BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9305

Length=732
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

dbj|BAO57289.1|  ATP-dependent Lon protease                             372   4e-119   Ipomoea nil [qian niu]
emb|CDP13424.1|  unnamed protein product                                323   1e-100   Coffea canephora [robusta coffee]
ref|XP_002282657.1|  PREDICTED: lon protease homolog 2, peroxisomal     322   5e-100   Vitis vinifera
ref|XP_009615530.1|  PREDICTED: lon protease homolog 2, peroxisom...    318   1e-98    Nicotiana tomentosiformis
ref|XP_010110520.1|  Lon protease-2-like protein                        315   2e-97    
ref|XP_008373622.1|  PREDICTED: lon protease homolog 2, peroxisomal     314   6e-97    Malus domestica [apple tree]
ref|XP_009371862.1|  PREDICTED: lon protease homolog 2, peroxisomal     314   7e-97    
ref|XP_009615537.1|  PREDICTED: lon protease homolog 2, peroxisom...    312   3e-96    Nicotiana tomentosiformis
emb|CAN75012.1|  hypothetical protein VITISV_034238                     312   6e-96    Vitis vinifera
ref|XP_007210904.1|  hypothetical protein PRUPE_ppa001173mg             311   8e-96    Prunus persica
ref|XP_009765598.1|  PREDICTED: lon protease homolog 2, peroxisom...    310   1e-95    Nicotiana sylvestris
ref|XP_009341221.1|  PREDICTED: lon protease homolog 2, peroxisom...    308   7e-95    Pyrus x bretschneideri [bai li]
ref|XP_009341220.1|  PREDICTED: lon protease homolog 2, peroxisom...    309   7e-95    Pyrus x bretschneideri [bai li]
ref|XP_008348469.1|  PREDICTED: lon protease homolog 2, peroxisom...    308   9e-95    Malus domestica [apple tree]
ref|XP_009765597.1|  PREDICTED: lon protease homolog 2, peroxisom...    304   3e-93    Nicotiana sylvestris
ref|XP_011070270.1|  PREDICTED: lon protease homolog 2, peroxisomal     304   3e-93    Sesamum indicum [beniseed]
ref|XP_007155737.1|  hypothetical protein PHAVU_003G2274001g            293   3e-93    Phaseolus vulgaris [French bean]
ref|XP_012075201.1|  PREDICTED: lon protease homolog 2, peroxisomal     303   8e-93    Jatropha curcas
ref|XP_010274558.1|  PREDICTED: lon protease homolog 2, peroxisomal     303   8e-93    Nelumbo nucifera [Indian lotus]
ref|XP_006440121.1|  hypothetical protein CICLE_v10018797mg             298   3e-91    
ref|XP_006440122.1|  hypothetical protein CICLE_v10018797mg             299   4e-91    Citrus clementina [clementine]
ref|XP_004300290.1|  PREDICTED: lon protease homolog 2, peroxisomal     298   4e-91    Fragaria vesca subsp. vesca
ref|XP_010055388.1|  PREDICTED: lon protease homolog 2, peroxisomal     298   9e-91    Eucalyptus grandis [rose gum]
gb|EYU33045.1|  hypothetical protein MIMGU_mgv1a001102mg                297   1e-90    Erythranthe guttata [common monkey flower]
gb|EYU17852.1|  hypothetical protein MIMGU_mgv1a0010891mg               291   8e-90    Erythranthe guttata [common monkey flower]
ref|XP_010325534.1|  PREDICTED: lon protease homolog 2, peroxisom...    295   1e-89    Solanum lycopersicum
gb|EPS62878.1|  hypothetical protein M569_11910                         293   3e-89    Genlisea aurea
ref|XP_006358613.1|  PREDICTED: lon protease homolog 2, peroxisom...    293   4e-89    Solanum tuberosum [potatoes]
ref|XP_003517387.1|  PREDICTED: lon protease homolog 2, peroxisom...    293   6e-89    Glycine max [soybeans]
gb|KHN42642.1|  Lon protease like 2, peroxisomal                        293   6e-89    Glycine soja [wild soybean]
ref|XP_007156608.1|  hypothetical protein PHAVU_002G002900g             289   1e-88    Phaseolus vulgaris [French bean]
ref|XP_007039619.1|  Lon protease 2                                     291   2e-88    
ref|XP_004150167.1|  PREDICTED: lon protease homolog 2, peroxisom...    290   4e-88    Cucumis sativus [cucumbers]
ref|XP_008448748.1|  PREDICTED: lon protease homolog 2, peroxisom...    290   5e-88    Cucumis melo [Oriental melon]
ref|XP_007156607.1|  hypothetical protein PHAVU_002G002900g             289   6e-88    Phaseolus vulgaris [French bean]
ref|XP_008788653.1|  PREDICTED: LOW QUALITY PROTEIN: lon protease...    290   7e-88    Phoenix dactylifera
gb|KJB25416.1|  hypothetical protein B456_004G190200                    288   1e-87    Gossypium raimondii
ref|XP_008229504.1|  PREDICTED: LOW QUALITY PROTEIN: lon protease...    288   2e-87    
gb|KJB25415.1|  hypothetical protein B456_004G190200                    288   3e-87    Gossypium raimondii
gb|KJB39795.1|  hypothetical protein B456_007G030900                    288   4e-87    Gossypium raimondii
gb|KHG28341.1|  Lon protease, peroxisomal -like protein                 288   5e-87    Gossypium arboreum [tree cotton]
gb|KJB39796.1|  hypothetical protein B456_007G030900                    287   6e-87    Gossypium raimondii
gb|KJB39792.1|  hypothetical protein B456_007G030900                    287   7e-87    Gossypium raimondii
ref|XP_010677210.1|  PREDICTED: lon protease homolog 2, peroxisomal     287   8e-87    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002528799.1|  ATP-dependent protease La, putative                286   2e-86    Ricinus communis
dbj|BAA20482.1|  ATP-dependent protease Lon                             286   2e-86    Spinacia oleracea
ref|XP_011032006.1|  PREDICTED: lon protease homolog 2, peroxisom...    286   2e-86    Populus euphratica
sp|O04979.2|LONP2_SPIOL  RecName: Full=Lon protease homolog 2, pe...    285   3e-86    Spinacia oleracea
ref|XP_010935031.1|  PREDICTED: lon protease homolog 2, peroxisomal     285   6e-86    Elaeis guineensis
ref|XP_003524333.1|  PREDICTED: lon protease homolog 2, peroxisom...    283   2e-85    Glycine max [soybeans]
ref|XP_010941248.1|  PREDICTED: lon protease homolog 2, peroxisom...    283   4e-85    Elaeis guineensis
gb|KHN01656.1|  Lon protease like 2, peroxisomal                        282   4e-85    Glycine soja [wild soybean]
ref|XP_003549964.1|  PREDICTED: lon protease homolog 2, peroxisom...    282   5e-85    Glycine max [soybeans]
ref|XP_010941247.1|  PREDICTED: lon protease homolog 2, peroxisom...    282   5e-85    Elaeis guineensis
ref|XP_010941245.1|  PREDICTED: lon protease homolog 2, peroxisom...    282   6e-85    Elaeis guineensis
ref|XP_010941244.1|  PREDICTED: lon protease homolog 2, peroxisom...    282   7e-85    Elaeis guineensis
ref|XP_008799399.1|  PREDICTED: lon protease homolog 2, peroxisom...    280   3e-84    Phoenix dactylifera
ref|XP_004511756.1|  PREDICTED: lon protease homolog 2, peroxisom...    279   6e-84    Cicer arietinum [garbanzo]
gb|KJB39794.1|  hypothetical protein B456_007G030900                    278   3e-83    Gossypium raimondii
gb|KHG09410.1|  Lon protease, peroxisomal -like protein                 277   6e-83    Gossypium arboreum [tree cotton]
gb|KEH31576.1|  lon-related ATP-dependent protease, putative            276   9e-83    Medicago truncatula
ref|XP_006368476.1|  Lon protease 1 family protein                      276   1e-82    Populus trichocarpa [western balsam poplar]
gb|KHN21044.1|  Lon protease like 2, peroxisomal                        276   1e-82    Glycine soja [wild soybean]
ref|XP_002304362.2|  Lon protease 1 family protein                      275   2e-82    
ref|XP_009393749.1|  PREDICTED: lon protease homolog 2, peroxisomal     275   3e-82    Musa acuminata subsp. malaccensis [pisang utan]
gb|ACF78488.1|  unknown                                                 266   3e-82    Zea mays [maize]
ref|XP_004957462.1|  PREDICTED: lon protease homolog 2, peroxisom...    267   6e-82    
ref|XP_004508987.1|  PREDICTED: lon protease homolog 2, peroxisom...    273   1e-81    Cicer arietinum [garbanzo]
ref|XP_003611421.1|  Lon protease-like protein                          273   2e-81    Medicago truncatula
ref|XP_006398398.1|  hypothetical protein EUTSA_v10000767mg             272   3e-81    Eutrema salsugineum [saltwater cress]
gb|AAK62365.1|AF385580_1  Lon protease                                  271   8e-81    Dichanthelium lanuginosum
gb|KFK31410.1|  hypothetical protein AALP_AA6G108400                    271   9e-81    Arabis alpina [alpine rockcress]
ref|XP_011018661.1|  PREDICTED: lon protease homolog 2, peroxisomal     271   1e-80    Populus euphratica
ref|XP_010530002.1|  PREDICTED: lon protease homolog 2, peroxisom...    268   5e-80    Tarenaya hassleriana [spider flower]
ref|XP_010530001.1|  PREDICTED: lon protease homolog 2, peroxisom...    268   8e-80    Tarenaya hassleriana [spider flower]
ref|XP_010530000.1|  PREDICTED: lon protease homolog 2, peroxisom...    268   1e-79    Tarenaya hassleriana [spider flower]
ref|XP_009383286.1|  PREDICTED: lon protease homolog 2, peroxisom...    268   1e-79    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006854015.1|  PREDICTED: lon protease homolog 2, peroxisomal     268   1e-79    Amborella trichopoda
ref|XP_010529999.1|  PREDICTED: lon protease homolog 2, peroxisom...    268   2e-79    Tarenaya hassleriana [spider flower]
ref|XP_010495794.1|  PREDICTED: lon protease homolog 2, peroxisom...    264   3e-79    
ref|XP_009101454.1|  PREDICTED: lon protease homolog 2, peroxisomal     266   3e-79    Brassica rapa
emb|CDY33510.1|  BnaA06g35630D                                          266   3e-79    Brassica napus [oilseed rape]
emb|CDX77732.1|  BnaC07g19860D                                          266   3e-79    
ref|NP_001105903.1|  lon protease homolog 2, peroxisomal                266   6e-79    Zea mays [maize]
ref|XP_010441513.1|  PREDICTED: lon protease homolog 2, peroxisomal     265   8e-79    Camelina sativa [gold-of-pleasure]
ref|XP_004970472.1|  PREDICTED: lon protease homolog 2, peroxisom...    265   8e-79    Setaria italica
ref|NP_568675.1|  lon protease-like 2                                   265   1e-78    Arabidopsis thaliana [mouse-ear cress]
dbj|BAD33324.1|  putative Lon protease                                  264   3e-78    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063769.1|  Os09g0533400                                       264   4e-78    
gb|AAM95459.1|  Lon protease                                            263   4e-78    Oryza sativa Indica Group [Indian rice]
sp|B8BDV1.1|LONP2_ORYSI  RecName: Full=Lon protease homolog 2, pe...    263   4e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_006279987.1|  hypothetical protein CARUB_v10025858mg             262   2e-77    Capsella rubella
ref|XP_002863374.1|  hypothetical protein ARALYDRAFT_494276             261   3e-77    
ref|XP_002462726.1|  hypothetical protein SORBIDRAFT_02g030960          261   4e-77    Sorghum bicolor [broomcorn]
ref|XP_010518860.1|  PREDICTED: lon protease homolog 2, peroxisomal     259   2e-76    
ref|XP_010481381.1|  PREDICTED: lon protease homolog 2, peroxisomal     257   1e-75    Camelina sativa [gold-of-pleasure]
dbj|BAJ95084.1|  predicted protein                                      256   2e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006661475.1|  PREDICTED: lon protease homolog 2, peroxisom...    254   1e-74    
ref|XP_003578503.1|  PREDICTED: lon protease homolog 2, peroxisomal     249   5e-73    Brachypodium distachyon [annual false brome]
gb|AAS19619.1|  LON1 protease                                           247   4e-72    Triticum aestivum [Canadian hard winter wheat]
ref|XP_008670352.1|  PREDICTED: lon protease homolog 2, peroxisom...    223   4e-69    
ref|XP_002974838.1|  hypothetical protein SELMODRAFT_150045             210   8e-59    
gb|EMS60327.1|  Lon protease-like protein 2, peroxisomal                209   2e-58    Triticum urartu
gb|EMT28056.1|  Lon protease-like protein, mitochondrial                190   1e-52    
ref|XP_002963756.1|  hypothetical protein SELMODRAFT_141788             186   4e-50    
gb|KDO52684.1|  hypothetical protein CISIN_1g003349mg                   179   4e-48    Citrus sinensis [apfelsine]
ref|XP_010325536.1|  PREDICTED: lon protease homolog 2, peroxisom...    177   2e-47    Solanum lycopersicum
ref|XP_011032007.1|  PREDICTED: lon protease homolog 2, peroxisom...    169   4e-44    Populus euphratica
ref|XP_001757793.1|  predicted protein                                  166   4e-43    
gb|KEH31578.1|  lon-related ATP-dependent protease, putative            155   3e-39    Medicago truncatula
gb|KEH31577.1|  lon-related ATP-dependent protease, putative            154   5e-39    Medicago truncatula
ref|XP_002980173.1|  hypothetical protein SELMODRAFT_444435             139   1e-34    
ref|XP_002963350.1|  hypothetical protein SELMODRAFT_405160           97.4    6e-20    
ref|XP_002501871.1|  lon protease                                     76.3    3e-12    Micromonas commoda
ref|XP_003057661.1|  predicted protein                                69.7    3e-10    Micromonas pusilla CCMP1545
ref|XP_001633523.1|  predicted protein                                58.2    1e-06    Nematostella vectensis
gb|KFH65868.1|  ATP-dependent protease La                             57.4    4e-06    Mortierella verticillata NRRL 6337
ref|XP_008364428.1|  PREDICTED: uncharacterized protein LOC103428108  56.6    6e-06    
ref|WP_036158520.1|  Lon protease                                     52.8    2e-04    Maribacter forsetii
gb|ERZ96146.1|  hypothetical protein GLOINDRAFT_334534                52.4    2e-04    
ref|XP_002446246.1|  hypothetical protein SORBIDRAFT_06g009066        43.9    7e-04    
ref|XP_008309291.1|  PREDICTED: lon protease homolog 2, peroxisomal   50.1    0.001    Cynoglossus semilaevis [half-smooth tongue sole]



