNLILLDNFNASQTALATSSA  131

Query  726   FLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPL  905
             +  +EFSVNV   +L +TF PS  +  S AFVNGIE+V  PDI+ T   ++   G N   
Sbjct  132   YFFREFSVNVTSSSLKLTFAPSTRN-GSYAFVNGIEIVPTPDIFTTPTPTSANGGDNVQY  190

Query  906   NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISY  1085
              ID    L+++YR+NVGG  ISP  D+G +RSWD DS YI+ A  GVT + D  N+TI Y
Sbjct  191   GIDPVMGLQTMYRLNVGGQPISPQGDSGFYRSWDNDSPYIYGAAYGVTFSKDG-NVTIKY  249

Query  1086  PPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEI  1265
             P   P Y APV VY T RSMGP A +N NYNLTW  PVD+GF YL+R HFCE    IT++
Sbjct  250   PNTEPNYTAPVAVYATARSMGPTAQINLNYNLTWILPVDAGFTYLLRFHFCEIQYPITKV  309

Query  1266  NERVFIIYLNNQTAEPGADAIAWAGKNG  1349
             N+R F IY+NNQTA+   D I W+G  G
Sbjct  310   NQRSFFIYINNQTAQNQMDVIVWSGGIG  337



>gb|EMS54122.1| Receptor-like protein kinase FERONIA [Triticum urartu]
Length=871

 Score =   305 bits (781),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/279 (56%), Positives = 198/279 (71%), Gaps = 8/279 (3%)
 Frame = +3

Query  513   QVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV--GEYTLLKN  686
             +VP +TAR   + FTYSFP+  GRKFLRL+FYPA+Y+G  A ++ FSV V   + TLL N
Sbjct  69    KVPCLTARVSAAPFTYSFPLGPGRKFLRLHFYPANYSGRAAADAFFSVSVPAAKVTLLSN  128

Query  687   FSAGQTTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTA  866
             FSA QT  A NF +LV+EFSVNV G TL++TFTP    PN+ AF+NGIEVVS PD+++ A
Sbjct  129   FSAYQTATAFNFAYLVREFSVNVTGPTLDLTFTPEKGRPNAYAFINGIEVVSSPDLFDLA  188

Query  867   DGSTMIV---GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAG  1037
               +   V   G N P  +D   AL+++YR+NVGG  ISPS D+G  RSWD+D+ YI+ AG
Sbjct  189   --TPFFVTGDGNNQPFPMDPGAALQTMYRLNVGGQAISPSKDSGGARSWDDDTPYIYGAG  246

Query  1038  TGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFY  1217
              GV+   +D N+TI+YPP +P YVAP++VY T RSMG +  VN  YNLTW   VD+GF Y
Sbjct  247   AGVS-YPNDPNVTITYPPSVPGYVAPLDVYATARSMGIDKGVNLAYNLTWIVQVDAGFTY  305

Query  1218  LVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAW  1334
             LVRLHFCE  + I + N+RVF IYLNNQTA  GAD + W
Sbjct  306   LVRLHFCEIQSPIDKPNQRVFNIYLNNQTAVEGADVLQW  344



>ref|XP_004962463.1| PREDICTED: receptor-like protein kinase FERONIA-like [Setaria 
italica]
Length=873

 Score =   305 bits (780),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 159/335 (47%), Positives = 210/335 (63%), Gaps = 8/335 (2%)
 Frame = +3

Query  357   VPTDKILLNCGGPDGVT-DQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQV-PF  524
             + + +I L+CG       D + R W +D GSKF  LL   K + ++A  Q P++P   P+
Sbjct  25    IGSGQIRLDCGASSPTAPDANERTWDSDTGSKFAPLL---KGTAATASYQDPALPSTTPY  81

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR F S +TYSFPV  GR F+RLY YP++Y      N+ F V     TLL NF+A QT
Sbjct  82    MTARIFTSNYTYSFPVGPGRMFVRLYLYPSTYGNHAPANAYFGVTAANLTLLDNFNASQT  141

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMI  884
               A N    V E+SVNV    L++TF+PS +   S AFVNGIE+V  PD++ T   +   
Sbjct  142   ALATNSASFVLEYSVNVSASKLDLTFSPSTHQNGSYAFVNGIEIVPTPDLFTTPTPTLAN  201

Query  885   VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
              G  +P  ID +T  +++YR+NVGG  ISP  D   +R WD+DS YI+ +G GV+    D
Sbjct  202   GGNPNPFPIDPATGFQTMYRLNVGGQAISPQGDIDFYRQWDDDSPYIYGSGFGVS-FGKD  260

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              N++I+Y P +P Y APV VY++ RSMGPNA VN N NLTW  PVD+GF YL+R HFCE 
Sbjct  261   KNLSITYTPSVPNYTAPVGVYESARSMGPNAQVNLNSNLTWILPVDAGFCYLLRFHFCEI  320

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
                IT+IN+R F IY+NNQTA+   D IAW+G  G
Sbjct  321   QYPITKINQRSFFIYINNQTAQQQMDVIAWSGGIG  355



>ref|XP_006373380.1| hypothetical protein POPTR_0017s13240g [Populus trichocarpa]
 gb|ERP51177.1| hypothetical protein POPTR_0017s13240g [Populus trichocarpa]
Length=879

 Score =   305 bits (780),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 210/338 (62%), Gaps = 13/338 (4%)
 Frame = +3

Query  363   TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGT--GKSSTSSADSQKPSVPQVPFMTAR  536
             TD ILLNCG    ++  D R W  D  SKF        SS  +A +Q PSV QVP+MTAR
Sbjct  33    TDLILLNCGASSNLSSPDGRGWDGDSQSKFAASNPPEASSVFAASNQDPSVNQVPYMTAR  92

Query  537   TFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  716
              F S+FTY+FPV  G KF+RLYFYPASY+ L+ + S FS+R   Y LL NFSA  T  A+
Sbjct  93    IFHSKFTYTFPVLPGPKFVRLYFYPASYSNLDISTSYFSIRANNYQLLNNFSASLTVSAI  152

Query  717   --NFDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTA--DGSTM  881
                 D+  KEF + V   + L +TF PSP S    +F+NGIE+VS PD +     D    
Sbjct  153   IPPVDYFTKEFIITVRDNQKLELTFIPSPAS---FSFINGIEIVSMPDSFYARGDDNPPT  209

Query  882   IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
              VG ++P ++ N+TALE++YR+NVGG  I  + DTGM+R+W +DS+Y+F           
Sbjct  210   YVGTDNPCSLYNTTALETVYRLNVGGQDIGSTGDTGMYRTWHQDSEYLFGQAGNTPYLP-  268

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
                + I Y    P Y APV VY T+RSMGP   +N NYNLTW FPVD+GF YL+RLHFCE
Sbjct  269   --GVKIKYTTKTPAYSAPVMVYSTMRSMGPEPRLNMNYNLTWIFPVDAGFLYLLRLHFCE  326

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                     N++VF+I++NNQTAE  AD I  +G NG+P
Sbjct  327   TRMEFKNENQQVFLIFINNQTAEHDADVIHMSGGNGIP  364



>gb|KHN29954.1| Receptor-like protein kinase FERONIA [Glycine soja]
Length=841

 Score =   303 bits (777),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 164/342 (48%), Positives = 219/342 (64%), Gaps = 11/342 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGG--PDGVTDQDNRKWTTDVGSKFLLGTG--KSSTSSADSQKPSVPQVP  521
             YVP++ I+LNCG    + V   D R W+ D+ S ++      K   + A +   S+P+VP
Sbjct  29    YVPSENIVLNCGSNVSNVVEYVDGRNWSGDIASPYMPSDADTKFLVARAPNTLQSIPEVP  88

Query  522   FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  701
             +MTAR FQS+FTY+F V  G KF+RL+FYPASY  LN +N+  SV    +TLL NFS   
Sbjct  89    YMTARIFQSQFTYTFNVTPGPKFIRLHFYPASYLNLNLSNAFLSVSAANFTLLHNFSVSL  148

Query  702   TTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGST  878
               + LN ++ +KEF V+V G  L +TFTP+ N+ ++ AFVNGIEVVS P  +Y+  D + 
Sbjct  149   NADYLNVNYFMKEFIVHVSGRVLELTFTPTYNASDAYAFVNGIEVVSMPLGLYSRGDDAP  208

Query  879   M-IVGQNSPL-NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTE  1052
             + +VG    L  I N +A+E+I R+ VGG  I P  DTGMFR+WD D  YI  + TG+  
Sbjct  209   LPLVGHYPELVYIYNDSAMENICRLKVGGEQIPPKYDTGMFRTWDTDGAYILGSDTGIEP  268

Query  1053  TADDYNMTISYPPGMPTYVAPVEVYKTLRSMG--PNASVNANYNLTWYFPVDSGFFYLVR  1226
                D +M + Y    P Y+AP +VY+T RSM       +N NYN+TW+FPVDSGFFYLVR
Sbjct  269   F--DMSMPVLYDGNAPPYLAPADVYRTSRSMRTFEKGLINLNYNMTWFFPVDSGFFYLVR  326

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
             LHFCE    IT +NE VF ++LNNQTAE   D IAW+G+ GV
Sbjct  327   LHFCEIYHGITRVNEVVFTVFLNNQTAEEQFDPIAWSGRPGV  368



>gb|KDO71938.1| hypothetical protein CISIN_1g041565mg [Citrus sinensis]
Length=862

 Score =   303 bits (777),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 162/331 (49%), Positives = 225/331 (68%), Gaps = 14/331 (4%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  551
             +L CG     TD ++RKWT+D  SKFL  +G S T++A SQ  S+P  +P+MTAR F+S 
Sbjct  37    VLACGASSDGTDSNDRKWTSD--SKFLTNSGNSITATAQSQDSSLPSTIPYMTARIFKST  94

Query  552   FTYSFPVASGRKF-LRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              +Y F V+S  +F LRL+FYPASY  L+ +N+ FSV    +TLL NFSA  T +AL   +
Sbjct  95    SSYKFTVSSKDRFWLRLHFYPASYGNLDPSNAYFSVNANGFTLLNNFSASITAKALTQAY  154

Query  729   LVKEFSVNVPGET--LNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSP  902
             +V+EFS+ VP ++  L +TFTPS +  +S AFVNGIEV+  PDI+    GS  +VG +  
Sbjct  155   IVREFSL-VPAQSGDLIITFTPSSDHKDSYAFVNGIEVIPMPDIF----GSAPLVGFSDQ  209

Query  903   LNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTIS  1082
                 NS+ L+++YR+NVGG  I  ++D+G+ R+W +DS Y+F A  GV   AD+    I 
Sbjct  210   SVEVNSSTLQTMYRLNVGGKFIPSTNDSGLTRTWYDDSPYLFGAAFGVASQADN-KTKIE  268

Query  1083  YPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITE  1262
             YP  +   +AP+ VY+T RSMGP+ +VN NYNLTW F +D+ F Y+VR HFCE   ++T+
Sbjct  269   YPSNLSQEIAPLSVYETARSMGPDPNVNRNYNLTWIFQIDANFTYIVRFHFCEI--LLTK  326

Query  1263  INERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             IN+RVF I++NNQTA+ GAD I WAG+ GVP
Sbjct  327   INQRVFDIFINNQTAQEGADVIGWAGEQGVP  357



>ref|XP_006373370.1| hypothetical protein POPTR_0017s13150g [Populus trichocarpa]
 gb|ERP51167.1| hypothetical protein POPTR_0017s13150g [Populus trichocarpa]
Length=855

 Score =   303 bits (777),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 166/341 (49%), Positives = 209/341 (61%), Gaps = 12/341 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGT--GKSSTSSADSQKPSVPQVPFM  527
             Y PTD ILLNCG    +   D R W  D  SKF        SS   A +Q PSV QVP+M
Sbjct  29    YSPTDLILLNCGASSNLLSPDGRGWDGDSQSKFAASNPPEASSVFEASNQDPSVNQVPYM  88

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F S+FTY+FPV  G KF+RLYFYPASY+ L+ + S FS+    Y LL NFSA  T 
Sbjct  89    TARIFHSKFTYTFPVLPGPKFVRLYFYPASYSNLDISTSYFSLSANNYELLNNFSASLTV  148

Query  708   EALN--FDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTA--DG  872
              A+    D+  KEF + V   + L + F PSP S    AF+NGIE+VS PD + +   D 
Sbjct  149   SAIRPPVDYFTKEFIITVWDSQKLELNFIPSPAS---FAFINGIEIVSMPDSFYSRGNDN  205

Query  873   STMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTE  1052
                 VG +    +DN+T LE++YR+NVGG  IS + DTGM+R+W +D +Y+    TG T 
Sbjct  206   PLTYVGTDLFFYLDNTTVLETVYRLNVGGKDISSTGDTGMYRTWHQDLEYLLGGQTGNTP  265

Query  1053  TADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLH  1232
                   + I Y    P Y APV VY T+RSMGP   +N NYNLTW FPVD+GF YL+RLH
Sbjct  266   YLP--GVKIKYTTKTPAYSAPVMVYSTMRSMGPEPLLNLNYNLTWNFPVDAGFHYLLRLH  323

Query  1233  FCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             FCE    I   N++VF+I++NNQTAE  AD I  +G NG+P
Sbjct  324   FCETRMEIKNENQQVFLIFINNQTAEHDADVIHMSGGNGIP  364



>gb|EMS66619.1| hypothetical protein TRIUR3_14353 [Triticum urartu]
Length=503

 Score =   294 bits (753),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 158/332 (48%), Positives = 212/332 (64%), Gaps = 4/332 (1%)
 Frame = +3

Query  369   KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQ  545
             ++ L+CG     TD D R W  D  SKFL  T     + A  Q PS+P  VP++TAR F 
Sbjct  31    QVRLSCGASAPATDSDGRAWEGDSTSKFLASTNAGVAARASYQDPSLPSSVPYVTARVFA  90

Query  546   SEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFD  725
             S  TY+F V+ GR FLRLYFYPA Y   +A+ ++F V  G  TLL++F+A Q   AL+  
Sbjct  91    SSHTYTFLVSPGRVFLRLYFYPADYGNRSASGALFGVTAGGVTLLRDFNASQAALALDAA  150

Query  726   FLVKEFSVNVP-GETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSP  902
             +LV+EFS+NV  G  L+VTF PSP + +  AFVNGIE+V  PD++     +    G+   
Sbjct  151   YLVREFSLNVSSGGKLDVTFAPSPGASSHYAFVNGIEIVPTPDVFTAPVPTFANGGRPDR  210

Query  903   LNIDNSTALESIYRVNVGGNVISPSSDTGMF-RSWDEDSKYIFSAGTGVTETADDYNMTI  1079
             + I   TA +++YR+NVGG  +SP+ D+G F R+W+ D  YIF A  GV+   D  N+TI
Sbjct  211   MPIRADTAFQTMYRLNVGGEAVSPADDSGRFYRTWNTDIPYIFGAAVGVSFEKDS-NVTI  269

Query  1080  SYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIIT  1259
              YPP +P ++AP  VY + RSMGP A +N NYNLTW  PVD+GF+YL+R HFCE    IT
Sbjct  270   RYPPSVPPHIAPEGVYASARSMGPYAQINLNYNLTWILPVDAGFYYLLRFHFCEVLYPIT  329

Query  1260  EINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             ++N+R F IY+NNQTA+   D I  +G  GVP
Sbjct  330   KVNQRSFFIYINNQTAQEQMDVIGRSGGIGVP  361



>ref|XP_010660578.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=900

 Score =   304 bits (778),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 162/344 (47%), Positives = 213/344 (62%), Gaps = 15/344 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF----LLGTGKSSTSSADSQKPSVPQVP  521
             Y PTD ILLNCG     T  D+R W  DVGSKF    LL     S  +  S   S+  VP
Sbjct  46    YYPTDIILLNCGSFGNSTALDDRGWMGDVGSKFTSSRLLNQTSVSAKAPHSHGFSIDPVP  105

Query  522   FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  701
             +MT R F+S+FTY+F V  G+KF+RL+FYPAS+ G   + + FSV+ G YTLL NFS   
Sbjct  106   YMTVRFFRSQFTYTFHVKPGQKFIRLHFYPASFPGFERSEAFFSVKAGPYTLLSNFSPSH  165

Query  702   TTEALNFDFLVKEFSVNVP--GETLNVTFTPSPNS-PNSLAFVNGIEVVSHP-DIY--NT  863
             T +AL    LVKEFSVN+     ++N+TF PS N+  ++ AF+NGIE+VS P ++Y   +
Sbjct  166   TADALGVKVLVKEFSVNINDNQRSINITFLPSSNARKDAFAFINGIEIVSMPANLYYPRS  225

Query  864   ADGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTG  1043
              D      G      I  +TALE+++R+NVGG+ ISP++D+GMFRSW ED+ Y+  +G  
Sbjct  226   RDIDVSSSGHQHDFLIKKNTALEAVHRLNVGGSYISPNNDSGMFRSWLEDTNYLLESGGV  285

Query  1044  VTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLV  1223
             +  T      T      +P Y+AP +VY+T RS+G +  VN  YNLTW  PVD GF YLV
Sbjct  286   LVNTTQRIRST-----RIPNYIAPAQVYRTARSVGMDKEVNMRYNLTWKLPVDPGFKYLV  340

Query  1224  RLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             RLHFC F     +   R F IY+NN+TAE  AD I W+G NG+P
Sbjct  341   RLHFCAFQGQTKKSGNRKFHIYINNETAEANADVITWSGGNGIP  384



>gb|KJB10587.1| hypothetical protein B456_001G208900 [Gossypium raimondii]
Length=524

 Score =   295 bits (755),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 163/341 (48%), Positives = 211/341 (62%), Gaps = 17/341 (5%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMT  530
             Y P D I LNCG     TD   R W +D  + +L    +SS  S  S  P+    +P+ T
Sbjct  41    YTPHDNIALNCGSTTNTTDLSGRSWISD-NTIYL---DQSSKVSVISTSPTEGDPIPYTT  96

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             A   +S+FT+SF V  G KF+RL+F+PASY   N  N+ F V +G YT+L NFSA    +
Sbjct  97    ALLSRSQFTFSFTVTPGPKFIRLHFHPASYRAFNRLNAFFDVHIGGYTVLSNFSAALKAD  156

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNTADGST--M  881
              L  +    EF + V  E LN+ F P+PN P+S AF+NGIE+VS P+ +Y ++D  T   
Sbjct  157   DLKLEVFYSEFCIYVDEEKLNILFNPNPNMPDSYAFINGIEIVSMPNNLYYSSDDDTGFK  216

Query  882   IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
              V Q +P  I  + ALES+YRVN+GG+ ISP+ DTGM+RSW ED +Y+ + G  V     
Sbjct  217   FVNQVNPYRILKNQALESLYRVNIGGSSISPTQDTGMYRSWSEDGEYVTNGGPSVLPV--  274

Query  1062  DYNMTISYPPG---MPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLH  1232
               N+ IS  P    +P Y APV VY+T R+MG N +VN NY LTW F VDSGF Y VRLH
Sbjct  275   --NLIIS--PSFSVIPNYSAPVPVYRTARTMGTNKTVNENYRLTWEFRVDSGFTYYVRLH  330

Query  1233  FCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             FCEF   ITE+ +RVF IY++N  AE  AD I+WAG NGVP
Sbjct  331   FCEFQVEITELGDRVFQIYIDNIVAEHQADVISWAGGNGVP  371



>ref|XP_011071382.1| PREDICTED: receptor-like protein kinase ANXUR1 [Sesamum indicum]
Length=871

 Score =   303 bits (775),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 162/334 (49%), Positives = 224/334 (67%), Gaps = 14/334 (4%)
 Frame = +3

Query  366   DKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTF  542
             D  +L CG     TD + RKW +D  +KFL+    S +++A SQ PS+P  VP+MTAR F
Sbjct  46    DSFVLACGATADATDSNGRKWASD--AKFLISPNSSLSATAQSQDPSLPSTVPYMTARIF  103

Query  543   QSEFTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  719
             +SE TY F V+   R ++RL+FYP+ Y+  +   S FSV  G +TLL NFSA  T EAL 
Sbjct  104   KSEATYKFSVSPNFRHWIRLHFYPSFYDNFDTLRSFFSVTAGGFTLLNNFSASITAEALT  163

Query  720   FDFLVKEFSVN-VPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQN  896
               ++++EFS+N +    LN+TFTPS +  N+ AFVNGIE++S P+I+     S  +VG  
Sbjct  164   QSYIIREFSMNMLESGILNLTFTPSASYNNAFAFVNGIEIISMPEIFQ----SVRMVGF-  218

Query  897   SPLNIDNST-ALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNM  1073
             S  N+D +T  ++++ R+NVGG  I  + D+G+ R+W +DS YI+ AG GVT  AD  N+
Sbjct  219   SDQNMDAATYTMQTMVRLNVGGQYIPANKDSGLSRTWYDDSPYIYGAGFGVTSQADK-NV  277

Query  1074  TISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTI  1253
             TI+YPP     +AP++VY+T RSMGP A+VN NYNLTW F +D  F YLVRLHFC++   
Sbjct  278   TIAYPPKASKDIAPLDVYRTSRSMGPTAAVNQNYNLTWIFQMDVNFTYLVRLHFCDYN--  335

Query  1254  ITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
               ++N+ VF I++NNQTAEP AD IAW+G  GVP
Sbjct  336   FEKVNQMVFSIFINNQTAEPDADVIAWSGGKGVP  369



>ref|XP_003520131.2| PREDICTED: receptor-like protein kinase FERONIA-like [Glycine 
max]
Length=847

 Score =   302 bits (774),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 165/344 (48%), Positives = 221/344 (64%), Gaps = 15/344 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGG--PDGVTDQDNRKWTTDVGSKFLLGTG--KSSTSSADSQKPSVPQVP  521
             YVP++ I+LNCG    + V   D R W+ D+ S ++      K   + A +   S+P+VP
Sbjct  34    YVPSENIVLNCGSNVSNVVEYVDGRNWSGDIASPYMPSDADTKFLVARAPNTLQSIPEVP  93

Query  522   FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  701
             +MTAR FQS+FTY+F V  G KF+RL+FYPASY  LN +N+  SV    +TLL NFS   
Sbjct  94    YMTARIFQSQFTYTFNVTPGPKFIRLHFYPASYLNLNLSNAFLSVSAANFTLLHNFSVSL  153

Query  702   TTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGST  878
               + LN ++ +KEF V+V G  L +TFTP+ N+ ++ AFVNGIEVVS P  +Y+  D + 
Sbjct  154   NADYLNVNYFMKEFIVHVSGRVLELTFTPTYNASDAYAFVNGIEVVSMPLGLYSRGDDAP  213

Query  879   M-IVGQNSPL-NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTE  1052
             + +VG    L  I N +A+E+I R+ VGG  I P  DTGMFR+WD D  YI  + TG+  
Sbjct  214   LPLVGHYPELVYIYNDSAMENICRLKVGGEQIPPKYDTGMFRTWDTDGAYILGSDTGI--  271

Query  1053  TADDYNMT--ISYPPGMPTYVAPVEVYKTLRSMG--PNASVNANYNLTWYFPVDSGFFYL  1220
               + +NM+  + Y    P Y+AP +VY+T RSM       VN NYN+TW+FPVDSGFFYL
Sbjct  272   --EPFNMSMPVLYDGNAPPYLAPADVYRTSRSMRTFEKGLVNLNYNMTWFFPVDSGFFYL  329

Query  1221  VRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
             VRLHFCE    IT +NE VF ++LNNQTAE   D IAW+G+ GV
Sbjct  330   VRLHFCEIYHGITRVNEVVFTVFLNNQTAEEQFDPIAWSGRPGV  373



>ref|NP_001055179.1| Os05g0317700 [Oryza sativa Japonica Group]
 gb|AAV44013.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|AAV44113.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17093.1| Os05g0317700 [Oryza sativa Japonica Group]
Length=841

 Score =   302 bits (773),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/328 (47%), Positives = 209/328 (64%), Gaps = 4/328 (1%)
 Frame = +3

Query  372   ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQS  548
             I LNCG      D +NR W  D  SKF         +SA  Q PS+P  VP+MT+R F S
Sbjct  35    IFLNCGASTMQLDINNRSWEGDTRSKFA-SAMNGIAASATYQDPSLPSLVPYMTSRIFIS  93

Query  549   EFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              +TYSFP++ GR F+RLYFYP +Y    + ++ F V+     LL NF+A QT +A N+ +
Sbjct  94    NYTYSFPISPGRIFVRLYFYPVAYGYYASEDAYFGVKTNNLILLDNFNASQTAQAANYAY  153

Query  729   LVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPLN  908
             +++EFS+NV   +L++TF PS  +  S AFVNGIE+V  PDI+ T   +    G   P +
Sbjct  154   ILREFSLNVTLGSLDLTFFPSTQN-GSYAFVNGIEIVPTPDIFTTRTPTHNTEGNLDPSD  212

Query  909   IDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISYP  1088
             ID+ T+ +++YR+NVGG  I P  D+  +RSW++DS YI+ A  GVT    D N+TI+YP
Sbjct  213   IDSMTSFQTMYRLNVGGQAIIPQGDSRFYRSWEDDSPYIYGAAFGVT-FGKDSNVTITYP  271

Query  1089  PGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEIN  1268
               MP Y AP +VY T RSMGPN  +N NYNLTW   VD+GF+YL+R HFCE    IT++N
Sbjct  272   GTMPNYTAPADVYATARSMGPNWQINLNYNLTWILSVDAGFYYLLRFHFCEIQYPITKMN  331

Query  1269  ERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
             +R F IY+NNQT +   D I W+G  G+
Sbjct  332   QRSFFIYINNQTVQDQMDVIRWSGGIGM  359



>ref|XP_010660597.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
 emb|CAN76104.1| hypothetical protein VITISV_015219 [Vitis vinifera]
Length=511

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 159/341 (47%), Positives = 209/341 (61%), Gaps = 12/341 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF-LLGTGKSST-SSADSQKPSVPQVPFM  527
             Y PTD   ++CG    +   DNR W  D  S+F L+   K+S  S A    PSV  VPF 
Sbjct  40    YNPTDIYTVDCGASGNLKAWDNRIWIGDTNSRFSLIEKNKASIISKAAKTSPSVDPVPFA  99

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR  + +F Y FPV +G+KF+RL+FYP+S  G + + + FSV++G YTLL NFSA    
Sbjct  100   TARLSRFQFAYIFPVTTGQKFIRLHFYPSSVAGFDRSKAFFSVKIGGYTLLNNFSAALAA  159

Query  708   EALNFDFLVKEFSVNVP--GETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNTA--DG  872
             +A   + + KEF VNV    + LN+TFTP+ + P++ AF+NGIE+VS PD +Y T+  +G
Sbjct  160   DAHGDETVSKEFCVNVKQGDQMLNITFTPTASDPDAYAFINGIEIVSMPDYLYYTSPQNG  219

Query  873   STMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTE  1052
                 +GQ +   I+   ALE +YR+NVGG  +SP  DTGMFR+WDED  Y          
Sbjct  220   GIQFIGQKNVFWIEIEYALEMVYRLNVGGRFVSPMEDTGMFRTWDEDDDYCVKLAFVPAN  279

Query  1053  TADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLH  1232
             ++ D   T       P Y AP +VY+T R+MG N + N  YNLTW   VDSGF YL+RLH
Sbjct  280   SSIDLKFT-----QQPEYTAPPDVYRTARTMGNNKTENMGYNLTWVLSVDSGFNYLLRLH  334

Query  1233  FCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             FCEF   ITE  +R F I++ NQTAE  AD I W+G NGVP
Sbjct  335   FCEFQPEITERQDREFTIFIANQTAENHADVITWSGGNGVP  375



>ref|XP_006373375.1| hypothetical protein POPTR_0017s13190g, partial [Populus trichocarpa]
 gb|ERP51172.1| hypothetical protein POPTR_0017s13190g, partial [Populus trichocarpa]
Length=855

 Score =   302 bits (773),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 166/339 (49%), Positives = 210/339 (62%), Gaps = 12/339 (4%)
 Frame = +3

Query  360   PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGT--GKSSTSSADSQKPSVPQVPFMTA  533
             PTD ILLNCG    ++  D R W  D  SKF        SS  +A +Q PSV QVP+MTA
Sbjct  33    PTDLILLNCGASSNLSSPDGRSWDGDSQSKFAASNPPETSSVFAASNQDPSVNQVPYMTA  92

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R F S+FTY+FPV  G KF+RLYFYPASY+ L+ + S FS+   +Y LL NFSA  T  A
Sbjct  93    RIFHSKFTYTFPVLPGPKFVRLYFYPASYSNLDISTSYFSLSANDYELLNNFSASLTVSA  152

Query  714   L--NFDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTA--DGST  878
             +    D   KEF + V   + L +TF PSP S    AF+NGIE+VS PD +     D   
Sbjct  153   IIPPVDSFTKEFIITVWDNQKLELTFIPSPAS---FAFINGIEIVSMPDSFYARGNDNPL  209

