BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9250

Length=597
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009778012.1|  PREDICTED: methanol O-anthraniloyltransferas...    180   3e-50   Nicotiana sylvestris
ref|XP_006361592.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    178   1e-49   Solanum tuberosum [potatoes]
gb|KDO36005.1|  hypothetical protein CISIN_1g041298mg                   170   1e-49   Citrus sinensis [apfelsine]
ref|XP_009589917.1|  PREDICTED: methanol O-anthraniloyltransferas...    177   3e-49   Nicotiana tomentosiformis
gb|AAN85436.1|  acyltransferase 2                                       177   3e-49   Capsicum chinense [bonnet pepper]
ref|XP_009759678.1|  PREDICTED: methanol O-anthraniloyltransferas...    176   4e-49   Nicotiana sylvestris
ref|XP_006350348.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    176   5e-49   Solanum tuberosum [potatoes]
ref|XP_004239236.1|  PREDICTED: methanol O-anthraniloyltransferas...    176   7e-49   Solanum lycopersicum
gb|ACV74416.1|  putative alcohol acyl transferase                       176   1e-48   Camellia sinensis [black tea]
ref|XP_006470748.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    175   1e-48   Citrus sinensis [apfelsine]
ref|XP_006446264.1|  hypothetical protein CICLE_v10015163mg             175   2e-48   Citrus clementina [clementine]
ref|XP_006446267.1|  hypothetical protein CICLE_v10015194mg             174   3e-48   
ref|XP_006470570.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    174   5e-48   Citrus sinensis [apfelsine]
gb|AIW04708.1|  alcohol acyltransferase 1                               172   2e-47   Solanum pennellii
ref|XP_006351055.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    171   4e-47   Solanum tuberosum [potatoes]
ref|XP_006470571.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    171   5e-47   Citrus sinensis [apfelsine]
ref|NP_001275839.1|  alcohol acyl transferase                           171   7e-47   Citrus sinensis [apfelsine]
gb|AGK82816.1|  alcohol acyltransferase 2                               170   1e-46   Solanum pimpinellifolium [currant tomato]
ref|XP_006470749.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    170   1e-46   
ref|XP_006470741.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    170   1e-46   Citrus sinensis [apfelsine]
ref|XP_006446263.1|  hypothetical protein CICLE_v10015199mg             170   1e-46   Citrus clementina [clementine]
ref|XP_004244681.1|  PREDICTED: methanol O-anthraniloyltransferase      169   2e-46   Solanum lycopersicum
ref|XP_002270240.1|  PREDICTED: methanol O-anthraniloyltransferase      169   2e-46   Vitis vinifera
ref|XP_007029789.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    169   3e-46   
ref|NP_001234496.1|  alcohol acyl transferase                           168   5e-46   Solanum lycopersicum
ref|XP_002524020.1|  transferase, putative                              162   9e-46   
ref|XP_006446260.1|  hypothetical protein CICLE_v10015249mg             167   9e-46   Citrus clementina [clementine]
ref|XP_008238035.1|  PREDICTED: methanol O-anthraniloyltransferas...    167   1e-45   
ref|XP_009612038.1|  PREDICTED: methanol O-anthraniloyltransferas...    159   1e-45   
ref|XP_002517500.1|  Taxadien-5-alpha-ol O-acetyltransferase, put...    167   1e-45   Ricinus communis
ref|XP_007208844.1|  hypothetical protein PRUPE_ppa025565mg             169   2e-45   
ref|XP_002325454.2|  transferase family protein                         167   2e-45   Populus trichocarpa [western balsam poplar]
gb|AJD25145.1|  benzoyl-CoA:benzyl alcohol O-benzoyltransferase         167   2e-45   Populus trichocarpa [western balsam poplar]
ref|XP_011012995.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    167   2e-45   Populus euphratica
ref|XP_002304071.1|  hypothetical protein POPTR_0003s01420g             166   3e-45   Populus trichocarpa [western balsam poplar]
ref|XP_007029786.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    167   3e-45   
ref|XP_007029787.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    167   3e-45   
gb|KDO44966.1|  hypothetical protein CISIN_1g0133462mg                  158   3e-45   Citrus sinensis [apfelsine]
ref|XP_010644575.1|  PREDICTED: methanol O-anthraniloyltransferas...    166   4e-45   
ref|XP_009612037.1|  PREDICTED: methanol O-anthraniloyltransferas...    158   7e-45   
ref|XP_011007948.1|  PREDICTED: methanol O-anthraniloyltransferas...    165   1e-44   Populus euphratica
ref|XP_002524021.1|  transferase, putative                              160   2e-44   
emb|CBI37444.3|  unnamed protein product                                158   2e-44   Vitis vinifera
gb|KHN31434.1|  Benzyl alcohol O-benzoyltransferase                     164   2e-44   Glycine soja [wild soybean]
gb|ACF07921.1|  alcohol acyl transferase                                164   3e-44   Prunus armeniaca
ref|XP_012070285.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    164   3e-44   Jatropha curcas
gb|KJB80921.1|  hypothetical protein B456_013G121500                    159   4e-44   Gossypium raimondii
ref|XP_006470747.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    163   5e-44   
emb|CBI25251.3|  unnamed protein product                                163   6e-44   Vitis vinifera
ref|XP_007209120.1|  hypothetical protein PRUPE_ppa005455mg             163   6e-44   Prunus persica
ref|XP_003521737.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    163   6e-44   Glycine max [soybeans]
ref|XP_002271603.1|  PREDICTED: methanol O-anthraniloyltransferase      162   8e-44   Vitis vinifera
ref|XP_009374085.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    162   8e-44   Pyrus x bretschneideri [bai li]
ref|XP_007029781.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    163   1e-43   
ref|XP_010665177.1|  PREDICTED: methanol O-anthraniloyltransferas...    160   1e-43   
ref|XP_007209131.1|  hypothetical protein PRUPE_ppa005625mg             162   1e-43   Prunus persica
ref|XP_002266420.1|  PREDICTED: methanol O-anthraniloyltransferase      162   2e-43   Vitis vinifera
ref|XP_008391402.1|  PREDICTED: methanol O-anthraniloyltransferas...    162   2e-43   Malus domestica [apple tree]
ref|XP_008238086.1|  PREDICTED: methanol O-anthraniloyltransferas...    162   2e-43   Prunus mume [ume]
emb|CBI37442.3|  unnamed protein product                                162   2e-43   Vitis vinifera
ref|XP_002270962.1|  PREDICTED: methanol O-anthraniloyltransferas...    161   2e-43   Vitis vinifera
emb|CAN69948.1|  hypothetical protein VITISV_009219                     161   3e-43   Vitis vinifera
ref|XP_010110383.1|  Benzyl alcohol O-benzoyltransferase                161   4e-43   Morus notabilis
emb|CAN74729.1|  hypothetical protein VITISV_042062                     160   4e-43   Vitis vinifera
ref|XP_002265841.1|  PREDICTED: methanol O-anthraniloyltransferase      160   5e-43   Vitis vinifera
ref|XP_006368249.1|  hypothetical protein POPTR_0001s00970g             160   6e-43   Populus trichocarpa [western balsam poplar]
emb|CAN68818.1|  hypothetical protein VITISV_012041                     160   6e-43   Vitis vinifera
emb|CAN77583.1|  hypothetical protein VITISV_040970                     160   8e-43   Vitis vinifera
ref|XP_009388282.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     160   9e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007029788.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    159   9e-43   
ref|XP_010665210.1|  PREDICTED: methanol O-anthraniloyltransferas...    158   1e-42   
emb|CAN72252.1|  hypothetical protein VITISV_017467                     159   1e-42   Vitis vinifera
gb|KHN31436.1|  Benzyl alcohol O-benzoyltransferase                     159   1e-42   Glycine soja [wild soybean]
ref|XP_009365763.1|  PREDICTED: methanol O-anthraniloyltransferas...    159   1e-42   Pyrus x bretschneideri [bai li]
ref|XP_012070521.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    159   1e-42   Jatropha curcas
ref|XP_002265049.1|  PREDICTED: methanol O-anthraniloyltransferase      159   2e-42   Vitis vinifera
ref|XP_008232530.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     159   2e-42   Prunus mume [ume]
gb|AJD18611.1|  alcohol acyltransferase                                 159   2e-42   Pyrus ussuriensis [Harbin pear]
gb|KJB80923.1|  hypothetical protein B456_013G121600                    159   2e-42   Gossypium raimondii
ref|XP_002266114.1|  PREDICTED: methanol O-anthraniloyltransferas...    159   2e-42   Vitis vinifera
gb|KHF99421.1|  Benzyl alcohol O-benzoyltransferase                     159   2e-42   Gossypium arboreum [tree cotton]
sp|Q3ZPN4.1|ACMAT_VITLA  RecName: Full=Methanol O-anthraniloyltra...    158   2e-42   Vitis labrusca [Concord grape]
ref|XP_003520833.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    158   2e-42   Glycine max [soybeans]
ref|XP_002319767.1|  transferase family protein                         159   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_008384757.1|  PREDICTED: methanol O-anthraniloyltransferas...    159   3e-42   
ref|XP_007029777.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    159   3e-42   
emb|CBI37443.3|  unnamed protein product                                159   3e-42   Vitis vinifera
gb|KEH40969.1|  benzyl alcohol O-benzoyltransferase                     158   4e-42   Medicago truncatula
ref|XP_003516503.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    158   4e-42   Glycine max [soybeans]
gb|AIC83790.1|  alcohol acyltransferase                                 157   6e-42   Actinidia deliciosa [Chinese gooseberry]
gb|KHN41759.1|  Benzyl alcohol O-benzoyltransferase                     158   6e-42   Glycine soja [wild soybean]
gb|KEH40977.1|  benzyl alcohol O-benzoyltransferase                     157   7e-42   Medicago truncatula
dbj|BAE72881.1|  benzoyl CoA benzoic acid benzoyltransferase            157   7e-42   Glandularia x hybrida [garden verbena]
gb|KJB82515.1|  hypothetical protein B456_013G200100                    157   8e-42   Gossypium raimondii
gb|KJB82264.1|  hypothetical protein B456_013G185700                    157   8e-42   Gossypium raimondii
ref|XP_007029790.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    157   9e-42   
ref|XP_012070522.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    157   1e-41   
ref|XP_012081025.1|  PREDICTED: LOW QUALITY PROTEIN: methanol O-a...    157   1e-41   
ref|XP_008356442.1|  PREDICTED: methanol O-anthraniloyltransferas...    157   1e-41   
ref|XP_002319766.1|  hypothetical protein POPTR_0013s07230g             157   1e-41   Populus trichocarpa [western balsam poplar]
ref|XP_011009229.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    157   1e-41   Populus euphratica
ref|XP_007029780.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    157   1e-41   
gb|KJB82262.1|  hypothetical protein B456_013G185500                    157   1e-41   Gossypium raimondii
ref|XP_006484694.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    157   1e-41   Citrus sinensis [apfelsine]
gb|KEH17125.1|  benzyl alcohol O-benzoyltransferase                     149   1e-41   Medicago truncatula
gb|KCW72711.1|  hypothetical protein EUGRSUZ_E01163                     157   1e-41   Eucalyptus grandis [rose gum]
ref|XP_007147133.1|  hypothetical protein PHAVU_006G098500g             156   2e-41   Phaseolus vulgaris [French bean]
ref|XP_011018694.1|  PREDICTED: methanol O-anthraniloyltransferas...    156   2e-41   Populus euphratica
ref|XP_006437408.1|  hypothetical protein CICLE_v10031489mg             156   2e-41   Citrus clementina [clementine]
ref|XP_007147136.1|  hypothetical protein PHAVU_006G098800g             156   2e-41   Phaseolus vulgaris [French bean]
gb|ABK96738.1|  unknown                                                 156   2e-41   Populus trichocarpa x Populus deltoides
ref|XP_008462816.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    156   2e-41   
ref|XP_009372579.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    156   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_009336752.1|  PREDICTED: methanol O-anthraniloyltransferas...    156   2e-41   
ref|XP_004151058.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    156   2e-41   Cucumis sativus [cucumbers]
ref|XP_009336751.1|  PREDICTED: methanol O-anthraniloyltransferas...    156   2e-41   
gb|AGW30205.1|  alcohol acyl transferase                                155   3e-41   Malus domestica [apple tree]
ref|XP_008359502.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    156   3e-41   
ref|XP_002319765.2|  hypothetical protein POPTR_0013s07220g             155   3e-41   
ref|XP_009365778.1|  PREDICTED: methanol O-anthraniloyltransferas...    155   3e-41   
ref|XP_009368754.1|  PREDICTED: methanol O-anthraniloyltransferas...    155   3e-41   Pyrus x bretschneideri [bai li]
ref|XP_008343918.1|  PREDICTED: methanol O-anthraniloyltransferas...    155   4e-41   
ref|XP_006470742.1|  PREDICTED: anthraniloyl-CoA:methanol acyltra...    155   4e-41   Citrus sinensis [apfelsine]
ref|XP_010689156.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    155   4e-41   Beta vulgaris subsp. vulgaris [field beet]
gb|AGW30201.1|  alcohol acyl transferase                                155   4e-41   Malus domestica [apple tree]
ref|XP_012065778.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    150   5e-41   
ref|XP_004290447.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     155   5e-41   Fragaria vesca subsp. vesca
gb|AAS48090.1|  alcohol acyl transferase                                155   5e-41   Pyrus communis
ref|XP_009368287.1|  PREDICTED: methanol O-anthraniloyltransferas...    155   6e-41   
gb|AAT68601.1|  benzoyl coenzyme A: benzyl alcohol benzoyl transf...    155   7e-41   Petunia x hybrida [garden petunia]
gb|KJB44361.1|  hypothetical protein B456_007G247900                    154   8e-41   Gossypium raimondii
ref|XP_010689157.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    154   9e-41   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007147132.1|  hypothetical protein PHAVU_006G098400g             155   9e-41   Phaseolus vulgaris [French bean]
ref|XP_007147134.1|  hypothetical protein PHAVU_006G098600g             154   9e-41   Phaseolus vulgaris [French bean]
gb|KDO48023.1|  hypothetical protein CISIN_1g031330mg                   147   9e-41   Citrus sinensis [apfelsine]
gb|AGW30204.1|  truncated alcohol acyl transferase                      152   9e-41   Malus domestica [apple tree]
ref|XP_012070283.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    154   1e-40   Jatropha curcas
gb|KDO54865.1|  hypothetical protein CISIN_1g048162mg                   146   1e-40   Citrus sinensis [apfelsine]
ref|XP_003521736.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    154   1e-40   Glycine max [soybeans]
gb|AGW30203.1|  alcohol acyl transferase                                154   1e-40   Malus domestica [apple tree]
ref|XP_006446261.1|  hypothetical protein CICLE_v10015234mg             154   1e-40   Citrus clementina [clementine]
ref|XP_003554685.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    154   2e-40   Glycine max [soybeans]
ref|XP_010110389.1|  Benzyl alcohol O-benzoyltransferase                154   2e-40   
gb|AHC32224.2|  alcohol acyl transferase 1                              154   2e-40   Eriobotrya japonica [loquat]
ref|XP_010689158.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    153   2e-40   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006368247.1|  hypothetical protein POPTR_0001s00950g             154   2e-40   
gb|AAW51125.1|  putative alcohol acyl-transferases                      153   2e-40   Cucumis melo [Oriental melon]
ref|XP_008797996.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    147   2e-40   
ref|XP_002264599.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     153   2e-40   Vitis vinifera
ref|XP_011082158.1|  PREDICTED: methanol O-anthraniloyltransferas...    153   3e-40   Sesamum indicum [beniseed]
emb|CAA64636.1|  hsr201                                                 153   3e-40   Nicotiana tabacum [American tobacco]
ref|XP_010275172.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     153   3e-40   Nelumbo nucifera [Indian lotus]
sp|Q8GT20.1|BEBT_TOBAC  RecName: Full=Benzyl alcohol O-benzoyltra...    153   3e-40   Nicotiana tabacum [American tobacco]
gb|ACT82248.1|  alcohol acyltransferase                                 153   4e-40   Vasconcellea cundinamarcensis
gb|AFK36385.1|  unknown                                                 152   4e-40   Medicago truncatula
gb|ACJ85557.1|  unknown                                                 152   4e-40   Medicago truncatula
ref|XP_002300497.2|  hypothetical protein POPTR_0001s45180g             152   4e-40   Populus trichocarpa [western balsam poplar]
gb|KDO36030.1|  hypothetical protein CISIN_1g044203mg                   145   5e-40   Citrus sinensis [apfelsine]
gb|ABX57719.1|  acyltransferase                                         152   5e-40   Vanda hybrid cultivar
ref|XP_007147137.1|  hypothetical protein PHAVU_006G098900g             152   6e-40   Phaseolus vulgaris [French bean]
ref|XP_010058385.1|  PREDICTED: methanol O-anthraniloyltransferas...    151   6e-40   
gb|KJB82514.1|  hypothetical protein B456_013G200000                    152   7e-40   Gossypium raimondii
dbj|BAF49304.1|  putative acyltransferase                               152   8e-40   Clitoria ternatea
ref|XP_009386561.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    152   9e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAS79797.1|  alcohol acyl transferase                                151   1e-39   Malus domestica [apple tree]
ref|XP_010667734.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    147   1e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009804829.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     151   1e-39   Nicotiana sylvestris
ref|XP_008373476.1|  PREDICTED: methanol O-anthraniloyltransferas...    151   1e-39   
gb|AAR99826.1|  alcohol acyl transferase                                151   1e-39   Malus domestica [apple tree]
ref|XP_009803456.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    151   1e-39   Nicotiana sylvestris
ref|XP_009619718.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     151   1e-39   Nicotiana tomentosiformis
ref|XP_008462818.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    151   1e-39   Cucumis melo [Oriental melon]
ref|XP_008355599.1|  PREDICTED: methanol O-anthraniloyltransferas...    151   1e-39   
ref|XP_008362881.1|  PREDICTED: methanol O-anthraniloyltransferas...    151   2e-39   
ref|XP_011098396.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    151   2e-39   Sesamum indicum [beniseed]
ref|XP_011046335.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    150   2e-39   Populus euphratica
emb|CDP09539.1|  unnamed protein product                                150   2e-39   Coffea canephora [robusta coffee]
gb|AES82602.2|  benzyl alcohol O-benzoyltransferase                     143   2e-39   Medicago truncatula
ref|XP_006370914.1|  hypothetical protein POPTR_0019s01690g             150   2e-39   Populus trichocarpa [western balsam poplar]
ref|XP_011046333.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    150   3e-39   Populus euphratica
ref|XP_008373466.1|  PREDICTED: methanol O-anthraniloyltransferas...    150   3e-39   
ref|XP_002524018.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    150   3e-39   Ricinus communis
ref|XP_008368021.1|  PREDICTED: methanol O-anthraniloyltransferas...    150   3e-39   
ref|XP_010933015.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     143   3e-39   Elaeis guineensis
ref|XP_009365780.1|  PREDICTED: methanol O-anthraniloyltransferas...    150   4e-39   Pyrus x bretschneideri [bai li]
ref|XP_006588255.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    147   4e-39   
ref|XP_003549135.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    150   4e-39   Glycine max [soybeans]
ref|XP_008364483.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    149   4e-39   
ref|XP_003518844.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     149   5e-39   Glycine max [soybeans]
ref|XP_006370717.1|  hypothetical protein POPTR_0001s45150g             147   5e-39   
ref|XP_006370913.1|  hypothetical protein POPTR_0019s01680g             149   6e-39   Populus trichocarpa [western balsam poplar]
dbj|BAJ92444.1|  predicted protein                                      149   7e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFK34239.1|  unknown                                                 149   8e-39   Medicago truncatula
gb|ABR16595.1|  unknown                                                 149   1e-38   Picea sitchensis
gb|ABR16407.1|  unknown                                                 149   1e-38   Picea sitchensis
ref|XP_007029776.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    149   1e-38   
ref|XP_004151857.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    149   1e-38   Cucumis sativus [cucumbers]
ref|XP_006600094.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    141   1e-38   
ref|XP_011041078.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    149   1e-38   Populus euphratica
gb|KDP39569.1|  hypothetical protein JCGZ_02589                         146   1e-38   Jatropha curcas
ref|XP_003626384.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    142   1e-38   
gb|AES82601.2|  benzyl alcohol O-benzoyltransferase                     149   2e-38   Medicago truncatula
ref|XP_003626388.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    148   2e-38   Medicago truncatula
ref|XP_003626383.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    149   2e-38   
ref|XP_002298956.2|  hypothetical protein POPTR_0001s45160g             148   2e-38   Populus trichocarpa [western balsam poplar]
gb|KJB82513.1|  hypothetical protein B456_013G199900                    148   2e-38   Gossypium raimondii
ref|XP_003574156.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     148   2e-38   Brachypodium distachyon [annual false brome]
ref|XP_011623977.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     147   3e-38   Amborella trichopoda
gb|KEH40971.1|  benzyl alcohol O-benzoyltransferase                     147   4e-38   Medicago truncatula
ref|XP_003536235.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    147   4e-38   Glycine max [soybeans]
ref|XP_008344828.1|  PREDICTED: methanol O-anthraniloyltransferas...    141   4e-38   
gb|ERM94783.1|  hypothetical protein AMTR_s00011p00264170               147   4e-38   Amborella trichopoda
sp|Q5H873.1|HLTT_LUPAL  RecName: Full=13-hydroxylupanine O-tigloy...    147   4e-38   Lupinus albus
gb|KEH40976.1|  benzyl alcohol O-benzoyltransferase                     146   4e-38   Medicago truncatula
ref|XP_011041077.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    147   5e-38   Populus euphratica
ref|XP_009374321.1|  PREDICTED: methanol O-anthraniloyltransferas...    147   6e-38   Pyrus x bretschneideri [bai li]
ref|XP_012070282.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    146   6e-38   Jatropha curcas
ref|XP_004498016.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    147   6e-38   Cicer arietinum [garbanzo]
ref|XP_008779983.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    139   6e-38   
gb|ABN48480.1|  quinolizidine alkaloid O-tigloyltransferase             146   6e-38   Lupinus albus
ref|XP_004305015.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    146   7e-38   Fragaria vesca subsp. vesca
ref|XP_010058392.1|  PREDICTED: methanol O-anthraniloyltransferas...    147   8e-38   
ref|XP_003616154.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    146   1e-37   Medicago truncatula
gb|KJB78759.1|  hypothetical protein B456_013G017100                    145   1e-37   Gossypium raimondii
gb|AES82607.2|  benzyl alcohol O-benzoyltransferase                     145   1e-37   Medicago truncatula
gb|ERM94786.1|  hypothetical protein AMTR_s00011p00264530               139   2e-37   Amborella trichopoda
ref|XP_004986631.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    145   2e-37   Setaria italica
ref|XP_010918388.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    139   2e-37   Elaeis guineensis
gb|KCW84614.1|  hypothetical protein EUGRSUZ_B01445                     144   2e-37   Eucalyptus grandis [rose gum]
ref|XP_008373467.1|  PREDICTED: methanol O-anthraniloyltransferas...    145   2e-37   