>dbj|BAO57289.1| ATP-dependent Lon protease [Ipomoea nil]
Length=886

 Score =   372 bits (956),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 180/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            SAETTTVAPTLSPGV TDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAETTTVAPTLSPGVATDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  180

Query  730  S  732
            S
Sbjct  181  S  181



>emb|CDP13424.1| unnamed protein product [Coffea canephora]
Length=888

 Score =   323 bits (829),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            SAET TVAP+LS G+ TDS +R  K+Q G S++HKH+ KN QEVIHWHNRGVAARALHLS
Sbjct  61   SAETATVAPSLSQGLGTDSVERNSKSQVGVSDAHKHESKNAQEVIHWHNRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITSLDMTK EMEQVEQD +FI+L
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITSLDMTKTEMEQVEQDPDFISL  180

Query  730  S  732
            +
Sbjct  181  T  181



>ref|XP_002282657.1| PREDICTED: lon protease homolog 2, peroxisomal [Vitis vinifera]
 emb|CBI33970.3| unnamed protein product [Vitis vinifera]
Length=888

 Score =   322 bits (826),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AE TTV P LS GV TDS +R+ K Q  TSES+K DGKNQQEVIHWH RGVAARALHLS
Sbjct  61   TAEMTTVGPLLSQGVGTDSGERSSKIQVATSESNKPDGKNQQEVIHWHTRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI+SLDM K EMEQVEQD EFIAL
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARISSLDMNKTEMEQVEQDPEFIAL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_009615530.1| PREDICTED: lon protease homolog 2, peroxisomal {ECO:0000255|HAMAP-Rule:MF_03121} 
isoform X1 [Nicotiana tomentosiformis]
Length=888

 Score =   318 bits (816),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MGESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            SAET T     S G   +SA+R  KNQAG S++HKHD KNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAETATSGTATSSGGGVESAERGLKNQAGISDTHKHDSKNQQEVIHWHNRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITSLDM+K EME +EQDQEFIAL
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITSLDMSKAEMELIEQDQEFIAL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_010110520.1| Lon protease-2-like protein [Morus notabilis]
 gb|EXC26738.1| Lon protease-2-like protein [Morus notabilis]
Length=865

 Score =   315 bits (806),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPARLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AETTTV P LS GV +DS +R  + Q GTS+SHK DGKNQQE IHWH RGVAARALHLS
Sbjct  61   AAETTTVGPVLSQGVGSDSGERNSRVQVGTSDSHKLDGKNQQEAIHWHTRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYY+ARI+ L+MTK EMEQVEQD +FI L
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFTVQELSTRGTYYSARISPLEMTKAEMEQVEQDPDFITL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_008373622.1| PREDICTED: lon protease homolog 2, peroxisomal [Malus domestica]
Length=888

 Score =   314 bits (804),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AE  TVAP LS GV +DS +R+ + Q GTS+SH+ DGKNQQEVIHWH RGVAARALHLS
Sbjct  61   AAEAATVAPVLSQGVGSDSGERSSRVQVGTSDSHRPDGKNQQEVIHWHTRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGLCRF+VQELSTRGTYYTARI+ L+MTK EMEQVEQD EFI+L
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNVQELSTRGTYYTARISPLEMTKSEMEQVEQDPEFISL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_009371862.1| PREDICTED: lon protease homolog 2, peroxisomal [Pyrus x bretschneideri]
Length=888

 Score =   314 bits (804),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AE  TVAP LS GV +DS +R+ + Q GTS+SH+ DGKNQQEVIHWH RGVAARALHLS
Sbjct  61   AAEAATVAPVLSQGVGSDSGERSSRVQVGTSDSHRPDGKNQQEVIHWHTRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGLCRF+VQELSTRGTYYTARI+ L+MTK EMEQVEQD EFI+L
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNVQELSTRGTYYTARISPLEMTKSEMEQVEQDPEFISL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_009615537.1| PREDICTED: lon protease homolog 2, peroxisomal {ECO:0000255|HAMAP-Rule:MF_03121} 
isoform X2 [Nicotiana tomentosiformis]
Length=882

 Score =   312 bits (799),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 161/181 (89%), Gaps = 6/181 (3%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MGESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            SAET T       G   +SA+R  KNQAG S++HKHD KNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAETAT------SGGGVESAERGLKNQAGISDTHKHDSKNQQEVIHWHNRGVAARALHLS  114

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITSLDM+K EME +EQDQEFIAL
Sbjct  115  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITSLDMSKAEMELIEQDQEFIAL  174

Query  730  S  732
            S
Sbjct  175  S  175



>emb|CAN75012.1| hypothetical protein VITISV_034238 [Vitis vinifera]
Length=904

 Score =   312 bits (799),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 164/197 (83%), Gaps = 16/197 (8%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLS----------------PGVVTDSADRTPKNQAGTSESHKHDGKNQQEV  501
            +AE TTV P LS                 GV TDS +R+ K Q  TSES+K DGKNQQEV
Sbjct  61   TAEMTTVXPLLSQVSFIACFEGNAFYLSAGVGTDSGERSSKIQVATSESNKPDGKNQQEV  120

Query  502  IHWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMT  681
            IHWH RGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI+SLDM 
Sbjct  121  IHWHTRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARISSLDMN  180

Query  682  KPEMEQVEQDQEFIALS  732
            K EMEQVEQD EFIALS
Sbjct  181  KTEMEQVEQDPEFIALS  197



>ref|XP_007210904.1| hypothetical protein PRUPE_ppa001173mg [Prunus persica]
 gb|EMJ12103.1| hypothetical protein PRUPE_ppa001173mg [Prunus persica]
Length=888

 Score =   311 bits (797),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELPGRL ILPF+NKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLGILPFKNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AE  +V P LS GV ++S +R  + Q GTS+SH+ DGKNQQEVIHWH RGVAARALHLS
Sbjct  61   AAEAASVGPVLSQGVGSESGERGSRVQVGTSDSHRLDGKNQQEVIHWHTRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGLCRFSVQELSTRGTYYTARI+ L+MTK EMEQVEQD EFI L
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFSVQELSTRGTYYTARISPLEMTKAEMEQVEQDPEFITL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_009765598.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X2 [Nicotiana 
sylvestris]
Length=882

 Score =   310 bits (795),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 159/181 (88%), Gaps = 6/181 (3%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MGESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            SA T T       G   +SA+R  KNQ G S++HKHD KNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAATAT------SGAGVESAERGLKNQTGISDTHKHDSKNQQEVIHWHNRGVAARALHLS  114

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITSLDMTK EME +EQDQEFIAL
Sbjct  115  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITSLDMTKAEMELIEQDQEFIAL  174

Query  730  S  732
            S
Sbjct  175  S  175



>ref|XP_009341221.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Pyrus x bretschneideri]
Length=888

 Score =   308 bits (790),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +A+  TV P +S GV TDS +R+ + Q G S+SH+ DGKNQQEVIHWH+RGVAARALHLS
Sbjct  61   AADAATVDPVVSQGVGTDSGERSSRVQVGASDSHRLDGKNQQEVIHWHSRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGLCRF+VQELSTRGTYYTARI+ L+MTK EMEQVEQD +FI+L
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNVQELSTRGTYYTARISPLEMTKTEMEQVEQDPDFISL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_009341220.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Pyrus x bretschneideri]
Length=900

 Score =   309 bits (791),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +A+  TV P +S GV TDS +R+ + Q G S+SH+ DGKNQQEVIHWH+RGVAARALHLS
Sbjct  61   AADAATVDPVVSQGVGTDSGERSSRVQVGASDSHRLDGKNQQEVIHWHSRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGLCRF+VQELSTRGTYYTARI+ L+MTK EMEQVEQD +FI+L
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNVQELSTRGTYYTARISPLEMTKTEMEQVEQDPDFISL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_008348469.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Malus domestica]
Length=888

 Score =   308 bits (789),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPTRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AE  TV P +S GV TDS +R+ + Q G S+SH+ DGKNQQEVIHWH+RGVAARALHLS
Sbjct  61   AAEAATVGPVVSQGVGTDSGERSSRVQVGVSDSHRLDGKNQQEVIHWHSRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGLCRF++QELSTRGTYYTARI+ L+MTK EMEQVEQD ++I+L
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFNIQELSTRGTYYTARISPLEMTKTEMEQVEQDPDYISL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_009765597.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X1 [Nicotiana 
sylvestris]
Length=888

 Score =   304 bits (779),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MGESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            SA T T     S G   +SA+R  KNQ G S++HKHD KNQQEVIHWHNRGVAARALHLS
Sbjct  61   SAATATSGTATSSGAGVESAERGLKNQTGISDTHKHDSKNQQEVIHWHNRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITSLDMTK EME +EQDQEFIAL
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITSLDMTKAEMELIEQDQEFIAL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_011070270.1| PREDICTED: lon protease homolog 2, peroxisomal [Sesamum indicum]
Length=889

 Score =   304 bits (779),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAP-TLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            +A  +  A  TL+PG  T+  +R+ KNQ  TS+SHKH GKNQQEVIHWHN+GVAARALHL
Sbjct  61   AAAESQSAASTLAPGGGTNLGERSSKNQEETSDSHKHGGKNQQEVIHWHNKGVAARALHL  120

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI  LDMTK EM+QVEQD +FIA
Sbjct  121  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIIPLDMTKVEMDQVEQDPDFIA  180

Query  727  LS  732
            LS
Sbjct  181  LS  182



>ref|XP_007155737.1| hypothetical protein PHAVU_003G2274001g, partial [Phaseolus vulgaris]
 gb|ESW27731.1| hypothetical protein PHAVU_003G2274001g, partial [Phaseolus vulgaris]
Length=462

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 158/181 (87%), Gaps = 2/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPF+NKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFKNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AE   V PT+S G  TDSA++  + Q G+S+SHK D K Q +V+HWHNRGVAAR LHLS
Sbjct  61   AAEIKAVGPTVSEG--TDSANQNTRVQGGSSDSHKLDTKRQNDVVHWHNRGVAARPLHLS  118

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY VVLEGLCRFSVQELSTRG Y+TARITSL+MTK E+EQVEQD +FI L
Sbjct  119  RGVEKPSGRVTYTVVLEGLCRFSVQELSTRGIYHTARITSLEMTKTELEQVEQDPDFIML  178

Query  730  S  732
            S
Sbjct  179  S  179



>ref|XP_012075201.1| PREDICTED: lon protease homolog 2, peroxisomal [Jatropha curcas]
 gb|KDP45972.1| hypothetical protein JCGZ_11875 [Jatropha curcas]
Length=895

 Score =   303 bits (776),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 162/184 (88%), Gaps = 3/184 (2%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAE---TTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARAL  540
            +A    T +V PTLS GV +DS +R+ K Q G +E+ K DGKNQQEVI WHNRGVAARAL
Sbjct  61   AAAEETTASVGPTLSQGVGSDSGERSSKIQVGNAENLKLDGKNQQEVIRWHNRGVAARAL  120

Query  541  HLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEF  720
            HLSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG YYTARI+SL+MTK EMEQVEQD +F
Sbjct  121  HLSRGVEKPSGRVTYIVVLEGLCRFSVQELSKRGMYYTARISSLEMTKAEMEQVEQDPDF  180

Query  721  IALS  732
            ++LS
Sbjct  181  VSLS  184



>ref|XP_010274558.1| PREDICTED: lon protease homolog 2, peroxisomal [Nelumbo nucifera]
Length=888

 Score =   303 bits (776),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M E VELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIGVLPVRD
Sbjct  1    MVEPVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGVLPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AETT+V   LSPGV T+S D+  K    TS+SHK D KNQQE+IHWH RGVAARALHLS
Sbjct  61   AAETTSVGSILSPGVGTESGDQGVKEPVSTSDSHKQDSKNQQELIHWHTRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGLCRFSVQELS RGTYYTARI+ LD+TK EMEQ EQD + IAL
Sbjct  121  RGVEKPSGRVTYVVVLEGLCRFSVQELSARGTYYTARISRLDITKAEMEQAEQDPDLIAL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_006440121.1| hypothetical protein CICLE_v10018797mg [Citrus clementina]
 gb|ESR53361.1| hypothetical protein CICLE_v10018797mg [Citrus clementina]
Length=863

 Score =   298 bits (764),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 159/182 (87%), Gaps = 6/182 (3%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M ESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MTESVELPNRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVT-DSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            +A  T+V PT+S G V  DS++R  K Q G S     DGKNQQEVIHWHNRGVAARALHL
Sbjct  61   AAADTSVGPTVSQGGVGGDSSERASKVQVGAS-----DGKNQQEVIHWHNRGVAARALHL  115

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI+SL+MTK EMEQVEQD +FIA
Sbjct  116  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARISSLEMTKIEMEQVEQDPDFIA  175

Query  727  LS  732
            LS
Sbjct  176  LS  177



>ref|XP_006440122.1| hypothetical protein CICLE_v10018797mg [Citrus clementina]
 ref|XP_006477041.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Citrus sinensis]
 gb|ESR53362.1| hypothetical protein CICLE_v10018797mg [Citrus clementina]
Length=886