Query  879   MIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETA  1058
               VG +    +DN+T LE++YR+NVGG  I  + DTGM+R+W +DS+Y+    TG T   
Sbjct  210   TYVGTDLFFYLDNTTVLETVYRLNVGGKDIGSTGDTGMYRTWHQDSEYLPGGQTGNTPYL  269

Query  1059  DDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFC  1238
                 + I Y    P Y APV VY T+RSMGP   +N NYNLTW FPVD+GF YL+RLHFC
Sbjct  270   P--GVKIKYTTKTPNYSAPVMVYSTMRSMGPEPHLNLNYNLTWIFPVDAGFHYLLRLHFC  327

Query  1239  EFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             E    I   N++VF+I++NNQTAE  AD I  +G NG+P
Sbjct  328   ETRMEIKNENQQVFLIFINNQTAEHDADVIHMSGGNGIP  366



>gb|EMS63765.1| Receptor-like protein kinase FERONIA [Triticum urartu]
Length=819

 Score =   301 bits (771),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 154/281 (55%), Positives = 197/281 (70%), Gaps = 4/281 (1%)
 Frame = +3

Query  519   PFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV--GEYTLLKNFS  692
             P  TAR   + FTYSFP+  GRKFLRL+FYPA+Y+  +A ++ FSV V   + TLL NFS
Sbjct  20    PSRTARVSAAPFTYSFPLGPGRKFLRLHFYPANYSNRDAADAFFSVSVPAAKVTLLSNFS  79

Query  693   AGQTTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADG  872
             A QTT ALNF ++V+EFSVNV G+ L++ FTP    P++ AF+NGIEVVS PD++  A  
Sbjct  80    AYQTTTALNFAYIVREFSVNVTGQNLDLAFTPEKGHPSAYAFINGIEVVSSPDLFGIATP  139

Query  873   STMIVGQNS-PLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVT  1049
               +    NS P  +D + AL+++YR+NVGG  ISPS D+G  RSWD+D+ YI+ AG GV+
Sbjct  140   QFVTGDGNSQPYEMDPAAALQTMYRLNVGGQAISPSKDSGGARSWDDDTPYIYGAGAGVS  199

Query  1050  ETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRL  1229
                +D N+TI YP  +P YVAP +VY T RSMGP+  VN  YNLTW   VD+G+ YLVRL
Sbjct  200   -YQNDPNVTIIYPDNVPGYVAPSDVYATARSMGPDKGVNMAYNLTWILQVDAGYQYLVRL  258

Query  1230  HFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
             HFCE  +  T+ N+RVF IYLNNQTA  GAD I WA  NG+
Sbjct  259   HFCEIQSPFTKPNQRVFNIYLNNQTAIEGADVIQWADPNGI  299



>ref|XP_003614252.1| Kinase-like protein [Medicago truncatula]
 gb|AES97210.1| feronia receptor-like kinase [Medicago truncatula]
Length=817

 Score =   301 bits (771),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 165/342 (48%), Positives = 219/342 (64%), Gaps = 13/342 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKFLLG----TGKSSTSSADSQKPSVPQV  518
             YVP++ I+LNCG     +   D R W  D+ S ++        KS T+ A S   S+P+V
Sbjct  28    YVPSENIVLNCGSNTSELVQYDGRIWNGDIDSPYVPSYEEIINKSLTAKAPSNLQSIPEV  87

Query  519   PFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAG  698
             P+MTAR FQS+FTY F V SG KF+RL+FYP SY   N + +  SV  G +TLL NFS  
Sbjct  88    PYMTARIFQSQFTYRFNVTSGPKFIRLHFYPFSYLNFNISKAFLSVTAGNFTLLHNFSVS  147

Query  699   QTTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNTADGS  875
                +  N  +L+KEF V+V G +L +TFTPS N  ++ AFVNGIEVVS P+ +Y   D S
Sbjct  148   LNVDYFNLAYLMKEFIVHVKGNSLELTFTPSSNDSDAYAFVNGIEVVSIPNGLYIGGDDS  207

Query  876   TM-IVGQNSP-LNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVT  1049
              + +VG ++  + I N +A+E++YR+NVGG  I P  DTGMFR+WD D  YIF    GV 
Sbjct  208   PIPLVGHDTKVVYIYNDSAMETLYRLNVGGEQILPKYDTGMFRNWDIDDGYIF----GVD  263

Query  1050  ETAD-DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVR  1226
             E    + +M + Y   +P Y AP +VY+T RSM P  +VN NYNLTW+F VDSGF YL+R
Sbjct  264   EIKPFNRSMKVLYTDHVPEYTAPDDVYRTSRSMTPYWAVNLNYNLTWFFEVDSGFLYLIR  323

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
             LHFC+ +  IT +NE VF ++LNNQTAE   D  A +G+ GV
Sbjct  324   LHFCDVSYAITRVNEVVFSVFLNNQTAEEEFDPFAISGRPGV  365



>ref|XP_008390536.1| PREDICTED: receptor-like protein kinase ANXUR1 [Malus domestica]
Length=860

 Score =   302 bits (773),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 160/336 (48%), Positives = 228/336 (68%), Gaps = 15/336 (4%)
 Frame = +3

Query  363   TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTART  539
             ++  ++ CG   G TD D R+W  D  S+FL  +  S T++A  Q PS+P Q+P+M+AR 
Sbjct  30    SESYIIACGSSSGGTDSDGRRWVPD--SRFLKSSENSKTATAQYQDPSLPSQIPYMSARI  87

Query  540   FQSEFTYSFPVASGRKFL-RLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  716
             F S  +Y F V+  ++ L RL+FYP+SY+GL A+NS F V    ++LL+NFSA  TT+AL
Sbjct  88    FNSAASYKFFVSPRQRLLVRLHFYPSSYDGLEASNSYFDVIANGFSLLRNFSAAITTQAL  147

Query  717   NFDFLVKEFSVNVPGET--LNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTMIV  887
                ++++EFS+ VP ++  LN+TF PS     S AFVNGIEV+S P +++  A+   MI 
Sbjct  148   TQAYIMREFSL-VPAQSGNLNITFVPSSQHDKSYAFVNGIEVISMPAEMFQPAN---MIG  203

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
              Q+  +++ NS+ L++++R+NVGG  I   +D+G+ R+W +DS Y+F A  GVT  A+  
Sbjct  204   FQDQTIDVQNSS-LQTMFRLNVGGQFIPTRNDSGLTRTWYDDSPYLFGAAFGVTCQAEK-  261

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             N++I YP  +P Y+AP  VY T RSMGPN+ +N NYNLTW F VD+ F Y+VRLHFCE  
Sbjct  262   NVSIKYPSNLPEYIAPPNVYGTARSMGPNSKINQNYNLTWVFTVDANFTYVVRLHFCELQ  321

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
               +T IN+RVF I+LNNQTA+  AD IAW+G  GVP
Sbjct  322   --LTRINQRVFDIFLNNQTAQQTADVIAWSGSIGVP  355



>ref|XP_008223394.1| PREDICTED: receptor-like protein kinase ANXUR1 [Prunus mume]
Length=860

 Score =   301 bits (770),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 160/335 (48%), Positives = 225/335 (67%), Gaps = 13/335 (4%)
 Frame = +3

Query  363   TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTART  539
             +D  +++CG   G TD D RKW +D  S+FL  + KS+T++A  Q PS+P QVP+M+AR 
Sbjct  28    SDSYVISCGSSSGGTDSDGRKWASD--SQFLTSSDKSNTATAQYQDPSLPSQVPYMSARI  85

Query  540   FQSEFTYSFPVASGRKFL-RLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  716
             F S  +Y F V+  ++ L RL+FYP SYN L  +NS F V    +TLL NFSA  T +AL
Sbjct  86    FNSASSYKFSVSPKQRLLVRLHFYPTSYNSLEPSNSYFDVVANGFTLLHNFSASITAQAL  145

Query  717   NFDFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTMIVG  890
                ++++EFS+  P    LN+TF PS     S AFVNG+EV+S P D++  A+   +I  
Sbjct  146   TQAYIMREFSLIPPQSGNLNITFIPSSQHDKSYAFVNGVEVISMPADMFKPAN---LIGF  202

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q+  + +  S++L++++R+NVGG  I  ++D+G+ R+W +DS Y+F A  GVT  A   N
Sbjct  203   QDQNVEV-QSSSLQTMFRLNVGGQFIPTTNDSGLTRTWYDDSPYLFGAAFGVTSEAGK-N  260

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             ++I YPP +P Y+AP+ VY T RSMGP+  +N NYNLTW F VD+ F Y+VR HFCE   
Sbjct  261   VSIEYPPEVPGYIAPLNVYSTARSMGPDPKINQNYNLTWVFSVDANFTYVVRFHFCELQ-  319

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              +T+IN+RVF I+LNN+TA+  ADAIAWAG  GVP
Sbjct  320   -LTKINQRVFDIFLNNRTAQQSADAIAWAGSIGVP  353



>ref|XP_002512045.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50714.1| conserved hypothetical protein [Ricinus communis]
Length=839

 Score =   300 bits (768),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 167/352 (47%), Positives = 216/352 (61%), Gaps = 28/352 (8%)
 Frame = +3

Query  354   YVPTDKILLNCGGP-DGVTDQ-DNRKWTTDVGSKFLLGTGKS----STSSADSQKPSVPQ  515
             Y P + I L+CG   D  T   D R WT DVGSKF      S    ST+S   +   +P+
Sbjct  36    YAPLENIALDCGSSFDSQTLSFDGRNWTGDVGSKFTAFNSHSNSTLSTASFFDEAIGIPE  95

Query  516   VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFS  692
             VP+ TAR F S+FTY+F V  G KF+RL+FYP+SY+GLNA+ +  SV  G+  TLL NFS
Sbjct  96    VPYKTARLFYSKFTYTFNVTPGPKFVRLHFYPSSYSGLNASRAFLSVIDGDNRTLLSNFS  155

Query  693   AGQTTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTAD  869
             A       N D   KEF + V   +L +TF+PS N  ++ AFVNGIEVVS P ++Y    
Sbjct  156   ATLAANYKNVDTFFKEFIIEVQNHSLCLTFSPSSNESDAFAFVNGIEVVSMPMNLY----  211

Query  870   GSTMIVGQNSPLN----------IDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSK  1019
                 I G++ PL           +DN +ALE++YR+NV G  ISP  D+GMFR+W +D  
Sbjct  212   ----IKGEDVPLRFVGYPAMVITLDNKSALETVYRINVAGADISPKHDSGMFRTWIKDDP  267

Query  1020  YIFSAGTGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPV  1199
             YIF +  G  E A D N++I Y   +P Y AP  VY+T R MG +  +N N+NL+WYF V
Sbjct  268   YIFGSAKG--ERAFDLNLSIRYTSAVPEYTAPQSVYRTARYMGNSPQINLNFNLSWYFSV  325

Query  1200  DSGFFYLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             ++GF YLVRLHFCE    IT +N+RVF IY+NNQTAE  AD   W+G  GVP
Sbjct  326   ETGFKYLVRLHFCEVARYITRVNQRVFRIYINNQTAEDQADIFGWSGGQGVP  377



>ref|XP_007153476.1| hypothetical protein PHAVU_003G038800g [Phaseolus vulgaris]
 gb|ESW25470.1| hypothetical protein PHAVU_003G038800g [Phaseolus vulgaris]
Length=840

 Score =   300 bits (767),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 215/343 (63%), Gaps = 12/343 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQ-DNRKWTTDVGSKFLLGTG--KSSTSSADSQKPSVPQVPF  524
             YVPT+ I+LNCG       Q D R W+ D+ S ++      KS    A +   S+P+ P+
Sbjct  29    YVPTENIVLNCGSSTSEFVQYDGRNWSGDIVSPYVPSNADTKSLVVRAPNTLQSIPEAPY  88

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR F S+FTY+F V  G KF+RL+FYPASY  LN +N+  SV    +TLL NFSA   
Sbjct  89    MTARIFHSQFTYTFNVTPGPKFIRLHFYPASYMDLNISNAFLSVSAANFTLLHNFSASLN  148

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTA-DGST  878
              E  N  +  KEF V+V G  L +TF+PS N+  + AFVNGIEVVS P ++Y    DG  
Sbjct  149   AEYYNLAYFKKEFIVHVSGSVLQLTFSPSYNASRAFAFVNGIEVVSMPLNLYMRGDDGDP  208

Query  879   M-IVGQ-NSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTE  1052
             + +VG  N  +NI N +A+E++YRV VGG  I    DTGMFR+WD D  YIF A  G+  
Sbjct  209   LPLVGHDNKVVNIYNDSAMETLYRVKVGGEQIPSKYDTGMFRTWDTDEVYIFGASFGIQP  268

Query  1053  TADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPN--ASVNANYNLTWYFPVDSGFFYLVR  1226
                + +M + Y    P Y AP +VY+T RSMGP+    VN NYN+TW+FPVDSGF YLVR
Sbjct  269   C--NMSMLVLYSDDAPPYSAPADVYRTSRSMGPSDYGLVNLNYNMTWFFPVDSGFLYLVR  326

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAW-AGKNGV  1352
             LHFCE    IT+IN+ VF ++LNNQTAE   D I   AG+ GV
Sbjct  327   LHFCEIDQDITKINQVVFTVFLNNQTAEEEVDVIGLGAGEPGV  369



>ref|XP_012088049.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=865

 Score =   300 bits (769),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 168/343 (49%), Positives = 214/343 (62%), Gaps = 13/343 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVG--SKFL-LGTGKSSTSSADSQKPSVPQVPF  524
             Y P D ILLNCG P+     D R W  D G  SK+    +  SS S A  Q  SV  VP+
Sbjct  26    YTPADLILLNCGAPNEGQSMDGRNWEGDAGHRSKYCPFNSEISSPSKASQQDSSVTPVPY  85

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR ++S+FT +FPV+ G KF+RLYFYP +Y+GLN + S FSV   +YTLL NFS+  T
Sbjct  86    MTARIYRSKFTCTFPVSMGPKFIRLYFYPTTYSGLNISTSFFSVTANDYTLLSNFSSYLT  145

Query  705   TEALN--FDFLVKEFSVNV--PGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIY-NTA  866
               A+     + VKEF ++V      +N+TFTPSPNS    AF+NGIE+VS P ++Y    
Sbjct  146   VSAMQPPVAYFVKEFIISVWDNQAVINLTFTPSPNS---FAFINGIEIVSMPTNLYAKDN  202

Query  867   DGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGV  1046
             D +   V  NS  N DN+TALE++ R+NVGG  I    D GMFR W +DS Y+F   +GV
Sbjct  203   DYAYPFVNDNSIFNFDNTTALETVCRLNVGGGDIENVKDIGMFRPWSDDSSYLFGGLSGV  262

Query  1047  TETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVR  1226
                  D N+TI Y    P YVAP  VY + R+MG ++ +N NYNLTW+F VDSGF YL+R
Sbjct  263   VHKWRD-NVTIKYSKDTPAYVAPEAVYISKRTMGTDSMLNKNYNLTWHFLVDSGFNYLLR  321

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             LHFCE    IT   +RVF I++NN TA   AD I W+G N +P
Sbjct  322   LHFCETDEQITHEGQRVFSIFINNMTAVADADVIHWSGGNSIP  364



>ref|XP_011009252.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Populus euphratica]
Length=744

 Score =   297 bits (761),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 161/338 (48%), Positives = 206/338 (61%), Gaps = 11/338 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             Y PTD ILLNCG    ++  D R W  D  SKF   +     SS   Q PSV QVP+MTA
Sbjct  44    YSPTDLILLNCGASSNLSSPDGRSWDGDSQSKFA-ASNPPEASSVTXQDPSVNQVPYMTA  102

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R F S+FTY+FPV  G KF+RLYFY ASY+ L+ + S FS+    Y LL NFSA  T  A
Sbjct  103   RIFHSKFTYTFPVLPGPKFVRLYFYRASYSNLDISTSYFSLSANNYKLLDNFSASLTVSA  162

Query  714   L--NFDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNTADGSTM  881
                  D   KEF + V   + L +TF PSP S    AF+NGIE+VS PD  Y   + +++
Sbjct  163   TIPPVDSFTKEFIITVWDNQKLELTFIPSPAS---FAFINGIEIVSMPDSFYARGNDNSL  219

Query  882   IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
                  +P ++ N+TALE+IYR+NVGG  IS + DTGM+R+W +D +Y+            
Sbjct  220   TYVGTAPFSLYNTTALETIYRLNVGGQDISSTRDTGMYRTWHQDLEYLIGQSGNTPYLP-  278

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
                + I Y    P Y APV VY T+RSMGP   +N NYNLTW FPVD+GF YL+RLHFCE
Sbjct  279   --GVKIKYTTKTPAYSAPVMVYSTMRSMGPEPRLNLNYNLTWIFPVDAGFLYLLRLHFCE  336

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                    +N++VF+I++NNQTAE  AD I  +G NG+P
Sbjct  337   TRMEFINVNQQVFLIFINNQTAEYDADVIHMSGGNGIP  374



>ref|XP_011021061.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA, partial [Populus euphratica]
Length=834

 Score =   299 bits (766),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 161/339 (47%), Positives = 206/339 (61%), Gaps = 12/339 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             Y PTD ILLNCG    ++  D R W  D  SKF   +     S  DSQ PSV QVP+MTA
Sbjct  44    YSPTDLILLNCGASSNLSSPDGRSWDGDSQSKFA-ASNPPEASXCDSQDPSVNQVPYMTA  102

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R F S+FTY+FPV  G KF+RLYFYPAS + L+ + S FS+    Y LL N SA  T  A
Sbjct  103   RIFHSKFTYTFPVLPGPKFVRLYFYPASDSNLDISTSYFSISANNYQLLNNCSASLTVSA  162

Query  714   L--NFDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIY--NTADGST  878
             +    D+  KEF + V   + L +TF PSP S    +FVNGIE+VS PD +     D   
Sbjct  163   IIPPVDYFTKEFIITVRDNQKLELTFVPSPAS---FSFVNGIEIVSMPDSFYARGHDNPL  219

Query  879   MIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETA  1058
               VG + P  +DN+TALE++YR+NVGG     + DTGM+R+W++D +Y+       T   
Sbjct  220   AYVGPDVPTFLDNTTALETVYRLNVGGQDSGSTGDTGMYRTWNQDLEYLIGQSGNTTYLP  279

Query  1059  DDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFC  1238
                 + I      P Y APV VY T+RSMGP   +N NYNLTW FPVD+GF YL+RLHFC
Sbjct  280   ---GVKIKXTTKTPAYSAPVMVYSTMRSMGPEPRLNMNYNLTWIFPVDAGFLYLLRLHFC  336

Query  1239  EFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             E       +N++VF+I++NNQTAE  AD I  +G NG+P
Sbjct  337   ETRMEFINVNQQVFLIFINNQTAEHDADVIHMSGGNGIP  375



>emb|CAN77538.1| hypothetical protein VITISV_025026 [Vitis vinifera]
Length=853

 Score =   300 bits (767),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 171/344 (50%), Positives = 205/344 (60%), Gaps = 21/344 (6%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS------SADSQKPSVPQ  515
             Y PTD ILL+CG        D R W  D GSKF   +G S          A  Q PSV Q
Sbjct  27    YRPTDNILLDCGSSINTKSPDGRTWQGDQGSKF---SGTSDVQNSSSSSKAFRQDPSVDQ  83

Query  516   VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  695
             VP+MTAR F S FTYSFPV++G KF+R YFYP +Y+G N +   FSV  G YTLL NFSA
Sbjct  84    VPYMTARIFNSSFTYSFPVSAGPKFVRFYFYPTAYSGHNESEFFFSVTSGVYTLLSNFSA  143

Query  696   GQTTEALN--FDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNT  863
               T   +      LVKEFS+NV   + LN+TF+PSPNS    AFVNGIEVVS P+ +Y  
Sbjct  144   SLTVAPMGSGVSSLVKEFSINVWDNQILNITFSPSPNS---WAFVNGIEVVSMPNHLYGQ  200

Query  864   ADGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTG  1043
              D    +V       +DN TALE++YR+NVGGN I   +D+GMFRSW +D  YI+    G
Sbjct  201   ID--LKLVSAVQQFEMDNYTALETVYRLNVGGNHIPAEADSGMFRSWSQDDSYIYGGNLG  258

Query  1044  VTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLV  1223
             +T   D   + I Y    P Y+AP  VY T R+M     +N   NLTW F VDSGF+YLV
Sbjct  259   LTPNLD---IRIQYTQTTPPYIAPRTVYTTSRTMTKQEEINKRTNLTWLFHVDSGFYYLV  315

Query  1224  RLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             RLHFCE    +T   ERVF I+LNNQTAE   D I  +G  G P
Sbjct  316   RLHFCELQLEVTRPGERVFSIFLNNQTAEEEMDVIVRSGGTGYP  359



>ref|XP_006654257.1| PREDICTED: receptor-like protein kinase FERONIA-like [Oryza brachyantha]
Length=889

 Score =   300 bits (768),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 160/329 (49%), Positives = 208/329 (63%), Gaps = 12/329 (4%)
 Frame = +3

Query  372   ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQS  548
             ILLNCG     TD  NR W  D  S+F     +   +SA  Q PS+P  VP+ TAR F S
Sbjct  36    ILLNCGASAAQTDNYNRSWDGDASSRFAPSV-RGLQASAGYQDPSLPSPVPYSTARVFAS  94

Query  549   EFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQTTEALNFD  725
              +TYSFPV  GR FLRLYFYP  Y    ++ ++ F V   +  LL +F+A QT  A NF 
Sbjct  95    NYTYSFPVGPGRVFLRLYFYPTDYGSRYDSADAYFGVAANDLVLLDSFNASQTALATNFA  154

Query  726   FLVKEFSVNVPGET-LNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSP  902
             +L++EFSVNV     LN+TF PS  +  S AFVNGIE+V  PDI+ ++  +T      +P
Sbjct  155   YLIREFSVNVTTSGGLNLTFAPSARN-GSYAFVNGIEIVPTPDIFKSSTPTT------NP  207

Query  903   LNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTIS  1082
              ++D +   +++YR+NVGG  I+P  D+G +RSWD D+ YI+ AG GVT   D  N+TI+
Sbjct  208   PDLDPAAGFQTMYRLNVGGQSITPQGDSGFYRSWDNDAPYIYGAGFGVTFPKDG-NVTIT  266

Query  1083  YPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITE  1262
             YP   P Y APV+VY T RSMGPNA +N NYNLTW  PVD+GF Y +R HFCE    IT+
Sbjct  267   YPSTEPRYTAPVDVYATARSMGPNAQINLNYNLTWILPVDAGFPYFLRFHFCEIQYPITK  326

Query  1263  INERVFIIYLNNQTAEPGADAIAWAGKNG  1349
             +N+R F IY+NNQT +   D I W+G  G
Sbjct  327   VNQRSFFIYINNQTVQNQMDVIVWSGGIG  355



>ref|XP_010914574.1| PREDICTED: receptor-like protein kinase ANXUR2 [Elaeis guineensis]
Length=865

 Score =   300 bits (767),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 164/338 (49%), Positives = 223/338 (66%), Gaps = 11/338 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMT  530
             Y PTD ILL+CG     TD D+RKW  D  SKF   +G S+T+ A  Q PS+   VP+MT
Sbjct  29    YTPTDSILLDCGSSADGTDADHRKWAADDSSKFR-PSGNSTTAPAAFQDPSLLSPVPYMT  87

Query  531   ARTFQSEFTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRV-GEYTLLKNFSAGQT  704
             AR F SE TY F V+     ++RL+FYP++YN LN  ++ FSV   G  TLL NFSA  T
Sbjct  88    ARIFTSESTYKFAVSDKDHHWIRLHFYPSTYNSLNPEDAYFSVTASGGITLLHNFSAHVT  147

Query  705   TEALNFDFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTM  881
              +AL   ++VKEFS+    +  L++TF PS   PNS AFVNGIE++S PDIY   + +T+
Sbjct  148   AQALTQAYIVKEFSIPPSSDGALSLTFAPSTEHPNSYAFVNGIEIISMPDIY--VEPATL  205

Query  882   IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
             +   +S +++  S ALE +YR+NVGG  I  S+D+G+ R+W +DS YI+ AG G++  A+
Sbjct  206   VGFSDSTVDVGES-ALEVMYRLNVGGQYIPASNDSGLSRTWYDDSPYIYGAGFGISFAAE  264

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
                + I YP     Y+AP++VY+T RSMGP+ +VN NYNLTW F VD  F Y+VRLHFCE
Sbjct  265   K-KVQIKYPSDDSKYIAPIDVYRTARSMGPDNAVNKNYNLTWVFQVDGNFTYVVRLHFCE  323

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                 + ++N+RVF I++NNQTA   AD +AW  + GVP
Sbjct  324   IQ--LDKVNQRVFDIFVNNQTATAAADVLAWTSEKGVP  359



>ref|XP_009799586.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nicotiana sylvestris]
Length=860

 Score =   299 bits (766),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 221/331 (67%), Gaps = 15/331 (5%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPS-VPQVPFMTARTFQSE  551
             +L CG     TD D R W+ D      L +G S TS A  Q PS V  +P+MTAR F+++
Sbjct  36    VLACGATSNATDADGRIWSPDSTH---LPSGNSITSKAKYQDPSLVSDIPYMTARIFKTQ  92

Query  552   FTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              TYSFPV+   R ++RL+FYP++Y+  N +NS FSV VG +TLL NFSA  T +AL   +
Sbjct  93    TTYSFPVSPKSRHWIRLHFYPSTYDNFNCSNSFFSVTVGGFTLLNNFSASITAQALTQAY  152

Query  729   LVKEFSVNVPGET--LNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSP  902
             +++EF++ VP +T  LN+TF PS    +S AF+NGIE++S P+I+  A     +VG +  
Sbjct  153   IIREFTI-VPLQTGTLNITFNPSSVYKDSFAFINGIEIISMPEIFQAAP----MVGFSDQ  207

Query  903   LNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTIS  1082
                  ++++++++R+NVGG  I  ++D+G+ R W +D+ Y+F A  GVT  A++ ++ IS
Sbjct  208   TMETEASSMQTMFRLNVGGQYIPSNNDSGLGRIWYDDAPYLFGASFGVTSAANN-SVKIS  266

Query  1083  YPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITE  1262
             YPP +P Y+APV+VY+T RSMGPN  VN NYNLTW F +D  F YLVRLHFCEF   +T 
Sbjct  267   YPPNLPNYIAPVDVYRTARSMGPNPDVNRNYNLTWIFQIDGNFTYLVRLHFCEFQ--LTR  324

Query  1263  INERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +N+RVF IY+NNQTA   AD I+W    GVP
Sbjct  325   VNQRVFNIYINNQTALEEADVISWTSAQGVP  355



>ref|XP_010660576.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=875

 Score =   300 bits (767),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 172/344 (50%), Positives = 205/344 (60%), Gaps = 21/344 (6%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSS------ADSQKPSVPQ  515
             Y PTD ILL+CG        D R W  D GSKF   +G S   +      A  Q PSV Q
Sbjct  35    YRPTDNILLDCGSSISKMSPDGRTWQGDQGSKF---SGTSDVQNSSSSSNAFRQDPSVEQ  91

Query  516   VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  695
             VP+MTAR F S FTYSFPV+SG KF+R YFYP +Y+G N +   FSV  G YTLL NFSA
Sbjct  92    VPYMTARIFNSSFTYSFPVSSGPKFVRFYFYPTAYSGHNESEFFFSVTSGVYTLLSNFSA  151

Query  696   GQTTEALN--FDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNT  863
               T   +      LVKEFS+NV   + LN+TF+PSPNS    AFVNGIEVVS P+ +Y  
Sbjct  152   SLTVAPMGSGVSSLVKEFSINVWDNQILNITFSPSPNS---WAFVNGIEVVSMPNHLYGQ  208

Query  864   ADGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTG  1043
              D    +V       +DN TALE++YR+NVGGN I   +D+GMFRSW +D  YI+    G
Sbjct  209   ID--LKLVSAVQQFEMDNYTALETVYRLNVGGNHIPAEADSGMFRSWSQDDSYIYGGNLG  266

Query  1044  VTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLV  1223
             +T   D     I Y    P Y+AP  VY T R+M     +N   NLTW F VDSGF+YLV
Sbjct  267   LTPNLDSL---IQYTQTTPPYIAPRTVYTTSRTMTKQEEINKRTNLTWLFHVDSGFYYLV  323

Query  1224  RLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             RLHFCE    +T   ERVF I+LNNQTAE   D I  +G  G P
Sbjct  324   RLHFCELQLEVTRPGERVFSIFLNNQTAEEEMDVIVRSGGTGYP  367



>ref|XP_009118021.1| PREDICTED: receptor-like protein kinase FERONIA isoform X1 [Brassica 
rapa]
Length=808