ref|XP_010058390.1|  PREDICTED: methanol O-anthraniloyltransferas...    145   2e-37   Eucalyptus grandis [rose gum]
ref|XP_011040637.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    145   2e-37   Populus euphratica
ref|XP_010045974.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    144   2e-37   Eucalyptus grandis [rose gum]
ref|XP_002298962.2|  hypothetical protein POPTR_0001s45210g             145   2e-37   
ref|XP_011085897.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    145   3e-37   Sesamum indicum [beniseed]
ref|XP_004294711.1|  PREDICTED: methanol O-anthraniloyltransferas...    144   3e-37   Fragaria vesca subsp. vesca
ref|XP_010040516.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    144   4e-37   Eucalyptus grandis [rose gum]
ref|XP_004494963.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    144   4e-37   
ref|XP_010040517.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    144   4e-37   
ref|XP_003626386.1|  Alcohol acetyltransferase                          144   4e-37   Medicago truncatula
ref|XP_003626389.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    145   4e-37   
ref|XP_011624423.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     140   5e-37   Amborella trichopoda
ref|NP_001064997.1|  Os10g0503300                                       144   6e-37   
sp|Q8GT21.1|BEBT_CLABR  RecName: Full=Benzyl alcohol O-benzoyltra...    143   9e-37   Clarkia breweri [fairy fans]
ref|XP_004986643.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    143   9e-37   Setaria italica
ref|XP_007145940.1|  hypothetical protein PHAVU_007G280800g             143   1e-36   Phaseolus vulgaris [French bean]
ref|XP_011085899.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    143   1e-36   Sesamum indicum [beniseed]
gb|AAG13627.1|AC078840_18  putative hypersensitivity-related (hsr...    144   1e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007147135.1|  hypothetical protein PHAVU_006G098700g             143   1e-36   Phaseolus vulgaris [French bean]
emb|CDP22130.1|  unnamed protein product                                136   1e-36   Coffea canephora [robusta coffee]
emb|CDP21409.1|  unnamed protein product                                143   1e-36   Coffea canephora [robusta coffee]
ref|XP_010038484.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    142   2e-36   Eucalyptus grandis [rose gum]
ref|XP_003536109.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    142   2e-36   Glycine max [soybeans]
gb|KCW72712.1|  hypothetical protein EUGRSUZ_E01165                     141   2e-36   Eucalyptus grandis [rose gum]
ref|XP_006377894.1|  hypothetical protein POPTR_0011s15660g             142   2e-36   
gb|EYU41386.1|  hypothetical protein MIMGU_mgv1a006089mg                142   2e-36   Erythranthe guttata [common monkey flower]
gb|EYU41389.1|  hypothetical protein MIMGU_mgv1a006154mg                142   3e-36   Erythranthe guttata [common monkey flower]
ref|XP_004506306.1|  PREDICTED: 13-hydroxylupanine O-tigloyltrans...    142   3e-36   Cicer arietinum [garbanzo]
ref|XP_004243495.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    142   4e-36   Solanum lycopersicum
ref|XP_002466979.1|  hypothetical protein SORBIDRAFT_01g017800          141   5e-36   Sorghum bicolor [broomcorn]
ref|XP_010668237.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    135   5e-36   
ref|XP_004498041.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    137   8e-36   
ref|XP_011016392.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    134   1e-35   Populus euphratica
ref|XP_010058393.1|  PREDICTED: methanol O-anthraniloyltransferas...    141   1e-35   
ref|XP_011085895.1|  PREDICTED: LOW QUALITY PROTEIN: benzyl alcoh...    140   1e-35   
ref|XP_010058386.1|  PREDICTED: methanol O-anthraniloyltransferas...    140   1e-35   Eucalyptus grandis [rose gum]
ref|XP_004982683.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    140   2e-35   Setaria italica
tpg|DAA49395.1|  TPA: 10-deacetylbaccatin III 10-O-acetyltransferase    140   2e-35   
ref|XP_008678444.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    140   2e-35   Zea mays [maize]
emb|CBI29212.3|  unnamed protein product                                139   2e-35   Vitis vinifera
ref|NP_001152518.1|  10-deacetylbaccatin III 10-O-acetyltransferase     140   2e-35   Zea mays [maize]
ref|XP_010672751.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    140   2e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW72714.1|  hypothetical protein EUGRSUZ_E01167                     140   2e-35   Eucalyptus grandis [rose gum]
gb|KJB44358.1|  hypothetical protein B456_007G247700                    139   3e-35   Gossypium raimondii
gb|EYU41395.1|  hypothetical protein MIMGU_mgv1a006288mg                139   4e-35   Erythranthe guttata [common monkey flower]
gb|AFK34995.1|  unknown                                                 133   4e-35   Lotus japonicus
ref|XP_004301775.1|  PREDICTED: methanol O-anthraniloyltransferas...    139   4e-35   Fragaria vesca subsp. vesca
ref|XP_010058394.1|  PREDICTED: methanol O-anthraniloyltransferas...    139   4e-35   Eucalyptus grandis [rose gum]
ref|XP_006878640.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     132   4e-35   
ref|XP_009803458.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    132   5e-35   
ref|XP_004243496.2|  PREDICTED: benzyl alcohol O-benzoyltransferase     139   5e-35   
ref|XP_003626382.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    138   7e-35   
ref|XP_006400294.1|  hypothetical protein EUTSA_v10013454mg             138   7e-35   
gb|AGW30202.1|  alcohol acyl transferase                                137   1e-34   
gb|KCW72709.1|  hypothetical protein EUGRSUZ_E01161                     138   1e-34   
ref|NP_001266678.1|  10-deacetylbaccatin III 10-O-acetyltransferase     137   1e-34   
gb|KFK25971.1|  hypothetical protein AALP_AA8G186800                    137   3e-34   
ref|XP_009131598.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferase      136   3e-34   
gb|AFK49108.1|  unknown                                                 136   5e-34   
ref|XP_003591040.1|  Benzoyl coenzyme A benzyl alcohol benzoyl tr...    136   5e-34   
ref|XP_010941428.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    135   6e-34   
emb|CDX78752.1|  BnaA03g06640D                                          135   7e-34   
gb|EYU34530.1|  hypothetical protein MIMGU_mgv1a006233mg                135   7e-34   
ref|XP_010058391.1|  PREDICTED: methanol O-anthraniloyltransferas...    135   7e-34   
ref|XP_010042878.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    128   1e-33   
ref|XP_010521555.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    135   1e-33   
gb|KDP39574.1|  hypothetical protein JCGZ_02594                         132   1e-33   
ref|XP_004151858.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    134   1e-33   
ref|NP_197256.1|  HXXXD-type acyl-transferase family protein            134   2e-33   
ref|XP_010667725.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    134   2e-33   
ref|XP_010557036.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    134   2e-33   
gb|AEM43830.1|  alcohol acyl transferase                                133   3e-33   
ref|XP_011650045.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    134   3e-33   
ref|NP_001284403.1|  benzyl alcohol O-benzoyltransferase-like           134   3e-33   
gb|AAL77060.1|AF468022_1  putative acyltransferase                      134   3e-33   
emb|CDP18599.1|  unnamed protein product                                134   3e-33   
gb|KJB80922.1|  hypothetical protein B456_013G121500                    131   3e-33   
ref|XP_008462820.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    133   6e-33   
ref|XP_010492711.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    133   6e-33   
ref|XP_010420481.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    132   8e-33   
ref|XP_007211147.1|  hypothetical protein PRUPE_ppa026958mg             125   1e-32   
ref|XP_010549748.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    132   1e-32   
ref|XP_010557037.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    132   1e-32   
emb|CDP11061.1|  unnamed protein product                                131   2e-32   
gb|KFK25975.1|  hypothetical protein AALP_AA8G187200                    131   2e-32   
gb|KFK38055.1|  hypothetical protein AALP_AA3G064400                    131   3e-32   
gb|KFK38057.1|  hypothetical protein AALP_AA3G064500                    132   3e-32   
dbj|BAB78588.1|  alcohol acetyltransferase                              130   3e-32   
ref|XP_009130368.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    130   3e-32   
ref|XP_008462821.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    130   3e-32   
gb|EYU41388.1|  hypothetical protein MIMGU_mgv1a021683mg                130   3e-32   
emb|CAA94432.1|  unknown                                                130   4e-32   
ref|XP_008677983.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    130   5e-32   
emb|CDY50708.1|  BnaC05g47750D                                          130   5e-32   
ref|XP_006289628.1|  hypothetical protein CARUB_v10003180mg             130   7e-32   
ref|XP_010489657.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    129   8e-32   
ref|XP_010941427.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    129   9e-32   
ref|XP_006290240.1|  hypothetical protein CARUB_v100037960mg            123   1e-31   
ref|XP_010453955.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    129   1e-31   
ref|XP_004151856.2|  PREDICTED: benzyl alcohol O-benzoyltransfera...    129   2e-31   
ref|XP_006446721.1|  hypothetical protein CICLE_v10017956mg             128   2e-31   
gb|EYU41396.1|  hypothetical protein MIMGU_mgv1a005907mg                128   2e-31   
gb|EYU41397.1|  hypothetical protein MIMGU_mgv1a024853mg                127   3e-31   
gb|KDO39324.1|  hypothetical protein CISIN_1g045235mg                   120   4e-31   
ref|XP_008779984.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    127   4e-31   
gb|AAM61186.1|  putative hypersensitivity-related gene                  127   5e-31   
ref|NP_186998.1|  acetyl CoA:(Z)-3-hexen-1-ol acetyltransferase         127   5e-31   
ref|XP_010420482.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    127   6e-31   
ref|XP_003627912.1|  Taxadien-5-alpha-ol O-acetyltransferase            120   7e-31   
ref|XP_006376283.1|  hypothetical protein POPTR_0013s11650g             127   7e-31   
ref|XP_010453953.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    127   8e-31   
ref|XP_010492712.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    127   9e-31   
dbj|BAK02525.1|  predicted protein                                      127   9e-31   
gb|KHN04051.1|  Benzyl alcohol O-benzoyltransferase                     126   1e-30   
gb|KJB82260.1|  hypothetical protein B456_013G185300                    126   1e-30   
ref|XP_010558858.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    126   2e-30   
ref|XP_010558859.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    126   2e-30   
gb|KEH33832.1|  benzyl alcohol O-benzoyltransferase                     120   2e-30   
ref|XP_010550256.1|  PREDICTED: LOW QUALITY PROTEIN: (Z)-3-hexen-...    125   2e-30   
ref|XP_010557044.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    125   2e-30   
emb|CDY43120.1|  BnaA05g32660D                                          125   4e-30   
ref|XP_011009230.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    124   5e-30   
ref|XP_009130369.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    124   5e-30   
emb|CDY50709.1|  BnaC05g47740D                                          124   5e-30   
ref|XP_007029784.1|  Quinolizidine alkaloid O-tigloyltransferase        119   5e-30   
dbj|BAC58010.1|  alcohol acyltransferase                                124   6e-30   
ref|XP_002884383.1|  chat-3-HEXEN-1-OL ACETYLTRANSFERASE                124   6e-30   
gb|EPS68008.1|  hypothetical protein M569_06766                         124   7e-30   
emb|CDP17523.1|  unnamed protein product                                124   8e-30   
ref|XP_006653585.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    122   1e-29   
ref|XP_004960441.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    123   2e-29   
ref|XP_008670946.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    122   2e-29   
ref|XP_010450554.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferase      122   3e-29   
gb|EMT16226.1|  10-deacetylbaccatin III 10-O-acetyltransferase          120   3e-29   
ref|XP_010676997.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    117   3e-29   
ref|XP_011085894.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    122   3e-29   
emb|CDP11065.1|  unnamed protein product                                117   3e-29   
gb|KHN43217.1|  Benzyl alcohol O-benzoyltransferase                     122   4e-29   
ref|NP_001148135.1|  taxadien-5-alpha-ol O-acetyltransferase            121   5e-29   
gb|ACR36326.1|  unknown                                                 121   6e-29   
ref|XP_002298960.2|  hypothetical protein POPTR_0001s45190g             121   7e-29   
ref|XP_004966401.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    121   1e-28   
gb|EEE62389.1|  hypothetical protein OsJ_17179                          120   2e-28   
ref|NP_001058545.2|  Os06g0710700                                       120   2e-28   
gb|EAZ02323.1|  hypothetical protein OsI_24425                          120   2e-28   
gb|EAZ04276.1|  hypothetical protein OsI_26418                          120   2e-28   
gb|AAS55785.1|  putative benzyl alcohol benzoyl transferase             120   2e-28   
ref|XP_008660766.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    120   2e-28   
ref|XP_010108950.1|  Benzyl alcohol O-benzoyltransferase                114   2e-28   
gb|KFK38056.1|  hypothetical protein AALP_AA3G064500                    121   3e-28   
ref|XP_008660976.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    119   4e-28   
ref|XP_008660975.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    119   5e-28   
gb|EMT26852.1|  10-deacetylbaccatin III 10-O-acetyltransferase          115   5e-28   
gb|EMT25787.1|  10-deacetylbaccatin III 10-O-acetyltransferase          118   6e-28   
gb|EMT21731.1|  Taxadien-5-alpha-ol O-acetyltransferase                 115   7e-28   
ref|XP_006657584.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    118   9e-28   
ref|XP_003563544.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    118   9e-28   
ref|XP_002438731.1|  hypothetical protein SORBIDRAFT_10g025140          118   9e-28   
gb|KCW72708.1|  hypothetical protein EUGRSUZ_E01160                     111   1e-27   
gb|EAY80579.1|  hypothetical protein OsI_35761                          117   1e-27   
ref|XP_006849740.2|  PREDICTED: benzyl alcohol O-benzoyltransferase     117   1e-27   
ref|XP_002438993.1|  hypothetical protein SORBIDRAFT_10g029610          117   2e-27   
ref|XP_002437572.1|  hypothetical protein SORBIDRAFT_10g029590          117   2e-27   
ref|XP_002437575.1|  hypothetical protein SORBIDRAFT_10g029620          117   3e-27   
ref|XP_006654215.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    116   4e-27   
ref|NP_001059277.1|  Os07g0244200                                       116   4e-27   
emb|CBI29213.3|  unnamed protein product                                111   5e-27   
gb|EMT07805.1|  10-deacetylbaccatin III 10-O-acetyltransferase          115   5e-27   
gb|EAY94788.1|  hypothetical protein OsI_16567                          114   8e-27   
ref|XP_004983290.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    115   8e-27   
gb|KHN31437.1|  Benzyl alcohol O-benzoyltransferase                     109   8e-27   
ref|XP_006657332.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    115   8e-27   
gb|EMT07181.1|  Taxadien-5-alpha-ol O-acetyltransferase                 115   9e-27   
ref|XP_002447250.1|  hypothetical protein SORBIDRAFT_06g031260          115   1e-26   
ref|XP_002464781.1|  hypothetical protein SORBIDRAFT_01g026670          115   1e-26   
emb|CAE04720.1|  OSJNBa0043L24.8                                        115   1e-26   
ref|XP_006577743.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    109   2e-26   
ref|XP_004966402.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    114   2e-26   
ref|XP_009371837.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     114   2e-26   
gb|EMT25788.1|  10-deacetylbaccatin III 10-O-acetyltransferase          110   2e-26   
gb|EEE61303.1|  hypothetical protein OsJ_15395                          114   3e-26   
ref|XP_007029779.1|  Benzoyl coenzyme A: Benzyl alcohol benzoyl t...    112   3e-26   
ref|NP_001148798.1|  transferase family protein                         114   4e-26   
gb|EAY73940.1|  hypothetical protein OsI_01825                          113   4e-26   
ref|XP_006297655.1|  hypothetical protein CARUB_v10013677mg             113   5e-26   
ref|XP_007147131.1|  hypothetical protein PHAVU_006G098300g             112   5e-26   
ref|XP_008662941.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    113   5e-26   
ref|XP_002873835.1|  transferase family protein                         113   5e-26   
gb|KGN63336.1|  hypothetical protein Csa_2G430570                       113   6e-26   
ref|NP_001059940.1|  Os07g0550600                                       112   7e-26   
ref|XP_002440560.1|  hypothetical protein SORBIDRAFT_09g003170          113   8e-26   
emb|CAN74177.1|  hypothetical protein VITISV_029256                     112   9e-26   
emb|CAH67336.1|  OSIGBa0157A06.5                                        112   1e-25   
ref|XP_002272487.1|  PREDICTED: benzyl alcohol O-benzoyltransferase     112   1e-25   
gb|KEH40970.1|  benzyl alcohol O-benzoyltransferase                     112   1e-25   
ref|XP_010231737.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    112   1e-25   
dbj|BAJ88238.1|  predicted protein                                      112   1e-25   
gb|EEE63107.1|  hypothetical protein OsJ_17915                          112   1e-25   
gb|AAT01406.1|  hypothetical protein                                    112   1e-25   
ref|NP_001042981.1|  Os01g0350000                                       110   5e-25   
emb|CDM80509.1|  unnamed protein product                                110   6e-25   
dbj|BAJ96970.1|  predicted protein                                      110   8e-25   
gb|EAY96502.1|  hypothetical protein OsI_18404                          108   2e-24   
ref|XP_006657816.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    108   3e-24   
ref|XP_008645066.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    108   3e-24   
ref|NP_001054603.1|  Os05g0141300                                       108   3e-24   
gb|KDP43343.1|  hypothetical protein JCGZ_25448                         102   3e-24   
gb|EEE62279.1|  hypothetical protein OsJ_17067                          108   3e-24   
gb|EEE63219.1|  hypothetical protein OsJ_18029                          108   3e-24   
tpg|DAA46610.1|  TPA: hypothetical protein ZEAMMB73_163572              108   4e-24   
gb|EMS58180.1|  Omega-hydroxypalmitate O-feruloyl transferase           103   4e-24   
gb|AAV32163.1|  hypothetical protein                                    108   5e-24   
gb|EPS60076.1|  hypothetical protein M569_14728                         103   5e-24   
ref|XP_003575185.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    107   7e-24   
ref|XP_008348656.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    107   8e-24   
ref|XP_002524013.1|  hypothetical protein RCOM_1516910                  103   8e-24   
ref|XP_004951311.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    107   1e-23   
ref|XP_003581404.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    106   1e-23   
ref|XP_002461609.1|  hypothetical protein SORBIDRAFT_02g005330          106   2e-23   
ref|XP_003573843.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    106   2e-23   
ref|XP_010436740.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    105   2e-23   
ref|XP_004983425.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    105   3e-23   
gb|AAG12478.2|AC037197_3  Putative hsr201 hypersensitivity-relate...    104   4e-23   
gb|EEE51952.1|  hypothetical protein OsJ_33591                          104   6e-23   
ref|XP_010527080.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    104   6e-23   
gb|AAP51790.2|  Transferase family protein                              104   7e-23   
ref|XP_006664809.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    104   8e-23   
gb|AAS07101.1|  putative hypersensitivity-related protein               103   2e-22   
gb|EEC75861.1|  hypothetical protein OsI_12874                          103   2e-22   
ref|XP_010109027.1|  Benzyl alcohol O-benzoyltransferase                103   2e-22   
ref|XP_004983466.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    103   3e-22   
ref|XP_007217533.1|  hypothetical protein PRUPE_ppa023329mg             103   3e-22   
ref|XP_007038058.1|  HXXXD-type acyl-transferase family protein i...    102   3e-22   
ref|XP_002524024.1|  3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransf...    102   4e-22   
ref|NP_001064288.1|  Os10g0195600                                       102   6e-22   
ref|XP_007038057.1|  HXXXD-type acyl-transferase family protein, ...    102   6e-22   
gb|EAY77933.1|  hypothetical protein OsI_32974                          102   6e-22   
ref|XP_006658432.1|  PREDICTED: uncharacterized protein LOC102714479    102   8e-22   
ref|XP_008464403.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    101   9e-22   
ref|XP_010678277.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    100   1e-21   
ref|XP_010550257.1|  PREDICTED: (Z)-3-hexen-1-ol acetyltransferas...    101   1e-21   
ref|XP_004983468.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...    100   2e-21   
ref|XP_004138033.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...    100   2e-21   
ref|XP_002464832.1|  hypothetical protein SORBIDRAFT_01g027380          100   3e-21   
ref|XP_006661593.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  99.8    4e-21   
ref|XP_008659223.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  99.8    5e-21   
gb|KJB70702.1|  hypothetical protein B456_011G088000                  99.4    5e-21   
gb|AIZ00468.1|  alcohol acyl transferase                              97.1    5e-21   
ref|XP_001772486.1|  predicted protein                                99.4    6e-21   
ref|XP_003576099.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  99.4    6e-21   
gb|KJB70701.1|  hypothetical protein B456_011G088000                  99.0    6e-21   
ref|XP_010265527.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  99.0    7e-21   
gb|KJB56505.1|  hypothetical protein B456_009G122600                  98.6    7e-21   
ref|XP_011073101.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  98.6    8e-21   
gb|KJB56501.1|  hypothetical protein B456_009G122600                  98.6    1e-20   
gb|AAX96461.1|  Transferase family                                    97.8    1e-20   
gb|ADD62404.1|  fatty omega-hydroxyacid/fatty alcohol 0-hydroxyci...  98.2    1e-20   
gb|ACU16063.1|  unknown                                               96.3    1e-20   
ref|XP_010249109.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  98.2    1e-20   
ref|XP_008791113.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  98.2    1e-20   
ref|XP_006664808.1|  PREDICTED: benzyl alcohol O-benzoyltransfera...  99.0    1e-20   
ref|XP_012067474.1|  PREDICTED: shikimate O-hydroxycinnamoyltrans...  98.2    1e-20   
ref|XP_011073100.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  99.0    1e-20   
gb|EMS53476.1|  Omega-hydroxypalmitate O-feruloyl transferase         96.3    1e-20   
ref|XP_006388974.1|  hypothetical protein POPTR_0065s002302g          92.4    2e-20   
gb|AHG97388.1|  putative hydroxycinnamoyl CoA shikimate/quinate h...  98.2    2e-20   
ref|XP_008804093.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  97.4    2e-20   
ref|XP_003634222.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  97.4    3e-20   
ref|XP_002440561.1|  hypothetical protein SORBIDRAFT_09g003180        98.2    3e-20   
ref|XP_009379971.1|  PREDICTED: omega-hydroxypalmitate O-feruloyl...  97.8    3e-20   