 Score =   299 bits (765),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 159/182 (87%), Gaps = 6/182 (3%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M ESVELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MTESVELPNRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVT-DSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            +A  T+V PT+S G V  DS++R  K Q G S     DGKNQQEVIHWHNRGVAARALHL
Sbjct  61   AAADTSVGPTVSQGGVGGDSSERASKVQVGAS-----DGKNQQEVIHWHNRGVAARALHL  115

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARI+SL+MTK EMEQVEQD +FIA
Sbjct  116  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARISSLEMTKIEMEQVEQDPDFIA  175

Query  727  LS  732
            LS
Sbjct  176  LS  177



>ref|XP_004300290.1| PREDICTED: lon protease homolog 2, peroxisomal [Fragaria vesca 
subsp. vesca]
Length=887

 Score =   298 bits (764),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 158/181 (87%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RL ILPF+NKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLGILPFKNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AE   V P LS G+ +DS +R+ K Q GTS+  + DGKNQQ+ IHWH RGVAARALHLS
Sbjct  61   AAEAAAVGPMLSQGMGSDSGERSSKVQVGTSDPQRLDGKNQQD-IHWHTRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGLCRFSVQELSTRGTYYTARI+ L+MTK EMEQVEQD EFI L
Sbjct  120  RGVEKPSGRVTYVVVLEGLCRFSVQELSTRGTYYTARISPLEMTKSEMEQVEQDPEFITL  179

Query  730  S  732
            S
Sbjct  180  S  180



>ref|XP_010055388.1| PREDICTED: lon protease homolog 2, peroxisomal [Eucalyptus grandis]
 gb|KCW71845.1| hypothetical protein EUGRSUZ_E00326 [Eucalyptus grandis]
Length=888

 Score =   298 bits (762),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            + ET +V+P +S GV TD  +R+ K QA +++SHK +GKN QEVIHWH RGVAARALHLS
Sbjct  61   AEETPSVSPVISHGVGTDLTERSSKTQASSTDSHKLNGKNPQEVIHWHARGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGLCRFSVQEL TRGTYY ARIT L+MTK EME VEQD +FIAL
Sbjct  121  RGVEKPSGRVTYMVVLEGLCRFSVQELGTRGTYYIARITPLEMTKAEMEHVEQDPDFIAL  180

Query  730  S  732
            S
Sbjct  181  S  181



>gb|EYU33045.1| hypothetical protein MIMGU_mgv1a001102mg [Erythranthe guttata]
Length=889

 Score =   297 bits (761),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 159/182 (87%), Gaps = 1/182 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKG+IG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGIIGILPVRD  60

Query  370  SA-ETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            +A E  +   T S G  T+  +R+ K Q  TS+SHK  GKNQQEVIHWHNRGVAARALHL
Sbjct  61   AAVEAPSAGSTSSAGGGTNLGERSSKTQEETSDSHKLGGKNQQEVIHWHNRGVAARALHL  120

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT L+M K EM+QVEQD +F+A
Sbjct  121  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITPLEMAKAEMDQVEQDPDFVA  180

Query  727  LS  732
            LS
Sbjct  181  LS  182



>gb|EYU17852.1| hypothetical protein MIMGU_mgv1a0010891mg, partial [Erythranthe 
guttata]
Length=685

 Score =   291 bits (744),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 159/189 (84%), Gaps = 8/189 (4%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKG+IG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGIIGILPVRD  60

Query  370  SA-ETTTVAPTLSPGV-------VTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGV  525
            +A E  +   T S G         T+  +R+ K Q  TS+SHK  GKNQQEVIHWHNRGV
Sbjct  61   AAVEAPSAGSTSSAGNRCTLSRGGTNLGERSSKTQEETSDSHKLGGKNQQEVIHWHNRGV  120

Query  526  AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVE  705
            AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT L+M K EM+QVE
Sbjct  121  AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITPLEMAKAEMDQVE  180

Query  706  QDQEFIALS  732
            QD +F+ALS
Sbjct  181  QDPDFVALS  189



>ref|XP_010325534.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X1 [Solanum 
lycopersicum]
Length=877

 Score =   295 bits (754),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 156/181 (86%), Gaps = 11/181 (6%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            SAE+ T    +S G+  +           TS+SHK D KNQQEVIHWH+RGVAARALHLS
Sbjct  61   SAESATSGTAVSSGMGGE-----------TSDSHKLDSKNQQEVIHWHDRGVAARALHLS  109

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITSLDMTK EME +EQDQEF+AL
Sbjct  110  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITSLDMTKGEMELIEQDQEFVAL  169

Query  730  S  732
            S
Sbjct  170  S  170



>gb|EPS62878.1| hypothetical protein M569_11910 [Genlisea aurea]
Length=886

 Score =   293 bits (751),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 157/181 (87%), Gaps = 5/181 (3%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP R+AILPFRNKVLLPG+IIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRIAILPFRNKVLLPGSIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +A +       S G+ T+  +R PK+Q   S+SHKH GKNQQE+IHWHNRGVAARALHLS
Sbjct  61   AAGSLQ-----SSGLGTNVMERNPKSQDDASDSHKHGGKNQQEIIHWHNRGVAARALHLS  115

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEG+CRF VQ+L  RGTYYTARIT+LDM+K EM+QVEQD EFIAL
Sbjct  116  RGVEKPSGRVTYIVVLEGMCRFGVQDLINRGTYYTARITTLDMSKAEMDQVEQDPEFIAL  175

Query  730  S  732
            S
Sbjct  176  S  176



>ref|XP_006358613.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Solanum 
tuberosum]
Length=877

 Score =   293 bits (750),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 156/181 (86%), Gaps = 11/181 (6%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            SAE+ T    +S G+  +           TS+SHK D KNQQEVIHWH+RGVAARALHLS
Sbjct  61   SAESATSGTAVSSGMGGE-----------TSDSHKLDSKNQQEVIHWHDRGVAARALHLS  109

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+VQELSTRGTYYTARITSLDMTK E+E +EQDQEF+AL
Sbjct  110  RGVEKPSGRVTYIVVLEGLCRFNVQELSTRGTYYTARITSLDMTKGELELIEQDQEFVAL  169

Query  730  S  732
            S
Sbjct  170  S  170



>ref|XP_003517387.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Glycine max]
Length=889

 Score =   293 bits (749),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAES ELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESFELPNRLAILPFRNKVLLPGAIIRIRCTSPISVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SA-ETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            +A E     P +S G  TDS D+  K Q G+S+S K D KNQ +V+HWHNRGVAARALHL
Sbjct  61   AAAEIQPAGPVISHGKGTDSLDQNSKVQGGSSDSQKLDVKNQHDVVHWHNRGVAARALHL  120

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTY+TARI+SL+MTK EMEQVEQD +FI 
Sbjct  121  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYHTARISSLEMTKTEMEQVEQDPDFIT  180

Query  727  LS  732
            LS
Sbjct  181  LS  182



>gb|KHN42642.1| Lon protease like 2, peroxisomal [Glycine soja]
Length=889

 Score =   293 bits (749),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAES ELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESFELPNRLAILPFRNKVLLPGAIIRIRCTSPISVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SA-ETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            +A E     P +S G  TDS D+  K Q G+S+S K D KNQ +V+HWHNRGVAARALHL
Sbjct  61   AAAEIQPAGPVISHGKGTDSLDQNSKVQGGSSDSQKLDVKNQHDVVHWHNRGVAARALHL  120

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTY+TARI+SL+MTK EMEQVEQD +FI 
Sbjct  121  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYHTARISSLEMTKTEMEQVEQDPDFIT  180

Query  727  LS  732
            LS
Sbjct  181  LS  182



>ref|XP_007156608.1| hypothetical protein PHAVU_002G002900g [Phaseolus vulgaris]
 gb|ESW28602.1| hypothetical protein PHAVU_002G002900g [Phaseolus vulgaris]
Length=722

 Score =   289 bits (739),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAES+ELP RLAILPFRNKVLLPGAIIRI CTSP SVKLVEQELWQRE+KGLIG+LPVRD
Sbjct  1    MAESIELPSRLAILPFRNKVLLPGAIIRIYCTSPTSVKLVEQELWQREDKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +A+  T AP +  GV TDS D++ K Q G+  SH+ D  +Q +V+HWH RGVAARALHLS
Sbjct  61   AAQLKTAAPVVPHGVGTDSLDKSSKVQGGSPNSHELDANSQHDVVHWHKRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRFSVQELS RGTY+TARI+SL+MT+ EMEQVEQD +FI L
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFSVQELSMRGTYHTARISSLEMTRTEMEQVEQDPDFIML  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_007039619.1| Lon protease 2 [Theobroma cacao]
 gb|EOY24120.1| Lon protease 2 [Theobroma cacao]
Length=888

 Score =   291 bits (745),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MA+SVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAQSVELPGRLAILPFRNKVLLPGAFIRIRCTSHSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +A+ T++   LS GV ++S +R+ K +A TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AADMTSMDSVLSQGVGSESGERSSKVKASTSDAHKVDGKNHPEVIHWHNRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+V+ELSTRG Y TA+I+SL+MTK EMEQVEQD +F+ L
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVEELSTRGPYCTAKISSLEMTKAEMEQVEQDPDFVML  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_004150167.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X1 [Cucumis 
sativus]
 gb|KGN55802.1| hypothetical protein Csa_3G016960 [Cucumis sativus]
Length=886

 Score =   290 bits (743),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M ESVELP RL ILPFRNKVLLPGAIIRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLGILPFRNKVLLPGAIIRIRCTSSSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
             A+   + P LS GV +DS DR+ + Q+GTS+S + DGKN QEVI WH+RGVAARAL LS
Sbjct  61   DADAPAIVPVLSQGVGSDSGDRSSRVQSGTSDSQRVDGKNHQEVIQWHSRGVAARALQLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY VVLEGLCRF+VQELSTRGTYYTARI+  +MTK EMEQVEQD +FI+L
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFTVQELSTRGTYYTARISPSEMTKAEMEQVEQDPDFISL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_008448748.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X1 [Cucumis 
melo]
Length=886

 Score =   290 bits (743),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M ESVELP RL ILPFRNKVLLPGAIIRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLGILPFRNKVLLPGAIIRIRCTSSSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
             A+   + P LS GV +DS DR+ + Q+GTS+S + DGKN QEVI WH+RGVAARAL LS
Sbjct  61   DADAPAIVPVLSQGVGSDSGDRSSRVQSGTSDSQRVDGKNHQEVIQWHSRGVAARALQLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY VVLEGLCRF+VQELSTRGTYYTARI+  +MTK EMEQVEQD +FI+L
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFTVQELSTRGTYYTARISPSEMTKAEMEQVEQDPDFISL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_007156607.1| hypothetical protein PHAVU_002G002900g, partial [Phaseolus vulgaris]
 gb|ESW28601.1| hypothetical protein PHAVU_002G002900g, partial [Phaseolus vulgaris]
Length=828

 Score =   289 bits (739),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAES+ELP RLAILPFRNKVLLPGAIIRI CTSP SVKLVEQELWQRE+KGLIG+LPVRD
Sbjct  1    MAESIELPSRLAILPFRNKVLLPGAIIRIYCTSPTSVKLVEQELWQREDKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +A+  T AP +  GV TDS D++ K Q G+  SH+ D  +Q +V+HWH RGVAARALHLS
Sbjct  61   AAQLKTAAPVVPHGVGTDSLDKSSKVQGGSPNSHELDANSQHDVVHWHKRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRFSVQELS RGTY+TARI+SL+MT+ EMEQVEQD +FI L
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFSVQELSMRGTYHTARISSLEMTRTEMEQVEQDPDFIML  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_008788653.1| PREDICTED: LOW QUALITY PROTEIN: lon protease homolog 2, peroxisomal-like 
[Phoenix dactylifera]
Length=888

 Score =   290 bits (742),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 152/182 (84%), Gaps = 2/182 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE VELPGRL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIGVLPVRD
Sbjct  1    MAELVELPGRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGVLPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGT-SESHKHDGKNQQEVIHWHNRGVAARALHL  546
            S E  TV   LSPGV  DS +R+ K  A    +S K DGKNQQE+IHWHNRGVAARALHL
Sbjct  61   S-EAATVGSMLSPGVGNDSGERSLKGPADVLGDSQKQDGKNQQELIHWHNRGVAARALHL  119

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG YY AR++ LDMTK E+EQ EQD + I 
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGNYYIARVSRLDMTKVELEQAEQDPDLIL  179

Query  727  LS  732
            LS
Sbjct  180  LS  181



>gb|KJB25416.1| hypothetical protein B456_004G190200 [Gossypium raimondii]
Length=832

 Score =   288 bits (737),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSHSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AE T++   LS GV ++S +R+ K Q  TS++HK DGK+  EVIHWH RGVAARALHLS
Sbjct  61   AAEMTSMDSVLSQGVGSESGERSSKVQISTSDAHKVDGKSHPEVIHWHKRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+V+ELSTRG Y TA+I+SL+MTK EMEQVEQD +F+ L
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVEELSTRGPYCTAKISSLEMTKAEMEQVEQDPDFVTL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_008229504.1| PREDICTED: LOW QUALITY PROTEIN: lon protease homolog 2, peroxisomal 
[Prunus mume]
Length=886

 Score =   288 bits (738),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 154/181 (85%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RL ILPF+NKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLGILPFKNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AE  +V P LS GV ++S +R  + Q GTS+SHK D       IHWH RGVAARALHLS
Sbjct  61   AAEAASVGPVLSQGVGSESGERGSRVQVGTSDSHKLD-XXXXXXIHWHTRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGLCRFSVQELSTRGTYYTARI+ L+MTK EMEQVEQD EFI L
Sbjct  120  RGVEKPSGRVTYVVVLEGLCRFSVQELSTRGTYYTARISPLEMTKSEMEQVEQDPEFITL  179

Query  730  S  732
            S
Sbjct  180  S  180



>gb|KJB25415.1| hypothetical protein B456_004G190200 [Gossypium raimondii]
Length=888

 Score =   288 bits (737),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSHSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AE T++   LS GV ++S +R+ K Q  TS++HK DGK+  EVIHWH RGVAARALHLS
Sbjct  61   AAEMTSMDSVLSQGVGSESGERSSKVQISTSDAHKVDGKSHPEVIHWHKRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+V+ELSTRG Y TA+I+SL+MTK EMEQVEQD +F+ L
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVEELSTRGPYCTAKISSLEMTKAEMEQVEQDPDFVTL  180