 Score =   298 bits (763),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 166/337 (49%), Positives = 214/337 (64%), Gaps = 25/337 (7%)
 Frame = +3

Query  363   TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSV-PQVPFMTART  539
              +++LL CGG   V    NR W  D   K L  +G+S TS A +Q PSV P VP+M+AR 
Sbjct  21    CEEVLLYCGGRVSVIGVGNRTWMPDQLFKCLSTSGESKTSPALTQDPSVVPSVPYMSARV  80

Query  540   FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  719
             F+S FTYSFPVASGRKFLRLYFYP SY+GLNAT S+FS+  G YTLL+NFSA QT + ++
Sbjct  81    FKSPFTYSFPVASGRKFLRLYFYPNSYDGLNATLSLFSLSSGPYTLLRNFSASQTVQEMS  140

Query  720   FDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNS  899
               ++VKEF VN  G TLN+TFTP     N+ AFVNGIEV S PDIY   +    IVG + 
Sbjct  141   LSYIVKEFVVNAEGGTLNLTFTPESTPSNAYAFVNGIEVTSMPDIY--PNRVFTIVGTSK  198

Query  900   PLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVT-----ETADD  1064
             P+ +D +T L+ +YRVN+GG  I P  D  +FR+W +D  +I+S G  VT     E+   
Sbjct  199   PIAMDKNTFLQMVYRVNIGGRGIYPFEDP-LFRTWYQD-LFIYSRGDRVTGAVVSESVHS  256

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPN-ASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
             Y              AP EVY + R+M  + A  N  +NL+W F VDS F YL+RLHFCE
Sbjct  257   Y--------------APEEVYSSARAMESSLAEENLKFNLSWSFTVDSRFHYLIRLHFCE  302

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
                 + + N+RVF I+LN+ TAEP AD + W+G  G+
Sbjct  303   VAPGVDKSNQRVFSIFLNSATAEPKADIVEWSGGQGL  339



>ref|XP_002277584.3| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=895

 Score =   299 bits (766),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 171/344 (50%), Positives = 205/344 (60%), Gaps = 21/344 (6%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS------SADSQKPSVPQ  515
             Y PTD ILL+CG        D R W  D GSKF   +G S          A  Q PSV Q
Sbjct  35    YRPTDNILLDCGSSINTKSPDGRTWQGDQGSKF---SGTSDVQNSSSSSKAFRQDPSVDQ  91

Query  516   VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  695
             VP+MTAR F S FTYSFPV++G KF+R YFYP +Y+G N +   FSV  G YTLL NFSA
Sbjct  92    VPYMTARIFNSSFTYSFPVSAGPKFVRFYFYPTAYSGHNESEFFFSVTSGVYTLLSNFSA  151

Query  696   GQTTEALN--FDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNT  863
               T   +      LVKEFS+NV   + LN+TF+PSPNS    AFVNGIEVVS P+ +Y  
Sbjct  152   SLTVAPMGSGVSSLVKEFSINVWDNQILNITFSPSPNS---WAFVNGIEVVSMPNHLYGQ  208

Query  864   ADGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTG  1043
              D    +V       +DN TALE++YR+NVGGN I   +D+GMFRSW +D  YI+    G
Sbjct  209   ID--LKLVSAVQQFEMDNYTALETVYRLNVGGNHIPAEADSGMFRSWSQDDSYIYGGNLG  266

Query  1044  VTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLV  1223
             +T   D   + I Y    P Y+AP  VY T R+M     +N   NLTW F VDSGF+YLV
Sbjct  267   LTPNLD---IRIQYTQTTPPYIAPRTVYTTSRTMTKQEEINKRTNLTWLFHVDSGFYYLV  323

Query  1224  RLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             RLHFCE    +T   ERVF I+LNNQTAE   D I  +G  G P
Sbjct  324   RLHFCELQLEVTRPGERVFSIFLNNQTAEEEMDVIVRSGGTGYP  367



>gb|EMT17367.1| Receptor-like protein kinase FERONIA [Aegilops tauschii]
Length=779

 Score =   297 bits (760),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 151/331 (46%), Positives = 203/331 (61%), Gaps = 4/331 (1%)
 Frame = +3

Query  363   TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTARTF  542
             +D+ L+ CG     +D D R W  D      L    +  S  D   PS  +VP+MTAR F
Sbjct  28    SDQFLMRCGATSSASDSDGRTWEGDANFGLALPGLSAKASYLDPSLPS--RVPYMTARIF  85

Query  543   QSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNF  722
              S  TYS  V  GR FLRLYFYP +Y   +A +++FSV  G Y+LL +F+  QT +A+  
Sbjct  86    TSNSTYSLGVDPGRMFLRLYFYPTAYGEHSAVDALFSVTAGTYSLLNDFNPSQTAQAMGH  145

Query  723   DFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSP  902
              +L++E+S+NV    L+VTF+PSP    S A+VNGIE+V  PDI+          G    
Sbjct  146   SYLIREYSLNVTSSQLSVTFSPSPRHTGSYAYVNGIEIVHTPDIFTIPVPRFANGGNPDL  205

Query  903   LNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTIS  1082
               I +S  LE++YR+NVGG  IS   D+G +RSW+EDS YI+  G+       D N+TIS
Sbjct  206   FPISSSIGLETMYRLNVGGVTISGKHDSGFYRSWEEDSLYIY--GSDGMNFFKDNNITIS  263

Query  1083  YPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITE  1262
             YP  MP Y+AP+++Y+T RSMG NA  N  YNLTW  PVD+GF+YL+R HFCE    +T+
Sbjct  264   YPLSMPDYIAPIDIYETARSMGWNARNNMRYNLTWILPVDAGFYYLLRFHFCEIQYPMTK  323

Query  1263  INERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             I +R F+IY+NNQTA    D I W+G  G+P
Sbjct  324   IGQRQFVIYINNQTAVEQMDVIDWSGGIGIP  354



>ref|XP_010247768.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=876

 Score =   299 bits (765),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 162/340 (48%), Positives = 215/340 (63%), Gaps = 12/340 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGP-DGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  524
             Y P+DKI LNCG P + +T QD R WT D+GSK   L      S+ S  +Q PSVPQ+P+
Sbjct  26    YDPSDKIFLNCGAPPEVITAQDGRNWTGDIGSKLAPLASLINISSISQATQGPSVPQIPY  85

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             +TAR F + FTY FPV++G KF+RL+F+PASY   N T ++F V  G YTLLKNFSA  T
Sbjct  86    LTARIFYAPFTYKFPVSAGPKFIRLHFFPASYAVANRTKALFDVSAGPYTLLKNFSASLT  145

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTM  881
              +  N     +EF V    E L++TF+P+PN+ ++  FVNGIEVVS P ++Y   D   M
Sbjct  146   ADFFNTSHFFREFIVIADNEELDITFSPNPNTSDTYGFVNGIEVVSMPGNLYFGND--PM  203

Query  882   IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
             +V      +I N  ALE +YR+NV GN IS   DTGM+R W +D+ Y+ +     ++ A+
Sbjct  204   LVPGKVAYSIGNEMALEMVYRLNVAGNDISTQEDTGMYRQWYQDNSYLVNR----SDDAE  259

Query  1062  DYNMT--ISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHF  1235
               N T  I+Y    P+Y AP +VY+T R+M  N S+N   N+TW F VD GF YL RLHF
Sbjct  260   PVNTTININYTATTPSYTAPEDVYRTARTMIGNNSINVRNNITWGFLVDQGFSYLFRLHF  319

Query  1236  CEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             CEF   IT  +ER+F I + NQTAE  AD + W+G  G+P
Sbjct  320   CEFQPDITAPSERIFFILIGNQTAEREADVLKWSGGKGIP  359



>ref|XP_007032813.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY03739.1| Malectin/receptor-like protein kinase family protein [Theobroma 
cacao]
Length=517

 Score =   290 bits (742),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 155/337 (46%), Positives = 208/337 (62%), Gaps = 9/337 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTA  533
             Y P D I L+CG     TD   R W  D  + +L  + K S  S+   K     +P+ TA
Sbjct  41    YTPHDNISLDCGSTGNNTDLAGRSWLAD-STIYLDRSNKVSVISSSPTKGD--SIPYRTA  97

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R  +S+F+YSF V  G KF+RL+FYP SY   N + + F V +G YTLL+N+SA  T + 
Sbjct  98    RLSRSQFSYSFTVTPGPKFIRLHFYPTSYQEFNRSKASFDVHIGRYTLLRNYSAALTADD  157

Query  714   LNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTA--DGSTMI  884
             L  +   +EF +NV  + LN+ FTP+   P+S AF+NGIE+VS P ++Y +A  D     
Sbjct  158   LKSEVFSREFCINVDDQKLNILFTPNTRMPDSYAFINGIEIVSMPNNLYYSAEDDSGFNF  217

Query  885   VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADD  1064
             V Q +P +I  + ALE++YR+N+GG+ ISP+ DTGM+RSW ED +Y+ +    V      
Sbjct  218   VNQVNPYHILKNQALETVYRLNIGGSSISPAQDTGMYRSWSEDDEYLTNGERSVLPVNLR  277

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEF  1244
              N + S    +P Y +PV VY+T R+MG N +VN NY LTW F VDSGF Y VRLHFCEF
Sbjct  278   VNPSFSV---IPNYSSPVSVYRTARTMGTNKTVNENYRLTWEFRVDSGFTYFVRLHFCEF  334

Query  1245  TTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                ITE  +RVF IY++N  AEP AD I+WAG  GVP
Sbjct  335   QVEITEPGDRVFQIYIDNIVAEPQADVISWAGGRGVP  371



>ref|XP_009372137.1| PREDICTED: receptor-like protein kinase ANXUR1 [Pyrus x bretschneideri]
Length=879

 Score =   298 bits (764),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 159/336 (47%), Positives = 229/336 (68%), Gaps = 15/336 (4%)
 Frame = +3

Query  363   TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTART  539
             ++  ++ CG   G TD D R+W  D  S+FL  +  S T++A  Q PS+P Q+P+M+AR 
Sbjct  49    SESYIIACGSSSGGTDSDGRRWVPD--SRFLSSSENSKTATAQYQDPSLPSQIPYMSARI  106

Query  540   FQSEFTYSFPVASGRKFL-RLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  716
             F S  +Y F V+  ++ L RL+FYP+SY+GL+A+NS F V    ++LL+NFSA  TT+AL
Sbjct  107   FNSAASYKFFVSPRQRLLVRLHFYPSSYDGLDASNSYFDVIANGFSLLRNFSAAITTQAL  166

Query  717   NFDFLVKEFSVNVPGET--LNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTMIV  887
                ++++EFS+ VP ++  LN+TF PS     S AFVNGIEV+S P +++  A+   MI 
Sbjct  167   TQAYIMREFSL-VPTQSGNLNITFVPSSQHDKSYAFVNGIEVISMPAEMFQPAN---MIG  222

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
              Q+  +++  S++L++++R+NVGG  I   +D+G+ R+W +DS Y+F A  GVT  A+  
Sbjct  223   FQDQTIDV-QSSSLQTMFRLNVGGQFIPTRNDSGLTRTWYDDSPYLFGAAFGVTFQAEK-  280

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             N++I YP  +P Y+AP  VY T RSMGPN+ +N NYNLTW F VD+ F Y+VRLHFCE  
Sbjct  281   NVSIKYPSNLPEYIAPPNVYGTARSMGPNSKLNQNYNLTWVFTVDANFTYVVRLHFCELQ  340

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
               +T IN+RVF I+LNNQTA+  AD IAW+G  GVP
Sbjct  341   --LTRINQRVFDIFLNNQTAQQTADVIAWSGSIGVP  374



>ref|XP_002519226.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF43090.1| ATP binding protein, putative [Ricinus communis]
Length=854

 Score =   298 bits (762),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 153/334 (46%), Positives = 224/334 (67%), Gaps = 15/334 (4%)
 Frame = +3

Query  366   DKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTF  542
             D  +L CG  +  TD D RKW  D  +K++  +G S  ++AD+Q PS+P  VP+MT R F
Sbjct  29    DSYVLACGASNAGTDGDGRKWEPD--TKYVKSSGNSIMATADNQDPSLPSTVPYMTGRLF  86

Query  543   QSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  719
              S FTY+FPV A GR ++RL+FYP++Y+ L+  N+ FSV   +  LLKNFSA  T +AL 
Sbjct  87    TSAFTYTFPVPAKGRLWVRLHFYPSTYSSLDPNNAYFSVTANKLQLLKNFSASITAKALT  146

Query  720   FDFLVKEFSVN-VPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQN  896
               ++++E+S++ +   TLN+TFTPS +  ++ AFVNGIEV+  P+IY +A     +VG +
Sbjct  147   MAYIIREYSLSPIESGTLNLTFTPSQDHDDAYAFVNGIEVIPMPEIYQSAG----MVGFS  202

Query  897   SPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMT  1076
               +    ++++++++R+NVGG  I  ++D+G+ R W +D+ Y+F AG G+T  A   N+ 
Sbjct  203   DQMIDVTTSSMQTMFRLNVGGQFIPSTNDSGLTRIWYDDTPYLFGAGAGITNQA---NIK  259

Query  1077  ISYP-PGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTI  1253
             I YP   +P  +AP +VY + RSMGP++ VN N+NLTW F VD+ F YLVR HFCE+   
Sbjct  260   IQYPTQELPKAIAPYDVYSSARSMGPDSKVNMNFNLTWLFDVDANFTYLVRFHFCEYE--  317

Query  1254  ITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +T  N+R F IY+NNQTA+ GAD I WAG  GVP
Sbjct  318   MTRSNQRAFNIYINNQTAQEGADVIGWAGSKGVP  351



>dbj|BAJ93584.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=885

 Score =   298 bits (763),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 170/334 (51%), Positives = 212/334 (63%), Gaps = 10/334 (3%)
 Frame = +3

Query  363   TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  539
             T  IL+NCG      D   R W  D GSKF     K   ++A  Q  S+P  VPFMTAR 
Sbjct  31    TGLILVNCGASGQEDDDSGRTWGEDTGSKFAPSL-KGVAANAQRQDSSLPSTVPFMTARI  89

Query  540   FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVG--EYTLLKNFSAGQTTEA  713
             F S +TYSFPV  GR FLRLYFYP  Y    A++S FSV V      LL  F+A QT +A
Sbjct  90    FTSNYTYSFPVTPGRMFLRLYFYPTDYPNFAASDSSFSVSVSTPNLVLLDGFNASQTVQA  149

Query  714   LNFDFLVKEFSVNVP-GETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             ++  FLV+EFSVNV  G TL++TF PS +   S AFVNGIE+V  PDI+   D  T  VG
Sbjct  150   ISSAFLVREFSVNVSSGSTLDLTFAPSAHQNGSYAFVNGIEIVPTPDIFTAPD--TRTVG  207

Query  891   QN-SPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
              + SP   D + A++++YR+NVGG  ISP  D+G +RSW  D+ YI + G+GVT + DD 
Sbjct  208   DDTSPYTFDTAMAVQTMYRLNVGGQAISPKGDSGFYRSWTNDAPYI-AGGSGVTFSKDD-  265

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             N+TI+Y   +P Y AP +VY + RSMG  A VN NYNLTW  PVD+GF YL+R HFCE  
Sbjct  266   NLTITYTSKVPKYTAPADVYGSARSMGTTAQVNLNYNLTWILPVDAGFSYLLRFHFCEIQ  325

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
               IT+IN+R F IY+NNQTA+   D I W+G  G
Sbjct  326   YPITKINQRSFFIYINNQTAQEQMDVIVWSGGIG  359



>ref|XP_011019995.1| PREDICTED: receptor-like protein kinase ANXUR1 [Populus euphratica]
Length=855

 Score =   297 bits (761),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 158/335 (47%), Positives = 221/335 (66%), Gaps = 15/335 (4%)
 Frame = +3

Query  363   TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  539
             +D  +L CG     TD D R W +D  + +++ +G S+ ++A +Q PS+P  +P+MTAR 
Sbjct  32    SDSYVLACGASGSGTDSDGRNWQSD--ANYIISSGNSTAATAQNQDPSLPSTIPYMTARI  89

Query  540   FQSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  716
             F SE TY F V   GR ++RL+FYP++   L+   S FSV    +TLL NFSA  T +AL
Sbjct  90    FSSESTYKFSVPKKGRLWVRLHFYPSTCTSLDPNTSYFSVTANTFTLLNNFSASITAQAL  149

Query  717   NFDFLVKEFS-VNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQ  893
                F+V+EFS + +   TLN+TFTPS N  N+ AFVNGIEV+  PDIY  A    ++   
Sbjct  150   TQAFIVREFSLIPIDSGTLNLTFTPSSNYDNAYAFVNGIEVIPMPDIYQPA---ALVGFS  206

Query  894   NSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNM  1073
             +  L++ +ST L++++R+NVGG  I    D+G+ R+W +D+ Y+F AG+GVT  A   N+
Sbjct  207   DQTLDVGSST-LQTMFRLNVGGRFIPAIKDSGLTRTWYDDTPYLFGAGSGVTSQA---NI  262

Query  1074  TISYP-PGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +I YP   +P +VAP++VY T RSMGP++ VN NYNLTW F VD  F Y +R HFCE+  
Sbjct  263   SIQYPTDNLPKHVAPLDVYSTARSMGPDSKVNQNYNLTWIFQVDPNFTYALRFHFCEYQE  322

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
               T++N+RVF IY+NNQTA+ GAD I WAG  GVP
Sbjct  323   --TKVNQRVFDIYVNNQTAQEGADVIGWAGSQGVP  355



>ref|XP_006373383.1| hypothetical protein POPTR_0017s13270g [Populus trichocarpa]
 gb|ERP51180.1| hypothetical protein POPTR_0017s13270g [Populus trichocarpa]
Length=829

 Score =   297 bits (760),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 161/339 (47%), Positives = 205/339 (60%), Gaps = 13/339 (4%)
 Frame = +3

Query  360   PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGT--GKSSTSSADSQKPSVPQVPFMTA  533
             PTD ILLNCG    ++  D R W  D  SKF        SS   A +  PSV QVP+MTA
Sbjct  41    PTDLILLNCGASSNLSSPDGRSWDGDSQSKFAASKPPEASSVFEASNHDPSVNQVPYMTA  100

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R F S+FTY+FPV  G KF+RLYFYPASY+ L+ + S FS+    Y LL NFSA  T  A
Sbjct  101   RIFHSKFTYTFPVLPGPKFVRLYFYPASYSNLDISTSYFSISANNYQLLNNFSASLTVSA  160

Query  714   L--NFDFLVKEFSVNVP-GETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIY--NTADGST  878
             +    D+  KEF + V   + L +TF PSP S    +F+NGIE+VS PD +     D   
Sbjct  161   IIPPVDYFTKEFIITVRDNQKLELTFIPSPAS---FSFINGIEIVSMPDSFYARGHDNPL  217

Query  879   MIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETA  1058
               VG +    +DN+TALE++YR+NVGG  I  + DTGM+R+W +DS+Y+F          
Sbjct  218   TYVGPDVHTFLDNTTALETVYRLNVGGQDIGSTGDTGMYRTWHQDSEYLFGQAGNTPYLP  277

Query  1059  DDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFC  1238
                 + I Y    P Y APV VY T+RSMG    +N NYNLTW FPVD+GF YL+RLHFC
Sbjct  278   ---GVKIKYTTKTPAYSAPVMVYSTMRSMGREPRLNMNYNLTWIFPVDAGFLYLLRLHFC  334

Query  1239  EFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             E        N++VF+I++NNQTAE  AD I  +G NG+P
Sbjct  335   ETRMEFKNENQQVFLIFINNQTAEHDADVIHMSGGNGIP  373



>ref|XP_009602553.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nicotiana tomentosiformis]
Length=867

 Score =   297 bits (761),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 154/330 (47%), Positives = 220/330 (67%), Gaps = 11/330 (3%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPS-VPQVPFMTARTFQSE  551
             +L CG     TD D R W+ D  +     +G S TS A  Q PS V  +P+MTAR F+++
Sbjct  41    VLACGATSNATDADGRIWSPD-STHLPSSSGNSITSKAKYQDPSLVSDIPYMTARIFKTQ  99

Query  552   FTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
               Y+FPV+   R ++RL+FYP+SY+  N +NS FSV VG +TLL NFSA  T +AL   +
Sbjct  100   TAYTFPVSPKSRHWIRLHFYPSSYDNFNCSNSFFSVTVGGFTLLNNFSASITAQALTQAY  159

Query  729   LVKEFS-VNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPL  905
             +++EF+ V +  +TLN+TF+PS    +S AF+NGIE++S P+I+  A     +VG +   
Sbjct  160   IIREFTLVPLQTDTLNITFSPSSVYKDSFAFINGIEIISMPEIFQAAP----MVGFSDQT  215

Query  906   NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISY  1085
                 ++++++++R+NVGG  I  ++D+G+ R W +D+ Y+F A  GVT  A++ ++ ISY
Sbjct  216   METEASSMQTMFRLNVGGQYIPANNDSGLGRIWYDDAPYLFGASFGVTSAANN-SVKISY  274

Query  1086  PPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEI  1265
             PP +P Y+APV+VY+T RSMGPN  VN NYNLTW F +D  F YLVRLHFCEF   +T +
Sbjct  275   PPNLPNYIAPVDVYRTARSMGPNPDVNRNYNLTWIFQIDGNFTYLVRLHFCEFQ--LTRM  332

Query  1266  NERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             N+RVF IY+NNQTA   AD I+W    GVP
Sbjct  333   NQRVFNIYINNQTALEEADVISWTSAQGVP  362



>emb|CBI21192.3| unnamed protein product [Vitis vinifera]
Length=974

 Score =   299 bits (766),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 171/344 (50%), Positives = 205/344 (60%), Gaps = 21/344 (6%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS------SADSQKPSVPQ  515
             Y PTD ILL+CG        D R W  D GSKF   +G S          A  Q PSV Q
Sbjct  117   YRPTDNILLDCGSSINTKSPDGRTWQGDQGSKF---SGTSDVQNSSSSSKAFRQDPSVDQ  173

Query  516   VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  695
             VP+MTAR F S FTYSFPV++G KF+R YFYP +Y+G N +   FSV  G YTLL NFSA
Sbjct  174   VPYMTARIFNSSFTYSFPVSAGPKFVRFYFYPTAYSGHNESEFFFSVTSGVYTLLSNFSA  233

Query  696   GQTTEALN--FDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNT  863
               T   +      LVKEFS+NV   + LN+TF+PSPNS    AFVNGIEVVS P+ +Y  
Sbjct  234   SLTVAPMGSGVSSLVKEFSINVWDNQILNITFSPSPNS---WAFVNGIEVVSMPNHLYGQ  290

Query  864   ADGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTG  1043
              D    +V       +DN TALE++YR+NVGGN I   +D+GMFRSW +D  YI+    G
Sbjct  291   ID--LKLVSAVQQFEMDNYTALETVYRLNVGGNHIPAEADSGMFRSWSQDDSYIYGGNLG  348

Query  1044  VTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLV  1223
             +T   D   + I Y    P Y+AP  VY T R+M     +N   NLTW F VDSGF+YLV
Sbjct  349   LTPNLD---IRIQYTQTTPPYIAPRTVYTTSRTMTKQEEINKRTNLTWLFHVDSGFYYLV  405

Query  1224  RLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             RLHFCE    +T   ERVF I+LNNQTAE   D I  +G  G P
Sbjct  406   RLHFCELQLEVTRPGERVFSIFLNNQTAEEEMDVIVRSGGTGYP  449



>ref|NP_001055180.1| Os05g0317900 [Oryza sativa Japonica Group]
 gb|AAV44014.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|AAV44114.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17094.1| Os05g0317900 [Oryza sativa Japonica Group]
Length=846

 Score =   296 bits (758),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/328 (46%), Positives = 206/328 (63%), Gaps = 4/328 (1%)
 Frame = +3

Query  372   ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQS  548
             I LNCG      D +NR W  D  S F     K   + A  Q PS+P  VP+MT+R F S
Sbjct  35    IFLNCGASAMQLDSNNRSWDGDTSSTFAPSV-KGLAARASYQDPSLPSLVPYMTSRIFIS  93

Query  549   EFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              +TYSFPV  GR F+RL+FYP +Y    + ++ F V     TLL NF+A QT  A  + +
Sbjct  94    NYTYSFPVIPGRMFVRLHFYPVAYGNYASRDAYFGVTTNNLTLLDNFNASQTALAAKYAY  153

Query  729   LVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPLN  908
             +++EFS+NV   +L++TF PS  +  S AFVNGIE+V  PDI+ T        G   P +
Sbjct  154   ILREFSLNVTSGSLDLTFFPSTQN-GSYAFVNGIEIVPTPDIFTTLSPIPPTNGNPDPSD  212

Query  909   IDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISYP  1088
             ID+  + +++YR+NVGG  ISP  D+  +RSW+ DS YI+ +  GVT + D  N+TI+YP
Sbjct  213   IDSMISFQTMYRLNVGGMTISPQGDSMFYRSWENDSPYIYGSAFGVTFSKDS-NVTITYP  271

Query  1089  PGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEIN  1268
               MP Y+AP +VY T RSMGP A +N +Y+LTW  PVD+GF+YL+R HFCE    IT++N
Sbjct  272   STMPNYIAPADVYGTARSMGPIAQINLHYSLTWILPVDAGFYYLLRFHFCEIEYPITKVN  331

Query  1269  ERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
             +R F IY+NNQT +   D I W+G  G+
Sbjct  332   QRSFFIYINNQTVQEQMDVIVWSGGIGI  359



>gb|KDP27676.1| hypothetical protein JCGZ_20096 [Jatropha curcas]
Length=838

 Score =   296 bits (757),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 213/345 (62%), Gaps = 16/345 (5%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVG--SKFL-LGTGKSSTSSADSQKPSVPQVPF  524
             Y PTD+ILLN G PDG    D R W +D    SK+  + +  S+ S A  Q PSV QVP+
Sbjct  27    YTPTDRILLNSGAPDGEQSMDGRNWESDADQQSKYCPMNSETSAASKASQQDPSVTQVPY  86

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR  +S++T  FPV+ G KF+RLYFYP SY+GL+ + S FSV    YTLL NFSA  T
Sbjct  87    MTARIIRSKYTCMFPVSMGPKFIRLYFYPNSYSGLDTSTSFFSVTANGYTLLSNFSAHLT  146

Query  705   TEALN--FDFLVKEFSVNVPGE--TLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADG  872
               A+     +LVKEF + V      +N+TFT    SPNS AF+NGIE+VS P    T D 
Sbjct  147   VSAMQPPVAYLVKEFIITVRDNQGVINLTFT---QSPNSFAFINGIEIVSMPTNLYTKDN  203

Query  873   ST---MIVGQNSPLN-IDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGT  1040
              +    +   N P    DN+T+LE++YR+N+GG  I   +DTG+FR+W  D  +IF  G 
Sbjct  204   DSPYSFVNDNNVPFYYFDNTTSLETVYRLNIGGPNIENVNDTGIFRTWSNDLLHIF-GGL  262

Query  1041  GVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYL  1220
             G      D ++T+ Y    PTYVAP  VY T R+MG N+ VN N NLTW F VDSGF YL
Sbjct  263   GYVHLWRD-DVTVKYSKDTPTYVAPEAVYITKRTMGANSVVNQNSNLTWLFLVDSGFNYL  321

Query  1221  VRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +RLHFCE    IT   +RVF I++NN TAE  AD I W+G N +P
Sbjct  322   LRLHFCETEKEITHEGQRVFSIFINNMTAEAEADVIHWSGGNSIP  366



>gb|EEE63232.1| hypothetical protein OsJ_18042 [Oryza sativa Japonica Group]
Length=845

 Score =   296 bits (758),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/328 (46%), Positives = 206/328 (63%), Gaps = 4/328 (1%)
 Frame = +3

Query  372   ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQS  548
             I LNCG      D +NR W  D  S F     K   + A  Q PS+P  VP+MT+R F S
Sbjct  34    IFLNCGASAMQLDSNNRSWDGDTSSTFAPSV-KGLAARASYQDPSLPSLVPYMTSRIFIS  92

Query  549   EFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              +TYSFPV  GR F+RL+FYP +Y    + ++ F V     TLL NF+A QT  A  + +
Sbjct  93    NYTYSFPVIPGRMFVRLHFYPVAYGNYASRDAYFGVTTNNLTLLDNFNASQTALAAKYAY  152

Query  729   LVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPLN  908
             +++EFS+NV   +L++TF PS  +  S AFVNGIE+V  PDI+ T        G   P +
Sbjct  153   ILREFSLNVTSGSLDLTFFPSTQN-GSYAFVNGIEIVPTPDIFTTLSPIPPTNGNPDPSD  211