>ref|XP_009778012.1| PREDICTED: methanol O-anthraniloyltransferase-like [Nicotiana 
sylvestris]
Length=461

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 112/142 (79%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            KPELV P T TPRE+K LSDIDDQ SLR+ +P L FY+   SM GKDP KVIKEGL+K L
Sbjct  15   KPELVIPATATPRERKHLSDIDDQGSLRFQIPILMFYKFSPSMEGKDPVKVIKEGLSKTL  74

Query  354  VFFYPLAGRLTE-GPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            VF+YPLAGR+ E  P++KL+VDCNGEG+LFV A+A + L  LGD I  PCPYL +L Y+V
Sbjct  75   VFYYPLAGRIIELMPDRKLVVDCNGEGILFVEADAQVELDKLGDSIKPPCPYLDQLLYSV  134

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPLLL+QVTRFSCG
Sbjct  135  PGSAAIIGCPLLLVQVTRFSCG  156



>ref|XP_006361592.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Solanum 
tuberosum]
Length=447

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            KP+LV P   TP E K LS+IDDQ S R+H+  L FY+    M GKDPAK IK+GL+K L
Sbjct  14   KPKLVVPSIVTPHEIKHLSEIDDQGSTRFHVSLLMFYKYNSLMEGKDPAKFIKDGLSKTL  73

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YPLAGRL EGPNKKL+V+CNGEGVLF+ A+AN+ L  LGD I  PCPYL  L +NVP
Sbjct  74   VFYYPLAGRLIEGPNKKLMVNCNGEGVLFIEADANVELEKLGDSIKPPCPYLDLLLHNVP  133

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  I GCPLLLIQVTRF CG
Sbjct  134  GSDGIIGCPLLLIQVTRFRCG  154



>gb|KDO36005.1| hypothetical protein CISIN_1g041298mg [Citrus sinensis]
Length=157

 Score =   170 bits (430),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 113/154 (73%), Gaps = 8/154 (5%)
 Frame = +3

Query  147  PRFSVRLTTK---PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKES-----M  302
            P+FS+ L+     PEL+ P  PTPRE K LSDIDDQ S R+H+P ++ Y+N  +     +
Sbjct  3    PKFSLVLSVTRQAPELIVPARPTPRELKQLSDIDDQESFRFHIPVIFLYKNNSASSPPVL  62

Query  303  VGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGD  482
              KDP KVIKE +++ALV++YP AGRL EGPN+KL+VDCNGEG+LF+ AEAN  L  LG 
Sbjct  63   KEKDPVKVIKEAISEALVYYYPFAGRLIEGPNRKLMVDCNGEGILFLEAEANFKLEQLGG  122

Query  483  FIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTR  584
             I  PCPYL++L YNVPGS  I GCPLLLIQV+R
Sbjct  123  AIQPPCPYLEQLTYNVPGSEGILGCPLLLIQVSR  156



>ref|XP_009589917.1| PREDICTED: methanol O-anthraniloyltransferase-like [Nicotiana 
tomentosiformis]
Length=444

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            KP+LV P   TPRE K LSDIDDQ S  + MP + FY+   SM GKDPAK IK GL+K L
Sbjct  9    KPKLVVPAKVTPRETKHLSDIDDQGSTHFQMPTIMFYKYNSSMEGKDPAKFIKNGLSKTL  68

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YPLAGR+ EGPNKKL+V+CNGEG+LFV A+ANI L  LG+ I  PC YL  + +NVP
Sbjct  69   VFYYPLAGRIFEGPNKKLLVNCNGEGILFVEADANIELDKLGNSIKPPCTYLDLVIHNVP  128

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  I GCPLLLIQVTRFSCG
Sbjct  129  GSDGIIGCPLLLIQVTRFSCG  149



>gb|AAN85436.1| acyltransferase 2 [Capsicum chinense]
Length=453

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            KP+LV P   TPRE K LSDIDDQ S R  +P L FY+    M GKDPAK+IK+GL+K L
Sbjct  19   KPKLVVPSIVTPRETKHLSDIDDQGSARLQIPILMFYKYNSLMEGKDPAKLIKDGLSKTL  78

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
             F+YPLAGRL EGPN+KL+V+CN EGVLFV A+AN+ L  LGD I  PCPYL  L +NVP
Sbjct  79   SFYYPLAGRLIEGPNRKLMVNCNSEGVLFVEADANVELEKLGDSIKPPCPYLDLLLHNVP  138

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  I GCPLLL+QVTRFSCG
Sbjct  139  GSDGIIGCPLLLVQVTRFSCG  159



>ref|XP_009759678.1| PREDICTED: methanol O-anthraniloyltransferase-like [Nicotiana 
sylvestris]
Length=444

 Score =   176 bits (447),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 92/141 (65%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            KP LV P   TP E K LSDIDDQ S  + MP + FY+   S+ GKDPAK IK+GL+K L
Sbjct  9    KPILVVPAKATPLETKHLSDIDDQGSTHFQMPTILFYKYNSSIEGKDPAKYIKDGLSKTL  68

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YPLAGR+ EGPNKKL+V+CNGEG+LFV A+ANI L  LGD I  PCPYL  L +NVP
Sbjct  69   VFYYPLAGRIIEGPNKKLLVNCNGEGILFVEADANIELDKLGDSIKPPCPYLDILIHNVP  128

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  I GCPLLL+QVTRFS G
Sbjct  129  GSDGIIGCPLLLVQVTRFSSG  149



>ref|XP_006350348.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Solanum 
tuberosum]
Length=453

 Score =   176 bits (447),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 112/156 (72%), Gaps = 0/156 (0%)
 Frame = +3

Query  129  MACLFPPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVG  308
            MA +  P        KPEL+ P+   P++   LSDIDDQ  LR+ MP L FY+   SM G
Sbjct  1    MAIIPKPLVISSSRRKPELIVPQNKIPKKILYLSDIDDQEGLRFQMPILMFYKYNSSMKG  60

Query  309  KDPAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFI  488
            KD AK+IK+GL+K LVF+YPLAGR+ EGPN+KL+V+CN EG++F+ A+AN+ L  LGD I
Sbjct  61   KDHAKIIKDGLSKTLVFYYPLAGRIIEGPNRKLMVNCNSEGIMFIEADANVELEKLGDSI  120

Query  489  HSPCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              PCPYL++L YN PGS  I GCPL+L+QVT F+CG
Sbjct  121  LPPCPYLEELLYNEPGSVGIIGCPLMLVQVTHFTCG  156



>ref|XP_004239236.1| PREDICTED: methanol O-anthraniloyltransferase-like [Solanum lycopersicum]
Length=448

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            KP+LV P   TP E K LS+IDDQ S R+H+  L FY+    M G DPAK+IK GL+K L
Sbjct  14   KPKLVVPSIVTPHEIKHLSEIDDQGSTRFHVSVLMFYKYNSLMEGNDPAKIIKNGLSKTL  73

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YPLAGRL EGPNKKL+V+CNGEGVLF+ A+AN+ L  LGD I  PCPY+  L +NVP
Sbjct  74   VFYYPLAGRLIEGPNKKLMVNCNGEGVLFIEADANVELEKLGDSIKPPCPYMDLLLHNVP  133

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  + GCPLLLIQVTRF+CG
Sbjct  134  GSDGMIGCPLLLIQVTRFTCG  154



>gb|ACV74416.1| putative alcohol acyl transferase [Camellia sinensis]
Length=464

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 0/124 (0%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKK  404
            LSDIDDQ  LR+ +P + FY+N  SM GKDPA VI+E LAKALVF+YP AGRL EGPN+K
Sbjct  33   LSDIDDQEGLRFQLPVIMFYKNNPSMEGKDPASVIREALAKALVFYYPFAGRLVEGPNRK  92

Query  405  LIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTR  584
            L VDC  EGVLF+ A+AN+ +  LGD +   CPYL++L Y+VPGS  I GCPLLLIQVTR
Sbjct  93   LSVDCTAEGVLFIEADANVEIDWLGDAVRPGCPYLEELLYDVPGSDGIVGCPLLLIQVTR  152

Query  585  FSCG  596
            FSCG
Sbjct  153  FSCG  156



>ref|XP_006470748.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=463

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 115/158 (73%), Gaps = 8/158 (5%)
 Frame = +3

Query  147  PRFSVRLTTK---PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKES-----M  302
            P+FS+ L+     PEL+ P  PTPRE K LSDIDDQ S R+H+P ++ Y+N  +     +
Sbjct  3    PKFSLVLSVTRQAPELIVPARPTPRELKQLSDIDDQESFRFHIPVIFLYKNNSASSPPVL  62

Query  303  VGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGD  482
              KDP KVIKE +++ALV++YP AGRL EGPN+KL+VDCNGEG+LF+ AEAN  L  LG 
Sbjct  63   KEKDPVKVIKEAISEALVYYYPFAGRLIEGPNRKLMVDCNGEGILFLEAEANFKLEQLGG  122

Query  483  FIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             I  PCPYL++L YNVPGS  I GCPLLLIQVTR  CG
Sbjct  123  AIQPPCPYLEQLTYNVPGSEGILGCPLLLIQVTRLMCG  160



>ref|XP_006446264.1| hypothetical protein CICLE_v10015163mg [Citrus clementina]
 gb|ESR59504.1| hypothetical protein CICLE_v10015163mg [Citrus clementina]
Length=464

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 115/158 (73%), Gaps = 8/158 (5%)
 Frame = +3

Query  147  PRFSVRLTTK---PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKES-----M  302
            P+FS+ L+     PEL+ P  PTPRE K LSDIDDQ S R+H+P ++ Y+N  +     +
Sbjct  3    PKFSLVLSVTRQAPELIVPARPTPRELKQLSDIDDQESFRFHIPVIFLYKNNSASSPPLL  62

Query  303  VGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGD  482
              KDP KVIKE +++ALV++YP AGRL EGPN+KL+VDCNGEG+LF+ AEAN  L  LG 
Sbjct  63   KEKDPVKVIKEAISEALVYYYPFAGRLIEGPNRKLMVDCNGEGILFLEAEANFKLEQLGG  122