Query  730  S  732
            S
Sbjct  181  S  181



>gb|KJB39795.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
Length=875

 Score =   288 bits (736),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESGERSSNVQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+ L+MTK EMEQVEQD +F+ L
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKISPLEMTKSEMEQVEQDPDFVTL  180

Query  730  S  732
            S
Sbjct  181  S  181



>gb|KHG28341.1| Lon protease, peroxisomal -like protein [Gossypium arboreum]
Length=888

 Score =   288 bits (736),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSHSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AE T++   LS GV ++S +R+ K Q  TS++HK DGK+  EVIHWH RGVAARALHLS
Sbjct  61   AAEMTSMDSVLSQGVGSESGERSSKVQISTSDNHKVDGKSHPEVIHWHKRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+V+ELSTRG Y TA+I+SL+MTK EMEQVEQD +F+ L
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNVEELSTRGPYCTAKISSLEMTKAEMEQVEQDPDFVTL  180

Query  730  S  732
            S
Sbjct  181  S  181



>gb|KJB39796.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
Length=881

 Score =   287 bits (735),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESGERSSNVQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+ L+MTK EMEQVEQD +F+ L
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKISPLEMTKSEMEQVEQDPDFVTL  180

Query  730  S  732
            S
Sbjct  181  S  181



>gb|KJB39792.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
 gb|KJB39793.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
 gb|KJB39797.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
Length=890

 Score =   287 bits (735),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESGERSSNVQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+ L+MTK EMEQVEQD +F+ L
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKISPLEMTKSEMEQVEQDPDFVTL  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_010677210.1| PREDICTED: lon protease homolog 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=888

 Score =   287 bits (735),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE VELP RL IL FRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG++PVRD
Sbjct  1    MAEPVELPNRLGILAFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGIVPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AE+ +V   L PG  +DS +R  KNQ+G S+S K D K+QQE +HWHNRGVAARALHLS
Sbjct  61   AAESASVGSVLYPGGGSDSGERNLKNQSGLSDSRKTDAKSQQEAVHWHNRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY VVLEGLCRFSV EL++RGTYYTARI+ LD+TK +MEQ EQD +F++L
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFSVLELNSRGTYYTARISPLDITKADMEQAEQDPDFVSL  180

Query  730  S  732
            +
Sbjct  181  A  181



>ref|XP_002528799.1| ATP-dependent protease La, putative [Ricinus communis]
 gb|EEF33621.1| ATP-dependent protease La, putative [Ricinus communis]
Length=890

 Score =   286 bits (733),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 149/187 (80%), Positives = 159/187 (85%), Gaps = 10/187 (5%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPNSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SA--ETTTVA---PTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAA  531
            SA  ETTT     P LS GV  DS     K Q   S+++ K DGK+QQEVI WHNRGVAA
Sbjct  61   SAAEETTTSVGPPPVLSQGVGNDSG----KIQVNNSDNNLKLDGKSQQEVIRWHNRGVAA  116

Query  532  RALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQD  711
            RALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG YYTARI+SL+MTK EMEQVEQD
Sbjct  117  RALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSKRGMYYTARISSLEMTKAEMEQVEQD  176

Query  712  QEFIALS  732
             +F++LS
Sbjct  177  PDFVSLS  183



>dbj|BAA20482.1| ATP-dependent protease Lon [Spinacia oleracea]
Length=875

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE+VELP RL IL FRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG++PVRD
Sbjct  1    MAEAVELPSRLGILAFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGIVPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            ++E+ +VAP L PG  TDS +R  K+Q G S+S K DGK+QQE +HWH RGVAARALHLS
Sbjct  61   ASESASVAPVLYPGGGTDSGERNVKSQPGLSDSRKADGKSQQEAVHWHTRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY VVLEGLCRF V EL++RG YYTARI+ LD+TK +MEQ +QD +F++L
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFRVMELNSRGNYYTARISPLDITKADMEQAQQDPDFVSL  180

Query  730  S  732
            +
Sbjct  181  A  181



>ref|XP_011032006.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Populus euphratica]
Length=895

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 160/188 (85%), Gaps = 7/188 (4%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTT------VAPTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVA  528
            +A   +      V PTLS GV +DS++R+ K QA TS  + K DGK+QQEV HWHNRGVA
Sbjct  61   AAAAASSSETASVGPTLSQGVGSDSSERSSKTQASTSSDNVKLDGKHQQEVFHWHNRGVA  120

Query  529  ARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQ  708
            ARALHLSRGVEKPSGRVTYIVVLEGLCRF++ EL TRGTYYTARI+ L+MT  E+EQV+Q
Sbjct  121  ARALHLSRGVEKPSGRVTYIVVLEGLCRFNLNELVTRGTYYTARISPLEMTNAELEQVDQ  180

Query  709  DQEFIALS  732
            D +FIALS
Sbjct  181  DPDFIALS  188



>sp|O04979.2|LONP2_SPIOL RecName: Full=Lon protease homolog 2, peroxisomal [Spinacia oleracea]
Length=887

 Score =   285 bits (730),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE+VELP RL IL FRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG++PVRD
Sbjct  1    MAEAVELPSRLGILAFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGIVPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            ++E+ +VAP L PG  TDS +R  K+Q G S+S K DGK+QQE +HWH RGVAARALHLS
Sbjct  61   ASESASVAPVLYPGGGTDSGERNVKSQPGLSDSRKADGKSQQEAVHWHTRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY VVLEGLCRF V EL++RG YYTARI+ LD+TK +MEQ +QD +F++L
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFRVMELNSRGNYYTARISPLDITKADMEQAQQDPDFVSL  180

Query  730  S  732
            +
Sbjct  181  A  181



>ref|XP_010935031.1| PREDICTED: lon protease homolog 2, peroxisomal [Elaeis guineensis]
Length=886

 Score =   285 bits (728),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 150/182 (82%), Gaps = 2/182 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE VELP RL ILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIGVLPVRD
Sbjct  1    MAELVELPSRLGILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGVLPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGT-SESHKHDGKNQQEVIHWHNRGVAARALHL  546
            + E   V   LSPGV  DS +R+ K  A    +S K DGKNQQE+IHWHNRGVAARALHL
Sbjct  61   T-EAAAVGSMLSPGVGNDSGERSLKGPADVLGDSQKQDGKNQQELIHWHNRGVAARALHL  119

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG YY AR++ LDMTK E+EQ EQD + I 
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGNYYIARVSRLDMTKAELEQAEQDPDLIL  179

Query  727  LS  732
            LS
Sbjct  180  LS  181



>ref|XP_003524333.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Glycine 
max]
Length=885

 Score =   283 bits (724),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 155/181 (86%), Gaps = 3/181 (2%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AE   V PT+S G   DS ++  K Q+G+S+SHK D K Q +V HWHNRGVAAR LHLS
Sbjct  61   AAEIKPVGPTVSEG--ADSTNQNSKVQSGSSDSHKLDTKKQNDV-HWHNRGVAARPLHLS  117

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY VVLEGLCRFSVQELS RG Y+TARITSL+MTK E+EQVEQD +FI L
Sbjct  118  RGVEKPSGRVTYTVVLEGLCRFSVQELSMRGIYHTARITSLEMTKTELEQVEQDPDFIML  177

Query  730  S  732
            S
Sbjct  178  S  178



>ref|XP_010941248.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X4 
[Elaeis guineensis]
Length=880

 Score =   283 bits (723),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = +1

Query  187  SMAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
             MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVR
Sbjct  7    GMAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVR  66

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            D+ ET  V   LSPGV  DS +R  K  A   +S K DGKN QE+IHWHNRGVAARALHL
Sbjct  67   DT-ETAAVGSMLSPGVGNDSGERRLKGPADVLDSQKQDGKNPQELIHWHNRGVAARALHL  125

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYYTAR++ LDMTK E+EQ E+D + I 
Sbjct  126  SRGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYTARVSRLDMTKAELEQAERDPDLIL  185

Query  727  LS  732
            LS
Sbjct  186  LS  187



>gb|KHN01656.1| Lon protease like 2, peroxisomal [Glycine soja]
Length=886

 Score =   282 bits (722),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 152/181 (84%), Gaps = 2/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
              E   V PT+S G   DS ++  K Q G+ +S K D K Q +V+HWHNRGVAAR LHLS
Sbjct  61   VVEIKPVGPTVSEG--ADSTNQNSKVQGGSLDSRKLDTKKQNDVVHWHNRGVAARPLHLS  118

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY VVLEGLCRFSVQELSTRG Y+TARITSL+MTK E+EQVEQD +FI L
Sbjct  119  RGVEKPSGRVTYTVVLEGLCRFSVQELSTRGIYHTARITSLEMTKTELEQVEQDPDFIML  178

Query  730  S  732
            S
Sbjct  179  S  179



>ref|XP_003549964.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Glycine max]
Length=886

 Score =   282 bits (722),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 152/181 (84%), Gaps = 2/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
              E   V PT+S G   DS ++  K Q G+ +S K D K Q +V+HWHNRGVAAR LHLS
Sbjct  61   VVEIKPVGPTVSEG--ADSTNQNSKVQGGSLDSRKLDTKKQNDVVHWHNRGVAARPLHLS  118

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY VVLEGLCRFSVQELSTRG Y+TARITSL+MTK E+EQVEQD +FI L
Sbjct  119  RGVEKPSGRVTYTVVLEGLCRFSVQELSTRGIYHTARITSLEMTKTELEQVEQDPDFIML  178

Query  730  S  732
            S
Sbjct  179  S  179



>ref|XP_010941247.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X3 
[Elaeis guineensis]
Length=889

 Score =   282 bits (722),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = +1

Query  187  SMAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
             MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVR
Sbjct  7    GMAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVR  66

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            D+ ET  V   LSPGV  DS +R  K  A   +S K DGKN QE+IHWHNRGVAARALHL
Sbjct  67   DT-ETAAVGSMLSPGVGNDSGERRLKGPADVLDSQKQDGKNPQELIHWHNRGVAARALHL  125

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYYTAR++ LDMTK E+EQ E+D + I 
Sbjct  126  SRGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYTARVSRLDMTKAELEQAERDPDLIL  185

Query  727  LS  732
            LS
Sbjct  186  LS  187



>ref|XP_010941245.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Elaeis guineensis]
 ref|XP_010941246.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Elaeis guineensis]
Length=891

 Score =   282 bits (722),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = +1

Query  187  SMAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
             MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVR
Sbjct  7    GMAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVR  66

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            D+ ET  V   LSPGV  DS +R  K  A   +S K DGKN QE+IHWHNRGVAARALHL
Sbjct  67   DT-ETAAVGSMLSPGVGNDSGERRLKGPADVLDSQKQDGKNPQELIHWHNRGVAARALHL  125

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYYTAR++ LDMTK E+EQ E+D + I 
Sbjct  126  SRGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYTARVSRLDMTKAELEQAERDPDLIL  185

Query  727  LS  732
            LS
Sbjct  186  LS  187



>ref|XP_010941244.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Elaeis guineensis]
Length=894

 Score =   282 bits (721),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 150/182 (82%), Gaps = 1/182 (1%)
 Frame = +1

Query  187  SMAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
             MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVR
Sbjct  7    GMAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVR  66

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            D+ ET  V   LSPGV  DS +R  K  A   +S K DGKN QE+IHWHNRGVAARALHL
Sbjct  67   DT-ETAAVGSMLSPGVGNDSGERRLKGPADVLDSQKQDGKNPQELIHWHNRGVAARALHL  125

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYYTAR++ LDMTK E+EQ E+D + I 
Sbjct  126  SRGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYTARVSRLDMTKAELEQAERDPDLIL  185

Query  727  LS  732
            LS
Sbjct  186  LS  187



>ref|XP_008799399.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Phoenix 
dactylifera]
Length=887

 Score =   280 bits (717),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 149/181 (82%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE V+LP RL ILPFRNKVLLPGAIIRIRCTSP SV LVEQELWQ+EEKGLIGVLPVRD
Sbjct  1    MAEPVDLPSRLGILPFRNKVLLPGAIIRIRCTSPSSVMLVEQELWQKEEKGLIGVLPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            + E   V   LSPGV  DS +R+ K  A   +S K DGKNQQ++IHWHNRGVAARALHLS
Sbjct  61   T-EAAAVGSMLSPGVGNDSGERSLKGPADVLDSQKQDGKNQQKLIHWHNRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCRFSVQELS RGTY  AR++ LDMTK E+EQ EQD + I L
Sbjct  120  RGVEKPSGRVTYIVVLEGLCRFSVQELSARGTYRMARVSRLDMTKAELEQAEQDPDLILL  179

Query  730  S  732
            S
Sbjct  180  S  180



>ref|XP_004511756.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Cicer arietinum]
Length=888

 Score =   279 bits (714),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 141/185 (76%), Positives = 155/185 (84%), Gaps = 9/185 (5%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MA+SVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MADSVELPNRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTT----VAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARA  537
            SA        + PTLS GV  DS D++ K   G+S+SH    K Q +V+HWHNRGVAARA
Sbjct  61   SASAAETKPPLGPTLSQGV--DSLDQSSKTHGGSSDSH---AKIQHDVVHWHNRGVAARA  115

Query  538  LHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQE  717
            LHLSRGVEKPSGRVTYIVVLEGLCRFSV+ELSTRG Y+TARI+SL+MTK EMEQVE D +
Sbjct  116  LHLSRGVEKPSGRVTYIVVLEGLCRFSVEELSTRGAYHTARISSLEMTKTEMEQVEHDPD  175

Query  718  FIALS  732
            FI LS
Sbjct  176  FIMLS  180



>gb|KJB39794.1| hypothetical protein B456_007G030900 [Gossypium raimondii]
Length=904

 Score =   278 bits (710),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 158/195 (81%), Gaps = 14/195 (7%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESGERSSNVQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKP--------------  687
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+ L+MTK               
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKISPLEMTKSGYFLISIFYLLTCL  180