Query  909   IDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISYP  1088
             ID+  + +++YR+NVGG  ISP  D+  +RSW+ DS YI+ +  GVT + D  N+TI+YP
Sbjct  212   IDSMISFQTMYRLNVGGMTISPQGDSMFYRSWENDSPYIYGSAFGVTFSKDS-NVTITYP  270

Query  1089  PGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEIN  1268
               MP Y+AP +VY T RSMGP A +N +Y+LTW  PVD+GF+YL+R HFCE    IT++N
Sbjct  271   STMPNYIAPADVYGTARSMGPIAQINLHYSLTWILPVDAGFYYLLRFHFCEIEYPITKVN  330

Query  1269  ERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
             +R F IY+NNQT +   D I W+G  G+
Sbjct  331   QRSFFIYINNQTVQEQMDVIVWSGGIGI  358



>gb|EEC78971.1| hypothetical protein OsI_19445 [Oryza sativa Indica Group]
Length=845

 Score =   296 bits (758),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 151/328 (46%), Positives = 206/328 (63%), Gaps = 4/328 (1%)
 Frame = +3

Query  372   ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQS  548
             I LNCG      D +NR W  D  S F     K   + A  Q PS+P  VP+MT+R F S
Sbjct  34    IFLNCGASAMQLDSNNRSWDGDTSSTFAPSV-KGLAARASYQDPSLPSLVPYMTSRIFIS  92

Query  549   EFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              +TYSFPV  GR F+RL+FYP +Y    + ++ F V     TLL NF+A QT  A  + +
Sbjct  93    NYTYSFPVIPGRMFVRLHFYPVAYGNYASRDAYFGVTTNNLTLLDNFNASQTALAAKYAY  152

Query  729   LVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPLN  908
             +++EFS+NV   +L++TF PS  +  S AFVNGIE+V  PDI+ T        G   P +
Sbjct  153   ILREFSLNVTSGSLDLTFFPSTQN-GSYAFVNGIEIVPTPDIFTTLSPIPPTNGNPDPSD  211

Query  909   IDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISYP  1088
             ID+  + +++YR+NVGG  ISP  D+  +RSW+ DS YI+ +  GVT + D  N+TI+YP
Sbjct  212   IDSMISFQTMYRLNVGGMTISPQGDSMFYRSWENDSPYIWGSAFGVTFSKDS-NVTITYP  270

Query  1089  PGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEIN  1268
               MP Y+AP +VY T RSMGP A +N +YNLTW  PVD+GF+YL+R HFC+    IT++N
Sbjct  271   STMPNYIAPADVYGTARSMGPIAQINLHYNLTWILPVDAGFYYLLRFHFCDIEYPITKVN  330

Query  1269  ERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
             +R F IY+NNQT +   D I W+G  G+
Sbjct  331   QRSFFIYINNQTVQEQMDVIVWSGGIGI  358



>ref|XP_002311383.2| hypothetical protein POPTR_0008s10500g [Populus trichocarpa]
 gb|EEE88750.2| hypothetical protein POPTR_0008s10500g [Populus trichocarpa]
Length=854

 Score =   296 bits (757),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 157/331 (47%), Positives = 219/331 (66%), Gaps = 15/331 (5%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  551
             +L CG     TD D R W +D  + +++ +G S+ ++A +Q PS+P  +P+MTAR F SE
Sbjct  36    VLACGASGSGTDSDGRNWQSD--ANYIISSGNSTAATAQNQDPSLPSTIPYMTARIFSSE  93

Query  552   FTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              TY F V   GR ++RL+FYP++Y+ L+   S FSV    +TLL NFSA  T +AL   F
Sbjct  94    STYKFSVPKKGRLWVRLHFYPSTYSSLDPNTSYFSVTANTFTLLNNFSASVTAQALTQAF  153

Query  729   LVKEFS-VNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPL  905
             +V+EFS + +   TLN+TFTPS N  N+ AFVNGIEV+  PDIY  A    ++   +  L
Sbjct  154   IVREFSLIPIDSGTLNLTFTPSSNYDNAYAFVNGIEVIPMPDIYQPA---ALVGFSDQTL  210

Query  906   NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISY  1085
             ++ +ST L++++R+NVGG  I    D+G+ R+W +D+ Y+F AG+GVT  A   N++I Y
Sbjct  211   DVGSST-LQTMFRLNVGGRFIPAIKDSGLTRTWYDDTPYLFGAGSGVTSQA---NISIQY  266

Query  1086  P-PGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITE  1262
             P   +P  +AP++VY T RSMGP++ VN NYNLTW F VD  F Y  R HFCE+    T+
Sbjct  267   PTDNLPKSIAPLDVYSTARSMGPDSKVNQNYNLTWIFQVDPNFTYAFRFHFCEYQE--TK  324

Query  1263  INERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +N+RVF IY+NNQTA+ GAD I WAG  GVP
Sbjct  325   VNQRVFDIYVNNQTAQEGADVIGWAGSQGVP  355



>ref|XP_010660579.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=522

 Score =   288 bits (736),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 159/343 (46%), Positives = 220/343 (64%), Gaps = 16/343 (5%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGK----SSTSSADSQKPSVPQVP  521
             Y PTD I L+CG     T  D R WT D+GS  +L T +    +  + A  Q P V  +P
Sbjct  39    YNPTDNIALDCGSSGNSTASDGRAWTGDIGS--ILATLQPLDTTIAARAIRQGP-VEGIP  95

Query  522   FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  701
             ++TAR   S+FTY+F V++G KF+RLYFYP+ Y G + + ++FSV+ G +TLL NF A  
Sbjct  96    YLTARMSSSQFTYTFLVSAGLKFVRLYFYPSWYPGFDRSKALFSVKSGPFTLLSNFRADL  155

Query  702   TTEALNFDFLVKEFSVNVP-GETLNVTFTPSPNSPN-SLAFVNGIEVVSHP-DIYNTADG  872
               ++L  ++ V+EF +NV   + LN+TF+PSP+S N S AFVNGIE+VS P ++Y T  G
Sbjct  156   VADSLGLEYFVREFCINVEENQLLNLTFSPSPSSSNDSYAFVNGIEIVSMPHNLYYTPAG  215

Query  873   STMI--VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGV  1046
             +  I  +GQ     I+N TALE++YR++VGG+ ISP+ D+GMFR W +D+++    G   
Sbjct  216   ADGIPFIGQTYFYEIENITALETMYRLDVGGHSISPTGDSGMFRFWSDDNQFFMGGGV--  273

Query  1047  TETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVR  1226
                 D  N TI Y    P Y+AP EVY+T RSMGPN + N   NLTW  PVD GF YLVR
Sbjct  274   --IPDKANSTIKYTKETPAYIAPAEVYQTSRSMGPNKTWNMRNNLTWVLPVDLGFRYLVR  331

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             LH CE    IT++++R FIIY++ +  +  ADAI W+G N +P
Sbjct  332   LHLCETNRAITQVSDRQFIIYIDGEMVDEAADAIIWSGGNSIP  374



>ref|XP_008809255.1| PREDICTED: receptor-like protein kinase ANXUR1 [Phoenix dactylifera]
Length=865

 Score =   296 bits (757),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 163/338 (48%), Positives = 223/338 (66%), Gaps = 11/338 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMT  530
             Y PTD ILLNCG     TD DNRKW  D GSK L  +G S+ + A  Q PS+   VP+MT
Sbjct  29    YTPTDSILLNCGSSADGTDADNRKWAADNGSK-LRPSGNSAAAQAAFQDPSLLSPVPYMT  87

Query  531   ARTFQSEFTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRV-GEYTLLKNFSAGQT  704
             AR F SE TY F V+   R ++RL+FYP++YN LN  ++ FSV V G  TLL+NFSA  T
Sbjct  88    ARIFTSESTYKFAVSDKDRHWIRLHFYPSTYNNLNPEDAYFSVTVSGGITLLRNFSAHVT  147

Query  705   TEALNFDFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTM  881
              +AL   ++VKEFS+    +  L++TF PS    NS AFVNGIE++S PDIY  ++ + +
Sbjct  148   AQALTQAYIVKEFSIPPSSDGALSLTFAPSDKHQNSYAFVNGIEIISMPDIY--SEPADL  205

Query  882   IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
             +   +S +++  S ALE +YR+NVGG  I  S+D+G+ R+W +DS YI+ AG G+T  A+
Sbjct  206   VGFSDSTVDVGRS-ALEVMYRLNVGGQYIPASNDSGLSRTWYDDSPYIYGAGFGITFAAE  264

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
               ++ I YP     Y+AP++VY+T RSMG + ++N NYNL+W F VD  F Y VRLHFCE
Sbjct  265   K-DLQIKYPSDDSKYIAPLDVYRTARSMGADNAINLNYNLSWVFQVDGNFTYAVRLHFCE  323

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                 + + N+RVF I+++NQTA   AD +AW  + GVP
Sbjct  324   LQ--LDKPNQRVFDIFVDNQTATAAADVLAWTSEKGVP  359



>gb|EMS60533.1| Receptor-like protein kinase FERONIA [Triticum urartu]
Length=836

 Score =   295 bits (754),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 207/332 (62%), Gaps = 5/332 (2%)
 Frame = +3

Query  363   TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  539
             +D+ L+ CG     +D D R W  D      L    +  S  D   PS+P  VP++TAR 
Sbjct  28    SDQFLMRCGATSSASDSDGRTWEGDANFGLALPGLSAKASYLD---PSLPSPVPYLTARI  84

Query  540   FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  719
             F S  TY+  V  GR FLRLYFYP +Y   +A +++FSV  G  +LL +F+  QT +A+ 
Sbjct  85    FTSNSTYTLGVDPGRMFLRLYFYPTTYAEHSAADALFSVTAGTSSLLNDFNPSQTAQAMG  144

Query  720   FDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNS  899
               +LV+E+S+NV    L+VTF+PSP    S AFVNGIE+V  PDI+       +  G   
Sbjct  145   HSYLVREYSLNVTSSELSVTFSPSPRHTGSYAFVNGIEIVPTPDIFTIPVPRFVNGGNPD  204

Query  900   PLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTI  1079
              + I +S AL+++YR+NVGG  IS   D+G +RSW+EDS+YI  +  GV    +  N+TI
Sbjct  205   LIPISSSIALQTMYRLNVGGATISGKYDSGFYRSWEEDSRYIHGSSNGVNFYKNS-NVTI  263

Query  1080  SYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIIT  1259
             SYP  MP Y+AP+ +Y+T RSMG +A +N  YNLTW  PVD+GF+YL+R HFCE    +T
Sbjct  264   SYPLSMPDYIAPIYIYETARSMGTDAHINMRYNLTWILPVDAGFYYLLRFHFCEIQYPMT  323

Query  1260  EINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +I +R F+IY+NNQTA    D I W+G  G+P
Sbjct  324   KIGQRQFVIYINNQTAVEQMDVIDWSGGIGIP  355



>gb|EMS57312.1| Receptor-like protein kinase FERONIA [Triticum urartu]
Length=839

 Score =   295 bits (754),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 158/329 (48%), Positives = 205/329 (62%), Gaps = 4/329 (1%)
 Frame = +3

Query  372   ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSV-PQVPFMTARTFQS  548
             ILLNCG      D   R W  D GS F   + K   + A  Q PS+ P+VP+ TAR F S
Sbjct  35    ILLNCGESTQDDDDGGRSWDGDTGSIFA-PSMKGDAAIALGQPPSLTPRVPYTTARIFTS  93

Query  549   EFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              +TYSFPV+ GR FLRLYF   +Y     +++VF V      LL +F+A QT +A+   +
Sbjct  94    NYTYSFPVSPGRMFLRLYFLSTAYEYYAVSDAVFGVMARNLVLLNDFNALQTAQAITSAY  153

Query  729   LVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPLN  908
             LV+EFSVNV   +L++TF PS +   S AFVNGIE+V  PD++ T D   +     SP  
Sbjct  154   LVREFSVNVSSGSLDLTFAPSAHQYGSYAFVNGIEIVPTPDVFATPDIRFVSGDNTSPFT  213

Query  909   IDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISYP  1088
              D   +L+++YR+NVGG  ISP  D+G +RSW  D+ YI   G G+T   +D N+TISY 
Sbjct  214   FDADMSLQTMYRLNVGGPAISPKGDSGFYRSWANDAPYIL-GGFGLTFWKND-NLTISYT  271

Query  1089  PGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEIN  1268
               +P Y APV+VY T RSMGP A +N NYNLTW  PVD+GFFYL+R HFCE    IT++N
Sbjct  272   SRVPNYTAPVDVYGTARSMGPTAQINLNYNLTWILPVDAGFFYLLRFHFCEIKYPITKVN  331

Query  1269  ERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +R F IY+NNQTA+   D I  +G  G P
Sbjct  332   QRSFFIYINNQTAQEQMDVIFRSGGIGRP  360



>ref|XP_010243447.1| PREDICTED: receptor-like protein kinase FERONIA [Nelumbo nucifera]
Length=825

 Score =   294 bits (752),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 159/340 (47%), Positives = 212/340 (62%), Gaps = 13/340 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTD-QDNRKWTTDVGSKFL-LGTGKSSTSSADSQKPSVPQVPFM  527
             YV T ++ ++CG    VT+  D R WT D G K+      + ST     Q  SVPQ+P+M
Sbjct  32    YVTTYQVFVDCGSHGEVTESHDGRNWTGDFGGKYKPYANIRGSTFVVSVQGISVPQIPYM  91

Query  528   TARTFQSEFTYSFP-VASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             TAR F+S  TY F  V++G KF+RLYFYPASY+ LN + + F V  G Y LL+NFSA  T
Sbjct  92    TARIFRSHLTYKFSDVSAGPKFIRLYFYPASYSNLNQSYAFFDVSAGPYILLRNFSASLT  151

Query  705   TEALNFDFLVKEFSVNVPGET-LNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGST-  878
                L+ D   KEF VN+  ++ L +TF+P+PN   +  FVNGIE++S PD +   D    
Sbjct  152   ANFLDTDRFFKEFVVNIERQSELIITFSPTPNIFETHGFVNGIEILSMPDNFYIRDEILP  211

Query  879   MIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETA  1058
               + QN     D   ALE +YR+NVGG  +SP  DTGM+R+W ED+ Y      GV    
Sbjct  212   YAIRQN-----DIPVALEMVYRLNVGGREVSPQDDTGMYRTWSEDTPYFHGGQPGVIPV-  265

Query  1059  DDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDS-GFFYLVRLHF  1235
              +  ++++Y P +P+Y AP  VY+T RSMG N S+N  Y+LTW FPVDS GF+YL RLHF
Sbjct  266   -NATISVTYTPSVPSYTAPESVYRTARSMGMNKSLNEKYDLTWSFPVDSSGFYYLFRLHF  324

Query  1236  CEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             CEF   IT+ +ER+F I++ NQTAE   D I W+G NG+P
Sbjct  325   CEFLHEITKRSERIFRIFIRNQTAEERVDIIEWSGGNGIP  364



>ref|XP_007032823.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03749.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=894

 Score =   295 bits (756),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 166/342 (49%), Positives = 210/342 (61%), Gaps = 13/342 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF---LLGTGKSSTSSADSQKPS-VPQVP  521
             Y+P + I ++CG P+  T  D R WT D   KF        +S  S A  Q PS V QVP
Sbjct  42    YIPIENITIDCGSPNDNTALDGRSWTRDNTPKFSPIESQNNQSVYSEAPQQPPSGVGQVP  101

Query  522   FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  701
             F+TAR  ++EF Y FP+ SG+KF+RLYFYP SY   +   + FSV  GE+TLLKNFSA  
Sbjct  102   FITARVSKAEFIYVFPLTSGQKFVRLYFYPTSYPPFDPLKAFFSVNTGEFTLLKNFSA--  159

Query  702   TTEALNFDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD--IYNTADG  872
             +  A   D L+KEF VNV  G+ LN+TF PSP+  +S AF+NGIE+VS P    Y  AD 
Sbjct  160   SLHAQGQDTLIKEFCVNVDEGQRLNLTFIPSPDISDSYAFINGIEIVSMPTNLYYRPADD  219

Query  873   STM-IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVT  1049
               +  +GQ +P ++ N TALE +YR+NVGG  ISP  DTGM+R W +D  Y+  A   V 
Sbjct  220   EGVKFLGQGNPFSMGNDTALELMYRINVGGTQISPELDTGMYRFWSDDDNYLTDAAPSVL  279

Query  1050  ETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRL  1229
                   N+  S     P++ AP  VY T R+MG N S N +Y LTW FPVDSGF Y VRL
Sbjct  280   PVNGSINLNFS---DKPSFSAPDVVYTTARTMGTNKSTNEHYKLTWEFPVDSGFNYFVRL  336

Query  1230  HFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             HFCEF   IT+  +RVF I++ N TAE  A+ I W+G  GVP
Sbjct  337   HFCEFQIEITKQGDRVFEIFIANLTAETQAEVILWSGGRGVP  378



>ref|XP_012067824.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=811

 Score =   293 bits (751),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 156/338 (46%), Positives = 210/338 (62%), Gaps = 6/338 (2%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQ-DNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMT  530
             Y P + + L+CG     T   D R WT D        T  ++TS   S  P VPQVP+ T
Sbjct  29    YEPLENVALDCGSSGLHTSSFDGRNWTNDATFISQSQTNSTATSIISSIDPGVPQVPYKT  88

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F SEFT +F +  G KFLRL+FYP SY G +A+ +  SV  G +TLL NFSA     
Sbjct  89    ARLFFSEFTCTFNLTPGHKFLRLHFYPTSYPGFDASKAFISVTGGNHTLLSNFSASLAAN  148

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTM-I  884
               N     KEF V+V   +L +TF+PS N+ ++ AFVNGIE+VS P ++Y   +   +  
Sbjct  149   YKNVYAFFKEFIVHVQNHSLRLTFSPSSNASDAFAFVNGIELVSMPLNLYIRGENVPLPF  208

Query  885   VGQ-NSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
             VG  N+P+ +D + ALE++YR+NVGG+ ISP SDTGMFR+W +D +Y+F A  G      
Sbjct  209   VGYPNNPIRLDTTYALETVYRINVGGDDISPKSDTGMFRTWIKDDQYLFGAAAGQVAFGS  268

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
             D  + + Y P +P Y AP  VY+T   M  +  +N N+ L+W+FPV++GF YLVRLHFCE
Sbjct  269   D--LQVKYTPMVPAYTAPDLVYRTACFMRSDNRINLNFYLSWFFPVETGFLYLVRLHFCE  326

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                 IT+IN++VF IY+NN+T E  AD IAW+G  GVP
Sbjct  327   LGWSITKINQKVFSIYMNNETVESQADVIAWSGGQGVP  364



>gb|EEE63231.1| hypothetical protein OsJ_18041 [Oryza sativa Japonica Group]
Length=798

 Score =   293 bits (749),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 149/316 (47%), Positives = 204/316 (65%), Gaps = 4/316 (1%)
 Frame = +3

Query  408   DQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSEFTYSFPVASGR  584
             D +NR W  D  SKF         +SA  Q PS+P  VP+MT+R F S +TYSFP++ GR
Sbjct  4     DINNRSWEGDTRSKFA-SAMNGIAASATYQDPSLPSLVPYMTSRIFISNYTYSFPISPGR  62

Query  585   KFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDFLVKEFSVNVPGE  764
              F+RLYFYP +Y    + ++ F V+     LL NF+A QT +A N+ ++++EFS+NV   
Sbjct  63    IFVRLYFYPVAYGYYASEDAYFGVKTNNLILLDNFNASQTAQAANYAYILREFSLNVTLG  122

Query  765   TLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPLNIDNSTALESIYR  944
             +L++TF PS  +  S AFVNGIE+V  PDI+ T   +    G   P +ID+ T+ +++YR
Sbjct  123   SLDLTFFPSTQN-GSYAFVNGIEIVPTPDIFTTRTPTHNTEGNLDPSDIDSMTSFQTMYR  181

Query  945   VNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISYPPGMPTYVAPVEV  1124
             +NVGG  I P  D+  +RSW++DS YI+ A  GVT    D N+TI+YP  MP Y AP +V
Sbjct  182   LNVGGQAIIPQGDSRFYRSWEDDSPYIYGAAFGVT-FGKDSNVTITYPGTMPNYTAPADV  240

Query  1125  YKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEINERVFIIYLNNQT  1304
             Y T RSMGPN  +N NYNLTW   VD+GF+YL+R HFCE    IT++N+R F IY+NNQT
Sbjct  241   YATARSMGPNWQINLNYNLTWILSVDAGFYYLLRFHFCEIQYPITKMNQRSFFIYINNQT  300

Query  1305  AEPGADAIAWAGKNGV  1352
              +   D I W+G  G+
Sbjct  301   VQDQMDVIRWSGGIGM  316



>ref|XP_009385155.1| PREDICTED: receptor-like protein kinase ANXUR2 [Musa acuminata 
subsp. malaccensis]
Length=852

 Score =   294 bits (752),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 168/340 (49%), Positives = 225/340 (66%), Gaps = 13/340 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMT  530
             Y+P+D ILLNCG     TD D RKW  D  SK  L +  S+ ++A  Q P++P  VP+M+
Sbjct  23    YLPSDSILLNCGFSSEATDADGRKWLADSTSKSSLTSKNSAPATALYQDPALPSTVPYMS  82

Query  531   ARTFQSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQT  704
             AR F SE TY F V  S R ++RL+FYP++YNGL   NS FSV   +  TLLKNFSA  T
Sbjct  83    ARVFNSESTYKFAVNGSERHWVRLHFYPSAYNGLPPENSFFSVSTSDGITLLKNFSAYIT  142

Query  705   TEALNFDFLVKEFSVNVP--GETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGST  878
              +AL   ++VKEFSV +P    ++++TFTPS +  +S AFVNGIE+VS PDIY+      
Sbjct  143   AKALTQAYIVKEFSV-LPTSAGSISLTFTPSADHNSSFAFVNGIEIVSMPDIYSEP---A  198

Query  879   MIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETA  1058
              +VG +       S+AL ++YR+NVGG  +  S+D+G+ R+W +DS YI+ AG G+T +A
Sbjct  199   ELVGFSDQAVEVGSSALLTMYRLNVGGQYLPASNDSGLSRTWYDDSPYIYGAGFGITTSA  258

Query  1059  DDYNMTISYPP-GMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHF  1235
              +  + ISYP  G     AP +VY+T RSMGP+  VN NYNLTW F VD+ F Y+VRLHF
Sbjct  259   SN-KLKISYPEEGTAESAAPTDVYRTARSMGPDPKVNMNYNLTWIFQVDANFTYVVRLHF  317

Query  1236  CEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             CE    +T++N+RVF I++NNQTA+  AD IAWA    VP
Sbjct  318   CELQ--MTKVNQRVFDIFVNNQTAQAQADVIAWASSKAVP  355



>dbj|BAJ88190.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96628.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=825

 Score =   293 bits (750),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 161/333 (48%), Positives = 205/333 (62%), Gaps = 13/333 (4%)
 Frame = +3

Query  372   ILLNCGGPDGVTDQDN--RKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTARTF  542
             ILLNCGG +   D D+  R W  D  SKF    G  + +SA  + PS+P  VP+MTAR F
Sbjct  33    ILLNCGGSNQYDDDDSGGRTWDGDTTSKFTPSVGGVA-ASATYRDPSLPSMVPYMTARIF  91

Query  543   QSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNF  722
              S  TYSFP+  GR FLRLYFYPA+Y     +++ F+V  G   LL +F+A Q   A N+
Sbjct  92    TSNSTYSFPITPGRMFLRLYFYPAAYGNYAVSDASFAVTAGNLVLLNSFNASQAAMATNY  151

Query  723   DFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIY----NTADGSTMIVG  890
               LV EFSV V   +L++TF PS    +S AFVNGIE+V  PD++       +G  +   
Sbjct  152   VCLVLEFSVYVSSSSLDLTFAPSAYLNSSYAFVNGIEIVHTPDMFIADTRFVNGDHIDYA  211

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
                P +I     L+++YR NVGG  ISP  D+G +RSWD+DS YIF AG GVT + D  +
Sbjct  212   FQLPADI----GLQTMYRFNVGGQAISPKDDSGFYRSWDDDSPYIFGAGYGVTYSRDS-S  266

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +TI Y P +P Y AP +VY T RSMGP+A +N NYNLTW  PVD GF YL+R HFCE   
Sbjct  267   VTIMYTPAVPNYTAPFDVYGTARSMGPDAQINLNYNLTWILPVDVGFSYLIRFHFCEIQY  326

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
              IT +N+R F IY+NNQT E   D I  +G  G
Sbjct  327   PITMVNQRTFNIYINNQTVEQDMDVIFRSGGIG  359



>ref|XP_007032799.1| Malectin/receptor protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY03725.1| Malectin/receptor protein kinase family protein, putative [Theobroma 
cacao]
Length=888

 Score =   295 bits (754),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 164/347 (47%), Positives = 212/347 (61%), Gaps = 21/347 (6%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTS------SADSQKPSVPQ  515
             YVPTD I LNCG        D R W  D  SKF  G  +SS +       AD+Q  SV  
Sbjct  30    YVPTDNITLNCGALSDSHGSDGRFWAGDKSSKF--GPVESSRTIPSAPYEADNQGGSVET  87

Query  516   VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  695
             VP+MTAR   SEF YSFPV+ G+KF+RL+FYPASY   + + + FSV+ G +TLLKNFSA
Sbjct  88    VPYMTARVSSSEFKYSFPVSPGQKFVRLHFYPASYKKFDRSKAFFSVKAGSFTLLKNFSA  147

Query  696   GQTTEALNFDFLVKEFSVNVP-GETLNVTFTPSPNSPN-SLAFVNGIEVVSHP-DIY---  857
                 E+ N     +EF +NV   + L + FTP+P+S N + AF+NGIE+VS P ++Y   
Sbjct  148   FLVAESSNVKSFFREFCLNVEENQVLELIFTPTPSSSNDTYAFINGIEIVSMPSNLYYTP  207

Query  858   -NTADGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSA  1034
              ++ DG+  I GQ +   +DN TALE++YR+NVGG  IS + DTGMFR W +D  YI S 
Sbjct  208   SDSLDGARFI-GQKNGFYVDNYTALETVYRLNVGGKSISQTEDTGMFRLWSDDYDYILSE  266

Query  1035  GTGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFF  1214
                   T      T+     +P Y AP EVY+T R+MGPN   N  +N+TW  PVDSGF 
Sbjct  267   SYFTVNTTVPLKYTM-----IPKYTAPEEVYQTARTMGPNGDYNRKHNITWGLPVDSGFR  321

Query  1215  YLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             Y+VRLHFCEF  +I+    R F I++NNQTAE   D I W  ++ VP
Sbjct  322   YMVRLHFCEFQDVISSAGIRQFEIFINNQTAEAFFDVIIWTQQSNVP  368



>ref|XP_011009253.1| PREDICTED: receptor-like protein kinase FERONIA [Populus euphratica]
Length=833

 Score =   293 bits (750),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 161/340 (47%), Positives = 206/340 (61%), Gaps = 12/340 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGT--GKSSTSSADSQKPSVPQVPFM  527
             Y PTD+ILLNCG    +T  D R W  D  SKF        SS  +A +Q PS  QVP+M
Sbjct  45    YSPTDQILLNCGASSNLTSPDGRSWDGDSQSKFAASNPPEASSVFAASTQGPSGDQVPYM  104

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR F S+FTY+FPV  G KF+RLYFY ASY+ L+ + S FS+    Y LL NFSA  T 
Sbjct  105   TARIFHSKFTYTFPVLPGPKFVRLYFYRASYSNLDISTSYFSLSANNYKLLDNFSASLTV  164

Query  708   EAL--NFDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNTADGS  875
              A     D   KEF + V   + L +TF PSP S    AF+NGIE+VS PD  Y   + +
Sbjct  165   SATIPPVDSFTKEFIITVWDKQKLELTFAPSPAS---FAFINGIEIVSMPDSFYARGNDN  221

Query  876   TMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTET  1055
             ++     +P ++ N+TALE+IYR+NVGG  IS + DTGM+R+W +D +Y+          
Sbjct  222   SLTYVGTAPFSLYNTTALETIYRLNVGGQDISSTRDTGMYRTWHQDLEYLIGQSGNTPYL  281

Query  1056  ADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHF  1235
                  + I Y    P Y APV VY T+RSMGP   +N NYNLTW FPVD+GF YL+RLHF
Sbjct  282   P---GVKIKYTTKTPAYSAPVMVYSTMRSMGPEPRLNMNYNLTWIFPVDAGFLYLLRLHF  338

Query  1236  CEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             CE        N++VF+I++NNQTA   AD I  +G NG+P
Sbjct  339   CETRMEFKNENQQVFLIFINNQTAAYDADVIHMSGGNGIP  378



>ref|XP_008364006.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Malus domestica]
Length=747

 Score =   291 bits (746),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/215 (65%), Positives = 166/215 (77%), Gaps = 1/215 (0%)
 Frame = +3