Query  483  FIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             I  PCPYL++L YNVPGS  I GCPLLLIQVTR  CG
Sbjct  123  AIQPPCPYLEQLTYNVPGSEGILGCPLLLIQVTRLMCG  160



>ref|XP_006446267.1| hypothetical protein CICLE_v10015194mg [Citrus clementina]
 gb|ESR59507.1| hypothetical protein CICLE_v10015194mg [Citrus clementina]
Length=456

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYEN--KESMVGKDPAKVIKEGLAKA  350
            PEL+ P  PTPRE K LSDIDDQ SLR+H+P ++FY+N    SM G+DP KVI+E ++KA
Sbjct  16   PELIVPARPTPREVKQLSDIDDQESLRFHVPVIFFYKNDPSPSMQGRDPVKVIREAISKA  75

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LVF+YPLAGRL EG N++L+V+CN EGVLF+ A+AN  L  LGD I  PCPYL +L Y+V
Sbjct  76   LVFYYPLAGRLKEGYNRRLMVECNAEGVLFIEADANFTLEQLGDDIQPPCPYLNQLLYDV  135

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPL LIQVTR +CG
Sbjct  136  PGSEGILGCPLFLIQVTRLTCG  157



>ref|XP_006470570.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=456

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 111/142 (78%), Gaps = 2/142 (1%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYEN--KESMVGKDPAKVIKEGLAKA  350
            PEL+ P+ PTPRE K +SDIDDQ SLR+ +P L+FY+N    SM G+DP KVI+E ++KA
Sbjct  16   PELIVPERPTPREVKQISDIDDQESLRFQIPLLFFYKNDPSPSMQGRDPVKVIREAISKA  75

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LVF+YPLAGRL EG N+KL+V+CN EGVLF+ A+AN  L  LGD I  PCPYL +L Y+V
Sbjct  76   LVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQLGDDIQPPCPYLNQLIYDV  135

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPLLLIQVTR +CG
Sbjct  136  PGSEGILGCPLLLIQVTRLTCG  157



>gb|AIW04708.1| alcohol acyltransferase 1 [Solanum pennellii]
Length=442

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            KP+LV P + TP E K LS+IDDQ  +R+ +P L FY+   SM GKDPA++I++GL+K L
Sbjct  13   KPKLVVPSSVTPHETKRLSEIDDQGFIRFQIPILMFYKYNSSMKGKDPARIIEDGLSKTL  72

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF++PLAGRL EGPNKKL+V+CNGEGVLF+  +ANI L  LG+ I  PCPYL  L +NVP
Sbjct  73   VFYHPLAGRLIEGPNKKLMVNCNGEGVLFIEGDANIELEKLGESIKPPCPYLDLLLHNVP  132

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  I G PLLLIQVTRF+CG
Sbjct  133  GSDGIIGSPLLLIQVTRFTCG  153



>ref|XP_006351055.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Solanum 
tuberosum]
Length=447

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKK  404
            LS+IDDQ S R+H   L FY+   SM GKDPAK+IK GL+K LVF+YPLAGRL EGPN+K
Sbjct  30   LSEIDDQGSTRFHSHILIFYKYNSSMKGKDPAKIIKNGLSKTLVFYYPLAGRLIEGPNRK  89

Query  405  LIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTR  584
            L+V+CN EG++F+ A+A + L  LGD I  PCPYL  L +NVPGS  I GCPLLL+QVTR
Sbjct  90   LMVNCNSEGIMFIEADAYVVLDKLGDSIKPPCPYLDLLLHNVPGSDGIIGCPLLLVQVTR  149

Query  585  FSCG  596
            FSCG
Sbjct  150  FSCG  153



>ref|XP_006470571.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=456

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 109/142 (77%), Gaps = 2/142 (1%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYEN--KESMVGKDPAKVIKEGLAKA  350
            PEL+ P  PTPRE K LSDIDDQ SLR+ +P ++FY+N    SM G+DP KVI+E ++KA
Sbjct  16   PELIVPARPTPREVKQLSDIDDQESLRFRVPVIFFYKNDPSPSMQGRDPVKVIREAISKA  75

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LVF+YPLAGRL EG N+KL+V+CN EGVLF+ A+AN  L  LGD I  PCPYL +L Y+V
Sbjct  76   LVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQLGDDIQPPCPYLNQLLYDV  135

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPL LIQ+TR +CG
Sbjct  136  PGSEGILGCPLFLIQMTRLTCG  157



>ref|NP_001275839.1| alcohol acyl transferase [Citrus sinensis]
 gb|ABW81204.1| alcohol acyl transferase [Citrus sinensis]
Length=456

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYEN--KESMVGKDPAKVIKEGLAKA  350
            PEL+ P+ PTPRE K +SDIDDQ SLR+ +P L+FY+N    SM G+DP KVI+E ++KA
Sbjct  16   PELIVPERPTPREVKQISDIDDQESLRFQIPLLFFYKNDPSPSMQGRDPVKVIREAISKA  75

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LVF+YPLAGRL EG N+KL+V+CN EGVLF+ A+AN  L  L D +  PCPYL +L Y+V
Sbjct  76   LVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQLRDDVQPPCPYLNQLIYDV  135

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPLLLIQVTR +CG
Sbjct  136  PGSEGILGCPLLLIQVTRLTCG  157



>gb|AGK82816.1| alcohol acyltransferase 2 [Solanum pimpinellifolium]
Length=447

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 96/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKK  404
            LS+IDDQ S R+H   L FY+    M GKDPAK+IK+GL+K LVF+YPLAGRL EGPNKK
Sbjct  30   LSEIDDQGSTRFHSHILIFYKYNSLMEGKDPAKIIKDGLSKTLVFYYPLAGRLIEGPNKK  89

Query  405  LIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTR  584
            L+V+CNGEGVLF+  +AN+ L  LG+ I  PCPYL  L +NVPGS  I G PLLL+QVTR
Sbjct  90   LMVNCNGEGVLFIEGDANVELEKLGESIKPPCPYLDLLLHNVPGSDGIIGSPLLLVQVTR  149

Query  585  FSCG  596
            FSCG
Sbjct  150  FSCG  153



>ref|XP_006470749.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=445

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 109/152 (72%), Gaps = 5/152 (3%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKES--MVGKDPAKV  326
            FSV +   PEL+ P  PT R  K LS +DDQ  LR+ +P ++FY+N  S  M GKDP KV
Sbjct  9    FSV-IRKTPELIGPARPTARVIKQLSSLDDQQCLRFQIPMIFFYKNDPSPAMEGKDPVKV  67

Query  327  IKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNL--GDFIHSPC  500
            I+E L+KAL F+YPLAGRL E  N+KL+VDCNGEGVLF  AEANI L  L  GD +  PC
Sbjct  68   IREALSKALTFYYPLAGRLKEVSNRKLMVDCNGEGVLFTEAEANITLEQLEVGDAVRPPC  127

Query  501  PYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            PYL +L YNVPGS  I GCPLLLIQVTR +CG
Sbjct  128  PYLHELLYNVPGSEGILGCPLLLIQVTRLACG  159



>ref|XP_006470741.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=445

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 109/152 (72%), Gaps = 5/152 (3%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKES--MVGKDPAKV  326
            FSV +   PEL+ P  PT R  K LS +DDQ  LR+ +P ++FY+N  S  M GKDP KV
Sbjct  9    FSV-IRKTPELIGPARPTARVIKQLSSLDDQQCLRFQIPMIFFYKNDPSPAMEGKDPVKV  67

Query  327  IKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNL--GDFIHSPC  500
            I+E L+KAL F+YPLAGRL E  N+KL+VDCNGEGVLF  AEANI L  L  GD +  PC
Sbjct  68   IREALSKALTFYYPLAGRLKEVSNRKLMVDCNGEGVLFTEAEANITLEQLEVGDAVRPPC  127

Query  501  PYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            PYL +L YNVPGS  I GCPLLLIQVTR +CG
Sbjct  128  PYLHELLYNVPGSEGILGCPLLLIQVTRLACG  159



>ref|XP_006446263.1| hypothetical protein CICLE_v10015199mg [Citrus clementina]
 gb|ESR59503.1| hypothetical protein CICLE_v10015199mg [Citrus clementina]
Length=456

 Score =   170 bits (430),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYEN--KESMVGKDPAKVIKEGLAKA  350
            PEL+ P+ PTPRE K +SDIDDQ SLR+ +P L+FY+N    SM G+DP KVI+E ++KA
Sbjct  16   PELIVPERPTPREVKQISDIDDQESLRFQIPLLFFYKNDPSPSMQGRDPVKVIREAISKA  75

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LVF+YPLAGRL EG N+KL+V+CN EGVLF+ A+AN  L  L D +  PCPYL +L Y+V
Sbjct  76   LVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQLRDDLQPPCPYLNQLIYDV  135

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPLLLIQVTR +CG
Sbjct  136  PGSEGILGCPLLLIQVTRLTCG  157



>ref|XP_004244681.1| PREDICTED: methanol O-anthraniloyltransferase [Solanum lycopersicum]
 gb|AGK82804.1| alcohol acyltransferase 2 [Solanum lycopersicum]
Length=447

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 95/124 (77%), Gaps = 0/124 (0%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKK  404
            LS+IDDQ S R+H   L FY+    M GKDPAK+IK+GL+K LVF+YPLAGRL EGPNKK
Sbjct  30   LSEIDDQGSTRFHSHLLIFYKYNSLMEGKDPAKIIKDGLSKTLVFYYPLAGRLIEGPNKK  89

Query  405  LIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTR  584
            L+V+CNGEGVLF+   AN+ L  LG+ I  PCPYL  L +NVPGS  I G PLLL+QVTR
Sbjct  90   LMVNCNGEGVLFIEGNANVELEKLGESIKPPCPYLDLLLHNVPGSDGIIGSPLLLVQVTR  149

Query  585  FSCG  596
            FSCG
Sbjct  150  FSCG  153



>ref|XP_002270240.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=445

 Score =   169 bits (428),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 110/156 (71%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MACLFPPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVG  308
            MA   P  FSV    +P LV P  PTPRE K LSDIDDQ  LR+ +P ++FY N   M G
Sbjct  1    MAMESPISFSV-TRGEPRLVAPAKPTPRELKELSDIDDQEGLRFQVPIIFFYGNSSLMDG  59

Query  309  KDPAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFI  488
            KDPAKVI+E LAKAL+++YP AGRL EG N+KL+VDC GEGVLFV A+A+  L  LGD I
Sbjct  60   KDPAKVIREALAKALIYYYPFAGRLVEGSNRKLLVDCTGEGVLFVEADADTTLEYLGDAI  119

Query  489  HSPCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              PCP  ++L Y+VPGS  I GCPLLL QVTR  CG
Sbjct  120  QPPCPCFEELLYDVPGSGGILGCPLLLFQVTRLRCG  155



>ref|XP_007029789.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10291.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=452

 Score =   169 bits (428),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P  PTP E K LSDIDDQ SL + +P + FY +  SM GKDP K+I+
Sbjct  10   FTVR-RCEPELVAPAKPTPHECKLLSDIDDQESLHFQVPVIQFYRHNPSMQGKDPVKIIR  68

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E LAKALVF+YP AGRL EGPN+KL+VDC GEGVLF+ A+A++ L   GD +H P P L 
Sbjct  69   EALAKALVFYYPFAGRLREGPNRKLMVDCTGEGVLFIEADADVTLEQFGDELHPPFPCLD  128

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS  +  CPLLLIQ+TR  CG
Sbjct  129  ELLYDVPGSEGMLNCPLLLIQITRMKCG  156



>ref|NP_001234496.1| alcohol acyl transferase [Solanum lycopersicum]
 gb|AAS48091.1| alcohol acyl transferase [Solanum lycopersicum]
 gb|AFD29888.1| alcohol acyl transferase [Solanum lycopersicum]
 gb|AGK82805.1| alcohol acyltransferase 3 [Solanum lycopersicum]
 gb|AIW04709.1| alcohol acyltransferase 1 [Solanum lycopersicum]
Length=442

 Score =   168 bits (426),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            KP+LV P + T  E K LS+IDDQ  +R  +P L FY+   SM GKD AK+IK+GL+K L
Sbjct  13   KPKLVVPSSVTSHETKRLSEIDDQGFIRLQIPILMFYKYNSSMKGKDLAKIIKDGLSKTL  72

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YPLAGRL EGPNKKL+V+CNGEGVLF+  +ANI L  LG+ I  PCPYL  L +NV 
Sbjct  73   VFYYPLAGRLIEGPNKKLMVNCNGEGVLFIEGDANIELEKLGESIKPPCPYLDLLLHNVH  132

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  I G PLLLIQVTRF+CG
Sbjct  133  GSDGIIGSPLLLIQVTRFTCG  153



>ref|XP_002524020.1| transferase, putative [Ricinus communis]
 gb|EEF38388.1| transferase, putative [Ricinus communis]
Length=244

 Score =   162 bits (411),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/149 (58%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  RFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVI  329
            RF V    +PEL+ P  PTP + KPLSDIDDQ  LR+H+P +  Y++  SM GKDP KVI
Sbjct  9    RFQVH-RREPELIVPAKPTPYDFKPLSDIDDQEGLRFHIPVVQIYKHDPSMQGKDPVKVI  67

Query  330  KEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYL  509
             E LAKALVF+YP AGRL E PN+KL+V+C  EGVLF+ A+AN+ L   GD +  P P L
Sbjct  68   SEALAKALVFYYPFAGRLREWPNRKLVVECTSEGVLFIEADANVTLEQCGDALQPPFPLL  127

Query  510  KKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             +L ++VPGS  +  CPLLLIQVTRF CG
Sbjct  128  DELLFDVPGSSGVINCPLLLIQVTRFKCG  156



>ref|XP_006446260.1| hypothetical protein CICLE_v10015249mg [Citrus clementina]
 gb|ESR59500.1| hypothetical protein CICLE_v10015249mg [Citrus clementina]
Length=445

 Score =   167 bits (424),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 108/152 (71%), Gaps = 5/152 (3%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKES--MVGKDPAKV  326
            FSV +   PEL+ P  PT R  K LS +DDQ  LR+ +P ++FY+N  S  M GKDP KV
Sbjct  9    FSV-IRKTPELIGPARPTARVIKQLSSLDDQQCLRFQIPMIFFYKNDPSPAMEGKDPVKV  67

Query  327  IKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNL--GDFIHSPC  500
            I+E L+KAL F+YPLAGRL E  N+KL+VDCNGEGVLF  AE NI L  L  GD +  PC
Sbjct  68   IREALSKALTFYYPLAGRLKEVSNRKLMVDCNGEGVLFTEAEGNITLEQLEVGDAVRPPC  127

Query  501  PYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            PYL +L YNVPGS  I GCPLLLIQVTR +CG
Sbjct  128  PYLHELLYNVPGSDGILGCPLLLIQVTRLACG  159



>ref|XP_008238035.1| PREDICTED: methanol O-anthraniloyltransferase-like [Prunus mume]
Length=460

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            KPEL+TP  PTP E K LS+IDDQ SLR+ +P +  Y+N  SM G D  +VI+E L++AL
Sbjct  15   KPELITPAKPTPHETKLLSNIDDQESLRFQVPVIMSYKNNPSMKGNDAVEVIREALSRAL  74

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            V++YPLAGRL EGPN+KL+V+CNGEGVLF+ A A++ L  LGD I  P P+L++  YNVP
Sbjct  75   VYYYPLAGRLREGPNRKLMVECNGEGVLFMEANADVRLAQLGDTIAPPSPFLEEFLYNVP  134

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  I GCPLLLIQVTR SCG
Sbjct  135  GSDGILGCPLLLIQVTRLSCG  155



>ref|XP_009612038.1| PREDICTED: methanol O-anthraniloyltransferase-like isoform X2 
[Nicotiana tomentosiformis]
Length=150

 Score =   159 bits (402),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 101/136 (74%), Gaps = 1/136 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            KPELV P T   R++K LSDIDDQ SL + +P L FY+   SM GK P KVIKEGL+K L
Sbjct  15   KPELVIPATTPSRDRKHLSDIDDQGSLGFQIPILMFYKYSPSMEGKYPVKVIKEGLSKTL  74

Query  354  VFFYPLAGRLTE-GPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            VF+YPLAGR+ E  P++KL+VDCNGEG+LFV A+A + L  LGD I  PCPYL +L YNV
Sbjct  75   VFYYPLAGRIVELMPDRKLVVDCNGEGILFVEADAQVELDKLGDSIKPPCPYLDQLLYNV  134

Query  531  PGSHRITGCPLLLIQV  578
            PGS  I  CPLLL+Q+
Sbjct  135  PGSAGIIDCPLLLVQI  150



>ref|XP_002517500.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
 gb|EEF45042.1| Taxadien-5-alpha-ol O-acetyltransferase, putative [Ricinus communis]
Length=458

 Score =   167 bits (423),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 114/151 (75%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  F+VR  + PEL+ P  PTPRE K +SDIDDQ  LR+ +  + FY +  SM G+DP +
Sbjct  7    PFTFAVR-RSPPELIVPARPTPRELKKVSDIDDQEGLRFQISFVMFYRSLPSMKGRDPVE  65

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            +I++ L++ALVF+YP AGRL EGPN+KLIVDCNGEG+LF+ A+A+I +  LGD +  PCP
Sbjct  66   IIRKALSEALVFYYPFAGRLIEGPNRKLIVDCNGEGILFIEADADITIEQLGDSMQPPCP  125

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             +++L Y+VPGS  I GCPLLLIQ+TR +CG
Sbjct  126  CIEELLYDVPGSSGIIGCPLLLIQITRLACG  156



>ref|XP_007208844.1| hypothetical protein PRUPE_ppa025565mg [Prunus persica]
 gb|EMJ10043.1| hypothetical protein PRUPE_ppa025565mg [Prunus persica]
Length=558

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            KPEL+TP  PTP E K LS+IDDQ SLR+ +P +  Y+N  SM G D  +VI+E L++AL
Sbjct  16   KPELITPAKPTPHETKLLSNIDDQESLRFQVPVIMSYKNNPSMKGNDAVEVIREALSRAL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            V++YPLAGRL EGPN+KL+V+CNGEGVLF+ A A++ L  LGD I  P P+L++  YNVP
Sbjct  76   VYYYPLAGRLREGPNRKLMVECNGEGVLFIEANADVTLAQLGDTIAPPSPFLEEFLYNVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  I GCPLLLIQVTR SCG
Sbjct  136  GSDGILGCPLLLIQVTRLSCG  156