Query  688  EMEQVEQDQEFIALS  732
            EMEQVEQD +F+ LS
Sbjct  181  EMEQVEQDPDFVTLS  195



>gb|KHG09410.1| Lon protease, peroxisomal -like protein [Gossypium arboreum]
Length=934

 Score =   277 bits (709),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 138/195 (71%), Positives = 158/195 (81%), Gaps = 14/195 (7%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELPGRLAILPFRNKVLLPGA IRIRCTS  SVKLVEQELWQREEKGLIG+LPV+D
Sbjct  1    MAESVELPGRLAILPFRNKVLLPGAFIRIRCTSQSSVKLVEQELWQREEKGLIGILPVQD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +AETT++   LS GV ++S +R+   Q  TS++HK DGKN  EVIHWHNRGVAARALHLS
Sbjct  61   AAETTSMDSMLSQGVGSESCERSSNAQVSTSDAHKVDGKNPSEVIHWHNRGVAARALHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTK--------------P  687
            RGVEKPSGRVTYIVVLEGLCRF+++EL+TRG Y TA+I+ L+MTK               
Sbjct  121  RGVEKPSGRVTYIVVLEGLCRFNIEELNTRGPYCTAKISPLEMTKSGYFLISIFYLLTCS  180

Query  688  EMEQVEQDQEFIALS  732
            EMEQVEQD +F+ LS
Sbjct  181  EMEQVEQDPDFVTLS  195



>gb|KEH31576.1| lon-related ATP-dependent protease, putative [Medicago truncatula]
Length=888

 Score =   276 bits (706),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 153/181 (85%), Gaps = 0/181 (0%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP R+AILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAESVELPSRIAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            + E  +  PT S G  TD  +++ K Q G+S+S K D K Q +++HWHNRGVAAR LHLS
Sbjct  61   ALEINSAGPTASQGAGTDILNQSSKLQDGSSDSIKPDTKRQNDIVHWHNRGVAARPLHLS  120

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY VVLEGLCRFSV ELSTRG Y+TA+I+SL+MTK EMEQ+EQD ++I L
Sbjct  121  RGVEKPSGRVTYTVVLEGLCRFSVLELSTRGIYHTAKISSLEMTKIEMEQLEQDPDYIML  180

Query  730  S  732
            S
Sbjct  181  S  181



>ref|XP_006368476.1| Lon protease 1 family protein [Populus trichocarpa]
 gb|ERP65045.1| Lon protease 1 family protein [Populus trichocarpa]
Length=893

 Score =   276 bits (706),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 159/186 (85%), Gaps = 5/186 (3%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SV+LVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVQLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETT----TVAPTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAAR  534
            +A  T    +V PTLS    +D+++++ +  A TS  + K DGK+QQEV HWHNRGVAAR
Sbjct  61   AAAATAETASVGPTLSHSAGSDTSEKSSRTPASTSSDNVKLDGKHQQEVFHWHNRGVAAR  120

Query  535  ALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQ  714
            ALHLSRGVEKPSGRVTYIVVLEGLCRF++ ELSTRG YYTARI+ L+MTK E+EQV+QD 
Sbjct  121  ALHLSRGVEKPSGRVTYIVVLEGLCRFNLHELSTRGAYYTARISPLEMTKAELEQVDQDP  180

Query  715  EFIALS  732
            +F+ALS
Sbjct  181  DFVALS  186



>gb|KHN21044.1| Lon protease like 2, peroxisomal [Glycine soja]
Length=893

 Score =   276 bits (706),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/189 (75%), Positives = 155/189 (82%), Gaps = 11/189 (6%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNR--------GV  525
            +AE   V PT+S G   DS ++  K Q+G+S+SHK D K Q +V HWHNR        GV
Sbjct  61   AAEIKPVGPTVSEG--ADSTNQNSKVQSGSSDSHKLDTKKQNDV-HWHNRHSSREYLLGV  117

Query  526  AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVE  705
            AAR LHLSRGVEKPSGRVTY VVLEGLCRFSVQELS RG Y+TARITSL+MTK E+EQVE
Sbjct  118  AARPLHLSRGVEKPSGRVTYTVVLEGLCRFSVQELSMRGIYHTARITSLEMTKTELEQVE  177

Query  706  QDQEFIALS  732
            QD +FI LS
Sbjct  178  QDPDFIMLS  186



>ref|XP_002304362.2| Lon protease 1 family protein [Populus trichocarpa]
 gb|EEE79341.2| Lon protease 1 family protein [Populus trichocarpa]
Length=893

 Score =   275 bits (704),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 157/186 (84%), Gaps = 5/186 (3%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETTTV----APTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAAR  534
            +A  ++        +  GV +DS++R+ K QA TS  + K DGK+QQEV HWHNRGVAAR
Sbjct  61   AAAASSSETASGNMICLGVGSDSSERSSKTQASTSSDNVKLDGKHQQEVFHWHNRGVAAR  120

Query  535  ALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQ  714
            ALHLSRGVEKPSGRVTYIVVLEGLCRF++ EL TRGTYYTARI+ L+MT  E+EQV+QD 
Sbjct  121  ALHLSRGVEKPSGRVTYIVVLEGLCRFNLNELITRGTYYTARISPLEMTNAELEQVDQDP  180

Query  715  EFIALS  732
            +FIALS
Sbjct  181  DFIALS  186



>ref|XP_009393749.1| PREDICTED: lon protease homolog 2, peroxisomal [Musa acuminata 
subsp. malaccensis]
Length=889

 Score =   275 bits (703),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 150/182 (82%), Gaps = 2/182 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE VELP RLAILPFRN+VLLPGAIIRIRCTSP SVKLVEQELWQ+EEKGLIGVLPVRD
Sbjct  1    MAEPVELPSRLAILPFRNQVLLPGAIIRIRCTSPSSVKLVEQELWQKEEKGLIGVLPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGT-SESHKHDGKNQQEVIHWHNRGVAARALHL  546
            + E T V   ++PG+ +DS+ R  K  A    +S K D KN QEVIHWHNRGVAARALHL
Sbjct  61   T-EATGVGSMIAPGMGSDSSGRGLKGVADVVGDSQKQDAKNPQEVIHWHNRGVAARALHL  119

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRF+VQELS RGTYY AR+  LD+TK E+EQ EQD + I 
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFNVQELSARGTYYVARVNRLDLTKAELEQAEQDPDLIL  179

Query  727  LS  732
            LS
Sbjct  180  LS  181



>gb|ACF78488.1| unknown [Zea mays]
 tpg|DAA62468.1| TPA: hypothetical protein ZEAMMB73_586377 [Zea mays]
Length=514

 Score =   266 bits (681),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 149/182 (82%), Gaps = 2/182 (1%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
            M++S VELP RLA+LPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MSDSPVELPSRLAVLPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            DS E T V   LSPGV +DS +   K      ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EATAVGSLLSPGVGSDSGEGGSKVGGSAVESSKQDTKNGKEPIHWHSKGVAARALHL  119

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG Y+ AR++ LDMTK E+EQ EQD + IA
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGPYHVARVSRLDMTKTELEQAEQDPDLIA  179

Query  727  LS  732
            LS
Sbjct  180  LS  181



>ref|XP_004957462.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Setaria 
italica]
Length=563

 Score =   267 bits (683),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 149/182 (82%), Gaps = 2/182 (1%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
            MA+S VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MADSPVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            DS E   V   LS GV +DS +   K      ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EAGAVGSLLSAGVGSDSGEGGSKAGGSAGESSKQDTKNGKEPIHWHSKGVAARALHL  119

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+EQ EQD + IA
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEQAEQDPDLIA  179

Query  727  LS  732
            LS
Sbjct  180  LS  181



>ref|XP_004508987.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Cicer arietinum]
Length=886

 Score =   273 bits (699),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 152/181 (84%), Gaps = 2/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M+ESV+LP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MSESVDLPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            + E  +  PT S G  TD  D++ K Q  +S+S K D K Q +V+HWHNRGVAAR LHLS
Sbjct  61   ALEIKSAGPTASQG--TDFLDQSSKLQDSSSDSLKLDTKKQNDVVHWHNRGVAARPLHLS  118

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY VVLEGLCRFSV ELSTRG Y+TARI+SL+MTK EMEQ+EQD ++I L
Sbjct  119  RGVEKPSGRVTYTVVLEGLCRFSVLELSTRGIYHTARISSLEMTKTEMEQIEQDPDYIML  178

Query  730  S  732
            S
Sbjct  179  S  179



>ref|XP_003611421.1| Lon protease-like protein [Medicago truncatula]
 gb|AES94379.1| lon-related ATP-dependent protease, putative [Medicago truncatula]
Length=883

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 155/184 (84%), Gaps = 11/184 (6%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MA+SVELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELWQREEKG+IG+LPVRD
Sbjct  1    MADSVELPSRLAILPFRNKVLLPGAIIRIRCTSPTSVKLVEQELWQREEKGMIGILPVRD  60

Query  370  ---SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARAL  540
               SAET  +  T     V+DS D+T K   G+S+S   + K Q +V+HWHNRGVAARAL
Sbjct  61   TAASAETKQLGST-----VSDSIDQTSKVHGGSSDS---NAKVQNDVVHWHNRGVAARAL  112

Query  541  HLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEF  720
            HLSRGVEKPSGRVTYIVVLEGLCRF+VQEL+TRGTY+TARI+SL+MTK EMEQVE D +F
Sbjct  113  HLSRGVEKPSGRVTYIVVLEGLCRFNVQELNTRGTYHTARISSLEMTKTEMEQVEHDPDF  172

Query  721  IALS  732
            I LS
Sbjct  173  IMLS  176



>ref|XP_006398398.1| hypothetical protein EUTSA_v10000767mg [Eutrema salsugineum]
 gb|ESQ39851.1| hypothetical protein EUTSA_v10000767mg [Eutrema salsugineum]
Length=887

 Score =   272 bits (696),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV HWHNRGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTTDAQKSDAKDQQEV-HWHNRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQV+QD +F+AL
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKAELEQVKQDPDFVAL  179

Query  730  S  732
            S
Sbjct  180  S  180



>gb|AAK62365.1|AF385580_1 Lon protease [Dichanthelium lanuginosum]
Length=884

 Score =   271 bits (692),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 136/182 (75%), Positives = 152/182 (84%), Gaps = 3/182 (2%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
            MA+S VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MADSPVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            DS E   V   LSPGV +DS +   K   G+ ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EAAAVGSLLSPGVGSDSGEGGSK-AGGSGESSKQDTKNGKEPIHWHSKGVAARALHL  118

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+EQ EQD + IA
Sbjct  119  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEQAEQDPDLIA  178

Query  727  LS  732
            LS
Sbjct  179  LS  180



>gb|KFK31410.1| hypothetical protein AALP_AA6G108400 [Arabis alpina]
Length=889

 Score =   271 bits (692),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
             AE + +   ++PG  +D+ +R+ K   GT+++ K D K+QQEV HWHNRGVAARALHLS
Sbjct  61   DAEGSAIGTMINPGAGSDTGERSLKFLVGTTDAQKSDAKDQQEV-HWHNRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RFSVQ+L  RG Y  ARITSL+MTK E+EQVE D +F+AL
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQDLGKRGPYSVARITSLEMTKAELEQVEHDSDFVAL  179

Query  730  S  732
            S
Sbjct  180  S  180



>ref|XP_011018661.1| PREDICTED: lon protease homolog 2, peroxisomal [Populus euphratica]
Length=896

 Score =   271 bits (692),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 139/189 (74%), Positives = 158/189 (84%), Gaps = 8/189 (4%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAESVELP RLAILPFRNKVLLPGAIIRIRCTSP SV+LVEQELWQREEKGLIG+LPVRD
Sbjct  1    MAESVELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVQLVEQELWQREEKGLIGILPVRD  60

Query  370  SAETT----TVAPTLSPGVV---TDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGV  525
            +A  T    +V PTLS       +D+++++ K  A TS  + K DGK+QQEV HWHNRGV
Sbjct  61   AAAATTETASVGPTLSDDKTRAESDTSEKSSKTPASTSSDNVKPDGKHQQEVFHWHNRGV  120

Query  526  AARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVE  705
            AARALHLSRGVEKPSGRVTYIVVLEGLCRF++ ELSTRG YYTARI+ L+MTK E+EQV+
Sbjct  121  AARALHLSRGVEKPSGRVTYIVVLEGLCRFNLHELSTRGAYYTARISPLEMTKAELEQVD  180

Query  706  QDQEFIALS  732
            QD  F+ALS
Sbjct  181  QDPGFVALS  189



>ref|XP_010530002.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X4 
[Tarenaya hassleriana]
Length=838

 Score =   268 bits (685),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            + ET      ++PGV +DS ++  K+Q  T+++H  + ++QQEV HWHNRGVAARALHLS
Sbjct  61   AGETAPFGTLITPGVGSDSGEKGIKHQVVTADAHGSEARDQQEV-HWHNRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RFSVQEL  RG Y  ARITSL+MTK E+EQVEQD +F+AL
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQELGKRGPYSVARITSLEMTKTELEQVEQDPDFVAL  179

Query  730  S  732
            S
Sbjct  180  S  180



>ref|XP_010530001.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X3 
[Tarenaya hassleriana]
Length=876

 Score =   268 bits (685),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            + ET      ++PGV +DS ++  K+Q  T+++H  + ++QQEV HWHNRGVAARALHLS
Sbjct  61   AGETAPFGTLITPGVGSDSGEKGIKHQVVTADAHGSEARDQQEV-HWHNRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RFSVQEL  RG Y  ARITSL+MTK E+EQVEQD +F+AL
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQELGKRGPYSVARITSLEMTKTELEQVEQDPDFVAL  179

Query  730  S  732
            S
Sbjct  180  S  180



>ref|XP_010530000.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Tarenaya hassleriana]
Length=889

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            + ET      ++PGV +DS ++  K+Q  T+++H  + ++QQEV HWHNRGVAARALHLS
Sbjct  61   AGETAPFGTLITPGVGSDSGEKGIKHQVVTADAHGSEARDQQEV-HWHNRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RFSVQEL  RG Y  ARITSL+MTK E+EQVEQD +F+AL
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQELGKRGPYSVARITSLEMTKTELEQVEQDPDFVAL  179