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
              L++ F+ KEF VNV GETL V+FTPS    N+ AFVNGIE+VS PDIY+  DG+TMIVG
Sbjct  2     GLDYVFITKEFIVNVEGETLAVSFTPSSRVANAFAFVNGIEIVSMPDIYSATDGTTMIVG  61

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q++P  IDNSTALE++YR+NVGGN ISP  DTG+FRSW +D++Y+  A  G  ET D  N
Sbjct  62    QSTPFYIDNSTALENVYRINVGGNDISPPKDTGLFRSWYDDTQYLLGAAYGAPETTDP-N  120

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             MTISYP GMPTY+AP +VY T RSMGP+  +N NYNLTW F +DSGF YLVRLHFCE   
Sbjct  121   MTISYPSGMPTYIAPEDVYSTARSMGPDQRINLNYNLTWIFSIDSGFSYLVRLHFCEVAQ  180

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT+IN+RVF I+LN QTA  GAD IAWAG NG+P
Sbjct  181   NITKINQRVFDIFLNKQTAMAGADVIAWAGGNGIP  215



>gb|AAV44117.1| unknown protein [Oryza sativa Japonica Group]
 gb|EEE63236.1| hypothetical protein OsJ_18046 [Oryza sativa Japonica Group]
Length=564

 Score =   287 bits (734),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/329 (47%), Positives = 200/329 (61%), Gaps = 5/329 (2%)
 Frame = +3

Query  369   KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTARTFQS  548
             +I L CGG     D D R W  D  SK  L    ++ S  D   PS   VP+MTAR F S
Sbjct  33    QIRLRCGGTSTAIDSDGRTWEGDANSKLALDGLAANASYLDPLLPS--PVPYMTARIFSS  90

Query  549   EFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              FTY F +  GR FLRLYFYP  Y    A +++FSV  G   LL +F+  Q   A+   +
Sbjct  91    NFTYWFGLNPGRVFLRLYFYPTEYADRAAADALFSVTAGILVLLNDFNPSQVAHAMGRTY  150

Query  729   LVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPLN  908
             L+ E+SVNVP   L+VTF+ SP+   S AFVNGIEVVS PDI+     + + VG + P  
Sbjct  151   LILEYSVNVPSGDLDVTFSLSPHHTGSYAFVNGIEVVSTPDIFTKPAPTFLNVGISDPFP  210

Query  909   IDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISYP  1088
             I  +  L+++YR+NVGG  ISP  D+   R+W +DS YI S  +G+    DD  +TISYP
Sbjct  211   ISVNIGLQTMYRLNVGGETISPKDDSEFCRTWGKDSPYI-SGDSGLNFFKDD-TVTISYP  268

Query  1089  PGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEIN  1268
               MP+Y+APV +Y+T RSMG    +N  YNLTW  P+D+GF YL+RLHFCE    IT+ N
Sbjct  269   RTMPSYIAPVGLYETARSMGLKGYINLRYNLTWILPIDAGFHYLLRLHFCEIQHPITKAN  328

Query  1269  ERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +R F +Y+NNQTA+   D I  +G  GVP
Sbjct  329   QRTFFVYINNQTAQK-MDVIVLSGGIGVP  356



>gb|KJB42940.1| hypothetical protein B456_007G175600 [Gossypium raimondii]
Length=891

 Score =   293 bits (751),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 164/343 (48%), Positives = 212/343 (62%), Gaps = 14/343 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDG--VTDQDNRKWTTDVGSKFLLGTGKSSTSS--ADSQKPSVPQVP  521
             Y PTD ILL+CG P    +  +D RKW TD  SKF     ++++S+  A  Q  SV +VP
Sbjct  23    YTPTDYILLDCGAPSSSSLVSEDGRKWITDERSKFATSNSENASSNFRATRQDHSVTRVP  82

Query  522   FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA--  695
             +MTAR F  +FTYSFPV++G KFLR YFYP   +G +   S FSV    + LLKNFSA  
Sbjct  83    YMTARVFHDKFTYSFPVSAGLKFLRFYFYPVQDSGFDGATSFFSVTANNHLLLKNFSAYL  142

Query  696   GQTTEALNFDFLVKEFSVNVPG-ETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIY-NTA  866
               + E      L+KEF V   G E L VTF+PSPNS   LAFVNGIEVVS P ++Y    
Sbjct  143   ALSAEDGQPASLIKEFMVPCFGTEKLIVTFSPSPNS---LAFVNGIEVVSMPKELYVKHQ  199

Query  867   DGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGV  1046
             + S   V    P +I ++TA E++YR+NVGG  +   +DTGMFR+W +DS +IF A  G 
Sbjct  200   EDSVSFVNSKIPFDIPDATAFETVYRLNVGGGAVENVNDTGMFRTWRDDSPHIFGAALGN  259

Query  1047  TETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVR  1226
               +    N+ I+Y    P Y AP  VY T R+MG    +N NYNLTW F +D GF YL+R
Sbjct  260   VPSRS--NVRINYTNDTPAYTAPAIVYTTSRTMGREPHINENYNLTWNFQIDGGFRYLLR  317

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             LHFCE    +T+  +RVF I++NNQTA+  AD I W+G N +P
Sbjct  318   LHFCETQLEVTKAGQRVFNIFINNQTAQHDADVIYWSGGNNIP  360



>ref|XP_012084350.1| PREDICTED: receptor-like protein kinase FERONIA, partial [Jatropha 
curcas]
Length=1088

 Score =   296 bits (758),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 213/345 (62%), Gaps = 16/345 (5%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVG--SKFL-LGTGKSSTSSADSQKPSVPQVPF  524
             Y PTD+ILLN G PDG    D R W +D    SK+  + +  S+ S A  Q PSV QVP+
Sbjct  27    YTPTDRILLNSGAPDGEQSMDGRNWESDADQQSKYCPMNSETSAASKASQQDPSVTQVPY  86

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR  +S++T  FPV+ G KF+RLYFYP SY+GL+ + S FSV    YTLL NFSA  T
Sbjct  87    MTARIIRSKYTCMFPVSMGPKFIRLYFYPNSYSGLDTSTSFFSVTANGYTLLSNFSAHLT  146

Query  705   TEALN--FDFLVKEFSVNVPGE--TLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADG  872
               A+     +LVKEF + V      +N+TFT    SPNS AF+NGIE+VS P    T D 
Sbjct  147   VSAMQPPVAYLVKEFIITVRDNQGVINLTFT---QSPNSFAFINGIEIVSMPTNLYTKDN  203

Query  873   ST---MIVGQNSPLN-IDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGT  1040
              +    +   N P    DN+T+LE++YR+N+GG  I   +DTG+FR+W  D  +IF  G 
Sbjct  204   DSPYSFVNDNNVPFYYFDNTTSLETVYRLNIGGPNIENVNDTGIFRTWSNDLLHIF-GGL  262

Query  1041  GVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYL  1220
             G      D ++T+ Y    PTYVAP  VY T R+MG N+ VN N NLTW F VDSGF YL
Sbjct  263   GYVHLWRD-DVTVKYSKDTPTYVAPEAVYITKRTMGANSVVNQNSNLTWLFLVDSGFNYL  321

Query  1221  VRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +RLHFCE    IT   +RVF I++NN TAE  AD I W+G N +P
Sbjct  322   LRLHFCETEKEITHEGQRVFSIFINNMTAEAEADVIHWSGGNSIP  366



>ref|XP_006842554.1| PREDICTED: receptor-like protein kinase FERONIA [Amborella trichopoda]
 ref|XP_011622684.1| PREDICTED: receptor-like protein kinase FERONIA [Amborella trichopoda]
 ref|XP_011622685.1| PREDICTED: receptor-like protein kinase FERONIA [Amborella trichopoda]
 gb|ERN04229.1| hypothetical protein AMTR_s00077p00138840 [Amborella trichopoda]
Length=899

 Score =   293 bits (751),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 152/335 (45%), Positives = 213/335 (64%), Gaps = 3/335 (1%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMT  530
             ++P D ILL+CG      D DNR WT D  S+F   +  +    A +Q  S+P + P+MT
Sbjct  38    FIPKDVILLDCGTDSDSNDADNRHWTGDANSRFAPASQNTLPVQASNQDTSLPSKTPYMT  97

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             AR F S FTY+FPV  GR ++RLYFYP+ Y   N+T ++FSV  G ++LL NFSA     
Sbjct  98    ARIFNSNFTYTFPVTPGRHWVRLYFYPSDYKPHNSTAALFSVTSGPFSLLHNFSASAAAL  157

Query  711   ALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG  890
             + N  ++++EFS+N    +LN+TF+   +   S AF+NGIE+ S P    +     +   
Sbjct  158   SGNLAYIIREFSLNATDTSLNLTFSRMLDVSGSYAFINGIEIFSMPVDLLSVVAPFITTP  217

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
             Q+ P+      +L+++YR+NVGG  ISP+ D+ + R W +D+ YI+ A  GVT   D  N
Sbjct  218   QSLPV-ASPFDSLQTMYRLNVGGQYISPNQDSNLSRIWYDDTPYIYGAAYGVTFDKDP-N  275

Query  1071  MTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTT  1250
             +TI+Y    P Y+APV+VY + R+MGP   VN N+NLTW FPVD GF+Y+VRLHFCE  +
Sbjct  276   VTINYTSITPAYIAPVDVYASARAMGPIWEVNLNFNLTWIFPVDPGFYYVVRLHFCEIQS  335

Query  1251  IITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              IT +N+RVF I+LNNQTAE  AD IAW+   G+P
Sbjct  336   EITVVNQRVFEIFLNNQTAEKMADVIAWSHGLGIP  370



>gb|ERN06449.1| hypothetical protein AMTR_s00016p00259140 [Amborella trichopoda]
Length=856

 Score =   292 bits (748),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 157/338 (46%), Positives = 216/338 (64%), Gaps = 32/338 (9%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPDGVTDQDNRKWTTDV-GSKFLLGTGKSSTSSADSQKPSVPQ-VPF  524
             +Y P+D IL+NCG      D D R W  DV GS++ L +  +  + A++Q PS+P  +P+
Sbjct  35    NYAPSDAILVNCGSSSDGVDADGRSWKGDVHGSRYTLDSENTVPARAETQDPSLPSTIPY  94

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRV-GEYTLLKNFSAGQ  701
             M+AR F S  TY F V  GR ++RL+FYP+SY+GL+  +++FSV   G + LL+NFSA  
Sbjct  95    MSARIFSSRSTYEFSVTPGRHWVRLHFYPSSYSGLSPDDALFSVEASGGFMLLRNFSASI  154

Query  702   TTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTM  881
             T  AL   ++++EFSVNV G++L++TF PS    ++ AFVNGIE+VS PDIY +      
Sbjct  155   TATALTQAYIIREFSVNVTGKSLSLTFEPSVKHRSAYAFVNGIEIVSMPDIYVS------  208

Query  882   IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
                         S+ L S+Y        I+  +DTGM R+W +D+ YI+ AG GVT +AD
Sbjct  209   ------------SSELPSLY--------IAAGNDTGMSRTWYDDTPYIYGAGVGVTYSAD  248

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
               ++ I Y   +P Y APV+VY T RSMGP++ VN N NLTW F VDS F Y+VRLHFCE
Sbjct  249   P-DVKIRYLDSIPEYTAPVDVYSTARSMGPDSRVNVNTNLTWVFQVDSNFTYIVRLHFCE  307

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                 +T+IN+RVF I+LNN+TAE  AD +AWA    VP
Sbjct  308   LQ--LTKINQRVFDIFLNNKTAEGAADVLAWAESRAVP  343



>ref|XP_004962464.1| PREDICTED: receptor-like protein kinase FERONIA-like isoform 
X1 [Setaria italica]
 ref|XP_004962465.1| PREDICTED: receptor-like protein kinase FERONIA-like isoform 
X2 [Setaria italica]
Length=911

 Score =   293 bits (749),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 158/342 (46%), Positives = 210/342 (61%), Gaps = 10/342 (3%)
 Frame = +3

Query  351   DYVPTDKILLNCGGPD-GVTDQDNRKWTTDVGSKFLLGTGKSSTSS-ADSQKPSVPQV-P  521
             D   + +I L CG P   V D  NR W +D+ SKF     +SS  + A    P +P   P
Sbjct  29    DSTDSGQIRLCCGNPSPMVADAINRAWYSDMNSKFAPSLLESSVDAYAWYPDPGLPSAAP  88

Query  522   FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATN------SVFSVRVGEYTLLK  683
             ++TAR F S +TYSF V+SGR FLRLYF+P +Y   +++       + F V     TLL 
Sbjct  89    YITARIFTSNYTYSFRVSSGRMFLRLYFFPITYVSQDSSENFTPEYAYFGVTASNLTLLD  148

Query  684   NFSAGQTTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNT  863
             NF+A QT  A N  F V E+SVNV    L++TF+PS +   S AF+N IE+V  PD++ T
Sbjct  149   NFNASQTALATNSGFFVLEYSVNVIAGRLDLTFSPSTHQTGSYAFINYIEIVPTPDLFTT  208

Query  864   ADGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTG  1043
                +    G  +P  ID +T  +++YR+NVGG  ISP  D   +R WD+DS YI+ +G G
Sbjct  209   TTPTLANGGNPNPFPIDPATGFQTMYRLNVGGQAISPQGDIDFYRQWDDDSPYIYDSGFG  268

Query  1044  VTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLV  1223
             V+    D N++I+Y P +P Y APV VY++ RSMGPNA VN NYNLTW  PVD+GF+YL+
Sbjct  269   VS-FGKDKNLSITYTPSVPNYTAPVGVYESARSMGPNAQVNLNYNLTWILPVDAGFYYLL  327

Query  1224  RLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
             R HFCE     TE+N R F IY+NNQTA+   D IAW+G  G
Sbjct  328   RFHFCEIQYPKTEVNRRSFFIYINNQTAQQQMDVIAWSGGIG  369



>emb|CBI21198.3| unnamed protein product [Vitis vinifera]
Length=932

 Score =   293 bits (750),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 157/342 (46%), Positives = 214/342 (63%), Gaps = 13/342 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKF-LLGTGKSST-SSADSQKPSVPQVPFM  527
             Y PTD   ++CG    +   DNR W  D  S+F L+   K+S  S A    PSV  VPF 
Sbjct  61    YNPTDIYTVDCGASGNLKAWDNRIWIGDTNSRFSLIEKNKASIISKAAKTSPSVDPVPFA  120

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTT  707
             TAR  + +F Y FPV +G+KF+RL+FYP+S  G + + + FSV++G YTLL NFSA    
Sbjct  121   TARLSRFQFAYIFPVTTGQKFIRLHFYPSSVAGFDRSKAFFSVKIGGYTLLNNFSAALAA  180

Query  708   EALNFDFLVKEFSVNVP--GETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNTA--DG  872
             +A   + + KEF VNV    + LN+TFTP+ + P++ AF+NGIE+VS PD +Y T+  +G
Sbjct  181   DAHGDETVSKEFCVNVKQGDQMLNITFTPTASDPDAYAFINGIEIVSMPDYLYYTSPQNG  240

Query  873   STMIVGQ-NSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVT  1049
                 +GQ N+   ++   ALE++YR+NVGG  +SP+ DTGMFR+WD D +Y         
Sbjct  241   GIQFIGQKNNSFFVETDHALENVYRLNVGGKSLSPTDDTGMFRTWDADDEYCVKLAFVPA  300

Query  1050  ETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRL  1229
              T+ +   T      +P Y AP++VY+T R+MG N + N  YNLTW+ PVDSGF YL+RL
Sbjct  301   NTSINLKFT-----QIPNYTAPLDVYRTARTMGNNKTENMGYNLTWFLPVDSGFSYLLRL  355

Query  1230  HFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             HFCEF   I E ++R F I + NQTAE  AD I W+  NGVP
Sbjct  356   HFCEFQPEIQEQHDREFAIIIANQTAENHADVITWSTGNGVP  397



>ref|XP_006358215.1| PREDICTED: receptor-like protein kinase ANXUR1-like [Solanum 
tuberosum]
Length=854

 Score =   291 bits (746),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 153/331 (46%), Positives = 220/331 (66%), Gaps = 13/331 (4%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPS-VPQVPFMTARTFQSE  551
             +L+CG     TD D R W+ D  + F   +G S TS A  Q PS +  +P+MTAR F+++
Sbjct  33    VLSCGATSNATDADGRIWSPD-STYFPSSSGNSITSKAKYQDPSLISDIPYMTARIFKNQ  91

Query  552   FTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              TYSFPV+   R ++RL+FYP+SY+  N +NS FSV +  +TLL NFSA  T +AL   +
Sbjct  92    TTYSFPVSPKSRHWIRLHFYPSSYDNFNCSNSFFSVNIAGFTLLNNFSASITAQALTQAY  151

Query  729   LVKEFSVNVPGET--LNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSP  902
             +++EF++ VP +T  LN+TFTPS    +S AF+NGIE+VS P+I+  A     +VG +  
Sbjct  152   IIREFTL-VPLQTATLNITFTPSSAYNDSFAFINGIEIVSMPEIFEPAP----MVGFSDQ  206

Query  903   LNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTIS  1082
                  ++++++++R+NVGG  I  ++D+G+ R W +D+ Y+F A  G+T  A++ +M IS
Sbjct  207   TTETQASSMQTMFRLNVGGQYIPANNDSGLGRIWYDDAPYLFGASFGITSAANN-SMKIS  265

Query  1083  YPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITE  1262
             YP  +P Y+AP +VY+T RSMGPN  VN NYNLTW F VD+ F YLVRLHFC+F   +  
Sbjct  266   YPSNLPNYIAPEDVYRTARSMGPNPDVNRNYNLTWIFQVDTNFTYLVRLHFCDFQ--MKR  323

Query  1263  INERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +N+RVF I+LNNQTA   AD I W+    VP
Sbjct  324   MNQRVFKIFLNNQTALEEADVIGWSSAQNVP  354



>ref|XP_012088048.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
 gb|KDP24278.1| hypothetical protein JCGZ_25574 [Jatropha curcas]
Length=845

 Score =   291 bits (745),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 166/343 (48%), Positives = 208/343 (61%), Gaps = 14/343 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVG--SKFL-LGTGKSSTSSADSQKPSVPQVPF  524
             Y PTD ILLN G P G    D RKW +D    SK+  + +  SS S A  Q PSV  VP+
Sbjct  27    YTPTDLILLNSGAPYGKQSMDGRKWESDADKQSKYCPVNSETSSASKASQQDPSVTPVPY  86

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR  +S++T  FPV+ G  F+RLYFYP +Y+GL+ + S FSV   +YTLL NFS+  T
Sbjct  87    MTARIIRSKYTCMFPVSVGPNFIRLYFYPTTYSGLDTSTSFFSVTANDYTLLSNFSSYLT  146

Query  705   TEALN--FDFLVKEFSVNV--PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADG  872
               A+     + VKEF + V      +N+TFTPSPNS    AF+NGIE+VS P    T D 
Sbjct  147   ASAMQPRVVYFVKEFIITVWDNQAIINLTFTPSPNS---FAFINGIEIVSMPTNLYTKDN  203

Query  873   STM--IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGV  1046
                   V  N+  N DN+TALE++ R+NVGG  I   +DTG+FR W +DS YIF     V
Sbjct  204   DYAYPFVNANTIFNFDNTTALETVCRLNVGGGDIENVNDTGIFRRWSDDSLYIFGGPGNV  263

Query  1047  TETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVR  1226
                  D  +T+ Y    P YVAP  VY T R+M  N+ VN N NLTW+F VDSGF YL+R
Sbjct  264   HAWRGD--VTVKYSKDTPAYVAPEAVYITKRTMSANSVVNQNSNLTWHFLVDSGFNYLLR  321

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             LHFCE    IT   +RVF I++NN TAE  AD I W+G N +P
Sbjct  322   LHFCETEKEITHKGQRVFSIFINNMTAEAQADVIHWSGGNSIP  364



>emb|CDP15786.1| unnamed protein product [Coffea canephora]
Length=517

 Score =   283 bits (724),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 167/348 (48%), Positives = 211/348 (61%), Gaps = 23/348 (7%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG--TGKSSTSSADSQKPSVPQVPFM  527
             Y PTD IL+NCG     T  D R W  DVGSKFL       S   +A  Q  SV Q+PF+
Sbjct  26    YTPTDYILINCGSSSNATSTDGRHWEGDVGSKFLPNDVANISLADTATEQHSSVTQIPFL  85

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             TAR  +S+F+Y+FPV+ G KFLRLYFYP+SY +GLN + S F+V    YTLL NF+A   
Sbjct  86    TARIIRSQFSYTFPVSPGEKFLRLYFYPSSYSSGLNTSESFFTVTANNYTLLSNFNAFLI  145

Query  705   TEALNF--DFLVKEFSVNVPG--ETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIY----  857
               A  F    L+KEF +NV G  + L V F P   S NS AFVNGIEVVS P D+Y    
Sbjct  146   VSAKKFAPASLIKEFIINVQGMNQFLKVNFLP---SMNSYAFVNGIEVVSTPDDLYMGNH  202

Query  858   -NTADGSTMIVGQNSPLNID-NSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFS  1031
                A+    +   N     D N TA E++YR+NVGGN +SP  D+GMFR W  D K+I+ 
Sbjct  203   DMYANPLKFVNCPNVQFEFDQNKTAFEALYRLNVGGNDVSPVYDSGMFREWASDDKFIWG  262

Query  1032  AGTGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGF  1211
                G   + ++  + I Y P  P Y AP  VY T R+MG     + ++NL+W FPVDSGF
Sbjct  263   GDRGNPLSNNE--IAIKYTPQTPNYAAPPIVYATARAMG---QFSTSFNLSWIFPVDSGF  317

Query  1212  FYLVRLHFCEFT-TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
              YL+RLHFCE    +IT+ N+RVF I++NN+TAEP AD I WA   G+
Sbjct  318   LYLLRLHFCEINPDLITKENQRVFTIFINNRTAEPEADIIYWAHDPGI  365



>ref|XP_004296245.1| PREDICTED: receptor-like protein kinase ANXUR1 [Fragaria vesca 
subsp. vesca]
Length=860

 Score =   291 bits (744),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 163/332 (49%), Positives = 229/332 (69%), Gaps = 17/332 (5%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTARTFQSE  551
             +L+CG   G TD D RKW++D  S+F+  +G S+T+ A  Q PS+P ++P+M+AR F S 
Sbjct  33    ILSCGSSKGGTDSDGRKWSSD--SQFI--SGNSTTAKAQYQDPSLPSEIPYMSARIFSSS  88

Query  552   FTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              ++ F V+   R +LRL+FYP+SYN L+ +NS F V    +TLLKNFSA  T +AL   +
Sbjct  89    CSFKFSVSPKQRHWLRLHFYPSSYNNLDKSNSYFDVTANGFTLLKNFSASITAQALTQAY  148

Query  729   LVKEFSVNVPGET--LNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSP  902
             +VKEFS+ +P E+  LN+TFTPS +  NS AFVNGIEV+  P+++ TA+    +VG N  
Sbjct  149   IVKEFSL-IPIESGNLNITFTPSSSHNNSYAFVNGIEVIPMPELFQTAN----LVGFNDK  203

Query  903   LNIDNSTALESIYRVNVGGNVISPSSDT-GMFRSWDEDSKYIFSAGTGVTETADDYNMTI  1079
                  S+ L++++R+NVGG  + P++D+ G+ R+W +DS Y+F A  GVT  A+  N+TI
Sbjct  204   TIDVQSSTLQTMFRLNVGGQYVGPANDSAGLSRTWYDDSPYLFGAAFGVTSQAEK-NVTI  262

Query  1080  SYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIIT  1259
              Y   +    APV+VYKT RSMGP++ VN+NYNLTW F VD+ F Y+VR HFCE    +T
Sbjct  263   QYSKNVSDSFAPVDVYKTARSMGPDSKVNSNYNLTWVFQVDANFTYVVRFHFCEL--YLT  320

Query  1260  EINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             ++N+RVF IY+NNQTA+  AD I WAGK GVP
Sbjct  321   KVNQRVFDIYVNNQTAQQDADVIIWAGKIGVP  352



>ref|XP_003614249.1| Kinase-like protein [Medicago truncatula]
 gb|AES97207.1| feronia receptor-like kinase [Medicago truncatula]
Length=833

 Score =   290 bits (741),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 164/343 (48%), Positives = 213/343 (62%), Gaps = 14/343 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGG-PDGVTDQDNRKWTTDVGSKFLLG----TGKSSTSSA-DSQKPSVPQ  515
             YVP++ I+LNCG     +   D R W  D+ S ++        KS T+ A  S   S+P+
Sbjct  28    YVPSENIVLNCGSNTSELVQYDGRIWNGDIDSPYVPSYEDIINKSLTAKALSSNLESIPE  87

Query  516   VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  695
             VP+MTAR FQS+FTY F V SG KF+RL+FYP SY   N + +  SV  G +TLL NFS 
Sbjct  88    VPYMTARIFQSQFTYRFNVTSGPKFIRLHFYPFSYLDFNISKAFLSVTAGNFTLLHNFSV  147

Query  696   GQTTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNTADG  872
                 +  N  +L+KEF V+V G +L +TFTPS N  ++ AFVNGIEVVS P+ +Y   D 
Sbjct  148   SLNVDYFNLAYLMKEFIVHVKGNSLELTFTPSSNDSDAYAFVNGIEVVSIPNGLYIGGDD  207

Query  873   STM-IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVT  1049
             S +   G ++ + I N +A+E++YR+NVGG  I P  DTGMFR+WD D  YIF    G  
Sbjct  208   SPIPFAGHDTIVYIYNDSAMETLYRLNVGGEQILPKYDTGMFRNWDIDDGYIFG---GYD  264

Query  1050  ETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNAS--VNANYNLTWYFPVDSGFFYLV  1223
                 + +M + Y   +P Y AP +VY+T RSM P  +  VN NYNLTW+F VDSGF YL+
Sbjct  265   FKHFNKSMKVLYTDHVPEYTAPDDVYRTSRSMAPYWAGFVNLNYNLTWFFEVDSGFLYLI  324

Query  1224  RLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
             RLHFCE T  IT +NE VF ++LNNQTAE   D  A  G  GV
Sbjct  325   RLHFCEVTYAITRVNEVVFSVFLNNQTAEE-LDPFAIGGGPGV  366



>gb|EAY97520.1| hypothetical protein OsI_19448 [Oryza sativa Indica Group]
Length=780

 Score =   287 bits (735),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 154/329 (47%), Positives = 200/329 (61%), Gaps = 5/329 (2%)
 Frame = +3

Query  369   KILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQVPFMTARTFQS  548
             +I L CGG     D D R W  D  SK  L    ++ S  D   PS   VP+MTAR F S
Sbjct  33    QIRLRCGGTSTAIDSDGRTWEGDANSKLALDGLAANASYLDPLLPS--PVPYMTARIFSS  90

Query  549   EFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              FTY F +  GR FLRLYFYP  Y    A +++FSV  G   LL +F+  Q   A+   +
Sbjct  91    NFTYWFGLNPGRVFLRLYFYPTEYADRAAADALFSVTAGILVLLNDFNPSQVAHAMGRTY  150

Query  729   LVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPLN  908
             L+ E+SVNVP   L+VTF+ SP+   S AFVNGIEVVS PDI+     + + VG + P  
Sbjct  151   LILEYSVNVPSGDLDVTFSLSPHHTGSYAFVNGIEVVSTPDIFTKPAPTFLNVGISDPFP  210

Query  909   IDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISYP  1088
             I  +  L+++YR+NVGG  ISP  D+   R+W +DS YI S  +G+    DD  +TISYP
Sbjct  211   ISVNIGLQTMYRLNVGGETISPKDDSEFCRTWGKDSPYI-SGDSGLNFFKDD-TVTISYP  268

Query  1089  PGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEIN  1268
               MP+Y+APV +Y+T RSMG    +N  YNLTW  P+D+GF YL+RLHFCE    IT+ N
Sbjct  269   RTMPSYIAPVGLYETARSMGLKGYINLRYNLTWILPIDAGFHYLLRLHFCEIQHPITKAN  328

Query  1269  ERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +R F +Y+NNQTA+   D I  +G  GVP
Sbjct  329   QRTFFVYINNQTAQK-MDVIVLSGGIGVP  356



>ref|XP_002271113.1| PREDICTED: receptor-like protein kinase ANXUR1 [Vitis vinifera]
Length=857

 Score =   288 bits (737),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 155/336 (46%), Positives = 223/336 (66%), Gaps = 14/336 (4%)
 Frame = +3

Query  357   VPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTA  533
             V  D ++L+CG   G TD D RKW +D  S +L+ + +S +++A SQ PS+P  VP+M+A
Sbjct  25    VSADSLILSCGSASGGTDADGRKWVSD--SAYLV-SDESISATAQSQDPSLPSPVPYMSA  81