>ref|XP_002325454.2| transferase family protein [Populus trichocarpa]
 gb|EEE99835.2| transferase family protein [Populus trichocarpa]
Length=460

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+ P  PTP E K LSDIDDQ  LR+H+P + FY N  SM GKDP K+I+E LAK L
Sbjct  16   EPELIKPAKPTPHEFKLLSDIDDQEGLRFHIPVMQFYRNNPSMQGKDPVKIIREALAKTL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EGPN+KL+V+C GEG+LF+ A+A++ L   GD +  P P L++L ++VP
Sbjct  76   VFYYPFAGRLREGPNRKLMVECTGEGILFIEADADVTLEQFGDALQPPFPCLEELLFDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +  CPLLLIQVTR  CG
Sbjct  136  GSSGVLNCPLLLIQVTRLKCG  156



>gb|AJD25145.1| benzoyl-CoA:benzyl alcohol O-benzoyltransferase [Populus trichocarpa]
Length=460

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+ P  PTP E K LSDIDDQ  LR+H+P + FY N  SM GKDP K+I+E LAK L
Sbjct  16   EPELIKPAKPTPHEFKLLSDIDDQEGLRFHIPVMQFYRNNPSMQGKDPVKIIREALAKTL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EGPN+KL+V+C GEG+LF+ A+A++ L   GD +  P P L++L ++VP
Sbjct  76   VFYYPFAGRLREGPNRKLMVECTGEGILFIEADADVTLEQFGDALQPPFPCLEELLFDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +  CPLLLIQVTR  CG
Sbjct  136  GSSGVLNCPLLLIQVTRLKCG  156



>ref|XP_011012995.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=459

 Score =   167 bits (422),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+ P  PTP E K LSDIDDQ  LR+H+P + FY N  SM GKDP K+I+E LAK L
Sbjct  16   EPELIKPAKPTPHEFKLLSDIDDQEGLRFHIPVMQFYRNNPSMQGKDPVKIIREALAKTL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EGPN+KL+V+C GEG+LF+ A+A++ L   GD +  P P L++L ++VP
Sbjct  76   VFYYPFAGRLREGPNRKLMVECTGEGILFIEADADVTLEQFGDALQPPFPCLEELLFDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +  CPLLLIQVTR  CG
Sbjct  136  GSSGVLNCPLLLIQVTRLKCG  156



>ref|XP_002304071.1| hypothetical protein POPTR_0003s01420g [Populus trichocarpa]
 gb|EEE79050.1| hypothetical protein POPTR_0003s01420g [Populus trichocarpa]
Length=454

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/151 (58%), Positives = 109/151 (72%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P RFSV+   +P+L+ P  PTP E K LSDIDDQ  LR+H+P + FY +  SM  +DP K
Sbjct  8    PLRFSVK-RREPQLIVPSKPTPHEIKQLSDIDDQQGLRFHLPFVMFYRSHPSMKREDPVK  66

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VIKE L KALVF+YP AGR+ EGP  KL+VDC GEG+LFV A+A + +  LGD IH P  
Sbjct  67   VIKEALGKALVFYYPFAGRIIEGPRSKLLVDCTGEGILFVEADAGVTIDQLGDSIHPPFS  126

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            Y+++  ++VPGS  I GCPLLLIQVTR +CG
Sbjct  127  YIEEFLHDVPGSSGILGCPLLLIQVTRLACG  157



>ref|XP_007029786.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
1 [Theobroma cacao]
 gb|EOY10288.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
1 [Theobroma cacao]
Length=525

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 120/179 (67%), Gaps = 11/179 (6%)
 Frame = +3

Query  69   SRKTHHLVFDNNII*YNY*SMACLFPPR---FSVRLTTKPELVtpktptprekkpLSDID  239
            S K+ HL F +      + +MA L PP    F+VR   +PELV P  PTPRE K LSDID
Sbjct  8    SIKSSHLAFSS------FFAMA-LLPPTSLVFTVR-RHEPELVVPAKPTPRECKLLSDID  59

Query  240  DQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDC  419
            DQ   R+ + GL FY  K SM GKDPA +IKE L KALVF+YP AGRL EGPN+KL+VDC
Sbjct  60   DQDGHRFQIRGLHFYRFKPSMQGKDPACIIKEALTKALVFYYPYAGRLREGPNRKLVVDC  119

Query  420  NGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             GEGVLF+ A+A++ L   GD +H P P  K+L Y VPGS+ +  CPLL IQVTR  CG
Sbjct  120  TGEGVLFIQADADVTLDQFGDSLHPPFPCYKELLYEVPGSNELLNCPLLQIQVTRLKCG  178



>ref|XP_007029787.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
2, partial [Theobroma cacao]
 gb|EOY10289.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase isoform 
2, partial [Theobroma cacao]
Length=485

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 119/177 (67%), Gaps = 11/177 (6%)
 Frame = +3

Query  75   KTHHLVFDNNII*YNY*SMACLFPPR---FSVRLTTKPELVtpktptprekkpLSDIDDQ  245
            K+ HL F +      + +MA L PP    F+VR   +PELV P  PTPRE K LSDIDDQ
Sbjct  2    KSSHLAFSS------FFAMA-LLPPTSLVFTVR-RHEPELVVPAKPTPRECKLLSDIDDQ  53

Query  246  ASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNG  425
               R+ + GL FY  K SM GKDPA +IKE L KALVF+YP AGRL EGPN+KL+VDC G
Sbjct  54   DGHRFQIRGLHFYRFKPSMQGKDPACIIKEALTKALVFYYPYAGRLREGPNRKLVVDCTG  113

Query  426  EGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            EGVLF+ A+A++ L   GD +H P P  K+L Y VPGS+ +  CPLL IQVTR  CG
Sbjct  114  EGVLFIQADADVTLDQFGDSLHPPFPCYKELLYEVPGSNELLNCPLLQIQVTRLKCG  170



>gb|KDO44966.1| hypothetical protein CISIN_1g0133462mg, partial [Citrus sinensis]
Length=152

 Score =   158 bits (400),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 104/145 (72%), Gaps = 5/145 (3%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKES--MVGKDPAKV  326
            FSV +   PEL+ P  PT R  K LS++DDQ  +R+ +P ++FY+N  S  M GKDP KV
Sbjct  9    FSV-IRKTPELIGPARPTARVIKQLSNLDDQQCVRFQIPMIFFYKNDPSPAMEGKDPVKV  67

Query  327  IKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNL--GDFIHSPC  500
            I+E L+KAL F+YPLAGRL E  N+KL+VDCNGEGVLF  AEANI L  L  GD +  PC
Sbjct  68   IREALSKALTFYYPLAGRLKEVSNRKLMVDCNGEGVLFTEAEANITLEQLEVGDAVRPPC  127

Query  501  PYLKKLQYNVPGSHRITGCPLLLIQ  575
            PYL +L YNVPGS  I GCPLLLIQ
Sbjct  128  PYLHELLYNVPGSEGILGCPLLLIQ  152



>ref|XP_010644575.1| PREDICTED: methanol O-anthraniloyltransferase-like [Vitis vinifera]
Length=445

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 107/156 (69%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MACLFPPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVG  308
            MA + P  FSV     P LV P  PT RE K LSDIDDQ  LR+    ++FY N   M G
Sbjct  1    MAMVSPLSFSV-TRCDPRLVAPAKPTRRELKQLSDIDDQGGLRFQASMIFFYRNSPLMDG  59

Query  309  KDPAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFI  488
            KDP KVI+E LAKALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L +LGD I
Sbjct  60   KDPVKVIREALAKALVYYYPFAGRLVEGSNRKLLVDCTGEGVLFIEADADTTLEHLGDAI  119

Query  489  HSPCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
               CP  ++L Y+VPGS  I GCPLLLIQVTR  CG
Sbjct  120  QPHCPCFEELLYDVPGSGEILGCPLLLIQVTRLRCG  155



>ref|XP_009612037.1| PREDICTED: methanol O-anthraniloyltransferase-like isoform X1 
[Nicotiana tomentosiformis]
Length=164

 Score =   158 bits (399),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 100/135 (74%), Gaps = 1/135 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            KPELV P T   R++K LSDIDDQ SL + +P L FY+   SM GK P KVIKEGL+K L
Sbjct  15   KPELVIPATTPSRDRKHLSDIDDQGSLGFQIPILMFYKYSPSMEGKYPVKVIKEGLSKTL  74

Query  354  VFFYPLAGRLTE-GPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            VF+YPLAGR+ E  P++KL+VDCNGEG+LFV A+A + L  LGD I  PCPYL +L YNV
Sbjct  75   VFYYPLAGRIVELMPDRKLVVDCNGEGILFVEADAQVELDKLGDSIKPPCPYLDQLLYNV  134

Query  531  PGSHRITGCPLLLIQ  575
            PGS  I  CPLLL+Q
Sbjct  135  PGSAGIIDCPLLLVQ  149



>ref|XP_011007948.1| PREDICTED: methanol O-anthraniloyltransferase-like [Populus euphratica]
Length=468

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 109/151 (72%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P RFSV+   +P+L+ P  PTP E K LSDIDDQ  LR+H P + FY +  S+  +DP K
Sbjct  22   PLRFSVK-RREPQLIVPSKPTPHEIKQLSDIDDQQGLRFHFPFVMFYRSHPSLKREDPVK  80

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VIKE L KALVF+YP AGR+ EGP  KL+VDC GEG+LFV A+A++ +  LGD IH P  
Sbjct  81   VIKEALGKALVFYYPFAGRIIEGPRSKLLVDCTGEGILFVEADADVTIDQLGDSIHPPFS  140

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            Y+++  ++VPGS  I GCPLLLIQVTR +CG
Sbjct  141  YIEEFLHDVPGSSGILGCPLLLIQVTRLACG  171



>ref|XP_002524021.1| transferase, putative [Ricinus communis]
 gb|EEF38389.1| transferase, putative [Ricinus communis]
Length=265

 Score =   160 bits (404),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PELVTP  PTP E KPLSDIDDQ  LR+H+P + FY    SM GKDPAKVI+E LA+ L
Sbjct  17   EPELVTPAKPTPHEFKPLSDIDDQEGLRFHIPVIQFYRCDPSMKGKDPAKVIREALAETL  76

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EGP++KL+V+C GEGVLF+ A+A+++L   GD +  P P L+ L ++VP
Sbjct  77   VFYYPFAGRLREGPDRKLMVECTGEGVLFIEADADVSLQQFGDALQPPFPCLEDLLFDVP  136

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +   PLLLIQVTR +CG
Sbjct  137  GSTAVLNSPLLLIQVTRLNCG  157



>emb|CBI37444.3| unnamed protein product [Vitis vinifera]
Length=222

 Score =   158 bits (400),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  FSV+    PE V P  PTPRE K LSDIDDQ  LR+ +P + FY N   M GKDP K
Sbjct  7    PLVFSVK-RHDPEFVRPTNPTPREVKQLSDIDDQEGLRFQVPVIMFYPNNPLMKGKDPVK  65

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VI+E L KALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP
Sbjct  66   VIREALGKALVYYYPFAGRLIEGHNRKLMVDCTGEGVLFIEADADSTLENLGDAIQPMCP  125

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              ++L Y+VPGS  I G PL+LIQVTR  CG
Sbjct  126  CFEELLYDVPGSGGILGSPLILIQVTRLRCG  156



>gb|KHN31434.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=471

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PELV P  PTPRE KPLSDIDDQ  LR+ +P + FY N+ SM GKDPAKVI+E LA+ L
Sbjct  16   QPELVAPAKPTPREVKPLSDIDDQQGLRFQIPFILFYGNEPSMAGKDPAKVIREALAQTL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGR+ EGP +KL+VDC GEGV+F+ A+A+  L  LGD +  P P  ++L Y+VP
Sbjct  76   VFYYPFAGRIREGPGRKLVVDCTGEGVMFIEADADATLDQLGDTLQPPFPCFEQLLYDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +  CPL+L QVTRF CG
Sbjct  136  GSEGVIDCPLMLFQVTRFKCG  156



>gb|ACF07921.1| alcohol acyl transferase [Prunus armeniaca]
Length=453

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+TP  PTP E K LSDIDDQ  LR+H P +  Y+N  SM G D   VI+E L++AL
Sbjct  13   EPELITPAKPTPIETKQLSDIDDQDGLRFHFPVIMSYKNNPSMKGNDAVMVIREALSRAL  72

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            V++YPLAGRL EGPN+KL+V+CNGEGVLF+ A A++ L  LGD I  PCP L++  +N P
Sbjct  73   VYYYPLAGRLREGPNRKLMVECNGEGVLFIEANADVTLEQLGDRILPPCPVLEEFLFNPP  132

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  I GCPLLL+QVTR +CG
Sbjct  133  GSDGILGCPLLLVQVTRLTCG  153



>ref|XP_012070285.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Jatropha 
curcas]
 gb|KDP39576.1| hypothetical protein JCGZ_02596 [Jatropha curcas]
Length=454

 Score =   164 bits (414),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/150 (57%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = +3

Query  147  PRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKV  326
            P F V+   +PEL+TP  P P E KPLSDIDDQ  LR+H+P +  Y +  SM GKDP +V
Sbjct  6    PIFEVQ-RCEPELITPSKPPPHELKPLSDIDDQEGLRFHIPVIQIYRHDPSMEGKDPVQV  64

Query  327  IKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPY  506
            I+  +AKALVF+YP AGRL EG N+KLI+DCNGEGVLF+ A+AN++L   GD +  P P+
Sbjct  65   IRNAIAKALVFYYPFAGRLREGANRKLIMDCNGEGVLFIEADANVSLDQSGDALQPPFPF  124

Query  507  LKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            L +L ++VPGS  I  CP++LIQVTRF CG
Sbjct  125  LDELLFDVPGSSGILNCPVVLIQVTRFKCG  154



>gb|KJB80921.1| hypothetical protein B456_013G121500 [Gossypium raimondii]
Length=269

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   + ELV P  PTP E KPLSDIDDQ   R+H+ G  F+++  SM G+DPAKVIK
Sbjct  11   FTVR-RQEAELVVPCEPTPHECKPLSDIDDQEGHRFHVRGFHFHQSNLSMKGQDPAKVIK  69

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E LAKALVF+YP AGRL EGPN+KLIVDC GEGVLF+ A+A+++L + GD ++ P P  +
Sbjct  70   EALAKALVFYYPFAGRLREGPNRKLIVDCTGEGVLFIEADADVSLVDFGDELYPPFPCAE  129

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS+ +   PLLLIQVTR  CG
Sbjct  130  ELLYDVPGSNGLLNSPLLLIQVTRLKCG  157



>ref|XP_006470747.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=468

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 109/142 (77%), Gaps = 2/142 (1%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYEN--KESMVGKDPAKVIKEGLAKA  350
            PEL+ P+ PTPRE K +SDIDDQ SLR+ +P L+FY+N    SM G+DP KVI+E ++KA
Sbjct  16   PELIVPERPTPREVKQISDIDDQESLRFQIPLLFFYKNDPSPSMQGRDPVKVIREAISKA  75

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LVF+YPLAGRL EG N+KL+V+CN EGVLF+ A+AN  L  LGD I  PCPYL +L Y+V
Sbjct  76   LVFYYPLAGRLKEGYNRKLMVECNAEGVLFIEADANFTLEQLGDDIQPPCPYLNQLIYDV  135

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPLLL+ ++ F+ G
Sbjct  136  PGSEGILGCPLLLVYISCFAIG  157



>emb|CBI25251.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 106/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  FSV     P++V P  PTPRE K LSDIDDQ  LR+ +P + FY N   M GKDP K
Sbjct  7    PLVFSVN-RCDPQIVRPANPTPREVKQLSDIDDQEGLRFQIPVIMFYRNNPLMDGKDPVK  65

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VI+E L KAL+++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP
Sbjct  66   VIREALGKALIYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCP  125

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              ++L Y+VPGS RI G PL+LIQVTR  CG
Sbjct  126  CFEELLYDVPGSTRILGSPLILIQVTRLRCG  156



>ref|XP_007209120.1| hypothetical protein PRUPE_ppa005455mg [Prunus persica]
 gb|EMJ10319.1| hypothetical protein PRUPE_ppa005455mg [Prunus persica]
Length=460

 Score =   163 bits (412),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 106/141 (75%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            K EL+TP  PTP E K LS+IDDQ SLR+ +  +  Y+N  SM G D  +VI+E L++AL
Sbjct  15   KAELITPAKPTPHETKLLSNIDDQESLRFQVSVIMSYKNNPSMKGNDAVEVIREALSRAL  74

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            V++YPLAGRL EGPN+KL+V+CNGEGVLF+ A A++ L  LGD I  P P+L++  YNVP
Sbjct  75   VYYYPLAGRLREGPNRKLMVECNGEGVLFIEANADVTLAQLGDTIAPPSPFLEEFLYNVP  134

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  I GCPLLLIQVTR SCG
Sbjct  135  GSDGILGCPLLLIQVTRLSCG  155



>ref|XP_003521737.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=475

 Score =   163 bits (413),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PELV P  PTPRE KPLSDIDDQ  LR+ +P + FY N+ SM GKDPAKVI+E LA+ L
Sbjct  16   QPELVAPAKPTPREVKPLSDIDDQQGLRFQIPFILFYGNEPSMAGKDPAKVIREALAQTL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGR+ EGP +KL+VDC GEG++F+ A+A+  L  LGD +  P P  ++L Y+VP
Sbjct  76   VFYYPFAGRIREGPGRKLVVDCTGEGLMFIEADADATLDQLGDTLQPPFPCFEQLLYDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +  CPL+L QVTRF CG
Sbjct  136  GSEGVIDCPLMLFQVTRFKCG  156



>ref|XP_002271603.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=449

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 102/140 (73%), Gaps = 0/140 (0%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALV  356
            P++V P  PTPRE K LSDIDDQ  LR+ +P + FY N   M GKDP KVI+E L KAL+
Sbjct  17   PQIVRPANPTPREVKQLSDIDDQEGLRFQIPVIMFYRNNPLMDGKDPVKVIREALGKALI  76

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
            ++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP  ++L Y+VPG
Sbjct  77   YYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPG  136

Query  537  SHRITGCPLLLIQVTRFSCG  596
            S RI G PL+LIQVTR  CG
Sbjct  137  STRILGSPLILIQVTRLRCG  156



>ref|XP_009374085.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Pyrus x 
bretschneideri]
Length=458