Query  730  S  732
            S
Sbjct  180  S  180



>ref|XP_009383286.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Musa acuminata 
subsp. malaccensis]
Length=887

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 147/181 (81%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M E  ELP RLAILPFRNKVLLPGAIIRIRCTSP SVKLVEQELW +EEKGLIGVLPVRD
Sbjct  1    MVELAELPSRLAILPFRNKVLLPGAIIRIRCTSPSSVKLVEQELWHKEEKGLIGVLPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            + E   V   ++PG+ +DS +++ K +A   E    D  N+QE++HWH+RGVAARALHLS
Sbjct  61   T-EAAAVGSMIAPGMGSDSGEQSLKAKADVGEFQNQDANNEQELMHWHHRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTYIVVLEGLCR SVQELSTRGTYY ARI+ LD+TK E+EQ EQD + + L
Sbjct  120  RGVEKPSGRVTYIVVLEGLCRISVQELSTRGTYYVARISRLDLTKSELEQAEQDPDLVLL  179

Query  730  S  732
            S
Sbjct  180  S  180



>ref|XP_006854015.1| PREDICTED: lon protease homolog 2, peroxisomal [Amborella trichopoda]
 gb|ERN15482.1| hypothetical protein AMTR_s00048p00009570 [Amborella trichopoda]
Length=888

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE VELPGRLAILPFRNKVLLPG+I+RIRCTSP SVKLVEQELWQREEKGLIGVLPV D
Sbjct  1    MAEMVELPGRLAILPFRNKVLLPGSIVRIRCTSPTSVKLVEQELWQREEKGLIGVLPVHD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            +   ++ A T   G   DS D    N A  +ESHK DGKNQ ++I+WH RGVAARALHLS
Sbjct  61   AGAESS-ASTSPSGATNDSRDHGSNNSASPTESHKQDGKNQHDLINWHKRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY V+LEGLCRFSVQELS RGTYY ARI+ LD+++ EM Q EQD +  AL
Sbjct  120  RGVEKPSGRVTYSVILEGLCRFSVQELSARGTYYVARISRLDLSQIEMGQAEQDPDLQAL  179

Query  730  S  732
            S
Sbjct  180  S  180



>ref|XP_010529999.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X1 
[Tarenaya hassleriana]
Length=905

 Score =   268 bits (684),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            M ESVELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MVESVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
            + ET      ++PGV +DS ++  K+Q  T+++H  + ++QQEV HWHNRGVAARALHLS
Sbjct  61   AGETAPFGTLITPGVGSDSGEKGIKHQVVTADAHGSEARDQQEV-HWHNRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RFSVQEL  RG Y  ARITSL+MTK E+EQVEQD +F+AL
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFSVQELGKRGPYSVARITSLEMTKTELEQVEQDPDFVAL  179

Query  730  S  732
            S
Sbjct  180  S  180



>ref|XP_010495794.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Camelina 
sativa]
Length=726

 Score =   264 bits (675),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 149/181 (82%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+Q E   WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTTDAQKSDAKDQHEA-QWHTRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E++QV+QD +F+AL
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKAELDQVQQDSDFVAL  179

Query  730  S  732
            S
Sbjct  180  S  180



>ref|XP_009101454.1| PREDICTED: lon protease homolog 2, peroxisomal [Brassica rapa]
Length=887

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 152/181 (84%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MA++VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MADTVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV HWH+RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGGGSDSGERSLKFLVGTTDAQKSDAKDQQEV-HWHSRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQVE D +F+AL
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKGELEQVEHDPDFVAL  179

Query  730  S  732
            S
Sbjct  180  S  180



>emb|CDY33510.1| BnaA06g35630D [Brassica napus]
Length=887

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 152/181 (84%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MA++VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MADNVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV HWH+RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGGGSDSGERSLKFLVGTTDAQKSDAKDQQEV-HWHSRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQVE D +F+AL
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKGELEQVEHDPDFVAL  179

Query  730  S  732
            S
Sbjct  180  S  180



>emb|CDX77732.1| BnaC07g19860D [Brassica napus]
Length=887

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 152/181 (84%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MA++VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MADTVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV HWH+RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGGGSDSGERSLKFLVGTTDAQKSDAKDQQEV-HWHSRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQVE D +F+AL
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKGELEQVEHDPDFVAL  179

Query  730  S  732
            S
Sbjct  180  S  180



>ref|NP_001105903.1| lon protease homolog 2, peroxisomal [Zea mays]
 sp|P93647.1|LONP2_MAIZE RecName: Full=Lon protease homolog 2, peroxisomal [Zea mays]
 gb|AAC50011.1| LON1 protease [Zea mays]
 tpg|DAA62469.1| TPA: lon protease-like protein 2, peroxisomal [Zea mays]
Length=885

 Score =   266 bits (679),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 149/182 (82%), Gaps = 2/182 (1%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
            M++S VELP RLA+LPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MSDSPVELPSRLAVLPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            DS E T V   LSPGV +DS +   K      ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EATAVGSLLSPGVGSDSGEGGSKVGGSAVESSKQDTKNGKEPIHWHSKGVAARALHL  119

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG Y+ AR++ LDMTK E+EQ EQD + IA
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGPYHVARVSRLDMTKTELEQAEQDPDLIA  179

Query  727  LS  732
            LS
Sbjct  180  LS  181



>ref|XP_010441513.1| PREDICTED: lon protease homolog 2, peroxisomal [Camelina sativa]
Length=888

 Score =   265 bits (678),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQE   WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSVERSLKFLVGTTDAQKSDAKDQQEA-QWHTRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQV+QD +F+AL
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKAELEQVQQDSDFLAL  179

Query  730  S  732
            S
Sbjct  180  S  180



>ref|XP_004970472.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Setaria 
italica]
Length=885

 Score =   265 bits (678),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 149/182 (82%), Gaps = 2/182 (1%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
            MA+S VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MADSPVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            DS E   V   LS GV +DS +   K      ES K D KN +E IHWH++GVAARALHL
Sbjct  61   DS-EAGAVGSLLSAGVGSDSGEGGSKAGGSAGESSKQDTKNGKEPIHWHSKGVAARALHL  119

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+EQ EQD + IA
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEQAEQDPDLIA  179

Query  727  LS  732
            LS
Sbjct  180  LS  181



>ref|NP_568675.1| lon protease-like 2 [Arabidopsis thaliana]
 sp|O64948.1|LONP2_ARATH RecName: Full=Lon protease homolog 2, peroxisomal [Arabidopsis 
thaliana]
 gb|AAC05085.1| Lon protease [Arabidopsis thaliana]
 dbj|BAB10243.1| mitochondrial Lon protease homolog 1 precursor [Arabidopsis thaliana]
 gb|AED95460.1| lon protease-like 2 [Arabidopsis thaliana]
Length=888

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 151/181 (83%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQ+ + WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTTDAQKSDAKDQQD-LQWHTRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQV+QD +F+AL
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKAELEQVKQDPDFVAL  179

Query  730  S  732
            S
Sbjct  180  S  180



>dbj|BAD33324.1| putative Lon protease [Oryza sativa Japonica Group]
 dbj|BAD46033.1| putative Lon protease [Oryza sativa Japonica Group]
Length=880

 Score =   264 bits (674),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 151/183 (83%), Gaps = 5/183 (3%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQREEKGLIGVLPV 
Sbjct  1    MADAAVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREEKGLIGVLPVH  60

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALH  543
            DS    ++   LSPGV +DS +   K   G++ ES K D KN +E IHWH+RGVAARALH
Sbjct  61   DSEAAGSL---LSPGVGSDSGEGGSKAPGGSAGESTKQDTKNGKETIHWHSRGVAARALH  117

Query  544  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFI  723
            LSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+E  EQD + I
Sbjct  118  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEHAEQDPDLI  177

Query  724  ALS  732
            ALS
Sbjct  178  ALS  180



>ref|NP_001063769.1| Os09g0533400 [Oryza sativa Japonica Group]
 sp|Q0J032.1|LONP2_ORYSJ RecName: Full=Lon protease homolog 2, peroxisomal [Oryza sativa 
Japonica Group]
 dbj|BAF25683.1| Os09g0533400 [Oryza sativa Japonica Group]
 gb|EEE70111.1| hypothetical protein OsJ_30122 [Oryza sativa Japonica Group]
Length=884

 Score =   264 bits (674),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 151/183 (83%), Gaps = 5/183 (3%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQREEKGLIGVLPV 
Sbjct  1    MADAAVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREEKGLIGVLPVH  60

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALH  543
            DS    ++   LSPGV +DS +   K   G++ ES K D KN +E IHWH+RGVAARALH
Sbjct  61   DSEAAGSL---LSPGVGSDSGEGGSKAPGGSAGESTKQDTKNGKETIHWHSRGVAARALH  117

Query  544  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFI  723
            LSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+E  EQD + I
Sbjct  118  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEHAEQDPDLI  177

Query  724  ALS  732
            ALS
Sbjct  178  ALS  180



>gb|AAM95459.1| Lon protease [Oryza sativa Indica Group]
Length=884

 Score =   263 bits (673),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 151/183 (83%), Gaps = 5/183 (3%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQREEKGLIGVLPV 
Sbjct  1    MADAAVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREEKGLIGVLPVH  60

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALH  543
            DS    ++   LSPGV +DS +   K   G++ ES K D KN +E IHWH+RGVAARALH
Sbjct  61   DSEAAGSL---LSPGVGSDSGEGGSKAPGGSAGESTKQDTKNGKETIHWHSRGVAARALH  117

Query  544  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFI  723
            LSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+E  EQD + I
Sbjct  118  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEHAEQDPDLI  177

Query  724  ALS  732
            ALS
Sbjct  178  ALS  180



>sp|B8BDV1.1|LONP2_ORYSI RecName: Full=Lon protease homolog 2, peroxisomal [Oryza sativa 
Indica Group]
 gb|EEC84943.1| hypothetical protein OsI_32159 [Oryza sativa Indica Group]
Length=884

 Score =   263 bits (673),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 151/183 (83%), Gaps = 5/183 (3%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQREEKGLIGVLPV 
Sbjct  1    MADAAVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREEKGLIGVLPVH  60

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALH  543
            DS    ++   LSPGV +DS +   K   G++ ES K D KN +E IHWH+RGVAARALH
Sbjct  61   DSEAAGSL---LSPGVGSDSGEGGSKAPGGSAGESTKQDTKNGKETIHWHSRGVAARALH  117

Query  544  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFI  723
            LSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+E  EQD + I
Sbjct  118  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTELEHAEQDPDLI  177

Query  724  ALS  732
            ALS
Sbjct  178  ALS  180



>ref|XP_006279987.1| hypothetical protein CARUB_v10025858mg [Capsella rubella]
 gb|EOA12885.1| hypothetical protein CARUB_v10025858mg [Capsella rubella]
Length=888

 Score =   262 bits (669),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
             AE +++   ++PG  +DS +R+ K   GT+++ K D K+QQEV  WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTTDAQKSDAKDQQEV-QWHTRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RF+VQE   RG Y  AR+TSL+MTK E+EQV+QD +F++L
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQEHGKRGPYSVARVTSLEMTKAELEQVQQDPDFVSL  179

Query  730  S  732
            S
Sbjct  180  S  180



>ref|XP_002863374.1| hypothetical protein ARALYDRAFT_494276 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39633.1| hypothetical protein ARALYDRAFT_494276 [Arabidopsis lyrata subsp. 
lyrata]
Length=888

 Score =   261 bits (667),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
             AE +++   ++ G  +DS +R+ K   GT+++ K D K+QQ+ + WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINHGAGSDSGERSLKFLVGTTDAQKSDAKDQQD-LQWHTRGVAARALHLS  119

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQV+QD +F+AL
Sbjct  120  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKAELEQVQQDPDFVAL  179

Query  730  S  732
            S
Sbjct  180  S  180



>ref|XP_002462726.1| hypothetical protein SORBIDRAFT_02g030960 [Sorghum bicolor]
 gb|EER99247.1| hypothetical protein SORBIDRAFT_02g030960 [Sorghum bicolor]
Length=885

 Score =   261 bits (666),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 149/182 (82%), Gaps = 2/182 (1%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
            MA++ VELP RLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+EEKGLIGVLPVR
Sbjct  1    MADAPVELPSRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR  60

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            DS E T V   LSPGV +DS +   K      ES + D KN ++ IHWH++GVAARALHL
Sbjct  61   DS-EATAVGSLLSPGVGSDSGEGGSKAGGSAGESSRQDTKNGKDPIHWHSKGVAARALHL  119

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            SRGVEKPSGRVTYIVVLEGLCRF+VQELS RG Y+ AR++ LDMTK E++Q EQD + IA
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFNVQELSARGPYHVARVSRLDMTKIELDQAEQDPDLIA  179

Query  727  LS  732
            LS
Sbjct  180  LS  181



>ref|XP_010518860.1| PREDICTED: lon protease homolog 2, peroxisomal [Tarenaya hassleriana]
Length=875

 Score =   259 bits (662),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 149/177 (84%), Gaps = 1/177 (1%)
 Frame = +1

Query  202  VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAET  381
            +ELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD+AE 
Sbjct  1    MELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRDAAEG  60

Query  382  TTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVE  561
            T+++  +SPGV +DS +   K+Q GT+++ K + ++QQ+V  WH+RGVAARALHLSRGVE
Sbjct  61   TSISTMISPGVGSDSGENGMKHQVGTADAQKSEARDQQDV-DWHHRGVAARALHLSRGVE  119

Query  562  KPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIALS  732
            KPSGRVTY+VVLEGL RFSV EL  RG Y  A+ITSLDMT  E+EQVEQD +F+ALS
Sbjct  120  KPSGRVTYVVVLEGLSRFSVHELGKRGPYSVAKITSLDMTNTELEQVEQDPDFVALS  176



>ref|XP_010481381.1| PREDICTED: lon protease homolog 2, peroxisomal [Camelina sativa]
Length=883