Query  534   RTFQSEFTYSFPVASGRKF-LRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTE  710
             R F +E +Y F V + +++ LRL+FYP++Y+ L+  ++ FS   G  TL+ NFSA  T +
Sbjct  82    RIFSAESSYKFSVKTNQRYWLRLHFYPSTYSSLDPADAYFSAVAGGVTLMTNFSASITAQ  141

Query  711   ALNFDFLVKEFSVN-VPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIV  887
             AL   ++V+E+S+  +  E LNVTF PS     S AFVNGIE+V  PD++   D ++M+ 
Sbjct  142   ALTQAYIVREYSLAPMDFEILNVTFKPSDQHKGSYAFVNGIELVPIPDLF---DKASMVG  198

Query  888   GQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDY  1067
               +  L++  +  +++++R+NVGG  I  S+D+G+ R+W +DS Y++ A  GVT  A D 
Sbjct  199   FSDQSLDVGTAN-VQTMFRLNVGGQYIPASNDSGLTRTWYDDSPYLYGAAFGVTSEASD-  256

Query  1068  NMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
              + I Y  GM  YVAPV+VY+T RSMGP+  +N N+NLTW F VD  F YLVRLHFCEF 
Sbjct  257   KLKIQYQ-GMEDYVAPVDVYRTSRSMGPDPKLNQNFNLTWVFQVDGNFTYLVRLHFCEF-  314

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              I+ +IN+RVF IY+NNQTA   AD IAW G   VP
Sbjct  315   -ILNKINQRVFDIYVNNQTAMASADVIAWTGSKAVP  349



>ref|XP_003633771.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=894

 Score =   288 bits (737),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 159/351 (45%), Positives = 214/351 (61%), Gaps = 35/351 (10%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFL-LGTGKSSTSSADSQKPSVPQVPFMT  530
             Y PT+   +NCG  +   D   R WT DVGSKF  L  GK ST+S  + KPS   V + T
Sbjct  36    YTPTENFAINCGSSENWQDL-GRNWTGDVGSKFSPLEKGKLSTTS-QADKPSSSSVLYST  93

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQTT  707
             AR  + EFTYSFP+ +G+KF+RL+FYP+SY   + + + FSV+ G  YTLL NFSA    
Sbjct  94    ARLSRYEFTYSFPLTAGQKFIRLHFYPSSYGEFDGSKAFFSVKTGGGYTLLSNFSAALAA  153

Query  708   EALNFDFLVKEFSV--NVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTA--DG  872
             E L  + +V+EF +  N  G  LN+TFTP+  + ++ AF+NGIE+VS P D+Y ++  D 
Sbjct  154   EDLQKETIVREFCIYFNEEGGKLNITFTPTA-AADAYAFINGIEIVSMPNDLYYSSPQDV  212

Query  873   STMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTE  1052
                ++GQ +   I+   ALE +YR+NVG   +S   DTGMFR+WD D             
Sbjct  213   GFQLIGQQNSFRIETDYALEMVYRLNVGMQYVSAKDDTGMFRTWDMD-------------  259

Query  1053  TADDYNMTISYPPG----------MPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVD  1202
               DDY M +++ P           +P Y AP +VY+T R+MG N + N  YNLTW  PVD
Sbjct  260   --DDYCMKLAFVPANTSINLKFTKIPNYTAPHDVYRTARTMGNNKTENMGYNLTWVLPVD  317

Query  1203  SGFFYLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             SGF+YL+RLHFCEF   I + ++R F I++ NQTAE  AD I W+G NGVP
Sbjct  318   SGFYYLIRLHFCEFQPEIQQQHDREFTIFIANQTAENHADVITWSGGNGVP  368



>emb|CDY26624.1| BnaA09g46530D [Brassica napus]
Length=1432

 Score =   292 bits (748),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 165/337 (49%), Positives = 212/337 (63%), Gaps = 25/337 (7%)
 Frame = +3

Query  363   TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSV-PQVPFMTART  539
              +++LL C G   V    NR W  D   K L  +G+S TS A +Q  SV P VP+M+AR 
Sbjct  12    CEEVLLYCSGGVSVIGVGNRTWMPDQLFKCLSTSGESKTSPALTQDSSVVPSVPYMSARV  71

Query  540   FQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALN  719
             F+S FTYSFPVASGRKFLRLYFYP SY+GLNAT S+FS+  G YTLL+NFSA QT + ++
Sbjct  72    FKSPFTYSFPVASGRKFLRLYFYPNSYDGLNATLSLFSLSSGPYTLLRNFSASQTVQEMS  131

Query  720   FDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNS  899
               ++VKEF VN  G TLN+TFTP     N+ AFVNGIEV S PDIY   +    IVG + 
Sbjct  132   LSYIVKEFVVNAEGGTLNLTFTPESTPSNAYAFVNGIEVTSMPDIY--PNRVFTIVGTSK  189

Query  900   PLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVT-----ETADD  1064
             P+ +D +T LE +YRVN+GG  I P  D  +FR+W +D  +I+S G  VT     E+   
Sbjct  190   PIAMDKNTFLEMVYRVNIGGRGIYPFEDP-LFRTWYQD-LFIYSRGDRVTGAVVSESVHS  247

Query  1065  YNMTISYPPGMPTYVAPVEVYKTLRSMGPN-ASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
             Y              AP EVY + R+M  + A  N  +NL+W F VDS F YL+RLHFCE
Sbjct  248   Y--------------APEEVYSSARAMESSLAEENLKFNLSWSFTVDSRFHYLIRLHFCE  293

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGV  1352
                 + + N+RVF I+LN+ TAEP AD + W+G  G+
Sbjct  294   VAPGVDKSNQRVFSIFLNSATAEPKADIVEWSGGQGL  330



>gb|KJB11637.1| hypothetical protein B456_001G269100 [Gossypium raimondii]
Length=889

 Score =   288 bits (736),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 165/344 (48%), Positives = 215/344 (63%), Gaps = 14/344 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGK--SSTSSADSQKP--SVPQVP  521
             + PT+ I ++CG P+     D R WT D   K  L   K   S SS   Q+P  S+ QVP
Sbjct  33    FTPTESITIDCGSPNDNIGLDGRVWTGDSMPKLSLVESKNNKSVSSKAFQQPPSSLGQVP  92

Query  522   FMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQ  701
             F TAR   SEFTY  P+ SG+KF+RLYF+P SY   +A+ ++FSV+ G+ TLLKNFSA  
Sbjct  93    FATARASNSEFTYVIPLTSGQKFIRLYFFPTSYPSFDASKALFSVKAGDITLLKNFSA--  150

Query  702   TTEALNFDFLVKEFSVNVP-GETLNVTFTPSPNSPNSLAFVNGIEVVSHPD--IYNTA-D  869
             T  A   + L+KEF VN+  G+ LN+TF PSP+  +S AFVNGIE+VS P+   Y  A D
Sbjct  151   TLHAQGEETLIKEFCVNLERGQGLNLTFIPSPDISDSYAFVNGIEIVSMPNNLYYRPAND  210

Query  870   GSTMIVGQN--SPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTG  1043
                  +GQ+  S   + N+TALE + R+NVGG  ISP  DTGM+R W  D  Y+  A T 
Sbjct  211   EGVKFIGQSQGSLYTVGNNTALELMNRINVGGKQISPVDDTGMYRFWSADDDYLTEAATA  270

Query  1044  VTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLV  1223
             V     + ++ ++Y    P++ AP  VY T R+MG NA++N +YNLTW FPVDSGF Y V
Sbjct  271   VLPV--NLSINLNYSDDKPSFSAPDVVYTTARTMGTNATLNEHYNLTWEFPVDSGFNYFV  328

Query  1224  RLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             RLHFCEF   IT+  +RVF I+L N TAE   D I+ +G  GVP
Sbjct  329   RLHFCEFQIEITQQGDRVFEIFLANITAETDMDVISRSGGRGVP  372



>gb|KJB80425.1| hypothetical protein B456_013G096400 [Gossypium raimondii]
Length=519

 Score =   278 bits (712),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 153/338 (45%), Positives = 202/338 (60%), Gaps = 22/338 (7%)
 Frame = +3

Query  354   YVPTDKILLNCGGPD-GVTDQDNRKWTTDVGSKFLLGTGKSS--TSSADSQKPSVPQVPF  524
             Y P + ILL+CG         D R WT D  S F     +SS   S A  ++ SV +VP+
Sbjct  24    YFPLETILLDCGSSALRALSYDGRNWTND-SSHFGASNSESSFAMSRASLEETSVAEVPY  82

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             MTAR F S FTY+F V  G KF+RL+FYP SY  LNA+ S  +V  G YTLL+NFSA   
Sbjct  83    MTARLFHSRFTYTFNVTPGSKFIRLHFYPDSYMNLNASKSFLTVTAGNYTLLRNFSAYLN  142

Query  705   TEALNFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTADGSTM  881
              + +   +  KEF V+V   TL++TF+P+ N+ +  AFVNGIE+VS P  +Y  A     
Sbjct  143   AKHIKSAYFFKEFIVHVENHTLDLTFSPTTNASDGYAFVNGIEIVSMPLSLYYQA-----  197

Query  882   IVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETAD  1061
                       +N +A+E+++RVNVGG  I P+ DTGM RSW  DS YIF    GV     
Sbjct  198   ----------NNVSAMETMHRVNVGGQSIPPNEDTGMSRSWAMDSSYIFGEAFGVENY--  245

Query  1062  DYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
             D++ +I+YP  +  Y+AP  VYKT  SM P   +N NYNL+W FP+D  F YL++LH CE
Sbjct  246   DFDASITYPKEVSAYIAPQGVYKTPHSMSPVPEININYNLSWTFPLDPSFMYLIKLHLCE  305

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              +  IT+IN+RVF I++NNQ  E G D IA    N +P
Sbjct  306   ISRNITKINQRVFDIFINNQVIERGIDIIALTYGNDIP  343



>ref|XP_002530992.1| kinase, putative [Ricinus communis]
 gb|EEF31380.1| kinase, putative [Ricinus communis]
Length=904

 Score =   287 bits (735),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 157/343 (46%), Positives = 217/343 (63%), Gaps = 12/343 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSAD--SQKPSVPQVPFM  527
             Y+P D I L+CG P    D ++R W  D  + F L    S+   A+  + +  +  VP+ 
Sbjct  44    YIPLDNIALDCGSPSNGPDMNHRNWIADT-NFFDLQHNASTPLQANESASRKGLDSVPYA  102

Query  528   TARTFQSEFTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             TAR   S+FTYSFP+  +G KF+RLYFYPASY+  + +N+ FSV+ G YTLL NFS+   
Sbjct  103   TARLSFSQFTYSFPITTAGPKFVRLYFYPASYSDFDMSNAYFSVQAGRYTLLSNFSSVLH  162

Query  705   TEALNFDFLVKEFSVNVP--GETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTAD--  869
             ++ L+    VKEF +NV      LN+TFTP+PN P++ AF+NGIE+VS P ++Y +A+  
Sbjct  163   SKNLSLPGFVKEFCLNVEEGQNLLNLTFTPTPNMPDAYAFINGIEIVSMPANLYYSAEND  222

Query  870   -GSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGV  1046
              G   +   NS + I+++ AL+ +YR+NVGG  +SP +DTGMFRSWD D+ YI       
Sbjct  223   VGFPSVGSLNSVMRIESNIALQLMYRINVGGQSVSPQNDTGMFRSWDGDTDYIILESQ--  280

Query  1047  TETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVR  1226
             +  A +    + Y   +  Y AP EVY T R MG NA++N  +NLTW F VDS F YLVR
Sbjct  281   SALAHNNVTQLKYRDNITRYSAPDEVYNTSRMMGLNATINEKHNLTWQFQVDSDFIYLVR  340

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              +FCEF   IT+  +RVF+IY+ NQTAE  AD I W+G NG+P
Sbjct  341   FYFCEFYPPITQKGDRVFLIYMANQTAEDYADVIEWSGGNGIP  383



>emb|CDO98765.1| unnamed protein product [Coffea canephora]
Length=859

 Score =   286 bits (731),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 158/333 (47%), Positives = 225/333 (68%), Gaps = 16/333 (5%)
 Frame = +3

Query  372   ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQS  548
             ++L CG P   TD + R W  D  SKFL  +  S  ++A SQ PS+P  VP+MTAR FQS
Sbjct  35    LVLACGAPTNATDNNGRSWIPD--SKFLASSDNSIVATALSQDPSLPSTVPYMTARVFQS  92

Query  549   EFTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFD  725
             +FTY+F ++   R ++RL+FYP+SYN L+++N  FSV    +TLL NFSA  T +AL   
Sbjct  93    QFTYTFRISPKARHWIRLHFYPSSYNNLSSSNGFFSVTADGFTLLNNFSALITAQALTQA  152

Query  726   FLVKEFSVNVPGET--LNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG-QN  896
             ++++E+++ VP +T  LN+TFTPSP    S AFVNGIE++S P+++  A     +VG   
Sbjct  153   YIIREYNI-VPIQTGILNLTFTPSPAYNGSFAFVNGIEIISTPELFQAAP----LVGFSE  207

Query  897   SPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMT  1076
               + ++ +T ++++ R+NVGG  I  S D+G+ R+W +DS Y+F A  GVT  AD+ N+ 
Sbjct  208   QSVEVEQNT-VQTLIRLNVGGQYIPASDDSGLSRTWYDDSPYLFGAAFGVTSQADE-NVR  265

Query  1077  ISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTII  1256
             I+YP G+P Y+APV VY T RSMGP+  VN N+NLTW F VD  + YLVR HFC++   +
Sbjct  266   INYPTGLPEYIAPVNVYDTARSMGPDPKVNQNFNLTWVFQVDPNYTYLVRFHFCDYQ--M  323

Query  1257  TEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +++N+RVF I++NNQTA P AD I WA   GVP
Sbjct  324   SKVNQRVFAIFINNQTAFPDADVIGWASAKGVP  356



>ref|XP_010242732.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nelumbo nucifera]
Length=858

 Score =   285 bits (730),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 154/330 (47%), Positives = 215/330 (65%), Gaps = 13/330 (4%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  551
             +L+CG  +  TD D R W  D+ SK+L     S  S A  Q PS+P  +P+M AR F +E
Sbjct  31    VLSCGSVNSSTDSDGRVW--DLDSKYLKSEDNSVPSKAQFQDPSLPSTIPYMNARIFTAE  88

Query  552   FTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              +Y+F V+   R ++RL+FYP+SY+ LNAT++ FSV  G  TLL NFSA  T EAL   +
Sbjct  89    ASYTFSVSPKQRHWVRLHFYPSSYSSLNATDAFFSVVAGGVTLLNNFSAYITAEALTQAY  148

Query  729   LVKEFSVN-VPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPL  905
             +V+EFS++  P   L++TF PS     S AF+NGIEV+  P++++ A     +VG    L
Sbjct  149   IVREFSLSPFPTGKLDLTFKPSDKHSGSFAFINGIEVIPMPELFHPAP----VVGSVHQL  204

Query  906   NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISY  1085
                  + ++++YR+NVGGN I+P++D+G+ R+W +DS Y+F A  GVT  A+  N+TI Y
Sbjct  205   IDAKLSNIQTMYRLNVGGNYIAPTNDSGLTRTWYDDSPYLFGANVGVTMDAEK-NLTIRY  263

Query  1086  PPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEI  1265
                 P Y+AP++VY T RSMGP   VNAN NLTW F VD  F Y+VR HFC+    +T++
Sbjct  264   KE-TPEYIAPIDVYSTSRSMGPEPEVNANANLTWVFQVDPNFMYVVRFHFCDLQ--MTKV  320

Query  1266  NERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             N+RVF IYLNN+TA+  AD + WAG  GVP
Sbjct  321   NQRVFDIYLNNRTAQAQADVVLWAGSGGVP  350



>ref|XP_010319813.1| PREDICTED: receptor-like protein kinase ANXUR1 [Solanum lycopersicum]
Length=873

 Score =   285 bits (729),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 148/330 (45%), Positives = 216/330 (65%), Gaps = 11/330 (3%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPS-VPQVPFMTARTFQSE  551
             +L+CG     TD D R W+ D  + F   +G S TS A  Q PS +  +P+MTAR F+++
Sbjct  52    VLSCGATSTATDADGRIWSPD-STYFPSSSGNSITSKAKYQDPSLISDIPYMTARIFKNQ  110

Query  552   FTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              TYSFPV+   R ++RL+FYP+SY+  N ++S FSV +  +TLL NFSA  T +AL   +
Sbjct  111   TTYSFPVSPKSRHWIRLHFYPSSYDNFNCSSSFFSVNIAGFTLLNNFSASITAQALTQAY  170

Query  729   LVKEFS-VNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPL  905
             +++EF+ V +   TLN+TFTPS    +S AF+NGIE+VS P I+  A     +VG +   
Sbjct  171   IIREFTLVPLQTSTLNITFTPSSAYNDSFAFINGIEIVSMPKIFEPAP----MVGFSDQT  226

Query  906   NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISY  1085
                 ++++++++R+NVGG  I  ++D+G+ R W +D+ Y+  A  G+T  A++ +M ISY
Sbjct  227   TETQASSMQTMFRLNVGGQYIPANNDSGLGRIWYDDAPYLVGASFGITSAANN-SMKISY  285

Query  1086  PPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEI  1265
             P  +P Y+AP +VY+T R+MGPN  VN NYNLTW F VD+ F YLVRLHFC+F   +  +
Sbjct  286   PSNLPNYIAPEDVYRTARTMGPNVDVNRNYNLTWIFQVDTNFTYLVRLHFCDFQ--MKRM  343

Query  1266  NERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             N+RVF ++LNNQTA   AD I W+    VP
Sbjct  344   NQRVFKVFLNNQTALEEADVIGWSSAQNVP  373



>ref|XP_004243035.1| PREDICTED: receptor-like protein kinase ANXUR1 [Solanum lycopersicum]
Length=854

 Score =   285 bits (728),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 148/330 (45%), Positives = 217/330 (66%), Gaps = 11/330 (3%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPS-VPQVPFMTARTFQSE  551
             +L+CG     TD D R W+ D  + F   +G S TS A  Q PS +  +P+MTAR F+++
Sbjct  33    VLSCGATSNATDADGRIWSPD-STYFPSSSGNSITSKAKYQDPSLISDIPYMTARIFKNQ  91

Query  552   FTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              TYSFPV+   R ++RL+FYP+SY+  N ++S FSV +  +TLL NFSA  T +AL   +
Sbjct  92    TTYSFPVSPKSRHWIRLHFYPSSYDNFNCSSSFFSVNIAGFTLLNNFSASITAQALTQAY  151

Query  729   LVKEFS-VNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPL  905
             +++EF+ V +   TLN+TFTPS    +S AF+NGIE+VS P+I+  A     +VG +   
Sbjct  152   IIREFTLVPLQTSTLNITFTPSSAYNDSFAFINGIEIVSMPEIFEPAP----MVGFSDQT  207

Query  906   NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISY  1085
                 ++++++++R+NVGG  I  ++D+ + R W +D+ Y+F A  G+T  A++ +M ISY
Sbjct  208   TETQASSMQTMFRLNVGGQYIPANNDSSLGRIWYDDAPYLFGASFGITSAANN-SMKISY  266

Query  1086  PPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEI  1265
             P  +  Y+AP +VY+T R+MGPNA VN NYNLTW F VD+ F YLVRLHFC+F   +  +
Sbjct  267   PSNLTNYIAPEDVYRTARTMGPNADVNRNYNLTWIFQVDTNFTYLVRLHFCDFQ--MKRM  324

Query  1266  NERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             N+RVF ++LNNQTA   AD I W+    VP
Sbjct  325   NQRVFKVFLNNQTALEEADVIGWSSAQNVP  354



>ref|XP_007035799.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY06725.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=886

 Score =   285 bits (728),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 153/330 (46%), Positives = 210/330 (64%), Gaps = 11/330 (3%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  551
             +L+CG     TD D RKW+ D  +KFL  +  S T +A  Q PS+P  VP+M AR F S 
Sbjct  66    ILSCGASGDETDADGRKWSPD--TKFLASSDNSETVTALYQDPSLPSTVPYMNARIFTST  123

Query  552   FTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              +Y F V+   R +LRLYFYP++YN L+ +   FSV    +TLLKNFSA  T +AL   +
Sbjct  124   TSYKFSVSQKTRLWLRLYFYPSTYNNLDPSKGCFSVVANGFTLLKNFSASITAKALTQAY  183

Query  729   LVKEFSVN-VPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPL  905
             + +EFS+  V    LNVT TPS     S AF+NGIEV+  PDI+        +VG +   
Sbjct  184   IAREFSLTPVESGDLNVTITPSTEQSGSYAFINGIEVIPMPDIFQQP---AALVGYSDQS  240

Query  906   NIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTISY  1085
                 S++L+++YR+NVGG  I+P++D+G+ R W +DS Y+F A  GV+  A   N+ I Y
Sbjct  241   VDVQSSSLQTMYRLNVGGQSIAPNNDSGLARIWYDDSPYLFGAAIGVSSKAGK-NVRIQY  299

Query  1086  PPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEI  1265
                +   +AP+ VY T R+MGP+  VN NYNLTW F +D+ F Y+VRLHFCE+   +T+I
Sbjct  300   SKDVTEDIAPLNVYSTARTMGPDPKVNQNYNLTWVFQIDANFTYIVRLHFCEYQ--LTKI  357

Query  1266  NERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             N+RVF I++NNQTA+ GAD I WAG  G+P
Sbjct  358   NQRVFDIFVNNQTAQSGADVIGWAGSRGIP  387



>ref|XP_007215522.1| hypothetical protein PRUPE_ppa003761mg [Prunus persica]
 gb|EMJ16721.1| hypothetical protein PRUPE_ppa003761mg [Prunus persica]
Length=550

 Score =   277 bits (709),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 153/348 (44%), Positives = 222/348 (64%), Gaps = 15/348 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTD-QDNRKWTTDVGSKF---LLGTGKSSTSSADSQKP--SVPQ  515
             Y P + I +NCG      +  DNR WT D+ SKF    L    ++TSS   + P  SV Q
Sbjct  29    YTPVEDITINCGSYGTSPNIYDNRNWTGDINSKFSPFELHQDNTNTSSQVREAPPSSVSQ  88

Query  516   VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSVRVGEYTLLKNFS  692
             VP+ TAR   SEF+Y  P+++G+KF+RL+F+P SY+ G + + ++FSV+ G +TLL +F+
Sbjct  89    VPYTTARLSLSEFSYKVPLSTGQKFIRLHFHPVSYDPGFDRSKTLFSVQAGGFTLLHDFN  148

Query  693   AGQTTEALNFDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNTA  866
             A  T +A   + L++EF +N+  G++L +TFTPS   P++ AFVNGIE+VS P ++Y TA
Sbjct  149   ASVTADASETETLIREFCLNIDEGQSLTITFTPSRAIPDAYAFVNGIEIVSMPTNLYYTA  208

Query  867   DGSTMI--VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWD---EDSKYIFS  1031
               S  +  VG      I+N TA+E +YR+NVGG+ +S   DTGM+R+WD   ++ KY+  
Sbjct  209   SESHGVDYVGNEVNYRIENITAMEMVYRINVGGSALSFDQDTGMYRNWDSVVDEQKYLDD  268

Query  1032  AGTGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGF  1211
               +  T    + ++ +++   +P Y AP  VY+T RSMG N + N +Y LTW FPVD  F
Sbjct  269   LSSRWTVLPQNVSLQLNFVK-IPEYSAPQVVYQTGRSMGSNHTRNKSYKLTWEFPVDPMF  327

Query  1212  FYLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              YL+RLHFCEF   I +  +R F+IY++NQ AEP AD I W+G NG P
Sbjct  328   LYLLRLHFCEFEPEIMDTGDRSFLIYVDNQLAEPQADIIMWSGGNGRP  375



>ref|XP_006427852.1| hypothetical protein CICLE_v10024830mg [Citrus clementina]
 ref|XP_006464563.1| PREDICTED: putative receptor-like protein kinase At5g39000-like 
[Citrus sinensis]
 gb|ESR41092.1| hypothetical protein CICLE_v10024830mg [Citrus clementina]
Length=911

 Score =   285 bits (729),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 171/353 (48%), Positives = 217/353 (61%), Gaps = 23/353 (7%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTG--KSSTSSADSQKPSVPQVPFM  527
             Y+PTD IL+ CG     T  D R W  D  SKF       KS TS A  Q+ SVPQVP+M
Sbjct  29    YIPTDYILIICGESSNTTSSDGRNWDGDAHSKFSSSNSATKSFTSRASFQENSVPQVPYM  88

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASY------NGLNATNSV----FSVRVGEYTL  677
             TAR F  EFTY+FPV+ G KFLRL+FYPA Y       GL+  +++    F+V   +YTL
Sbjct  89    TARVFPEEFTYTFPVSPGPKFLRLHFYPAPYLLGQQQGGLDNNDTISTSFFTVSANKYTL  148

Query  678   LKNFSAGQTTEAL--NFDFLVKEFSVNVPG-ETLNVTFTPSPNSPNSLAFVNGIEVVSHP  848
             L+NFSA  T  A+     +  KEF ++V   + LN+TF+PS +S  S AF+NGIEVVS P
Sbjct  149   LRNFSAHLTVSAIIPPVAYFFKEFIISVSSSQMLNLTFSPSSSS--SYAFINGIEVVSMP  206

Query  849   D-IY-NTADGSTMI--VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDS  1016
             D +Y   +DG   I  +  N+  + D   ALE+ YR+NVGG  +S   DTGMFR W +D+
Sbjct  207   DNLYLQQSDGDRSIPFINSNTIFSFDKPVALETAYRLNVGGAHVSAKDDTGMFREWLDDT  266

Query  1017  KYIFSAGTGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFP  1196
              YI+ A +GVT         I Y    P Y+APV VY T R+MG + ++N  YNLTW F 
Sbjct  267   NYIYGAASGVTPHLP--GARIKYTSDTPAYIAPVIVYTTSRTMGKDPNINKKYNLTWNFS  324

Query  1197  VDSGFFYLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             VD GF YLVRLHFCE    IT  N+RVF I++NNQTAE  AD I W+G +G+P
Sbjct  325   VDPGFNYLVRLHFCETQLEITRENQRVFSIFINNQTAENDADVIHWSGGSGIP  377



>ref|XP_010660596.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
Length=895

 Score =   285 bits (728),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 152/340 (45%), Positives = 211/340 (62%), Gaps = 14/340 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLG-TGKSSTSSADSQKPSVPQVPFMT  530
             Y PT+   +NCG  +       R WT DV SKF     G+ ST+S  +++P     P+ T
Sbjct  38    YTPTENFAINCGSAEN-WQALARNWTGDVDSKFSPSEKGELSTTSLAAEQP-FESFPYST  95

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQTT  707
             AR  ++EFTYSFP+ +G+K++RL+FYP+SY   + + + FSV+ G  YTLL NFSA    
Sbjct  96    ARLSRNEFTYSFPLTAGQKYIRLHFYPSSYGEFDRSKAFFSVKTGGGYTLLSNFSAALAA  155

Query  708   EALNFDFLVKEFSVNV--PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD--IYNTADGS  875
             E +  + +V+EF +N    GE LN+TFTP+  + ++ AF+NGIE+VS PD   Y   DG 
Sbjct  156   EDIQKETIVREFCINFNEEGEKLNITFTPTAGA-DAYAFINGIEIVSMPDNLYYTAQDGG  214

Query  876   TMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTET  1055
                +GQ +   ++   ALE++YR+NVGG  +SP+ DTGMFR+WD D +Y          T
Sbjct  215   FQFIGQQNSFFVETDHALENVYRLNVGGKSLSPTDDTGMFRTWDADDEYCVKLAFVPANT  274

Query  1056  ADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHF  1235
             + +   T      +P Y AP++VY+T R+MG N + N  YNLTW+ PVDSGF YL+RLHF
Sbjct  275   SINLKFT-----QIPNYTAPLDVYRTARTMGNNKTENMGYNLTWFLPVDSGFSYLLRLHF  329

Query  1236  CEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             CEF   I E ++R F I + NQTAE  AD I W+  NGVP
Sbjct  330   CEFQPEIQEQHDREFAIIIANQTAENHADVITWSTGNGVP  369



>gb|KDO53394.1| hypothetical protein CISIN_1g002533mg [Citrus sinensis]
Length=911

 Score =   285 bits (728),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 171/353 (48%), Positives = 217/353 (61%), Gaps = 23/353 (7%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTG--KSSTSSADSQKPSVPQVPFM  527
             Y+PTD IL+ CG     T  D R W  D  SKF       KS TS A  Q+ SVPQVP+M
Sbjct  29    YIPTDYILIICGESSNTTSSDGRNWDGDAHSKFSSSNSATKSFTSRASFQENSVPQVPYM  88