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P   TP E + LSDIDDQ  LR+ +P L FY    SM G+DP  VI+
Sbjct  10   FTVR-RRQPELVAPAKATPYEFRQLSDIDDQEGLRFQIPVLQFYRYDLSMQGRDPVHVIR  68

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E +A+ LVF+YP AGRL EGPN+KL V+C  EG++F+ A+A+I L + GD +H P P L+
Sbjct  69   EAIAQTLVFYYPFAGRLKEGPNRKLAVECTAEGIMFIEADADITLEHFGDNLHPPFPCLE  128

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L YNVPGS  +  CPLLLIQVTR  CG
Sbjct  129  ELLYNVPGSDGVLNCPLLLIQVTRLQCG  156



>ref|XP_007029781.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10283.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=562

 Score =   163 bits (413),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 104/147 (71%), Gaps = 0/147 (0%)
 Frame = +3

Query  156  SVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKE  335
            SV    +PELV P  PTPRE K LSDIDDQ   R+ + GL FY  K SM GKDPA +IKE
Sbjct  120  SVVRRHEPELVVPAKPTPRECKLLSDIDDQDGHRFQIRGLHFYRFKPSMQGKDPACIIKE  179

Query  336  GLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKK  515
             L KALVF+YP AGRL EGPN+KL+VDC GEGVLF+ A+A++ L   GD +H P P  K+
Sbjct  180  ALTKALVFYYPYAGRLREGPNRKLVVDCTGEGVLFIQADADVTLDQFGDSLHPPFPCYKE  239

Query  516  LQYNVPGSHRITGCPLLLIQVTRFSCG  596
            L Y VPGS+ I  CPLL IQVTR  CG
Sbjct  240  LLYEVPGSNEILNCPLLQIQVTRLKCG  266



>ref|XP_010665177.1| PREDICTED: methanol O-anthraniloyltransferase isoform X2 [Vitis 
vinifera]
Length=382

 Score =   160 bits (406),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 106/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  FSV+    PE V P  PTPRE K LSD+DDQ  LR+ +P + FY N   M GKDPAK
Sbjct  7    PLVFSVK-RCAPEFVRPTNPTPREVKQLSDLDDQEGLRFQVPVIMFYPNNPLMKGKDPAK  65

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VIKE L KALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP
Sbjct  66   VIKEALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDSIQPMCP  125

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              +++ Y+VPGS  I G PL+LIQVTR  CG
Sbjct  126  CYEEILYDVPGSGEILGSPLILIQVTRLRCG  156



>ref|XP_007209131.1| hypothetical protein PRUPE_ppa005625mg [Prunus persica]
 gb|EMJ10330.1| hypothetical protein PRUPE_ppa005625mg [Prunus persica]
Length=450

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+TP  PTP E K LSDIDDQ  LR+H P +  Y+N  SM G D   VI+E L++AL
Sbjct  15   EPELITPAKPTPIETKQLSDIDDQDGLRFHFPVIISYKNNPSMKGNDAVMVIREALSRAL  74

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            V++YPLAGRL EGPN+KL+V+CNGEGVLF+ A A++ L  LGD I  PCP L++   N P
Sbjct  75   VYYYPLAGRLREGPNRKLMVECNGEGVLFIEANADVTLEQLGDRILPPCPVLEEFLSNPP  134

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  I GCPLLL+QVTR +CG
Sbjct  135  GSDGILGCPLLLVQVTRLTCG  155



>ref|XP_002266420.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=451

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            FSV+    PE V P  PTPRE K LSD+DDQ  LR+ +P + FY N   M GKDPAKVIK
Sbjct  10   FSVK-RRAPEFVRPTNPTPREVKQLSDLDDQEGLRFQIPVIMFYPNNPLMKGKDPAKVIK  68

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E L KALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP  +
Sbjct  69   EALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFE  128

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS  I G PL+LIQVTR  CG
Sbjct  129  ELLYDVPGSGGILGSPLILIQVTRLRCG  156



>ref|XP_008391402.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 110/154 (71%), Gaps = 1/154 (1%)
 Frame = +3

Query  138  LFPPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMV-GKD  314
            + PP        +PEL+TP   TPRE K LSDIDDQ SLR+H+P +  Y++  S+   ++
Sbjct  1    MMPPSVLQVKRLQPELITPVKSTPRETKFLSDIDDQESLRFHVPVIMCYKDNPSLKENRN  60

Query  315  PAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHS  494
            P K I+E L++ALV++YPLAGRL EGPN+KL+VDCNGEG+LFV A A++ L  LGD I  
Sbjct  61   PVKAIREALSRALVYYYPLAGRLREGPNRKLMVDCNGEGILFVEASADVTLEQLGDKILP  120

Query  495  PCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            PCP L++   N PGS  I GCPLLL+QVTR +CG
Sbjct  121  PCPLLEEFLVNFPGSDGIIGCPLLLVQVTRLTCG  154



>ref|XP_008238086.1| PREDICTED: methanol O-anthraniloyltransferase-like [Prunus mume]
Length=532

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 107/144 (74%), Gaps = 3/144 (2%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENK--ESM-VGKDPAKVIKEGLA  344
            KPEL+ P  PTP E K LS++DDQ SLR+ +P +  Y N    SM   +DP KVI+EGL+
Sbjct  15   KPELIKPSKPTPHETKLLSNVDDQESLRFQIPVIMSYRNNNPSSMNANRDPVKVIREGLS  74

Query  345  KALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQY  524
            +ALV++YP+AGRL EGPN+KL+V+CNGEGVLF+   A++ L  LGD I  P P+L++  Y
Sbjct  75   RALVYYYPMAGRLREGPNRKLMVECNGEGVLFIEGNADVTLAQLGDTIAPPSPFLEEFLY  134

Query  525  NVPGSHRITGCPLLLIQVTRFSCG  596
            NVPGS  I GCPLLLIQVTR SCG
Sbjct  135  NVPGSDGILGCPLLLIQVTRLSCG  158



>emb|CBI37442.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            FSV+    PE V P  PTPRE K LSD+DDQ  LR+ +P + FY N   M GKDPAKVIK
Sbjct  34   FSVK-RRAPEFVRPTNPTPREVKQLSDLDDQEGLRFQIPVIMFYPNNPLMKGKDPAKVIK  92

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E L KALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP  +
Sbjct  93   EALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFE  152

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS  I G PL+LIQVTR  CG
Sbjct  153  ELLYDVPGSGGILGSPLILIQVTRLRCG  180



>ref|XP_002270962.1| PREDICTED: methanol O-anthraniloyltransferase isoform X1 [Vitis 
vinifera]
 emb|CBI37440.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 106/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  FSV+    PE V P  PTPRE K LSD+DDQ  LR+ +P + FY N   M GKDPAK
Sbjct  7    PLVFSVK-RCAPEFVRPTNPTPREVKQLSDLDDQEGLRFQVPVIMFYPNNPLMKGKDPAK  65

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VIKE L KALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP
Sbjct  66   VIKEALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDSIQPMCP  125

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              +++ Y+VPGS  I G PL+LIQVTR  CG
Sbjct  126  CYEEILYDVPGSGEILGSPLILIQVTRLRCG  156



>emb|CAN69948.1| hypothetical protein VITISV_009219 [Vitis vinifera]
Length=451

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 106/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  FSV+    PE V P  PTPRE K LSD+DDQ  LR+ +P + FY N   M GKDPAK
Sbjct  7    PLVFSVK-RCAPEFVRPTNPTPREVKQLSDLDDQEGLRFQVPVIMFYPNNPLMKGKDPAK  65

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VIKE L KALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP
Sbjct  66   VIKEALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDSIQPMCP  125

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              +++ Y+VPGS  I G PL+LIQVTR  CG
Sbjct  126  CYEEILYDVPGSGEILGSPLILIQVTRLRCG  156



>ref|XP_010110383.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
 gb|EXC26215.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
Length=465

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 107/143 (75%), Gaps = 3/143 (2%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYE--NKESM-VGKDPAKVIKEGLA  344
            +PELV P  PTP+E K LSDIDDQ  LR+H+P ++FY+  N  S+ +GKDP +VI+E L 
Sbjct  17   EPELVKPSKPTPKEIKLLSDIDDQEGLRFHVPFIFFYKKNNHPSVKLGKDPNRVIREALG  76

Query  345  KALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQY  524
            +ALV++YP AGRL EG N+KL+VDC GEGVLFV A+A++    LGD I  PCP+L K  Y
Sbjct  77   RALVYYYPFAGRLREGSNRKLMVDCTGEGVLFVAAKADVGYDRLGDAIRPPCPFLDKFLY  136

Query  525  NVPGSHRITGCPLLLIQVTRFSC  593
            NVPGS  I GCPLLLIQVT+  C
Sbjct  137  NVPGSDGILGCPLLLIQVTQLKC  159



>emb|CAN74729.1| hypothetical protein VITISV_042062 [Vitis vinifera]
Length=451

 Score =   160 bits (406),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 104/151 (69%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  FSV+    PE V P   TPRE K LSDIDDQ  LR+ +P + FY N   M GKDP K
Sbjct  7    PLVFSVK-RCAPEFVRPTNLTPREVKQLSDIDDQEGLRFQIPVIMFYPNNPLMKGKDPVK  65

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VI+E L KALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP
Sbjct  66   VIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCP  125

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              ++L Y+VPGS  I G PL+LIQVTR  CG
Sbjct  126  CFEELLYDVPGSGGILGSPLILIQVTRLRCG  156



>ref|XP_002265841.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
 emb|CBI37446.3| unnamed protein product [Vitis vinifera]
Length=451

 Score =   160 bits (405),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  FSV+    PE V P  PTPRE K LSDIDDQ  LR+ +P + FY N   M GKDP K
Sbjct  7    PLVFSVK-RCAPEFVRPTNPTPREVKQLSDIDDQEGLRFQIPVIMFYPNNPLMKGKDPVK  65

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VI+E L KALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP
Sbjct  66   VIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCP  125

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              ++L Y+VPGS  I G PL+LIQVTR  CG
Sbjct  126  CFEELLYDVPGSGGILGSPLILIQVTRLRCG  156



>ref|XP_006368249.1| hypothetical protein POPTR_0001s00970g [Populus trichocarpa]
 gb|ERP64818.1| hypothetical protein POPTR_0001s00970g [Populus trichocarpa]
Length=459

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 107/150 (71%), Gaps = 3/150 (2%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKES--MVGKDPAKV  326
            F VR    PELV P  P P E+K LSD+DDQ +LRY +P + FY++  +  M G+D  K+
Sbjct  10   FKVR-HRDPELVVPAKPVPYEQKQLSDVDDQEALRYQIPFIMFYDSNSNPCMEGEDQVKI  68

Query  327  IKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPY  506
            I+  LA+ALV++YPLAGRL EGP+ KL+VDC GEGVLF+ A+A+  L  L D I  PCPY
Sbjct  69   IRAALAEALVYYYPLAGRLKEGPDGKLLVDCTGEGVLFLEADADTTLELLEDTIQPPCPY  128

Query  507  LKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            L +L YNVPGS  I GCPLLLIQVTR  CG
Sbjct  129  LDQLLYNVPGSTGIVGCPLLLIQVTRLMCG  158



>emb|CAN68818.1| hypothetical protein VITISV_012041 [Vitis vinifera]
Length=451

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 101/140 (72%), Gaps = 0/140 (0%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALV  356
            PE V P  PTPRE K LSD+DDQ  LR+ +P + FY N   M GKDPAKVIKE L KALV
Sbjct  17   PEFVRPTNPTPREVKQLSDLDDQEGLRFQVPVIMFYPNNPLMKGKDPAKVIKEALGKALV  76

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
            ++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP  +++ Y+VPG
Sbjct  77   YYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDSIQPMCPCYEEILYDVPG  136

Query  537  SHRITGCPLLLIQVTRFSCG  596
            S  I G PL+LIQVTR  CG
Sbjct  137  SGEILGSPLILIQVTRLRCG  156



>emb|CAN77583.1| hypothetical protein VITISV_040970 [Vitis vinifera]
Length=451

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  FSV+    PE V P  PTPRE K LSDIDDQ  LR+ +P + FY N   M GKDP K
Sbjct  7    PLVFSVK-RXDPEFVRPTNPTPREVKQLSDIDDQEGLRFQVPVIMFYPNNPLMKGKDPVK  65

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VI+E L KALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP
Sbjct  66   VIREALGKALVYYYPFAGRLIEGXNRKLMVDCTGEGVLFIEADADSTLENLGDAIQPMCP  125

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              ++L Y+VPGS  I G PL+LIQVTR  CG
Sbjct  126  CFEELLYDVPGSGGILGSPLILIQVTRLRCG  156



>ref|XP_009388282.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   160 bits (404),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   KP LV P   TP E K LSDIDDQ  LR+H+P + FY N  SM G+D AKVI+
Sbjct  7    FTVR-RQKPVLVAPAGSTPHEFKRLSDIDDQDGLRFHIPVIQFYRNDPSMGGRDQAKVIR  65

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E LA+ALVF+YP AGRL E   +KL+V+C GEG+LF+ A+A++ L   GD +  P P L+
Sbjct  66   EALARALVFYYPFAGRLREAAGRKLVVECTGEGILFIEADADVRLEQFGDELQPPFPCLE  125

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L YNVPGS  +  CPLLLIQVTR  CG
Sbjct  126  ELVYNVPGSDGVLDCPLLLIQVTRLLCG  153



>ref|XP_007029788.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10290.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=454

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+ P  PTP E K LSDIDDQ  LR+ +P + FY+   SM GKDPA+VI+E LA+ L
Sbjct  14   EPELIAPAKPTPHEYKLLSDIDDQEGLRFQIPVIQFYQYSPSMQGKDPARVIREALAQTL  73

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EGP +KL+VDC GEGV+F+ A+A++ L   GD +  P P L+ L ++VP
Sbjct  74   VFYYPFAGRLREGPQRKLMVDCTGEGVMFIEADADVTLEQFGDALQPPFPCLEDLLHDVP  133

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +  CPLLLIQVTR  CG
Sbjct  134  GSAGVLNCPLLLIQVTRLRCG  154



>ref|XP_010665210.1| PREDICTED: methanol O-anthraniloyltransferase isoform X2 [Vitis 
vinifera]
Length=382

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 89/151 (59%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  FSV+    PE V P  PTPRE K LSDIDDQ  LR+ +P + FY N   M GKDP K
Sbjct  7    PLVFSVK-RHDPEFVRPTNPTPREVKQLSDIDDQEGLRFQVPVIMFYPNNPLMKGKDPVK  65

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VI+E L KALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP
Sbjct  66   VIREALGKALVYYYPFAGRLIEGHNRKLMVDCTGEGVLFIEADADSTLENLGDAIQPMCP  125

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              ++L Y+VPGS  I G PL+LIQVTR  CG
Sbjct  126  CFEELLYDVPGSGGILGSPLILIQVTRLRCG  156



>emb|CAN72252.1| hypothetical protein VITISV_017467 [Vitis vinifera]
Length=451

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  FSV+    PE V P  PTPRE K LSDIDDQ  LR+ +P + FY N   M GKDP K
Sbjct  7    PLVFSVK-RCDPEFVRPTNPTPRELKQLSDIDDQEGLRFQIPVIMFYPNNPLMKGKDPVK  65

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VI+E L KALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP
Sbjct  66   VIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCP  125

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              ++L Y+VPGS  I G P++LIQVTR  CG
Sbjct  126  CFEELLYDVPGSGGILGSPVVLIQVTRLRCG  156



>gb|KHN31436.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=440

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P  PTP E KPLSDIDDQ  LR+H+P +  Y N+ SM  KDP +VI+
Sbjct  2    FTVR-RLQPELVAPAIPTPHELKPLSDIDDQEGLRFHIPMIQVYRNQPSMAEKDPVQVIR  60

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + LAK LVF+YP AGRL E P+ KL+VDC GEGVLF+ A+A++ L  LGD +  P P  +
Sbjct  61   KALAKTLVFYYPFAGRLRERPDHKLMVDCTGEGVLFIEADADVTLDQLGDALQPPFPCFE  120

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L YNVP S  IT  PLLLIQVTR  CG
Sbjct  121  QLLYNVPDSEEITDTPLLLIQVTRLKCG  148



>ref|XP_009365763.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=451

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 104/142 (73%), Gaps = 2/142 (1%)
 Frame = +3

Query  171  TKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKA  350
            ++P+L+ P  PTPRE K LSD+DDQ   R+H P +  Y NKE+    DP   I++ L++A
Sbjct  15   SEPQLIKPAKPTPRETKRLSDVDDQQGTRFHFPLILSYRNKENQ--GDPVTAIRDALSRA  72

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YP+AGRL EGPNKKL+VDCNGEGVLF+ A+A+  L  LGD I  PCP L +L +NV
Sbjct  73   LVYYYPVAGRLREGPNKKLMVDCNGEGVLFIEADADFTLEELGDTIRPPCPLLDELLFNV  132

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCP+LL+QVTR  CG
Sbjct  133  PGSDGILGCPILLVQVTRLKCG  154



>ref|XP_012070521.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Jatropha 
curcas]
Length=451

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+ P  PTP E K LSDIDDQ SLR+HMP + FY    SM GKDP KVI+E + K L
Sbjct  16   EPELLVPSNPTPHEFKLLSDIDDQDSLRFHMPLVQFYRYDPSMKGKDPVKVIREAIGKTL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EGP +KL+V+C GEGVLF+ A+A+++L + GD +  P P L++L ++VP
Sbjct  76   VFYYPFAGRLREGPERKLMVECTGEGVLFIEADADVSLEDFGDPLQPPFPCLEELLFDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  I   PLLLIQVTR +CG
Sbjct  136  GSSSILNSPLLLIQVTRLNCG  156



>ref|XP_002265049.1| PREDICTED: methanol O-anthraniloyltransferase [Vitis vinifera]
Length=451

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  FSV+    PE V P  PTPRE K LSDIDDQ  LR+ +P + FY N   M GKDP K
Sbjct  7    PLVFSVK-RCDPEFVRPTNPTPRELKQLSDIDDQEGLRFQIPVIMFYPNNPLMKGKDPVK  65

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VI+E L KALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP
Sbjct  66   VIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCP  125

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              ++L Y+VPGS  I G P++LIQVTR  CG
Sbjct  126  CFEELLYDVPGSGGILGSPVVLIQVTRLRCG  156



>ref|XP_008232530.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Prunus mume]
Length=461