 Score =   257 bits (656),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 147/181 (81%), Gaps = 6/181 (3%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
            MAE+VELP RLAILPFRNKVLLPGAIIRIRCTS  SV LVEQELWQ+EEKGLIG+LPVRD
Sbjct  1    MAETVELPSRLAILPFRNKVLLPGAIIRIRCTSHSSVTLVEQELWQKEEKGLIGILPVRD  60

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
             AE +++   ++PG  +DS +R+ K   GT+     D K+QQE   WH RGVAARALHLS
Sbjct  61   DAEGSSIGTMINPGAGSDSGERSLKFLVGTT-----DAKDQQEA-QWHTRGVAARALHLS  114

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            RGVEKPSGRVTY+VVLEGL RF+VQEL  RG Y  ARITSL+MTK E+EQV+QD +F+AL
Sbjct  115  RGVEKPSGRVTYVVVLEGLSRFNVQELGKRGPYSVARITSLEMTKAELEQVQQDSDFVAL  174

Query  730  S  732
            S
Sbjct  175  S  175



>dbj|BAJ95084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=886

 Score =   256 bits (654),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/185 (73%), Positives = 153/185 (83%), Gaps = 7/185 (4%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQRE+KGLIGVLPVR
Sbjct  1    MADAPVELPGRLAILPFRNKVLLPGAIVRIRCTTPSSVKLVEQELWQREDKGLIGVLPVR  60

Query  367  DSAETTTVAPTLSPGVVTDSAD---RTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARA  537
            DS E   V   LSPGV  DS +   R+P    G  ES K D K+ +E IHWH+RGVAARA
Sbjct  61   DS-EAAAVGSILSPGVGGDSGEGGRRSPGASGG--ESSKQDAKSGKEPIHWHSRGVAARA  117

Query  538  LHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQE  717
            LHLSRGVEKPSGRVTYIVVLEGLCRFSV+EL+ RG+Y+ AR++ LDMTK E+EQVEQD +
Sbjct  118  LHLSRGVEKPSGRVTYIVVLEGLCRFSVEELNARGSYHVARVSRLDMTKTELEQVEQDPD  177

Query  718  FIALS  732
             IALS
Sbjct  178  LIALS  182



>ref|XP_006661475.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Oryza brachyantha]
Length=894

 Score =   254 bits (650),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 149/193 (77%), Gaps = 15/193 (8%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPR----------SVKLVEQELWQREE  336
            MA+  VELPGRLAILPFRNKVLLPGAI+RIRCT+P           SVKLVEQELWQREE
Sbjct  1    MADGPVELPGRLAILPFRNKVLLPGAIVRIRCTNPILLYQCNCFACSVKLVEQELWQREE  60

Query  337  KGLIGVLPVRDSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWH  513
            KGLIGVLPV DS    ++   LSPGV +DS +   K   GT  ES K D KN +E IHWH
Sbjct  61   KGLIGVLPVHDSEAAGSL---LSPGVGSDSGEGGSKAPGGTGGESTKQDTKNGKETIHWH  117

Query  514  NRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEM  693
            +RGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELS RG+Y+ AR++ LDMTK E+
Sbjct  118  SRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSARGSYHVARVSRLDMTKTEL  177

Query  694  EQVEQDQEFIALS  732
            E  EQD + IALS
Sbjct  178  EHAEQDPDLIALS  190



>ref|XP_003578503.1| PREDICTED: lon protease homolog 2, peroxisomal [Brachypodium 
distachyon]
Length=886

 Score =   249 bits (637),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 133/183 (73%), Positives = 150/183 (82%), Gaps = 3/183 (2%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQRE+KGLIGVLPVR
Sbjct  1    MADAPVELPGRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQREDKGLIGVLPVR  60

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAARALH  543
            DS E  +V   LSPGV  DS +   K+  G+     K D KN +E IHWHNRGVAARALH
Sbjct  61   DS-EAASVGSILSPGVGGDSGEGGSKSPGGSGGESTKQDAKNGKEPIHWHNRGVAARALH  119

Query  544  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFI  723
            LSRGVEKPSGRVTY VVLEGLCRFSVQEL+ RG+Y+ AR++ LDMTK E+EQ EQD + I
Sbjct  120  LSRGVEKPSGRVTYTVVLEGLCRFSVQELNARGSYHVARVSRLDMTKTELEQAEQDPDLI  179

Query  724  ALS  732
            ALS
Sbjct  180  ALS  182



>gb|AAS19619.1| LON1 protease [Triticum aestivum]
Length=886

 Score =   247 bits (631),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 152/183 (83%), Gaps = 3/183 (2%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
            MA++ VELPGRLAILPFRNKVLLPGAI+RIRCT P SVKLVEQELWQRE++GLIGVLPVR
Sbjct  1    MADAPVELPGRLAILPFRNKVLLPGAIVRIRCTYPSSVKLVEQELWQREDRGLIGVLPVR  60

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ESHKHDGKNQQEVIHWHNRGVAARALH  543
            DS E   V   LSPGV +DS D   ++  G+  ES K D K+ +E IHWH+RGVAARALH
Sbjct  61   DS-EAAAVGSILSPGVGSDSGDGGRRSPGGSGGESTKQDAKSGKEPIHWHSRGVAARALH  119

Query  544  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFI  723
            LSRGVEKPSGRVTYIVVLEGLCRFSV+EL+ RG+Y+ AR++ LDMTK E+EQ EQD + I
Sbjct  120  LSRGVEKPSGRVTYIVVLEGLCRFSVEELNARGSYHVARVSRLDMTKTELEQAEQDPDLI  179

Query  724  ALS  732
            ALS
Sbjct  180  ALS  182



>ref|XP_008670352.1| PREDICTED: lon protease homolog 2, peroxisomal-like [Zea mays]
Length=188

 Score =   223 bits (567),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 133/166 (80%), Gaps = 2/166 (1%)
 Frame = +1

Query  190  MAES-VELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVR  366
            MA+S VELP RLAILPFRNKVLLPGAI+RIRCT+P SVKLVEQELWQ+E+KGLIGVLPVR
Sbjct  1    MADSPVELPNRLAILPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEDKGLIGVLPVR  60

Query  367  DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHL  546
            DS E T +   LSPGV +DS     K      ES K   KN +E I WH +GVAARALHL
Sbjct  61   DS-EATAIGSLLSPGVGSDSGGGGSKAVGSAGESSKQHLKNGKEPIQWHTKGVAARALHL  119

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTK  684
            SRGVEKPSGRVTYIVVLEGLCRFSVQEL+ RG Y+ AR++ LDMTK
Sbjct  120  SRGVEKPSGRVTYIVVLEGLCRFSVQELNARGPYHFARVSRLDMTK  165



>ref|XP_002974838.1| hypothetical protein SELMODRAFT_150045 [Selaginella moellendorffii]
 gb|EFJ24358.1| hypothetical protein SELMODRAFT_150045 [Selaginella moellendorffii]
Length=888

 Score =   210 bits (534),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 132/177 (75%), Gaps = 10/177 (6%)
 Frame = +1

Query  193  AESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDS  372
             +  ELP RLAI+ FRN+VLLPGA++RIRCTSP +V+LVEQELWQ+E++GLIGVLPVRD 
Sbjct  6    GDVAELPPRLAIMLFRNRVLLPGAVVRIRCTSPTNVRLVEQELWQKEDRGLIGVLPVRDL  65

Query  373  AETTTVAPTLSPGVVTDSADRTPKNQAGTS--ESHKHDGKNQQEVIHWHNRGVAARALHL  546
             +T           VT     +P ++ GT+  +  +  GK  QE++ WH RGVAARALHL
Sbjct  66   QQTVLG--------VTCVLIASPGDRGGTALPDFQQCLGKQNQELVQWHPRGVAARALHL  117

Query  547  SRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQE  717
            SRG+EKPSGRVTY VVLEG CRFS+++++ RG+Y TARI  LDMTK EMEQ E+D E
Sbjct  118  SRGMEKPSGRVTYTVVLEGWCRFSLKDMNARGSYNTARIGQLDMTKAEMEQAEKDPE  174



>gb|EMS60327.1| Lon protease-like protein 2, peroxisomal [Triticum urartu]
Length=838

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 106/155 (68%), Positives = 124/155 (80%), Gaps = 2/155 (1%)
 Frame = +1

Query  271  RIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAETTTVAPTLSPGVVTDSADRTPKNQ  450
            R RC +P SVKLVEQELWQRE+KGLIGVLPVRDS E   V   LSPGV +DS +   ++ 
Sbjct  3    RSRCPTPSSVKLVEQELWQREDKGLIGVLPVRDS-EAAAVGSILSPGVGSDSGEGGRRSP  61

Query  451  AGTS-ESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQE  627
             G+  ES K D K+ +E IHWH+RGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSV+E
Sbjct  62   GGSGGESTKQDAKSGKEPIHWHSRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVEE  121

Query  628  LSTRGTYYTARITSLDMTKPEMEQVEQDQEFIALS  732
            L+ RG+Y+ AR++ LDMTK E+EQ EQD + IALS
Sbjct  122  LNARGSYHVARVSRLDMTKTELEQAEQDPDLIALS  156



>gb|EMT28056.1| Lon protease-like protein, mitochondrial [Aegilops tauschii]
Length=597

 Score =   190 bits (483),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 120/165 (73%), Gaps = 19/165 (12%)
 Frame = +1

Query  292  RSVKLVEQELWQREEKGLIGVLPVRDSAETTTVAPTLSPGVVTDSADRTPKNQAGTS-ES  468
            +SVKLVEQELWQRE+KGLIGVLPVRDS E   V   LSPGV +DS +   ++  G+  ES
Sbjct  28   KSVKLVEQELWQREDKGLIGVLPVRDS-EAAAVGSILSPGVGSDSGEGGRRSPGGSGGES  86

Query  469  HKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTY  648
             K D K+ +E IHWH+RGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSV+EL+ RG+Y
Sbjct  87   TKQDAKSGKEPIHWHSRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVEELNARGSY  146

Query  649  YTARITSLDMTKP-----------------EMEQVEQDQEFIALS  732
            + AR++ LDMTK                  E+EQ EQD + IALS
Sbjct  147  HVARVSRLDMTKTDIFTFLGLHYYCVFGFLELEQAEQDPDLIALS  191



>ref|XP_002963756.1| hypothetical protein SELMODRAFT_141788 [Selaginella moellendorffii]
 gb|EFJ35627.1| hypothetical protein SELMODRAFT_141788 [Selaginella moellendorffii]
Length=879

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/175 (56%), Positives = 122/175 (70%), Gaps = 15/175 (9%)
 Frame = +1

Query  193  AESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDS  372
             +  ELP RLAI+ FRN+VLLPGA++RIRCTSP +V+LVEQELWQ+E++GLIGVLPVRD 
Sbjct  6    GDVAELPPRLAIMLFRNRVLLPGAVVRIRCTSPTNVRLVEQELWQKEDRGLIGVLPVRDL  65

Query  373  AETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSR  552
              +   +       +  S +  P    G +     DG  +        RGVAARALHLSR
Sbjct  66   QHSAWESK------IKSSCNGIP----GKNSRVFPDGSRKNVC-----RGVAARALHLSR  110

Query  553  GVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQE  717
            G+EKPSGRVTY VVLEG CRFS+++++ RG+Y TARI  LDMTK EMEQ E+D E
Sbjct  111  GMEKPSGRVTYTVVLEGWCRFSLKDMNARGSYNTARIGQLDMTKAEMEQAEKDPE  165



>gb|KDO52684.1| hypothetical protein CISIN_1g003349mg [Citrus sinensis]
Length=828

 Score =   179 bits (455),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/108 (82%), Positives = 94/108 (87%), Gaps = 5/108 (5%)
 Frame = +1

Query  409  GVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYI  588
            GV  DS++R  K Q G S     DGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYI
Sbjct  17   GVGGDSSERASKVQVGAS-----DGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYI  71

Query  589  VVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIALS  732
            VVLEGLCRFSVQELSTRGTYYTARI+SL+MTK EMEQVEQD +FIALS
Sbjct  72   VVLEGLCRFSVQELSTRGTYYTARISSLEMTKIEMEQVEQDPDFIALS  119



>ref|XP_010325536.1| PREDICTED: lon protease homolog 2, peroxisomal isoform X2 [Solanum 
lycopersicum]
Length=803

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  457  TSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELST  636
            TS+SHK D KNQQEVIHWH+RGVAARALHLSRGVEKPSGRVTYIVVLEGLCRF+VQELST
Sbjct  5    TSDSHKLDSKNQQEVIHWHDRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFNVQELST  64

Query  637  RGTYYTARITSLDMTKPEMEQVEQDQEFIALS  732
            RGTYYTARITSLDMTK EME +EQDQEF+ALS
Sbjct  65   RGTYYTARITSLDMTKGEMELIEQDQEFVALS  96



>ref|XP_011032007.1| PREDICTED: lon protease homolog 2, peroxisomal-like isoform X2 
[Populus euphratica]
Length=842

 Score =   169 bits (427),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 94/109 (86%), Gaps = 1/109 (1%)
 Frame = +1

Query  409  GVVTDSADRTPKNQAGTSESH-KHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTY  585
            GV +DS++R+ K QA TS  + K DGK+QQEV HWHNRGVAARALHLSRGVEKPSGRVTY
Sbjct  27   GVGSDSSERSSKTQASTSSDNVKLDGKHQQEVFHWHNRGVAARALHLSRGVEKPSGRVTY  86

Query  586  IVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIALS  732
            IVVLEGLCRF++ EL TRGTYYTARI+ L+MT  E+EQV+QD +FIALS
Sbjct  87   IVVLEGLCRFNLNELVTRGTYYTARISPLEMTNAELEQVDQDPDFIALS  135



>ref|XP_001757793.1| predicted protein [Physcomitrella patens]
 gb|EDQ77433.1| predicted protein [Physcomitrella patens]
Length=893