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASY------NGLNATNSV----FSVRVGEYTL  677
             TAR F  EFTY+FPV+ G KFLRL+FYPA Y       GL+  +++    F+V   +YTL
Sbjct  89    TARVFPEEFTYTFPVSPGPKFLRLHFYPAPYLLGQQQGGLDNNDTISTSFFTVSANKYTL  148

Query  678   LKNFSAGQTTEAL--NFDFLVKEFSVNVPG-ETLNVTFTPSPNSPNSLAFVNGIEVVSHP  848
             L+NFSA  T  A+     +  KEF ++V   + LN+TF+PS +S  S AF+NGIEVVS P
Sbjct  149   LRNFSAHLTVSAIIPPVAYFFKEFIISVSSSQMLNLTFSPSSSS--SYAFINGIEVVSMP  206

Query  849   D-IY-NTADGSTMI--VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDS  1016
             D +Y   +DG   I  +  N+  + D   ALE+ YR+NVGG  +S   DTGMFR W +D+
Sbjct  207   DNLYLQQSDGDRSIPFINSNTIFSFDKPVALETAYRLNVGGAHVSAKDDTGMFREWLDDT  266

Query  1017  KYIFSAGTGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFP  1196
              YI+ A +GVT         I Y    P Y+APV VY T R+MG + ++N  YNLTW F 
Sbjct  267   NYIYGAASGVTPHLP--GARIKYTSDTPAYIAPVIVYTTSRTMGKDPNINKKYNLTWNFS  324

Query  1197  VDSGFFYLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             VD GF YLVRLHFCE    IT  N+RVF I++NNQTAE  AD I W+G +G+P
Sbjct  325   VDPGFNYLVRLHFCETQLEITRENQRVFSIFINNQTAENDADVIHWSGGSGIP  377



>ref|XP_012084846.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
 gb|KDP27273.1| hypothetical protein JCGZ_19972 [Jatropha curcas]
Length=918

 Score =   285 bits (728),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 166/338 (49%), Positives = 213/338 (63%), Gaps = 15/338 (4%)
 Frame = +3

Query  372   ILLNCGGPDGVTDQDNRKWTTDVGSKFLL--GTGKSSTSSADSQKPSVPQVPFMTARTFQ  545
             I ++CG     T +  R WT D  SKF L   T  S TS A     S  QVP++TAR  +
Sbjct  63    ITIDCGSTSAPTAEGGRIWTADTDSKFSLLDPTNASITSPAPKNPTSGDQVPYITARLSR  122

Query  546   SEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFD  725
             S+FTY+ PV  G KF+RLYFYPASY   +++ + FSV+ G +TLL NFSA    +A NFD
Sbjct  123   SDFTYTLPVTPGPKFIRLYFYPASYVSFSSSTAFFSVKAGGFTLLSNFSAALYAQAHNFD  182

Query  726   FLVKEFSVNVP-GETLNVTFTPSPNSPNSLAFVNGIEVVSHPD--IYN-TADGSTMIVGQ  893
               VKEFS+NV  G+ LNVTF+P+P+   + AF+NG+E+VS P   +YN T D     + +
Sbjct  183   TFVKEFSLNVEDGQMLNVTFSPTPSMTGAYAFINGLEIVSIPSNLLYNATGDPEIKFLDR  242

Query  894   NSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNM  1073
             +   ++ ++TALE  YR+NVGG  +SP  D GMFRSW  D +Y+    T    +A  YN+
Sbjct  243   SDLGSLGSNTALEVTYRINVGGGDVSPLKDNGMFRSWTADDEYL----TIAKPSAILYNL  298

Query  1074  TISYPPG----MPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCE  1241
             T+    G    +  Y AP EVYKT RSMG N S N  YNLTW F +DS F YL RLHFCE
Sbjct  299   TLHLKYGDLNNIARYGAPAEVYKTARSMGDNKSTNEKYNLTWTFQLDSNFTYLFRLHFCE  358

Query  1242  FTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             F + ITEI +RVF IY+NNQTA+  AD I W+G NG P
Sbjct  359   FQSPITEIEDRVFWIYINNQTAD-SADVIKWSGGNGFP  395



>ref|XP_012084845.1| PREDICTED: receptor-like protein kinase FERONIA [Jatropha curcas]
Length=918

 Score =   285 bits (728),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 161/334 (48%), Positives = 207/334 (62%), Gaps = 7/334 (2%)
 Frame = +3

Query  372   ILLNCGGPDGVTDQDNRKWTTDVGSKFLL--GTGKSSTSSADSQKPSVPQVPFMTARTFQ  545
             I ++CG     T + +R WT D  SKF L   T  S TS A     S  QVP++TAR  Q
Sbjct  63    ITIDCGSTSATTAEGDRIWTVDTDSKFSLLDPTNASITSPASKHPTSGDQVPYITARLSQ  122

Query  546   SEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFD  725
             S+FTY+ PV  G KF+ LYFYPASY   ++  + FSV  G +TLL NFSA    +A NFD
Sbjct  123   SDFTYTLPVTPGPKFILLYFYPASYVSFSSPTAFFSVNAGGFTLLSNFSAALYAQAHNFD  182

Query  726   FLVKEFSVNVP-GETLNVTFTPSPNSPNSLAFVNGIEVVSHPD--IYN-TADGSTMIVGQ  893
               VKEFS+NV  G+ LNVTF+P+P+   + AF+NG+E+VS P   +YN T D     + +
Sbjct  183   SFVKEFSLNVEDGQMLNVTFSPAPSMTGAYAFINGLEIVSIPTNLLYNATGDPGIKFLDR  242

Query  894   NSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNM  1073
             +   ++ ++TALE  YR+NVGG  +SP  D GMFRSW  D +Y+ SA  G   +    ++
Sbjct  243   SDLGSLGSNTALEVTYRINVGGGDVSPLKDNGMFRSWTADDEYLTSAEQGAILSNFAIHL  302

Query  1074  TISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTI  1253
                    +  Y AP  VY+T RSMG N S+N  YNLTW F +DS F YL RLHFCEF   
Sbjct  303   KYGDLNNISRYGAPDVVYETARSMGMNKSINEKYNLTWTFQLDSNFTYLFRLHFCEFQPP  362

Query  1254  ITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             ITEI +RVF IY+NNQTA+  AD I W+G NG P
Sbjct  363   ITEIEDRVFWIYINNQTAD-SADVIKWSGGNGFP  395



>ref|XP_002316044.1| Pto-like kinase OGw family protein [Populus trichocarpa]
 gb|EEF02215.1| Pto-like kinase OGw family protein [Populus trichocarpa]
Length=858

 Score =   283 bits (724),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 153/336 (46%), Positives = 218/336 (65%), Gaps = 17/336 (5%)
 Frame = +3

Query  363   TDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTART  539
             +D  +L CG     TD D+R W  D  +K +  +G S TS+A++Q PS+P  +P+MTAR 
Sbjct  34    SDSYILACGASGAGTDSDSRDWQPD--AKHINSSGNSITSTAENQDPSLPSTIPYMTARI  91

Query  540   FQSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEAL  716
             F SE TY F V    R ++RL+FYP++Y+ L+  NS FSV    +TLL NFSA  T +AL
Sbjct  92    FTSESTYKFSVPTKSRLWVRLHFYPSTYSSLDPNNSYFSVTANSFTLLNNFSASITAQAL  151

Query  717   NFDFLVKEFS-VNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG-  890
                ++++EFS + +   TLN+TFTPS    +S AFVNGIEV+  PDIY  A     +VG 
Sbjct  152   TLAYIIREFSLIPIDSGTLNLTFTPSSKYNDSYAFVNGIEVIPMPDIYQPA----ALVGF  207

Query  891   QNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYN  1070
              +  +++ +ST L++++R+NVGG  I  + D+G+ R W +D+ Y+F A  GVT  A   +
Sbjct  208   SDQAVDVGSST-LQTMFRLNVGGQFIPANKDSGLTRIWYDDTPYLFGAAGGVTSQA---S  263

Query  1071  MTISYP-PGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFT  1247
             ++I YP   +P  +AP++VY T R+MGP++ VN  YNLTW F VD+ F Y  R HFCE+ 
Sbjct  264   ISIQYPTDNLPNSIAPLDVYSTARTMGPDSKVNQKYNLTWVFQVDANFTYAFRFHFCEYQ  323

Query  1248  TIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
                T++N+RVF IY+NN+TA+ G D I WAG  GVP
Sbjct  324   E--TKVNQRVFDIYVNNRTAQEGGDVIGWAGSQGVP  357



>ref|XP_009373799.1| PREDICTED: receptor-like protein kinase FERONIA [Pyrus x bretschneideri]
Length=890

 Score =   283 bits (725),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 156/346 (45%), Positives = 219/346 (63%), Gaps = 13/346 (4%)
 Frame = +3

Query  354   YVPTDKILLNCG-GPDGVTDQDNRKWTTDVGSKFL--LGTGKSSTSSADSQKPSVPQVPF  524
             Y P D I L CG   D V  QD R W+ D+ SKF      G SS   A +   S  QVP+
Sbjct  29    YKPVDDITLQCGFSGDQVNQQDGRTWSGDINSKFSPSQAAGSSSVLKAATPISSSSQVPY  88

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQ  701
              TAR  +SEFTY+FP+ SG+KF+RL FYP  Y    + + S+FSV  G +TLL++F+A  
Sbjct  89    TTARLSRSEFTYTFPLTSGQKFIRLSFYPTFYAAEFDRSKSLFSVEAGGFTLLRDFNASV  148

Query  702   TTEALNFDFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNT---A  866
             T +A   + + +EF +N+  E +LN+TFTPS  SP++ AF+NGIE+VS PD +Y T   +
Sbjct  149   TADASWSETVSREFCLNIASEQSLNITFTPSRASPDAYAFINGIEIVSMPDNLYYTPPQS  208

Query  867   DGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWD---EDSKYIFSAG  1037
             +   ++VG  +   I+N+TA+E +YR+NVGG+ +S + DTGM+R+WD    +  Y+ +  
Sbjct  209   EDGAVLVGSINQYPIENNTAMEMVYRINVGGSQLSFNQDTGMYRNWDGFQAEDNYLDALS  268

Query  1038  TGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFY  1217
                +    + N  + +   +P Y AP EVY+T RSMG N ++N +YNLTW FPVDS F Y
Sbjct  269   KNFSVLPQNSNTELDFSK-IPKYSAPEEVYRTGRSMGWNKTINKSYNLTWGFPVDSMFNY  327

Query  1218  LVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              +RLHFCEF   +T   +R+F I++ NQTAEP AD I W+G NG P
Sbjct  328   FIRLHFCEFEGDVTLPRDRLFQIFIANQTAEPMADVITWSGGNGKP  373



>ref|XP_010660595.1| PREDICTED: receptor-like protein kinase FERONIA [Vitis vinifera]
 emb|CBI21195.3| unnamed protein product [Vitis vinifera]
Length=599

 Score =   277 bits (709),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 154/343 (45%), Positives = 220/343 (64%), Gaps = 18/343 (5%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFL-LGTGKSSTSSADSQKPSVPQVPFMT  530
             Y PT+   +NCG   G + +  R W  D+ SKF  L  G S+TSSAD  +P    VP+ T
Sbjct  36    YSPTENFAINCGS-SGNSQELGRNWMGDIDSKFSPLENGTSTTSSAD--EPPFLSVPYST  92

Query  531   ARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGE-YTLLKNFSAGQT  704
             AR  + EFTYSFP+ +G+K++RL+F+P+SY G  + + ++FSV+ G  YTLL NFS    
Sbjct  93    ARLSRYEFTYSFPLTAGQKYIRLHFHPSSYGGEFDRSTAIFSVKTGGGYTLLSNFSGALV  152

Query  705   TEA-LNFDFLVKEFSVNVP--GETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNTA--  866
              ++ L  + ++KEF +N    GE LN+TF P+    ++ AF+NGIE+VS PD +Y T+  
Sbjct  153   ADSDLGREKILKEFCINFKEEGEKLNITFAPTAGE-DAYAFINGIEIVSMPDYLYYTSPQ  211

Query  867   DGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGV  1046
             DG    +GQ++   ++   ALE++YR+NVGG  +SP  DTGMFR+WD D +Y+      +
Sbjct  212   DGGFKFIGQHNSFFVETDHALENLYRLNVGGQSLSPMDDTGMFRTWDADDEYL----PKL  267

Query  1047  TETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVR  1226
                  + ++T+ +   +P Y AP++VY+T R+MG N + N  YNLTW  PVDSGF YL+R
Sbjct  268   AFVPVNGSITLKFIQ-IPNYTAPLDVYRTARTMGNNKTENMGYNLTWSLPVDSGFSYLLR  326

Query  1227  LHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             LHFCEF   I +  +R F I++ NQTAE  AD I W+G NGVP
Sbjct  327   LHFCEFQPEIQQQQDREFTIFIANQTAENHADVIKWSGGNGVP  369



>ref|XP_009118022.1| PREDICTED: receptor-like protein kinase FERONIA isoform X2 [Brassica 
rapa]
Length=766

 Score =   280 bits (717),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 156/309 (50%), Positives = 201/309 (65%), Gaps = 25/309 (8%)
 Frame = +3

Query  447   KFLLGTGKSSTSSADSQKPSV-PQVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYN  623
             K L  +G+S TS A +Q PSV P VP+M+AR F+S FTYSFPVASGRKFLRLYFYP SY+
Sbjct  7     KCLSTSGESKTSPALTQDPSVVPSVPYMSARVFKSPFTYSFPVASGRKFLRLYFYPNSYD  66

Query  624   GLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDFLVKEFSVNVPGETLNVTFTPSPNSP  803
             GLNAT S+FS+  G YTLL+NFSA QT + ++  ++VKEF VN  G TLN+TFTP     
Sbjct  67    GLNATLSLFSLSSGPYTLLRNFSASQTVQEMSLSYIVKEFVVNAEGGTLNLTFTPESTPS  126

Query  804   NSLAFVNGIEVVSHPDIYNTADGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSD  983
             N+ AFVNGIEV S PDIY   +    IVG + P+ +D +T L+ +YRVN+GG  I P  D
Sbjct  127   NAYAFVNGIEVTSMPDIY--PNRVFTIVGTSKPIAMDKNTFLQMVYRVNIGGRGIYPFED  184

Query  984   TGMFRSWDEDSKYIFSAGTGVT-----ETADDYNMTISYPPGMPTYVAPVEVYKTLRSMG  1148
               +FR+W +D  +I+S G  VT     E+   Y              AP EVY + R+M 
Sbjct  185   P-LFRTWYQD-LFIYSRGDRVTGAVVSESVHSY--------------APEEVYSSARAME  228

Query  1149  PN-ASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADA  1325
              + A  N  +NL+W F VDS F YL+RLHFCE    + + N+RVF I+LN+ TAEP AD 
Sbjct  229   SSLAEENLKFNLSWSFTVDSRFHYLIRLHFCEVAPGVDKSNQRVFSIFLNSATAEPKADI  288

Query  1326  IAWAGKNGV  1352
             + W+G  G+
Sbjct  289   VEWSGGQGL  297



>ref|XP_008341792.1| PREDICTED: receptor-like protein kinase FERONIA [Malus domestica]
Length=892

 Score =   283 bits (723),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 161/355 (45%), Positives = 215/355 (61%), Gaps = 31/355 (9%)
 Frame = +3

Query  354   YVPTDKILLNCG-GPDGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  524
             Y P D I L CG   D V  QD R W+ D+ SKF      G SS   A +   S  QVP+
Sbjct  29    YKPVDDITLQCGFSGDQVNQQDGRTWSGDINSKFSPFQAAGSSSVYKAATPIXSSSQVPY  88

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQ  701
              TAR  +SEFTY+FP+ SG+KF+RLYFYP SY    + + S+FSV  G +TLL++F+A  
Sbjct  89    TTARLSRSEFTYTFPLTSGQKFIRLYFYPTSYAAEFDRSKSLFSVEAGGFTLLRDFNASV  148

Query  702   TTEALNFDFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNT----  863
             T +A + + + +EF +N+  E +LN+TFTPS  SP++ AF+NGIE+VS PD +Y T    
Sbjct  149   TADAFSSETVSREFCLNIASEQSLNITFTPSRASPDAYAFINGIEIVSMPDNLYYTSPQS  208

Query  864   ADGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTG  1043
             ADG  + VG  +P  I+N+ A+E +YR+NVGG+ +S + DTGM+R+WD         G  
Sbjct  209   ADGP-VSVGSINPSRIENNAAMEMVYRINVGGSQLSFNRDTGMYRNWD---------GIQ  258

Query  1044  VT-ETADDYNMTISYPP----------GMPTYVAPVEVYKTLRSMGPNASVNANYNLTWY  1190
             V     DD +   S  P           +P Y AP EVY+T RSMG N ++N  YNLTW 
Sbjct  259   VEYNYLDDLSKNFSVLPQNSSIQPDFSXIPEYSAPEEVYRTARSMGXNKTINKXYNLTWG  318

Query  1191  FPVDSGFFYLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             FPVDS F+Y  RLHFCEF   +T   +R+F I++ NQ AE  AD I W+   G P
Sbjct  319   FPVDSTFYYFXRLHFCEFEGXVTLPRDRLFQIFIXNQXAEQXADVITWSXGXGKP  373



>ref|XP_008231019.1| PREDICTED: receptor-like protein kinase FERONIA [Prunus mume]
Length=400

 Score =   270 bits (691),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 153/349 (44%), Positives = 218/349 (62%), Gaps = 17/349 (5%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQ--DNRKWTTDVGSKF---LLGTGKSSTSSADSQKP--SVP  512
             Y P + I +NCG   G +    DN+ WT D+ SKF    L    ++TSS   + P  SV 
Sbjct  29    YTPVEDITINCGS-SGTSPNIYDNQNWTGDINSKFSPIELHQDNTNTSSQVREAPPSSVS  87

Query  513   QVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSVRVGEYTLLKNF  689
             QVP+ TAR   SEF+Y  P++ G+KF+RLYF+P SY+   + + ++FSVR G +TLL +F
Sbjct  88    QVPYTTARLSLSEFSYKVPLSIGQKFIRLYFHPVSYDPSFDRSKTLFSVRAGGFTLLHDF  147

Query  690   SAGQTTEALNFDFLVKEFSVNVP-GETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNT  863
             +A  T +A   + L++EF +N+  G +L +TFTPS   P++ AFVNGIE+VS P ++Y T
Sbjct  148   NASVTADASETETLIREFCLNIDDGHSLTITFTPSRAIPDAYAFVNGIEIVSMPTNLYYT  207

Query  864   ADGSTMI--VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWD---EDSKYIF  1028
             A  S  +  VG      I+N TA+E +YR+NVGG+ +S   DTGM+R+W    ++ KY+ 
Sbjct  208   ASESHGVDYVGNEVNYRIENITAMEMVYRINVGGSALSFDQDTGMYRNWGSVVDEQKYLD  267

Query  1029  SAGTGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSG  1208
                +  T    + ++ +++   +P Y AP  VY+T RSMG N + N +Y LTW FPVD  
Sbjct  268   DLSSRWTVLPQNVSLQLNFV-KIPEYSAPQVVYQTGRSMGSNHTRNKSYKLTWEFPVDPK  326

Query  1209  FFYLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             F YL+RLHFCEF   I +  +R F+IY+ NQ AEP AD I W+G NG P
Sbjct  327   FLYLLRLHFCEFEPEIMDPGDRSFLIYVENQLAEPQADIIVWSGGNGRP  375



>ref|XP_009385224.1| PREDICTED: receptor-like protein kinase ANXUR1 [Musa acuminata 
subsp. malaccensis]
Length=863

 Score =   282 bits (721),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 160/339 (47%), Positives = 213/339 (63%), Gaps = 11/339 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDV-GSKFLLGTGKSSTSSADSQKPSVPQ-VPFM  527
             YVP+D ILLNCG     TD D RKW  D   S   L +  S+ ++A  Q PS+P  VP+M
Sbjct  26    YVPSDSILLNCGSSSEATDSDGRKWIADSPTSTSSLVSKNSNPATAVYQDPSLPSAVPYM  85

Query  528   TARTFQSEFTYSFPV-ASGRKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQ  701
             +AR F SE TY F V  + R ++RL+FYP++Y      NS F+V   +  TLLKNFSA  
Sbjct  86    SARIFASESTYKFAVNKTERHWVRLHFYPSTYGDHAPNNSYFAVSTSDGVTLLKNFSAYI  145

Query  702   TTEALNFDFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGST  878
             T +AL   ++VKEFS+    + +L++TFTPS +   S AFVNGIE++S P IY+      
Sbjct  146   TAKALTQAYIVKEFSIPPASDGSLSLTFTPSNDHNGSFAFVNGIEIISMPAIYSEPAELV  205

Query  879   MIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETA  1058
                 QN  +     +AL ++YR+NVGG  +  S+D+G+ R+W +DS YI+ AG GVT +A
Sbjct  206   GFSDQNVEVG---DSALLTMYRLNVGGQYLPASNDSGLSRTWYDDSPYIYGAGFGVTSSA  262

Query  1059  DDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFC  1238
                 + I YP     Y+AP +VY T RSMGP+  VN N+NLTW F VD  F YLVRLHFC
Sbjct  263   SG-KLEIKYPKDTAEYLAPTDVYSTARSMGPDPKVNMNFNLTWIFQVDGNFTYLVRLHFC  321

Query  1239  EFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             EF   +++IN+RVF I++NNQTA+  AD IAW     VP
Sbjct  322   EFQ--MSKINQRVFDIFINNQTAQAQADVIAWTSAKAVP  358



>ref|XP_002439522.1| hypothetical protein SORBIDRAFT_09g009320 [Sorghum bicolor]
 gb|EES17952.1| hypothetical protein SORBIDRAFT_09g009320 [Sorghum bicolor]
Length=870

 Score =   282 bits (721),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 153/339 (45%), Positives = 220/339 (65%), Gaps = 11/339 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSS-TSSADSQKPSVPQ-VPFM  527
             Y P + IL++CG      D D RKW TD GS +L+  GKSS  + AD Q PS+P  VP+M
Sbjct  27    YKPPESILVDCGSAKEGQDADGRKWVTDQGSNWLIDGGKSSIMADADVQDPSLPSPVPYM  86

Query  528   TARTFQSEFTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQ  701
             +AR F  E  Y+F +  + R +LRL+FYPA+Y+G+ A    FSV      TLL+NFS   
Sbjct  87    SARVFTKEAVYNFSIGDTDRHWLRLHFYPAAYHGVPAEQFFFSVSTSTGITLLRNFSVYI  146

Query  702   TTEALNFDFLVKEFSVN-VPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGST  878
             T +AL+  ++++EF++  +    L++TFTP+  +  S AFVNGIE++S PDI+  AD +T
Sbjct  147   TAKALSQAYIIREFTLPPMTDGKLSLTFTPTAMNNASYAFVNGIEIISMPDIF--ADPAT  204

Query  879   MIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETA  1058
             M VG +       +++L+++YR+NVGG+ I+P++D+G+ R W +D+ Y++ A  GVT  A
Sbjct  205   M-VGLSDQTVDTAASSLQTMYRLNVGGSYIAPTNDSGLSRDWYDDTPYLYGAAVGVTYKA  263

Query  1059  DDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFC  1238
             DD  + I +      Y AP  +Y + RSMGPN  VN NYNLTW F VDS F Y+VRLHFC
Sbjct  264   DD-KVQIKFSSPEAEYAAPTSLYLSSRSMGPNPKVNQNYNLTWVFEVDSNFTYIVRLHFC  322

Query  1239  EFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             E   ++T++N+R F IY+NN+TA+  AD I W  +  VP
Sbjct  323   EL--LLTKVNQRAFDIYINNKTAQADADVIGWTSEKDVP  359



>ref|XP_007032808.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
 gb|EOY03734.1| Malectin/receptor-like protein kinase family protein, putative 
[Theobroma cacao]
Length=910

 Score =   282 bits (722),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 164/352 (47%), Positives = 213/352 (61%), Gaps = 28/352 (8%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADS-------QKPSVP  512
             Y P + I ++CG        DNR WT D   KF     +S+ ++  S       Q PSV 
Sbjct  43    YNPIENITIDCGSSTDGHALDNRPWTGDGNGKFSPIEQQSNNNNKSSVLLTALEQPPSVD  102

Query  513   QVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLN--ATNSVFSVRVGEYTLLKN  686
             +VP+ TAR   SEFTY+  + +G+KF+RLYFYP SY G +  +  + FSV+ G +TLL+N
Sbjct  103   KVPYSTARLSYSEFTYTISLTAGQKFIRLYFYPTSYRGFDDPSNKAFFSVKAGPFTLLRN  162

Query  687   FSA-----GQTTEALNFDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHP  848
             FSA     GQ T       L+KEF +NV  GE LN+TFTPSP+  +S AF+NGIE+VS P
Sbjct  163   FSALLHAQGQPT-------LIKEFCLNVDEGERLNLTFTPSPDISDSYAFINGIEIVSMP  215

Query  849   -DIY--NTADGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSK  1019
              ++Y    +D     +GQ S   + N++ALE ++RVNVGG  ISP  DTGM+R+W  D  
Sbjct  216   TNLYYRQASDEGVTFLGQGSSYPLGNNSALEMVHRVNVGGMQISPQDDTGMYRNWLSDDD  275

Query  1020  YIFSAGTGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPV  1199
             Y+  A        +  N+T S    + ++ AP  VY T RSMG N + N NYNLTW FPV
Sbjct  276   YLAIAKPSALPVNNSVNLTFS---SILSFSAPRVVYLTARSMGRNKTENENYNLTWEFPV  332

Query  1200  DSGFFYLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             DSGF Y VRLHFCEF   IT+  +RVF I+L N TAE  AD IAW+G NG P
Sbjct  333   DSGFSYFVRLHFCEFQIEITQQGDRVFEIFLANLTAETQADVIAWSGGNGFP  384



>ref|XP_002530995.1| kinase, putative [Ricinus communis]
 gb|EEF31383.1| kinase, putative [Ricinus communis]
Length=888

 Score =   281 bits (719),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 160/341 (47%), Positives = 210/341 (62%), Gaps = 13/341 (4%)
 Frame = +3

Query  360   PTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST--SSADSQKPSVPQVPFMTA  533
             P D ILLNCG     T  D R W  D  SKFL    ++++   SA  + PS  +VP+M A
Sbjct  25    PADLILLNCGTSSSATSLDGRGWDGDAQSKFLASNSETASYGCSASQRDPSATEVPYMDA  84

Query  534   RTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEA  713
             R  QS+FTY FPV+ G KF+RLYFYP  Y+ L  + S FSV   +YTLL+NFSA     A
Sbjct  85    RVSQSKFTYLFPVSPGSKFVRLYFYPTKYSDLEISKSFFSVTANDYTLLRNFSAYLAVSA  144

Query  714   LNFDF--LVKEFSVNV--PGETLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNTADGST  878
             +  D    VKE+ + V    + L++TF+    S  S AF+NGIE+VS PD +Y ++  + 
Sbjct  145   MKPDVYSFVKEYVITVWDNNQKLDLTFSA---SRGSFAFINGIEIVSIPDNLYASSINNP  201

Query  879   MI-VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTET  1055
             +  VG N+P  +DN+TALE+ +R+NVGG  IS S DTGM+R+W +DS YIF    G+  T
Sbjct  202   LTYVGINNPFYLDNTTALETFHRLNVGGKDISGSGDTGMYRTWLQDSDYIFGGAFGLL-T  260

Query  1056  ADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHF  1235
                 N+TI Y    P Y AP+ VY  LR MG + + + NYNLTW F VD+GF YLVRLHF
Sbjct  261   ILPKNVTIKYKMATPDYTAPLLVYSILRFMGHDPNRSMNYNLTWLFSVDAGFNYLVRLHF  320

Query  1236  CEFTTIITE-INERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             CEF   I E  N+ VF +++NNQTA+   D I  +G   VP
Sbjct  321   CEFRVEIAESWNQLVFFVFINNQTADDQVDVIYLSGGKSVP  361



>ref|XP_008341791.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Malus domestica]
Length=856

 Score =   281 bits (718),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 155/347 (45%), Positives = 218/347 (63%), Gaps = 15/347 (4%)
 Frame = +3

Query  354   YVPTDKILLNCG-GPDGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  524
             Y P D I L CG   D V  QD R W+ D+ SK       G S    A +   S  QVP+
Sbjct  29    YKPVDDITLQCGFSGDQVNQQDERTWSGDINSKLSPFQAAGSSFVFKAATPISSSSQVPY  88

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQ  701
              TAR  +S+FTY+FP+ SG+KF+RLYFYP SY    +   S+FSV    +TLL++F+A  
Sbjct  89    TTARLSRSKFTYTFPLTSGQKFIRLYFYPTSYAAEFDRLKSLFSVEARGFTLLRDFNASV  148

Query  702   TTEALNFDFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHPD--IYN---T  863
             T +A   + + +EF +N+  E +LN+TFTPS  SP++ AF+NGIE+VS PD   YN   +
Sbjct  149   TADASWSETVSREFCLNIASEQSLNITFTPSRASPDAYAFINGIEIVSMPDNLYYNPPQS  208