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 101/148 (68%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P   TP E + LSDIDDQ  LR+ +P + FY    SM G DP  VI+
Sbjct  10   FTVR-RRQPELVAPAKATPHEFQQLSDIDDQEGLRFQIPVIQFYRYDPSMQGSDPVTVIR  68

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E +A+ LVF+YP AGRL EGP +KL+VDC  EG+LF+ A+A++ L   GD +  P P L+
Sbjct  69   EAIAETLVFYYPFAGRLREGPARKLMVDCTAEGILFIEADADVTLQQFGDALQPPFPCLE  128

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L YNVPGS  +  CPLLLIQVTR  CG
Sbjct  129  ELLYNVPGSDGVLNCPLLLIQVTRLKCG  156



>gb|AJD18611.1| alcohol acyltransferase [Pyrus ussuriensis]
Length=459

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKDPAKVIKEGLAKA  350
            +PEL+TP   TP+E K LSDIDDQ  LR+H+P +  Y++  S+   ++P KVI+E L++A
Sbjct  13   QPELITPAKSTPQETKFLSDIDDQEFLRFHVPVIMCYKDNPSLNKNRNPVKVIREALSRA  72

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGRL EGPN+KL+V+CNGEG+LFV A AN+ L  LGD I  PCP L++  +N 
Sbjct  73   LVYYYPLAGRLREGPNRKLVVNCNGEGILFVEASANVTLEQLGDKILPPCPLLEEFLFNF  132

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPLLL+QVT  +CG
Sbjct  133  PGSDGIIGCPLLLVQVTCLTCG  154



>gb|KJB80923.1| hypothetical protein B456_013G121600 [Gossypium raimondii]
Length=448

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 111/148 (75%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   + ELV P  PTP E KPLSD+DDQ   R+H+ G  F+++  SM G+DPAKVIK
Sbjct  11   FTVR-RQEAELVVPCEPTPHECKPLSDVDDQEGHRFHVRGFHFHQSNLSMKGQDPAKVIK  69

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E LAKALVF+YP AGRL EGPN+KLIVDC GEGVLF+ A+A+++L + GD ++ P P  +
Sbjct  70   EALAKALVFYYPFAGRLREGPNRKLIVDCTGEGVLFIEADADVSLVDFGDELYPPFPCAE  129

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS+ +   PLLLIQVTR  CG
Sbjct  130  ELLYDVPGSNGLLNSPLLLIQVTRLKCG  157



>ref|XP_002266114.1| PREDICTED: methanol O-anthraniloyltransferase isoform X1 [Vitis 
vinifera]
Length=451

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 88/148 (59%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            FSV+    PE V P  PTPRE K LSDIDDQ  LR+ +P + FY N   M GKDP KVI+
Sbjct  10   FSVK-RHDPEFVRPTNPTPREVKQLSDIDDQEGLRFQVPVIMFYPNNPLMKGKDPVKVIR  68

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E L KALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP  +
Sbjct  69   EALGKALVYYYPFAGRLIEGHNRKLMVDCTGEGVLFIEADADSTLENLGDAIQPMCPCFE  128

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS  I G PL+LIQVTR  CG
Sbjct  129  ELLYDVPGSGGILGSPLILIQVTRLRCG  156



>gb|KHF99421.1| Benzyl alcohol O-benzoyltransferase [Gossypium arboreum]
Length=454

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+ P  PTP E K LSDIDDQ  LR+ +P + FY+   SM GKDP +VI+E LA+AL
Sbjct  16   EPELIAPAKPTPHEYKLLSDIDDQEGLRFQIPVIQFYKYNPSMQGKDPVRVIREALAQAL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EGP +KL+VDC GEG++F+ A+A++ L   GD +  P P L++L Y+VP
Sbjct  76   VFYYPFAGRLREGPQRKLMVDCTGEGLMFIEADADVTLEQFGDVLQPPFPCLEELLYDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +  CP++LIQVTR  CG
Sbjct  136  GSTGVLNCPVILIQVTRLRCG  156



>sp|Q3ZPN4.1|ACMAT_VITLA RecName: Full=Methanol O-anthraniloyltransferase; AltName: Full=Anthraniloyl-CoA:methanol 
acyltransferase; AltName: Full=Benzyl 
alcohol O-benzoyltransferase [Vitis labrusca]
 gb|AAW22989.1| anthraniloyal-CoA: methanol anthraniloyal transferase [Vitis 
labrusca]
Length=449

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/140 (59%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALV  356
            P++V P  PTPRE K LSDIDDQ   R+ +P + FY N   M GKDP KVI+E L KALV
Sbjct  17   PQIVRPANPTPREVKQLSDIDDQEGRRFQIPVIMFYRNNPLMEGKDPVKVIREALGKALV  76

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
            ++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP  ++L Y+VPG
Sbjct  77   YYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCPCFEELLYDVPG  136

Query  537  SHRITGCPLLLIQVTRFSCG  596
            S  I G PL+LIQVTR  CG
Sbjct  137  STTILGSPLILIQVTRLRCG  156



>ref|XP_003520833.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=452

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P  PTP E KPLSDIDDQ  LR+H+P +  Y N+ SM  KDP +VI+
Sbjct  14   FTVR-RLQPELVAPAIPTPHELKPLSDIDDQEGLRFHIPMIQVYRNQPSMAEKDPVQVIR  72

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + LAK LVF+YP AGRL E P+ KL+VDC GEGVLF+ A+A++ L  LGD +  P P  +
Sbjct  73   KALAKTLVFYYPFAGRLRERPDHKLMVDCTGEGVLFIEADADVTLDQLGDALQPPFPCFE  132

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L YNVP S  IT  PLLLIQVTR  CG
Sbjct  133  QLLYNVPDSEEITDTPLLLIQVTRLKCG  160



>ref|XP_002319767.1| transferase family protein [Populus trichocarpa]
 gb|EEE95690.1| transferase family protein [Populus trichocarpa]
 gb|AJD25144.1| benzoyl-CoA:salicyl alcohol O-benzoyltransferase [Populus trichocarpa]
Length=459

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+ P  PTP E K LSDIDDQ  LR+H+P + FY +  S+ GKDP KVI+E +AK L
Sbjct  16   EPELIKPAKPTPHEFKLLSDIDDQEGLRFHIPVIQFYRHNPSVQGKDPVKVIREAIAKTL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EG N+KL+V+C GEG+LF+ A+A++ L   GD +  P P L++L ++VP
Sbjct  76   VFYYPFAGRLREGQNRKLMVECTGEGILFIEADADVTLEQFGDALQPPFPCLEELIFDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +  CPLLLIQVTR  CG
Sbjct  136  GSSGVLNCPLLLIQVTRLKCG  156



>ref|XP_008384757.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKDPAKVIKEGLAKA  350
            +PEL+TP  PTP+E K LSDIDDQ SLR+ +P +  Y+   S+   ++P KVI+E L++A
Sbjct  13   QPELITPAKPTPQETKFLSDIDDQESLRFQVPVIMCYKANPSLNKNRNPVKVIREALSRA  72

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGRL EGPNKKL+VDCNGEG+LFV A A++ L  LGD I  PCP L++  +N 
Sbjct  73   LVYYYPLAGRLREGPNKKLVVDCNGEGILFVEASADVTLEQLGDXILPPCPLLEEFLFNF  132

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPLLL+QVT  +CG
Sbjct  133  PGSDGIIGCPLLLVQVTCLTCG  154



>ref|XP_007029777.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase, putative 
[Theobroma cacao]
 gb|EOY10279.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase, putative 
[Theobroma cacao]
Length=471

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 104/148 (70%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P  PTPRE K LSDIDDQ  LR  +P + FY+   SM GKDPAKVI+
Sbjct  26   FTVR-RCEPELVKPARPTPRELKLLSDIDDQECLRTQIPIIQFYKYNPSMQGKDPAKVIR  84

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E L K LVF+YP AGRL EGPN KL+VDC G+GVLF+ A+A++ L   G+ +  P P L 
Sbjct  85   EALGKTLVFYYPFAGRLREGPNGKLMVDCTGDGVLFIEADADVKLEQFGEALQPPFPCLD  144

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS  I  CPLLLIQVT   CG
Sbjct  145  QLLYDVPGSGEILNCPLLLIQVTTMKCG  172



>emb|CBI37443.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  FSV+    PE V P  PTPRE K LSDIDDQ  LR+ +P + FY N   M GKDP K
Sbjct  7    PLVFSVK-RCDPEFVRPTNPTPRELKQLSDIDDQEGLRFQIPVIMFYPNNPLMKGKDPVK  65

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VI+E L KALV++YP AGRL EG N+KL+VDC GEGVLF+ A+A+  L NLGD I   CP
Sbjct  66   VIREALGKALVYYYPFAGRLIEGDNRKLMVDCTGEGVLFIEADADTTLENLGDAIQPMCP  125

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              ++L Y+VPGS  I G P++LIQVTR  CG
Sbjct  126  CFEELLYDVPGSGGILGSPVVLIQVTRLRCG  156



>gb|KEH40969.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=458

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+V+   +PEL+TP  PTP E K LSDIDDQ SLR+ +PG+ FY+   +M GKDP  +I+
Sbjct  7    FTVK-RREPELITPSKPTPHETKLLSDIDDQDSLRWQVPGIQFYKYDPNMAGKDPVDIIR  65

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + LAK LVF+YP AGRL EGP +KL+VDC GEGVLF+ A+A+++L   G+ +H P P + 
Sbjct  66   KALAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADADVSLKEFGEDLHPPFPCID  125

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS  +   PLLLIQVTR  CG
Sbjct  126  ELLYDVPGSSDMLNTPLLLIQVTRLKCG  153



>ref|XP_003516503.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Glycine 
max]
Length=452

 Score =   158 bits (399),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            FSV +  +PELV P  PTPRE K LSDIDDQ  LR+    + FY+    M GK PA VIK
Sbjct  8    FSV-VHGEPELVVPAGPTPRELKNLSDIDDQEGLRFQHQVIMFYQKSHVMEGKHPATVIK  66

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
             GLA+ALV +YPLAGRL E PN+KL VDC+GEG+LFV AEA+++L  LG+ I  PCP++K
Sbjct  67   YGLAEALVHYYPLAGRLREWPNRKLTVDCSGEGILFVEAEAHVSLKELGNSILPPCPHMK  126

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L  +VPGS  I GCPLLL QVTR +CG
Sbjct  127  ELLLDVPGSQGILGCPLLLFQVTRLTCG  154



>gb|AIC83790.1| alcohol acyltransferase [Actinidia deliciosa]
Length=456

 Score =   157 bits (398),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 93/155 (60%), Positives = 112/155 (72%), Gaps = 5/155 (3%)
 Frame = +3

Query  141  FPPR--FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKD  314
            FPP   F+VR   +P LV P  PTPRE K LSDIDDQ  LR+ +P + FY+ K S  G+D
Sbjct  4    FPPSLVFTVR-RKEPILVLPSKPTPRELKQLSDIDDQEGLRFQVPVIMFYKRKLSTEGED  62

Query  315  PAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNL-GDFIH  491
            P KVI+E LA+AL F+YP AGRL EGPN+KL+VDC  EGVLF+ A+A+I L+ L GD I 
Sbjct  63   PVKVIREALAEALAFYYPFAGRLIEGPNRKLMVDCTSEGVLFIEADADIELNQLIGDTI-  121

Query  492  SPCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             P  YL +L ++VPGS  I GCPLLLIQVTRF CG
Sbjct  122  DPGTYLDELLHDVPGSEGILGCPLLLIQVTRFRCG  156



>gb|KHN41759.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=469

 Score =   158 bits (399),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 89/148 (60%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            FSV +  +PELV P  PTPRE K LSDIDDQ  LR+    + FY+    M GK PA VIK
Sbjct  8    FSV-VHGEPELVVPAGPTPRELKNLSDIDDQEGLRFQHQVIMFYQKSHVMEGKHPATVIK  66

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
             GLA+ALV +YPLAGRL E PN+KL VDC+GEG+LFV AEA+++L  LG+ I  PCP++K
Sbjct  67   YGLAEALVHYYPLAGRLREWPNRKLTVDCSGEGILFVEAEAHVSLKELGNSILPPCPHMK  126

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L  +VPGS  I GCPLLL QVTR +CG
Sbjct  127  ELLLDVPGSQGILGCPLLLFQVTRLTCG  154



>gb|KEH40977.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=425

 Score =   157 bits (396),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALV  356
            PEL+TP  PT  E K LSDIDDQ SLR+ +P + FY +  +M GKDP  VI++ LAK LV
Sbjct  14   PELITPSKPTLHETKLLSDIDDQDSLRWQVPLIQFYNHDPNMAGKDPVDVIRKALAKTLV  73

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
            F+YP AGRL EGP +KL+VDC GEGVLF+ A+A++ L   GD +H P P L +L Y VPG
Sbjct  74   FYYPFAGRLREGPGRKLMVDCTGEGVLFIEADADVTLKEFGDALHPPFPCLDELLYYVPG  133

Query  537  SHRITGCPLLLIQVTRFSCG  596
            S  +   PL+LIQVTR  CG
Sbjct  134  SSDVINTPLMLIQVTRLKCG  153



>dbj|BAE72881.1| benzoyl CoA benzoic acid benzoyltransferase [Verbena x hybrida]
Length=461

 Score =   157 bits (397),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 108/148 (73%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PEL+ P  PTPRE KPLSDIDDQ  LR+ +P + FY +   M  K+PA+VI+
Sbjct  10   FTVR-RNEPELIAPAKPTPRELKPLSDIDDQEGLRFQIPVIQFYRHDPKMRNKNPARVIR  68

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E LAK LVF+YP AGRL EGP KKL+VDC+GEGVLF+ AEA++ L+  GD +  P P L+
Sbjct  69   EALAKVLVFYYPFAGRLKEGPAKKLMVDCSGEGVLFIEAEADVTLNQFGDALQPPFPCLE  128

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS  +   PLLLIQVTR  CG
Sbjct  129  ELLYDVPGSGGVLDSPLLLIQVTRLLCG  156



>gb|KJB82515.1| hypothetical protein B456_013G200100 [Gossypium raimondii]
Length=461

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 86/151 (57%), Positives = 108/151 (72%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P +F+VR   +PELV P  PTP E+K LSDIDDQASLR+ +P + FY+ + SM G DPA+
Sbjct  8    PLKFTVR-RCEPELVAPAKPTPYEQKLLSDIDDQASLRFQIPVINFYQYEPSMEGNDPAE  66

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VI+E LA+ LV +YP AGRL EG N KLIVDC GEGV+F+ A+A++ L   G+ +  P P
Sbjct  67   VIREALAQTLVCYYPFAGRLREGANGKLIVDCTGEGVMFIKADADVTLEQFGEPLLPPFP  126

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
               +L YNVPGS  +  CPLLLIQVTR  CG
Sbjct  127  CSDELLYNVPGSEGMLNCPLLLIQVTRLKCG  157



>gb|KJB82264.1| hypothetical protein B456_013G185700 [Gossypium raimondii]
Length=465

 Score =   157 bits (397),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 108/151 (72%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  F+VR   +PELVTP  PTP E+K +SDIDDQ + R H+P   FY+ + SM GKDPA+
Sbjct  13   PLEFTVR-RCEPELVTPAKPTPYEQKLVSDIDDQEAFRLHVPIFNFYQYEPSMEGKDPAE  71

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            +I+E LA+ LV +YP AGRL EG N KLIVDC GEGV+F+ A+A++ L   G+ +  P P
Sbjct  72   IIREALAQTLVCYYPFAGRLREGANGKLIVDCTGEGVMFIKADADVTLEQFGEPLLPPFP  131

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            YL +L Y+VPGS  I  CPLLL+QVTR  CG
Sbjct  132  YLDQLLYDVPGSEGILNCPLLLVQVTRLKCG  162



>ref|XP_007029790.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10292.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=457

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P  PTP E K LSDIDDQ S R+ +P + FY     M GKDPA +++
Sbjct  10   FTVR-RCEPELVGPAKPTPNECKRLSDIDDQESFRFQVPVIQFYRYNPCMQGKDPAMIVR  68

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E LA+ALVF+YPLAGRL EGPN+KL+VDCNGEG LFV A+A++ L   GD +  P P L 
Sbjct  69   EALAQALVFYYPLAGRLREGPNRKLMVDCNGEGALFVEADADVTLEQFGDALQPPFPCLH  128

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+ P S  +   PLL IQVTR  CG
Sbjct  129  ELLYDTPSSEGMLNSPLLFIQVTRLRCG  156



>ref|XP_012070522.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Jatropha 
curcas]
Length=484

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 93/124 (75%), Gaps = 0/124 (0%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKK  404
            LSDIDDQ  LR+ +P +  Y +  SM GKDP +VI+  +AKALVF+YP AGR+ EG N+K
Sbjct  61   LSDIDDQEGLRFQIPFIQIYRHGRSMEGKDPVQVIRNAIAKALVFYYPFAGRIREGSNRK  120

Query  405  LIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTR  584
            LI+DCNGEGVLF+ A+AN++L   GD +  P P+L +L ++VPGS  I  CP++LIQVTR
Sbjct  121  LIMDCNGEGVLFIEADANVSLDQSGDALQPPFPFLDELLFDVPGSSGILNCPVILIQVTR  180

Query  585  FSCG  596
            F CG
Sbjct  181  FKCG  184



>ref|XP_012081025.1| PREDICTED: LOW QUALITY PROTEIN: methanol O-anthraniloyltransferase-like 
[Jatropha curcas]
Length=453

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 110/153 (72%), Gaps = 1/153 (1%)
 Frame = +3

Query  138  LFPPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDP  317
            L    FSV+   +PEL+ P  PTP E K LSDIDDQ  LR+ +  + FY +   M GKDP
Sbjct  5    LLSTAFSVQ-RRQPELIVPAKPTPCELKTLSDIDDQEGLRFQISFILFYRSHPLMKGKDP  63

Query  318  AKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSP  497
              +I++ L++ALV++ P AG++ EGPNKKL+VDCNGEG+LF+ A A++++  LGD +  P
Sbjct  64   VAIIRKALSEALVYYXPFAGKVIEGPNKKLMVDCNGEGILFIEANADVSIEQLGDSMLPP  123

Query  498  CPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            CP +++L Y+VPGS  I GCPLLLIQVTR +CG
Sbjct  124  CPSIEELLYDVPGSFGILGCPLLLIQVTRLTCG  156