 Score =   166 bits (421),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/184 (50%), Positives = 118/184 (64%), Gaps = 9/184 (5%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKG-LIGVLPVR  366
            + ++  LP  LAILPFRNKVLLPGAI++IR   P SV+L+EQELWQ+E KG  IGVLP+ 
Sbjct  6    VGDTSALPPVLAILPFRNKVLLPGAIVKIRVNVPASVRLIEQELWQKENKGRFIGVLPLH  65

Query  367  DSAETTT--VAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARAL  540
            D     +  V P    G V  +     + +   S    H  KN  ++I WH RGVAARAL
Sbjct  66   DLHRVISHKVKPA---GTVIKAPGEKERGEIILS---LHSNKNGDDLIQWHPRGVAARAL  119

Query  541  HLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEF  720
             L + +EK +GRV+YIV+LEG CRF VQEL +  +Y +ARIT LD  + E+EQ E+D E 
Sbjct  120  ELEQKIEKYTGRVSYIVMLEGWCRFGVQELISTSSYKSARITQLDRNEAEIEQAEKDPEV  179

Query  721  IALS  732
              LS
Sbjct  180  QVLS  183



>gb|KEH31578.1| lon-related ATP-dependent protease, putative [Medicago truncatula]
Length=821

 Score =   155 bits (392),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/108 (69%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  409  GVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYI  588
            G  TD  +++ K Q G+S+S K D K Q +++HWHNRGVAAR LHLSRGVEKPSGRVTY 
Sbjct  7    GAGTDILNQSSKLQDGSSDSIKPDTKRQNDIVHWHNRGVAARPLHLSRGVEKPSGRVTYT  66

Query  589  VVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIALS  732
            VVLEGLCRFSV ELSTRG Y+TA+I+SL+MTK EMEQ+EQD ++I LS
Sbjct  67   VVLEGLCRFSVLELSTRGIYHTAKISSLEMTKIEMEQLEQDPDYIMLS  114



>gb|KEH31577.1| lon-related ATP-dependent protease, putative [Medicago truncatula]
Length=825

 Score =   154 bits (389),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/105 (70%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +1

Query  418  TDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGVEKPSGRVTYIVVL  597
            TD  +++ K Q G+S+S K D K Q +++HWHNRGVAAR LHLSRGVEKPSGRVTY VVL
Sbjct  14   TDILNQSSKLQDGSSDSIKPDTKRQNDIVHWHNRGVAARPLHLSRGVEKPSGRVTYTVVL  73

Query  598  EGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIALS  732
            EGLCRFSV ELSTRG Y+TA+I+SL+MTK EMEQ+EQD ++I LS
Sbjct  74   EGLCRFSVLELSTRGIYHTAKISSLEMTKIEMEQLEQDPDYIMLS  118



>ref|XP_002980173.1| hypothetical protein SELMODRAFT_444435, partial [Selaginella 
moellendorffii]
 gb|EFJ18433.1| hypothetical protein SELMODRAFT_444435, partial [Selaginella 
moellendorffii]
Length=432

 Score =   139 bits (350),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 93/129 (72%), Gaps = 8/129 (6%)
 Frame = +1

Query  193  AESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDS  372
             +  ELP RL+I+ FRN+VLLPGA++RIRCTSP +V+LVEQELWQ+E++GLIGVLPVRD 
Sbjct  6    GDVAELPPRLSIMLFRNRVLLPGAVVRIRCTSPTNVRLVEQELWQKEDRGLIGVLPVRDL  65

Query  373  AETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSR  552
             ++   +P   P   + S  R         ++ K  GK  QE++ WH RGVAARALHLSR
Sbjct  66   QQSDPASPPPPPPPSSSSLPRL--------KARKGLGKQNQELVQWHPRGVAARALHLSR  117

Query  553  GVEKPSGRV  579
            G+EKPSGR+
Sbjct  118  GMEKPSGRM  126



>ref|XP_002963350.1| hypothetical protein SELMODRAFT_405160 [Selaginella moellendorffii]
 gb|EFJ35221.1| hypothetical protein SELMODRAFT_405160 [Selaginella moellendorffii]
Length=432

 Score = 97.4 bits (241),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 53/59 (90%), Gaps = 0/59 (0%)
 Frame = +1

Query  193  AESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRD  369
             +  ELP RLAI+ FRN+VLLPGA++RIRCTSP +V+LVEQELWQ+E++GLIGVLPVRD
Sbjct  6    GDVAELPPRLAIMLFRNRVLLPGAVVRIRCTSPTNVRLVEQELWQKEDRGLIGVLPVRD  64



>ref|XP_002501871.1| lon protease [Micromonas sp. RCC299]
 gb|ACO63129.1| lon protease [Micromonas sp. RCC299]
Length=904

 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 83/179 (46%), Gaps = 16/179 (9%)
 Frame = +1

Query  208  LPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKG------LIGVLPVRD  369
            LP  L+ILP +N++LLP + +++  TSPRSV LV+  L              +GV+P R 
Sbjct  12   LPSTLSILPLKNRILLPSSAMKLLLTSPRSVALVDAILSSTSAGSGHHHSLYVGVVPTRR  71

Query  370  SAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLS  549
                 + A   + G++ D+ D            H   G ++ E    H+ G AAR + +S
Sbjct  72   DPRANSNAFAAANGMLDDTDD-------NEDAPHHAGGDHEDERARLHDVGTAARIVQIS  124

Query  550  RGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIA  726
            R   K S   +Y ++LEG CRF + +L+    +    +  LD         EQD   +A
Sbjct  125  R---KDSPVRSYTLLLEGRCRFGLDKLTAVHPFIVGEVRQLDAAGGSQGDPEQDDPELA  180



>ref|XP_003057661.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57612.1| predicted protein [Micromonas pusilla CCMP1545]
Length=917

 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/174 (29%), Positives = 85/174 (49%), Gaps = 27/174 (16%)
 Frame = +1

Query  193  AESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQEL---WQREEKGLIGVLPV  363
            AE   LP  L+ILP ++++LLP + +++  T+P ++ LV+  L   + +     +GV+PV
Sbjct  9    AEPRGLPSTLSILPLKDRILLPSSAMKLVLTTPSALALVDDILGAAYVKPGTLYVGVVPV  68

Query  364  RDSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALH  543
            R  A         S G VT  A +        +ES   +        H H+ G AAR + 
Sbjct  69   RRDAPP-------SAGGVTSGASQL------DAESFDAEDDADDVRAHLHDVGTAARIIQ  115

Query  544  LSRGVEKPSGRV----------TYIVVLEGLCRFSVQELSTRGTYYTARITSLD  675
            ++RG ++P  +           +Y ++LEG CRF + +LS+   +  A +  LD
Sbjct  116  IARG-DRPGMKARSIHWSPYDRSYTLLLEGRCRFELNQLSSTSPFLVAHVRQLD  168



>ref|XP_001633523.1| predicted protein [Nematostella vectensis]
 gb|EDO41460.1| predicted protein, partial [Nematostella vectensis]
Length=343

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/183 (23%), Positives = 87/183 (48%), Gaps = 33/183 (18%)
 Frame = +1

Query  190  MAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREE--KGLIGVLPV  363
            MA   +LP ++ +L   +KVLLPG+ +RI      S+++++  L +R+     LIGV+P 
Sbjct  1    MAAKADLPRKIPLLILDDKVLLPGSSMRIAVRDAASIRMIDSRLLRRDSLRSVLIGVVPR  60

Query  364  RDSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALH  543
            +  +ET +                       + + ++  G +  + +     G AA  + 
Sbjct  61   KSKSETLS-----------------------SLDYYQDSGSSFLKTV-----GTAAVVIQ  92

Query  544  LSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFI  723
            ++ G   P  +  Y +++ GLCRFS+  +     Y  A +T LD+   +  +++++ E  
Sbjct  93   VT-GTNWP--KPLYTLLVTGLCRFSIDGIVQAEPYLLADVTQLDLPSKQEAEIKRNAELA  149

Query  724  ALS  732
            +L+
Sbjct  150  SLA  152



>gb|KFH65868.1| ATP-dependent protease La [Mortierella verticillata NRRL 6337]
Length=896

 Score = 57.4 bits (137),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 60/221 (27%), Positives = 94/221 (43%), Gaps = 51/221 (23%)
 Frame = +1

Query  199  SVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGL----IGVLPVR  366
            S+ +P  + +LP  +KVLLPG + R++ +   S+ L E+ L   + K L    IGV PVR
Sbjct  7    SIPIPRTVPVLPLHDKVLLPGVVTRLQISRRDSIPLFEKILRTFDSKELSKCIIGVFPVR  66

Query  367  DSAETTTVAPTLS---PGVVTDSADRTPKNQAGTSESHKH-----------------DGK  486
                TTT+A T     P     +     K++ G +  H                   DG 
Sbjct  67   -LPPTTTLAITEKGEEPSNNNTNNTTGGKSKRGDNSHHGELIIPTPGPIYPTPSSVGDGS  125

Query  487  NQQEVI----------HWHNRGVAARALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELST  636
              +             H H+ G AAR + L R V        + VVLEG+ R  + + ++
Sbjct  126  YGRSSSSSSQGALNPAHIHSTGCAARLVRLERAVGG------FTVVLEGIVRLRLNKFTS  179

Query  637  RGTYYTARITSL-DMTKPEMEQVEQDQ---------EFIAL  729
            +  Y+ A +T + D    + +Q  QDQ         EF++L
Sbjct  180  QSPYFEADVTPMPDRAVDKNDQELQDQIVALRSTSKEFVSL  220



>ref|XP_008364428.1| PREDICTED: uncharacterized protein LOC103428108 [Malus domestica]
Length=452

 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +1

Query  187  SMAESVELPGRLAILPFRNKVLLPGAIIRIRCTSP  291
            +M ESVELP  L ILPFRNKVLL  AII IRCTSP
Sbjct  416  NMTESVELPTSLNILPFRNKVLLLSAIIXIRCTSP  450



>ref|WP_036158520.1| Lon protease [Maribacter forsetii]
Length=816

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 48/177 (27%), Positives = 75/177 (42%), Gaps = 48/177 (27%)
 Frame = +1

Query  199  SVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQREEKGLIGVLPVRDSAE  378
            S  LP  L ILP RN VL PG +I I     +S++L++          +IGV+  +D   
Sbjct  37   SETLPETLPILPLRNTVLFPGVVIPITAGRDKSIQLIKD---ANNGSKVIGVVSQKDEE-  92

Query  379  TTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARALHLSRGV  558
                         T++ D    N  GT                       AR L   R +
Sbjct  93   -------------TENPDVQDINTLGT----------------------VARIL---RVL  114

Query  559  EKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTKPEMEQVEQDQEFIAL  729
            + P G  T  V+++G  RF + E+ T+  Y+TA +   +  +PE    + D+EF+A+
Sbjct  115  QMPDGNTT--VIIQGKKRFEIAEVLTKKPYFTATVRETEEVRPE----KNDKEFLAI  165



>gb|ERZ96146.1| hypothetical protein GLOINDRAFT_334534 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX78515.1| Pim1p [Rhizophagus irregularis DAOM 197198w]
Length=850

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 77/165 (47%), Gaps = 27/165 (16%)
 Frame = +1

Query  205  ELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQ----REEKGLIGVLPVR--  366
            ++P  L I+P RNKVLLP A + ++  S  SV+L+ Q +++    +E K +IG +PV   
Sbjct  7    DVPKILPIIPIRNKVLLPSASLVLQVVSKDSVQLL-QRIYRSAENKESKYIIGCVPVHPP  65

Query  367  -----DSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAA  531
                 +S +TTT     +P  +T + +R    +    E+     +        H  G AA
Sbjct  66   SYNKLESKDTTT-----APFTLTRNGNRNSTPKKTIEETFNQSIQPSD----LHKFGCAA  116

Query  532  RALHLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARIT  666
            R + L R V        +IV +EG+ R  + +      Y  A +T
Sbjct  117  RIVKLERTVN------GFIVRIEGVIRIRIDKYVLERPYLEAEVT  155



>ref|XP_002446246.1| hypothetical protein SORBIDRAFT_06g009066 [Sorghum bicolor]
 gb|EES10574.1| hypothetical protein SORBIDRAFT_06g009066, partial [Sorghum bicolor]
Length=90

 Score = 43.9 bits (102),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 17/27 (63%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +1

Query  604  LCRFSVQELSTRGTYYTARITSLDMTK  684
            LCRF+++ELS RG Y+ AR++ LDMTK
Sbjct  63   LCRFNIEELSARGPYHVARVSRLDMTK  89


 Score = 26.9 bits (58),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 14/31 (45%), Positives = 17/31 (55%), Gaps = 0/31 (0%)
 Frame = +2

Query  485  KISRKLFTGITEELLLGLCISQEEWKNQVGG  577
            K  +  FTGI  ELL  L    E W++QV G
Sbjct  26   KKGKDPFTGIAGELLPELYTFPEGWRSQVEG  56



>ref|XP_008309291.1| PREDICTED: lon protease homolog 2, peroxisomal [Cynoglossus semilaevis]
Length=839

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 47/168 (28%), Positives = 73/168 (43%), Gaps = 40/168 (24%)
 Frame = +1

Query  187  SMAESVELPGRLAILPFRNKVLLPGAIIRIRCTSPRSVKLVEQELWQRE--EKGLIGVLP  360
            S A  +++P RL +L     VLLPG+ +R    SPR+++LV Q L +    +  +IGV+P
Sbjct  2    SSAGGIQIPSRLPLLLTHEGVLLPGSTVRFSVNSPRNMQLVIQRLLRGTSLKSTIIGVIP  61

Query  361  VRDSAETTTVAPTLSPGVVTDSADRTPKNQAGTSESHKHDGKNQQEVIHWHNRGVAARAL  540
                   TT               R P+N             +  E+   H  G A  A+
Sbjct  62   -------TT---------------RDPEN-------------DSDELPTLHKIGTAGIAV  86

Query  541  HLSRGVEKPSGRVTYIVVLEGLCRFSVQELSTRGTYYTARITSLDMTK  684
             +  G   P  +  Y +++ GLCRFSV  +     +  A +  LD T+
Sbjct  87   QVV-GSNWP--KPNYTLLITGLCRFSVSTVLKERPFVLAEVEQLDKTE  131



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1358489737150