Query  864   ADGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWD---EDSKYIFSA  1034
             ADG+ + VG  +P  I+N+TA+E +YR+NVGG+ +S + DTGM+R+WD   E+  Y+   
Sbjct  209   ADGA-VYVGSINPYWIENNTAMEMVYRINVGGSQLSFNQDTGMYRNWDGIQEEYNYLDDL  267

Query  1035  GTGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFF  1214
                 +    + ++ + +   +P Y AP EVY+T RSMG N ++N +YNLTW FPVDS F+
Sbjct  268   SKNFSRLPQNSSIQLDFSK-IPKYSAPEEVYRTARSMGRNKTINKSYNLTWGFPVDSTFY  326

Query  1215  YLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             Y +RLHFCEF   +T   +R+F I++ NQTAE  AD I W+   G P
Sbjct  327   YFIRLHFCEFEGAVTLPRDRLFQIFIANQTAEKMADVIWWSQGYGKP  373



>gb|KCW87969.1| hypothetical protein EUGRSUZ_A00377, partial [Eucalyptus grandis]
Length=831

 Score =   280 bits (716),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/332 (44%), Positives = 217/332 (65%), Gaps = 13/332 (4%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST--SSADSQKPSVPQ-VPFMTARTFQ  545
             ++ CG      D D R W+ D   +FL     + T  + A+ Q PS+P  VP+M AR F 
Sbjct  8     MIACGASKRGADSDGRAWSPD--PRFLASPAVTDTVPAEAEFQDPSLPSPVPYMFARVFT  65

Query  546   SEFTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNF  722
             +  +Y F V    R +LRL+FYP+SY+ L+ ++S F+V V  +TLL NFSA  T +AL  
Sbjct  66    APASYRFSVPPRARLWLRLHFYPSSYSNLDPSDSYFAVGVNGFTLLNNFSASITAQALTQ  125

Query  723   DFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNS  899
              ++++EFS+   G   LN+TFTPS     + AF+NGIE++  PDI+  A  +TM+   + 
Sbjct  126   AYIIREFSLAPVGSGNLNITFTPSVEHGGAYAFINGIEIIWMPDIFEEA--ATMVGFSDQ  183

Query  900   PLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTI  1079
              +++  S+ L+++YR+NVGG  I P++D+G+ R+W +D+ Y+F A  GVT  AD   + +
Sbjct  184   AVSVGGSS-LQTLYRLNVGGQYIPPTNDSGLTRTWYDDTPYLFGAAAGVTSEADR-KVKV  241

Query  1080  SYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIIT  1259
              YPP +P YVAP++VY+T R+MGP+  VN NYNLTW F +D+ F Y+VR HFC+F  ++ 
Sbjct  242   RYPPDVPEYVAPLDVYRTARTMGPDPKVNKNYNLTWVFQIDANFTYIVRFHFCDF--LLD  299

Query  1260  EINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             ++N+RVF I++NNQTA+  AD IAW+G  G P
Sbjct  300   KVNQRVFDIFVNNQTAQASADVIAWSGSKGAP  331



>ref|XP_002447169.1| hypothetical protein SORBIDRAFT_06g029710 [Sorghum bicolor]
 gb|EES11497.1| hypothetical protein SORBIDRAFT_06g029710 [Sorghum bicolor]
Length=877

 Score =   281 bits (718),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 154/338 (46%), Positives = 212/338 (63%), Gaps = 14/338 (4%)
 Frame = +3

Query  357   VPTDKILLNCGG--PDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQV-PFM  527
             + + +I L+CG   P G  D D R W +D  SKF     K   ++A  Q  S+P   P+M
Sbjct  30    IGSGQIRLDCGATSPTG-PDADGRSWDSDTNSKFAPAL-KGIAATASYQDSSLPSATPYM  87

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASY-NGLNATNSVFSVRVGEYTLLKNFSAGQT  704
             TAR F S +TYSFPV+ G  F+RLYFYP +Y +   A ++ F V  G  TLL +F+A QT
Sbjct  88    TARIFTSNYTYSFPVSPGCMFVRLYFYPTNYVSNHAAADAYFGVTAGNLTLLYDFNASQT  147

Query  705   TEAL---NFDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGS  875
               A+   +  F V+E+ +NV   +LN+TF+PS +   S AF+NGIE+V  PD++ T    
Sbjct  148   AAAVTPVSVAFFVREYYINVTEGSLNLTFSPSTHHNGSYAFINGIEIVPTPDLFTTPK-P  206

Query  876   TMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTET  1055
             T++ G N  L     T  +++YR+NVGG  I P  D   +RSW +DS YI+++  GVT  
Sbjct  207   TLVNGGNMDLA---GTGFQTMYRLNVGGQAIPPQGDVDFYRSWGDDSFYIYASDYGVTFG  263

Query  1056  ADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHF  1235
              D+ N+TI+Y P +P Y AP  VY T RSMGPNA +N N+NLTW  PVD+GF+YL+R HF
Sbjct  264   KDN-NLTITYTPSVPNYTAPFNVYATARSMGPNAQINLNHNLTWILPVDAGFYYLLRFHF  322

Query  1236  CEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNG  1349
             CE    IT++N+R F IY+NNQTA+   D IA++G  G
Sbjct  323   CEIQYPITKVNQRSFFIYINNQTAQQQMDVIAFSGGIG  360



>ref|XP_006405671.1| hypothetical protein EUTSA_v10027636mg [Eutrema salsugineum]
 gb|ESQ47124.1| hypothetical protein EUTSA_v10027636mg [Eutrema salsugineum]
Length=876

 Score =   280 bits (717),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 166/344 (48%), Positives = 207/344 (60%), Gaps = 19/344 (6%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADS--QKPSVPQVPFM  527
             Y PTD  L NCG      D   R WT +   K L     +++  ++S  Q   VPQVP+ 
Sbjct  27    YTPTDVFLFNCGATSDTVDNTGRNWTAE-NRKILSSNPVNASFPSESSFQDSGVPQVPYT  85

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSVRVGEYTLLKNFSAGQT  704
             TAR F+SEFTYSFPV+ G KFLRLY YP SY  G +A NS+FSV V  +TL++NFSA  T
Sbjct  86    TARIFRSEFTYSFPVSPGDKFLRLYIYPTSYKPGFDAVNSLFSVTVNGFTLMENFSADLT  145

Query  705   TEALN--FDFLVKEFSVNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGST  878
               A     +FL+KEF V V   TLN+TFTPSPNS   LAFVNGIE++S PD + +  G  
Sbjct  146   VRASKPVSNFLIKEFIVPVHHNTLNLTFTPSPNS---LAFVNGIEILSIPDRFYSKGGFD  202

Query  879   MI---VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVT  1049
              +   VG     +IDN TA E++YR+NV G  +S   DT MFR W  D ++I S  +G+ 
Sbjct  203   DVITNVGSTVDFHIDNKTAFETVYRLNVAGQDVS---DTDMFRRWLSDDEFILSENSGLK  259

Query  1050  ETADDYNMTISYPPGMPTYVAPVEVYKTLRSMG--PNASVNANYNLTWYFPVDSGFFYLV  1223
                 D  +T  Y    P YVAP +VYKT RSMG   N  +N N+NLTW   VD+GF YLV
Sbjct  260   PDVPDAEIT--YTEETPVYVAPEDVYKTFRSMGNIKNPKLNLNFNLTWPLNVDAGFNYLV  317

Query  1224  RLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             RLHFCE    + E  ERVF I+L NQ A+   D I  +G + VP
Sbjct  318   RLHFCETLPEVDETGERVFSIFLGNQMAKLEMDVIQLSGGSRVP  361



>ref|XP_010065050.1| PREDICTED: receptor-like protein kinase ANXUR2 [Eucalyptus grandis]
Length=858

 Score =   280 bits (716),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 145/332 (44%), Positives = 217/332 (65%), Gaps = 13/332 (4%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSST--SSADSQKPSVPQ-VPFMTARTFQ  545
             ++ CG      D D R W+ D   +FL     + T  + A+ Q PS+P  VP+M AR F 
Sbjct  35    MIACGASKRGADSDGRAWSPD--PRFLASPAVTDTVPAEAEFQDPSLPSPVPYMFARVFT  92

Query  546   SEFTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNF  722
             +  +Y F V    R +LRL+FYP+SY+ L+ ++S F+V V  +TLL NFSA  T +AL  
Sbjct  93    APASYRFSVPPRARLWLRLHFYPSSYSNLDPSDSYFAVGVNGFTLLNNFSASITAQALTQ  152

Query  723   DFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNS  899
              ++++EFS+   G   LN+TFTPS     + AF+NGIE++  PDI+  A  +TM+   + 
Sbjct  153   AYIIREFSLAPVGSGNLNITFTPSVEHGGAYAFINGIEIIWMPDIFEEA--ATMVGFSDQ  210

Query  900   PLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTI  1079
              +++  S+ L+++YR+NVGG  I P++D+G+ R+W +D+ Y+F A  GVT  AD   + +
Sbjct  211   AVSVGGSS-LQTLYRLNVGGQYIPPTNDSGLTRTWYDDTPYLFGAAAGVTSEADR-KVKV  268

Query  1080  SYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIIT  1259
              YPP +P YVAP++VY+T R+MGP+  VN NYNLTW F +D+ F Y+VR HFC+F  ++ 
Sbjct  269   RYPPDVPEYVAPLDVYRTARTMGPDPKVNKNYNLTWVFQIDANFTYIVRFHFCDF--LLD  326

Query  1260  EINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             ++N+RVF I++NNQTA+  AD IAW+G  G P
Sbjct  327   KVNQRVFDIFVNNQTAQASADVIAWSGSKGAP  358



>ref|NP_001055089.1| Os05g0280700 [Oryza sativa Japonica Group]
 gb|AAS98512.1| putative protein kinase [Oryza sativa Japonica Group]
 dbj|BAF17003.1| Os05g0280700 [Oryza sativa Japonica Group]
 gb|EAY97366.1| hypothetical protein OsI_19288 [Oryza sativa Indica Group]
 gb|EEE63092.1| hypothetical protein OsJ_17900 [Oryza sativa Japonica Group]
Length=869

 Score =   280 bits (716),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 159/337 (47%), Positives = 217/337 (64%), Gaps = 14/337 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSS-TSSADSQKPSVPQ-VPFM  527
             Y PT+ IL+NCG      D D RKW +D  SK+L+   KSS  ++AD Q PS+P  VP+M
Sbjct  26    YKPTESILVNCGSDKEGQDIDGRKWLSDKDSKWLIDGEKSSIMANADFQDPSLPSPVPYM  85

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQT  704
             TAR F  E  Y+F V   R ++RL+FYPASY+ L A N  FSV      TLLKNFS   T
Sbjct  86    TARVFTKETMYNFSVGEERHWVRLHFYPASYHDLPAENFFFSVSTSTGITLLKNFSVYIT  145

Query  705   TEALNFDFLVKEFSVNVPGET--LNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGST  878
              +AL+  ++++EF++  P  T  L++ FTP+  +  S AFVNGIE++S P+I++ A  S 
Sbjct  146   AKALSQAYIIREFTLP-PSTTGSLSLIFTPTAMNNASYAFVNGIEIISMPNIFSQAAASV  204

Query  879   MIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETA  1058
              I G N     D+S  L++IYR+NVGG+ ++P++D+G+ R W +D+ YI+ A  GVT  A
Sbjct  205   DIAG-NEVSTTDSS--LQTIYRLNVGGSYVAPTNDSGLSRDWYDDTPYIYGAAVGVTYQA  261

Query  1059  DDYNMTISYPPGMP--TYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLH  1232
             +D  + I YP   P   Y AP  VY T RSMGP+  VN NY LTW F VD  F Y+VRLH
Sbjct  262   ND-TVQIKYPKNDPDAEYAAPASVYLTSRSMGPDPKVNKNYKLTWVFEVDGNFTYIVRLH  320

Query  1233  FCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGK  1343
             FCE   ++++ N+RVF I +NN+TA+ GAD I W G+
Sbjct  321   FCEL--LLSKPNQRVFDILINNKTAQSGADVIGWGGQ  355



>ref|XP_008464587.1| PREDICTED: receptor-like protein kinase FERONIA [Cucumis melo]
Length=908

 Score =   281 bits (718),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 148/351 (42%), Positives = 212/351 (60%), Gaps = 19/351 (5%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQ--DNRKWTTDVGSKFL----LGTGKSSTSSADSQKPSVPQ  515
             Y P D I L CG    +++   D R W  D+ SKF        G S TS AD+Q  SV  
Sbjct  33    YQPIDNIPLVCGSHGNLSNSYLDGRIWVGDIDSKFFPSDHQQNGASMTSKADAQSTSVTT  92

Query  516   VPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSA  695
             VP+MTAR  +S+FTYSFPV+ G KF+RLYFY A+Y   + + +VFSVR G +TLL++F+ 
Sbjct  93    VPYMTARLSRSQFTYSFPVSPGHKFIRLYFYSANYQQFDRSKAVFSVRAGRFTLLRDFNT  152

Query  696   GQTTEALNFDFLVKEFSVNVP--GETLNVTFTPSPNSPNSLAFVNGIEVVSHP-------  848
                 +A N + + +EF V V    + LN+TFTP+  + +S AF++GIE+VS P       
Sbjct  153   SVNADASNNNEIFREFCVYVEEYDQKLNLTFTPT--NQDSYAFISGIEIVSMPSNLYYTP  210

Query  849   -DIYNTADGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSW-DEDSKY  1022
              D+ +        VGQ+    I+N T+LE +YR+N+GG  ISP  DTGMFR+W +E+  +
Sbjct  211   LDLNDEGGRGLKQVGQSKFFPIENYTSLEMVYRINIGGRFISPIEDTGMFRTWFNEERNF  270

Query  1023  IFSAGTGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVD  1202
             +    +       D+++ ++Y   +P Y AP +VY+T R+MGP+ + N  YNLTW +PVD
Sbjct  271   LIPFPSKYDAQPADFSIRLNYSSKVPAYTAPEDVYRTARTMGPDNTENKRYNLTWEYPVD  330

Query  1203  SGFFYLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
              GFFY++RLHFCEF   I    +RVF+IY+ +   E  A+   WA   G+P
Sbjct  331   PGFFYMIRLHFCEFQKEINSTEDRVFLIYIRDTIVEGSANVFYWAEGKGIP  381



>ref|XP_008368476.1| PREDICTED: LOW QUALITY PROTEIN: receptor-like protein kinase 
FERONIA [Malus domestica]
Length=892

 Score =   280 bits (717),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 161/355 (45%), Positives = 214/355 (60%), Gaps = 31/355 (9%)
 Frame = +3

Query  354   YVPTDKILLNCG-GPDGVTDQDNRKWTTDVGSKF--LLGTGKSSTSSADSQKPSVPQVPF  524
             Y P D I L CG   D V  QD R W+ D+ SKF      G SS   A +   S  QVP+
Sbjct  29    YKPVDDITLQCGFSGDQVNQQDGRTWSGDINSKFSPFQAAGSSSVYKAATPIXSSSQVPY  88

Query  525   MTARTFQSEFTYSFPVASGRKFLRLYFYPASYNG-LNATNSVFSVRVGEYTLLKNFSAGQ  701
              TAR  +SEFTY+FP+ SG+KF+RLYFYP SY    + + S+FSV  G +TLL++F+A  
Sbjct  89    TTARLSRSEFTYTFPLTSGQKFIRLYFYPTSYAAEFDRSKSLFSVEAGGFTLLRDFNASV  148

Query  702   TTEALNFDFLVKEFSVNVPGE-TLNVTFTPSPNSPNSLAFVNGIEVVSHPD-IYNT----  863
             T +A   + + +EF +N+  E +LN+TFTPS  SP++ AF+NGIE+VS PD +Y T    
Sbjct  149   TADAFXSETVSREFCLNIASEQSLNITFTPSRASPDAYAFINGIEIVSMPDNLYYTXPQS  208

Query  864   ADGSTMIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTG  1043
             ADG  + VG  +   I N+ A+E +YR+NVGG+ +S + DTGM+R+WD         G  
Sbjct  209   ADGP-VSVGSINXXXIXNNXAMEMVYRINVGGSQLSFNRDTGMYRNWD---------GIQ  258

Query  1044  VT-ETADDYNMTISYPP----------GMPTYVAPVEVYKTLRSMGPNASVNANYNLTWY  1190
             V     DD +   S  P           +P Y AP EVY+T RSMG N ++N NYNLTW 
Sbjct  259   VEYNYLDDLSKNFSVLPQNSSIQPDFSKIPEYSAPEEVYRTARSMGRNKTINKNYNLTWG  318

Query  1191  FPVDSGFFYLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             FPVDS F+Y +RLHFCEF   +T   +R+F I++ NQ AE  AD I W+   G P
Sbjct  319   FPVDSTFYYFIRLHFCEFEGAVTLPRDRLFQIFIANQKAEQFADVITWSQGYGKP  373



>gb|AFW77551.1| putative receptor-like protein kinase family protein [Zea mays]
Length=870

 Score =   280 bits (715),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 153/339 (45%), Positives = 214/339 (63%), Gaps = 11/339 (3%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSS-TSSADSQKPSVPQ-VPFM  527
             Y PT+ IL+NCG      D D RKW  D    +L+  GKSS    AD Q PS+P  VP+M
Sbjct  26    YKPTESILVNCGSAKEGKDVDGRKWAADQDKSWLVDAGKSSIMGDADVQDPSLPSPVPYM  85

Query  528   TARTFQSEFTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQ  701
             TAR F  E  Y+F V    R +LRL+FYPA+Y+G+ A    FSV      TLL+NFS   
Sbjct  86    TARVFTKEAMYNFSVGDADRHWLRLHFYPAAYHGVPAEQFFFSVSTSTGITLLRNFSVYI  145

Query  702   TTEALNFDFLVKEFSVN-VPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGST  878
             T +AL+  ++++EF++  +   TL +TF P+  +  S AFVNGIE++S PDI+  AD +T
Sbjct  146   TAKALSQAYIIREFTLPPMADGTLALTFKPTAMNNASYAFVNGIEIISMPDIF--ADPAT  203

Query  879   MIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETA  1058
             M+   +  ++   S+ L+++YR+NVGG+ I+P++D+G+ R W +D+ Y++ A  GVT   
Sbjct  204   MVGLADQTVDTATSS-LQTMYRLNVGGSYIAPTNDSGLSRDWYDDTPYLYGAAVGVTYKP  262

Query  1059  DDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFC  1238
             DD N  I +P     Y AP  +Y + RSMGPN  VN NYNLTW F VDS F Y+VRLHFC
Sbjct  263   DD-NAQIKFPSPEAEYAAPASLYLSSRSMGPNPKVNQNYNLTWVFEVDSNFTYVVRLHFC  321

Query  1239  EFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             E   ++T++N+R F I++NN+TA+  AD I W     VP
Sbjct  322   EL--LLTKVNQRAFDIFVNNKTAQADADVIGWTSGKDVP  358



>ref|XP_007216899.1| hypothetical protein PRUPE_ppa019630mg [Prunus persica]
 gb|EMJ18098.1| hypothetical protein PRUPE_ppa019630mg [Prunus persica]
Length=862

 Score =   279 bits (714),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 150/349 (43%), Positives = 222/349 (64%), Gaps = 16/349 (5%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTD-QDNRKWTTDVGSKF---LLGTGKSSTSSADSQKP---SVP  512
             Y P + I +NCG  + +++  D R W  D+ SKF    L    ++TSS   + P   SV 
Sbjct  29    YTPVEDITINCGSSETLSNIYDKRNWVGDIKSKFSPSELHQADTNTSSEVRKAPPSSSVS  88

Query  513   QVPFMTARTFQSEFTYSFPVASGRKFLRLYFYPASYN-GLNATNSVFSVRVGEYTLLKNF  689
             QVP+ TAR  + EF+Y   +++G+KF+R YFYP SY+ G + + ++FSV+ G +TLL +F
Sbjct  89    QVPYTTARLSRFEFSYKISLSTGQKFIRFYFYPVSYDPGFDRSKALFSVQAGGFTLLHDF  148

Query  690   SAGQTTEALNFDFLVKEFSVNV-PGETLNVTFTPSPNSPNSLAFVNGIEVVSHP-DIYNT  863
             +A  T +A   + L++EF +N+  G++L +TFTPS   P++ AFVNGIE+VS P ++Y T
Sbjct  149   NASVTADASETETLIREFCLNIDEGQSLTITFTPSRAIPDAYAFVNGIEIVSMPTNLYYT  208

Query  864   ADGSTMI--VGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWD---EDSKYIF  1028
             A  S  +  VG  +   I+N TA+E +YR+NVGG+ +S   DTGM+R+WD   ++ KY+ 
Sbjct  209   ASESHGVDYVGNEANYRIENITAMEMVYRINVGGSALSFDQDTGMYRNWDSVVDEQKYLD  268

Query  1029  SAGTGVTETADDYNMTISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSG  1208
                +  T    + ++ +++   +P Y AP  VY+T RSMG N + N +Y LTW FPVD  
Sbjct  269   DLSSRWTVLPQNVSLQLNFVK-IPEYCAPQVVYRTGRSMGSNHTRNKSYKLTWEFPVDPM  327

Query  1209  FFYLVRLHFCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             F YL+RLHFCEF   I +  +R F+IY+ NQ AEP AD I W+G NG+P
Sbjct  328   FLYLLRLHFCEFEPEIMDPGDRSFLIYVENQLAEPQADLIVWSGGNGIP  376



>ref|XP_006654205.1| PREDICTED: receptor-like protein kinase FERONIA-like [Oryza brachyantha]
Length=868

 Score =   278 bits (711),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 155/337 (46%), Positives = 219/337 (65%), Gaps = 14/337 (4%)
 Frame = +3

Query  354   YVPTDKILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSS-TSSADSQKPSVPQ-VPFM  527
             Y PT+ IL++CG      D D RKW +D  SK+L+  GKSS  ++AD Q PS+P  VP+M
Sbjct  26    YKPTESILVDCGADKEGQDVDGRKWVSDKDSKWLVDGGKSSIMANADFQDPSLPSPVPYM  85

Query  528   TARTFQSEFTYSFPVASGRKFLRLYFYPASYNGLNATNSVFSVRVGE-YTLLKNFSAGQT  704
             +AR F  E  Y+FP+   R ++RL+FYPASY+ L A N  FSV      TLLKNFS   T
Sbjct  86    SARVFTKEAAYNFPIGEDRHWVRLHFYPASYHDLPAENFFFSVSTSTGITLLKNFSVYIT  145

Query  705   TEALNFDFLVKEFSVNVPGET--LNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGST  878
              + L+  ++VKEF++  P  T  L++TFTP+  +  S AFVNGIE++S P+I++    S 
Sbjct  146   AKVLSQAYIVKEFTLP-PSTTGSLSLTFTPTAMNNASYAFVNGIEIISMPNIFSQPATSV  204

Query  879   MIVGQNSPLNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETA  1058
              I G N     D+S  ++++YR+NVGG+ ++P++D+G+ R W +D+ YI+ A +GVT  A
Sbjct  205   DIEG-NEVSTTDSS--MQTVYRLNVGGSYVAPANDSGLSRDWYDDTPYIYGAASGVTYQA  261

Query  1059  DDYNMTISYPPGMP--TYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLH  1232
             +D  + I YP   P    +AP  VY T RSMGP+  VN NY LTW F VD  F Y+VRLH
Sbjct  262   ND-TVQIKYPKNDPDAEAIAPASVYLTSRSMGPDPKVNQNYKLTWVFEVDGNFTYMVRLH  320

Query  1233  FCEFTTIITEINERVFIIYLNNQTAEPGADAIAWAGK  1343
             FCE   ++++ N+RVF I +NN+TA+ GAD + W G+
Sbjct  321   FCEL--LLSKPNQRVFDILINNKTAQSGADVVGWGGQ  355



>ref|XP_010025009.1| PREDICTED: receptor-like protein kinase ANXUR1 [Eucalyptus grandis]
Length=860

 Score =   278 bits (711),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 153/333 (46%), Positives = 220/333 (66%), Gaps = 17/333 (5%)
 Frame = +3

Query  372   ILLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVP-QVPFMTARTFQS  548
             ++L+CG   G  D D +KW +D  SK+   +  S++  A  Q PS+P  VP+M+AR F S
Sbjct  31    LILSCGSTGGGKDADGQKWDSD--SKYFT-SNNSTSEKAMFQDPSLPSDVPYMSARIFTS  87

Query  549   EFTYSFPVASG-RKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFD  725
               TY  PV SG R ++RL+FYP+SY  L+  ++ FSV  G  TLLKNFSA  T +AL   
Sbjct  88    VGTYQLPVKSGNRYWVRLHFYPSSYGSLDPADAYFSVVAGSVTLLKNFSASVTAQALTQA  147

Query  726   FLVKEFSVNVPGET--LNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVGQNS  899
             +LVKE+S+ VP ++  +N+TFTPS     + AFVNGIE++  PD++++A    M+   + 
Sbjct  148   YLVKEYSL-VPSDSDFVNITFTPSDKHSGAFAFVNGIELIPIPDLFDSAQ---MVGFSDQ  203

Query  900   PLNIDNSTALESIYRVNVGGNVISPSSDTG-MFRSWDEDSKYIFSAGTGVTETADDYNMT  1076
             P++   +  L+++YR+NVGG  I PS+D+G + R+W +D+ Y++ A  GVT  AD   + 
Sbjct  204   PVDA-KAANLQTMYRLNVGGQYIPPSNDSGSLTRTWYDDTPYLYGAVAGVTNEADK-KVK  261

Query  1077  ISYPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTII  1256
             I Y   +P YVAPV+VY+T RSMG + ++N NYNLTW F VD+ F YLVR+HFC++    
Sbjct  262   IQYN-DLPDYVAPVDVYRTARSMGYDKNLNKNYNLTWQFQVDANFTYLVRMHFCDY--FC  318

Query  1257  TEINERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             T++N+RVF IY+NNQ A+  AD I WA   GVP
Sbjct  319   TKVNQRVFTIYINNQIAQEAADVIGWASAEGVP  351



>ref|XP_010258502.1| PREDICTED: receptor-like protein kinase ANXUR1 [Nelumbo nucifera]
Length=855

 Score =   278 bits (710),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 153/331 (46%), Positives = 217/331 (66%), Gaps = 15/331 (5%)
 Frame = +3

Query  375   LLNCGGPDGVTDQDNRKWTTDVGSKFLLGTGKSSTSSADSQKPSVPQ-VPFMTARTFQSE  551
             LL+CG      D D R W  D  SK+L     S  S+A+ Q PS+P  +P+M+AR F + 
Sbjct  32    LLSCGSTSSDADSDGRTWEPD--SKYLETQDNSMPSTAEFQDPSLPSTIPYMSARVFTAP  89

Query  552   FTYSFPVA-SGRKFLRLYFYPASYNGLNATNSVFSVRVGEYTLLKNFSAGQTTEALNFDF  728
              +Y F ++ + R ++RL+FYP SY+GLNAT++ FSV  G  TLL NFSA  T EAL   +
Sbjct  90    SSYKFSISLNDRHWVRLHFYPTSYSGLNATDAFFSVVAGGVTLLNNFSAYITAEALTQAY  149

Query  729   LVKEFS-VNVPGETLNVTFTPSPNSPNSLAFVNGIEVVSHPDIYNTADGSTMIVG-QNSP  902
             +++EFS V VP   L++TFTPS     S AF+NGIEV+  P+++  A    M+VG  + P
Sbjct  150   IIREFSLVPVPTGQLSLTFTPSDKHDGSYAFINGIEVIPMPNVFQNA----MLVGFPDQP  205

Query  903   LNIDNSTALESIYRVNVGGNVISPSSDTGMFRSWDEDSKYIFSAGTGVTETADDYNMTIS  1082
             +++ +S  L+++YR+NVGG  ISP +D+G+ R+W +DS Y+F A  G++  A   N+TI 
Sbjct  206   VDVQSSN-LQTMYRLNVGGQYISPVNDSGLTRTWYDDSPYLFGANMGISFEAGK-NVTIQ  263

Query  1083  YPPGMPTYVAPVEVYKTLRSMGPNASVNANYNLTWYFPVDSGFFYLVRLHFCEFTTIITE  1262
             Y        AP++VY + R+MGP ++VNAN NLTW F VD  F Y+VR HFCE    +T+
Sbjct  264   YTDEQKP-AAPLDVYSSARTMGPESTVNANANLTWVFQVDGSFMYVVRFHFCELD--MTK  320

Query  1263  INERVFIIYLNNQTAEPGADAIAWAGKNGVP  1355
             +N+RVF IY+NNQTA+ GAD I W+G  G+P
Sbjct  321   VNQRVFDIYVNNQTAQVGADVILWSGGRGIP  351



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4021510853400