>ref|XP_008356442.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PELVTP +PTP E+K LS+ID+Q +LR   P +W Y +  S    DP +VI++ L+++L
Sbjct  16   EPELVTPASPTPCEQKILSEIDNQEALRCQTPFIWSYTSNPSSKEIDPVQVIRDALSRSL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            V++YPLAGR+ EGPNKKL+VDCNGEGVLF+ AEA++ L  LGD +  PCP L+   Y+VP
Sbjct  76   VYYYPLAGRVREGPNKKLMVDCNGEGVLFIEAEADVTLEQLGDTLQPPCPLLEDFLYDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            G++ I G PLL +QVTR  CG
Sbjct  136  GTNDIVGTPLLJVQVTRLKCG  156



>ref|XP_002319766.1| hypothetical protein POPTR_0013s07230g [Populus trichocarpa]
 gb|EEE95689.1| hypothetical protein POPTR_0013s07230g [Populus trichocarpa]
Length=456

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+ P  PTP E K LSDIDDQ  LR+H+P + FY +  SM GKDP KVI+E +AK L
Sbjct  16   EPELIKPAKPTPHEFKLLSDIDDQEGLRFHVPIIQFYRHNPSMHGKDPVKVIREAIAKTL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EG N+KL+V+C GEG+LF+ A+A++ L   GD +  P P L++L ++VP
Sbjct  76   VFYYPFAGRLREGHNRKLMVECTGEGILFIEADADVTLEQFGDPLQPPFPCLEELLFDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +  CPLLLIQV+R  CG
Sbjct  136  GSSGVLNCPLLLIQVSRLKCG  156



>ref|XP_011009229.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=456

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+ P  PTPRE K LSDIDDQ  LR+H+P + FY +  SM GKDP KVI+E +AK L
Sbjct  16   EPELIKPAKPTPREFKLLSDIDDQEGLRFHIPLIHFYRHNPSMHGKDPVKVIREAIAKTL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EG N+KL+V+C GEG+LF+ A+A++ L   GD +  P P L++L ++VP
Sbjct  76   VFYYPFAGRLREGHNRKLMVECTGEGILFIEADADVTLEQFGDPLQPPFPCLEELLFDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +  CPLLLIQV+R  CG
Sbjct  136  GSSGVLNCPLLLIQVSRLKCG  156



>ref|XP_007029780.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10282.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=475

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 115/172 (67%), Gaps = 11/172 (6%)
 Frame = +3

Query  69   SRKTHHLVFDNNII*YNY*SMACLFPPR---FSVRLTTKPELVtpktptprekkpLSDID  239
            S K+ HL F +      + +MA L PP    F+VR   +PELV P  PTPRE K LSDID
Sbjct  8    SIKSSHLAFSS------FFAMA-LLPPTSLVFTVR-RHEPELVVPAKPTPRECKLLSDID  59

Query  240  DQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDC  419
            DQ   R+ + GL FY  K SM GKDPA +IKE L KALVF+YP AGRL EGPN+KL+VDC
Sbjct  60   DQDGHRFQIRGLHFYRFKPSMQGKDPACIIKEALTKALVFYYPYAGRLREGPNRKLVVDC  119

Query  420  NGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQ  575
             GEGVLF+ A+A++ L   GD +H P P  K+L Y VPGS+ I  CPLL IQ
Sbjct  120  TGEGVLFIQADADVTLDQFGDSLHPPFPCYKELLYEVPGSNEILNCPLLQIQ  171



>gb|KJB82262.1| hypothetical protein B456_013G185500 [Gossypium raimondii]
Length=454

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+ P  PTP E K LSDIDDQ  LR+ +P + FY+   SM GKDP +VI+E LA+AL
Sbjct  16   EPELIAPAKPTPHEYKLLSDIDDQEGLRFQIPVIQFYKYNPSMQGKDPVRVIREALAQAL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EG  +KL+VDC+GEGV+F+ A+A++ L   GD +  P P L++L Y+VP
Sbjct  76   VFYYPFAGRLREGAQRKLMVDCSGEGVMFIEADADVTLEQFGDALQPPFPCLEELLYDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +  CP++LIQVTR  CG
Sbjct  136  GSTGVLNCPVILIQVTRLRCG  156



>ref|XP_006484694.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Citrus sinensis]
Length=458

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = +3

Query  165  LTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLA  344
            L   PEL+ P  PTPRE KPLSDIDDQ  LR+H+P + FY+    + GKDP KVI+E +A
Sbjct  10   LRRAPELIAPAKPTPRELKPLSDIDDQEGLRFHIPVIQFYKYNPFVNGKDPVKVIREAIA  69

Query  345  KALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQY  524
            + LV +YP AGRL EGPN+KL+VDC GEGVLF+ A+A++ L   GD +  P P L++L +
Sbjct  70   QTLVSYYPFAGRLREGPNRKLMVDCTGEGVLFIEADADVTLEQFGDALQPPFPGLEELLF  129

Query  525  NVPGSHRITGCPLLLIQVTRFSCG  596
            +VPGS  +  CPLLLIQVTR  CG
Sbjct  130  DVPGSAGVLNCPLLLIQVTRLKCG  153



>gb|KEH17125.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=155

 Score =   149 bits (376),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = +3

Query  171  TKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKA  350
            ++PEL++P  PTP E K LSDIDDQ SLR+H+P + FY     M GKDP  VI++ LAK 
Sbjct  12   SEPELISPSKPTPHEIKRLSDIDDQQSLRFHVPLIQFYNYNPIMEGKDPVVVIRKALAKT  71

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LVF+YPLAGRL EGP +KL+VDC GEGVLF+ A+A++ L   GD +H P P L +L Y+V
Sbjct  72   LVFYYPLAGRLREGPGRKLMVDCTGEGVLFIEADADVTLKQFGDALHPPFPCLGELIYDV  131

Query  531  PGSHRITGCPLLLIQV  578
            PGS  +   PLLLIQ+
Sbjct  132  PGSSDVLNTPLLLIQL  147



>gb|KCW72711.1| hypothetical protein EUGRSUZ_E01163 [Eucalyptus grandis]
Length=464

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGK-DPAKVIKEGLAKA  350
            KPEL++P   TPRE KPLSD+DDQ  LR+ +P L+FY N   + G+ DPA+V+KE L KA
Sbjct  18   KPELISPSQATPRELKPLSDLDDQEGLRFQIPFLFFYPNSPPIRGREDPARVVKEALRKA  77

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGR+ EGPN+KL+VDC GEG+LFV A+A+ +L  LGD +  PC ++ ++  +V
Sbjct  78   LVYYYPLAGRIREGPNRKLVVDCTGEGILFVKADADFSLEELGDSMRPPCGFVDEVLCDV  137

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
             GS  I GCPLLL+QVTR  CG
Sbjct  138  AGSGGIIGCPLLLVQVTRLKCG  159



>ref|XP_007147133.1| hypothetical protein PHAVU_006G098500g [Phaseolus vulgaris]
 gb|ESW19127.1| hypothetical protein PHAVU_006G098500g [Phaseolus vulgaris]
Length=463

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  RFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVI  329
            +F+VR  ++P+LV P  PTP E K LSDIDDQ +LR+H+P +  Y  + SM  KDP +VI
Sbjct  15   KFTVR-RSQPQLVAPAIPTPHELKLLSDIDDQEALRFHIPMIQIYRKQASMAEKDPVEVI  73

Query  330  KEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYL  509
            ++ L++ LVF+YP AGRL EGP +KL+VDC GEGV+F+  +A++ L   GD +  P P  
Sbjct  74   RKALSQTLVFYYPFAGRLREGPQRKLMVDCTGEGVMFMEGDADVTLAEFGDSLQPPFPCF  133

Query  510  KKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             +L Y+VPGS +IT  PLLL+QVTR  CG
Sbjct  134  DELLYDVPGSQQITNTPLLLVQVTRLKCG  162



>ref|XP_011018694.1| PREDICTED: methanol O-anthraniloyltransferase-like [Populus euphratica]
Length=461

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 85/153 (56%), Positives = 107/153 (70%), Gaps = 6/153 (4%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGK----DPA  320
            F+VR   +P L+ P  PTP E K LSD+DDQ  LR+HMP + F+ N     G     DP 
Sbjct  10   FTVR-RQEPRLILPAKPTPSEVKQLSDLDDQEGLRFHMPFIAFFRNTNKKGGNETYPDPV  68

Query  321  KVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGE-GVLFVTAEANIALHNLGDFIHSP  497
            KVI++ LA ALV++YPLAGRL EG ++KL+VDC GE GVLF+ A A+I L +LGD I  P
Sbjct  69   KVIRDALAHALVYYYPLAGRLKEGDSRKLMVDCTGELGVLFIEAVADITLEHLGDAIQPP  128

Query  498  CPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            CPYL+   Y++PGS  I GCPL+LIQVTR +CG
Sbjct  129  CPYLEHFLYDIPGSSGIIGCPLMLIQVTRLTCG  161



>ref|XP_006437408.1| hypothetical protein CICLE_v10031489mg [Citrus clementina]
 gb|ESR50648.1| hypothetical protein CICLE_v10031489mg [Citrus clementina]
Length=458

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = +3

Query  165  LTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLA  344
            L   PEL+ P  PTPRE KPLSDIDDQ  LR+H+P + FY+    + GKDP KVI+E +A
Sbjct  10   LRRAPELIAPAKPTPRELKPLSDIDDQEGLRFHIPVIQFYKYNPFVNGKDPVKVIREAVA  69

Query  345  KALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQY  524
            + LV +YP AGRL EGPN+KL+VDC GEGVLF+ A+A++ L   GD +  P P L++L +
Sbjct  70   QTLVSYYPFAGRLREGPNRKLMVDCTGEGVLFIEADADVTLEQFGDALQPPFPGLEELLF  129

Query  525  NVPGSHRITGCPLLLIQVTRFSCG  596
            +VPGS  +  CPLLLIQVTR  CG
Sbjct  130  DVPGSAGVLNCPLLLIQVTRLKCG  153



>ref|XP_007147136.1| hypothetical protein PHAVU_006G098800g [Phaseolus vulgaris]
 gb|ESW19130.1| hypothetical protein PHAVU_006G098800g [Phaseolus vulgaris]
Length=460

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 107/149 (72%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  RFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVI  329
            +F+VR   +P+LV P  PTP E K LSDIDDQ +LR+H P +  Y  + SM  KDP +VI
Sbjct  14   KFTVR-RCEPQLVAPAIPTPHELKLLSDIDDQEALRFHSPAIQIYGKQASMAEKDPVEVI  72

Query  330  KEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYL  509
            ++ L++ LVF+YPLAGR+ EGP++KL+V+C GEG +F+ A+A++ LH  GD +  P P  
Sbjct  73   RKALSQTLVFYYPLAGRVREGPHRKLMVECTGEGAMFIEADADVTLHEFGDSLQPPFPCF  132

Query  510  KKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             +L Y+VPGS +IT  PLLL+QVTR  CG
Sbjct  133  HELLYHVPGSQQITNTPLLLVQVTRLKCG  161



>gb|ABK96738.1| unknown [Populus trichocarpa x Populus deltoides]
Length=440

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+ P  PTPRE K LSDIDDQ  LR+H+P + FY +  SM GKDP KVI+E +AK L
Sbjct  16   EPELIKPAKPTPREFKLLSDIDDQEGLRFHIPLIQFYRHNPSMHGKDPVKVIREAIAKTL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            +F+YP AGRL EG N+KL+V+C GEG+LF+ A+A++ L   GD +  P P L++L ++VP
Sbjct  76   LFYYPFAGRLREGHNRKLMVECTGEGILFIEADADVTLEQFGDPLQPPFPCLEELLFDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +  CPLLLIQV+R  CG
Sbjct  136  GSSGVLNCPLLLIQVSRLKCG  156



>ref|XP_008462816.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=459

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 102/142 (72%), Gaps = 0/142 (0%)
 Frame = +3

Query  171  TKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKA  350
            ++P+L+ P  PTP E K LSDIDDQ  LR+ +P + FY +   M G DPA+VIKE +AKA
Sbjct  12   SQPQLIPPSDPTPHEFKQLSDIDDQEGLRFQIPVIQFYRHDPRMAGTDPARVIKEAIAKA  71

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LVF+YP AGRL EGP +KL V+C GEGV+F+ A+A+++L   GD +  P P L++L ++V
Sbjct  72   LVFYYPFAGRLREGPGRKLFVECTGEGVMFIEADADVSLEQFGDALQPPFPCLEELLFDV  131

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            P S  +  CPLLLIQVTR  CG
Sbjct  132  PNSSGVLDCPLLLIQVTRLKCG  153



>ref|XP_009372579.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Pyrus x 
bretschneideri]
Length=461

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PELV P   TP E + LSDIDDQ  LR+ +P + FY+   SM G+DP  V++E +A+ L
Sbjct  16   QPELVAPAKATPYEFRQLSDIDDQEGLRFQIPVIQFYKYDPSMQGRDPVHVLREAIAQTL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EGP++KL V+C  EGV+F+ A+A++ L   GD +  P P L++L YNVP
Sbjct  76   VFYYPFAGRLREGPDRKLTVECTAEGVMFIEADADVTLEQFGDALQPPFPCLEELLYNVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +  CPLLLIQVTR  CG
Sbjct  136  GSDGVLNCPLLLIQVTRLQCG  156



>ref|XP_009336752.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=459

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKDPAKVIKEGLAKA  350
            +PEL+TP  PTP+E K LSD+DDQ  LR+ +P +  Y++  S+   ++P KVI+E L++A
Sbjct  13   QPELITPAKPTPQETKFLSDVDDQEGLRFQLPIIMCYKDNSSLNENRNPIKVIREALSRA  72

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGRL EGPN+ L+VDCNGEG+LFV A A++ L  +GD I  PCP L++  +N 
Sbjct  73   LVYYYPLAGRLREGPNRMLMVDCNGEGILFVEASADVTLEQVGDKILPPCPLLEEFLFNF  132

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPLLL+QVTR +CG
Sbjct  133  PGSDGIIGCPLLLVQVTRLTCG  154



>ref|XP_004151058.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 gb|KGN63337.1| hypothetical protein Csa_2G431070 [Cucumis sativus]
Length=459

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +3

Query  171  TKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKA  350
            ++P+L+ P  PTP E K LSDIDDQ  LR+ +P + FY +   M G DPA+VIKE +AKA
Sbjct  12   SQPQLIPPSDPTPHEFKQLSDIDDQEGLRFQIPVIQFYRHDPRMAGTDPARVIKEAIAKA  71

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LVF+YP AGRL EGP +KL V+C GEGVLF  A+A+++L   GD +  P P L++L ++V
Sbjct  72   LVFYYPFAGRLREGPGRKLFVECTGEGVLFTEADADVSLEQFGDALQPPFPCLEELLFDV  131

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            P S  +  CPLLLIQVTR  CG
Sbjct  132  PNSSGVLDCPLLLIQVTRLKCG  153



>ref|XP_009336751.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=459

 Score =   156 bits (394),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKDPAKVIKEGLAKA  350
            +PEL+TP  PTP+E K LSD+DDQ  LR+ +P +  Y++  S+   ++P KVI+E L++A
Sbjct  13   QPELITPAKPTPQETKFLSDVDDQEGLRFQLPIIMCYKDNSSLNENRNPIKVIREALSRA  72

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGRL EGPN+ L+VDCNGEG+LFV A A++ L  +GD I  PCP L++  +N 
Sbjct  73   LVYYYPLAGRLREGPNRMLMVDCNGEGILFVEASADVTLEQVGDKILPPCPLLEEFLFNF  132

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPLLL+QVTR +CG
Sbjct  133  PGSDGIIGCPLLLVQVTRLTCG  154



>gb|AGW30205.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKDPAKVIKEGLAKA  350
            +PEL+TP  PTP+E K LS+IDDQ SLR+ +P +  Y+   S+   ++P KVI+E L++A
Sbjct  13   QPELITPAKPTPQETKFLSEIDDQESLRFQVPVIMCYKANPSLNKNRNPVKVIREALSRA  72

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGRL EGPNKKL+VDCNGEG+LFV A A++ L  LGD I  PCP L++  +N 
Sbjct  73   LVYYYPLAGRLREGPNKKLVVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNF  132

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPLLL+QVT  +CG
Sbjct  133  PGSGGIIGCPLLLVQVTCLTCG  154



>ref|XP_008359502.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Malus domestica]
Length=461

 Score =   156 bits (394),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P   TP E + LSDIDDQ  LR+ +P + FY+   SM G+DP  V++
Sbjct  10   FTVR-RRQPELVAPAKATPHEFRQLSDIDDQEGLRFQIPVIQFYKYDPSMQGRDPVHVLR  68

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E +A+ LVF+YP AGRL EGPN+KL V+C  EGV+F+ A+A++ L   GD +  P P L+
Sbjct  69   EAIAQTLVFYYPFAGRLREGPNRKLTVECTAEGVMFIEADADVTLEQFGDALQPPFPCLE  128

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L YNV GS  +  CPLLLIQVTR  CG
Sbjct  129  ELLYNVRGSDGVLNCPLLLIQVTRLQCG  156



>ref|XP_002319765.2| hypothetical protein POPTR_0013s07220g [Populus trichocarpa]
 gb|EEE95688.2| hypothetical protein POPTR_0013s07220g [Populus trichocarpa]
Length=440

 Score =   155 bits (392),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+ P  PTP E K LSDIDDQ  LRYH+P + FY +  S+ GKDP KVI+E +AK L
Sbjct  16   EPELIKPAKPTPHEFKLLSDIDDQEGLRYHIPFIQFYRHNPSLQGKDPVKVIREAIAKTL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL  G N+KL+V+C GEG+LF+ A+A++ L   GD +  P P L++L ++VP
Sbjct  76   VFYYPFAGRLMAGHNRKLMVECTGEGILFIEADADVTLEQFGDPLQPPFPCLEELLFDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +  CPLLLIQV+R  CG
Sbjct  136  GSSGVLNCPLLLIQVSRLKCG  156



>ref|XP_009365778.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=454

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 109/154 (71%), Gaps = 1/154 (1%)
 Frame = +3

Query  138  LFPPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKD  314
            + PP        +PEL+TP  PTP+E K LSDIDDQ  LR+ +P +  Y++  S+   ++
Sbjct  1    MMPPSVLQVKRLQPELITPAKPTPQETKFLSDIDDQEGLRFQVPVIMCYKDNPSLNENRN  60

Query  315  PAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHS  494
            P KVI+E L++ALV++YPLAGRL EGPN+KL+VDCNGEG+LFV A A++ L  LGD I  
Sbjct  61   PVKVIREALSRALVYYYPLAGRLREGPNRKLMVDCNGEGILFVEASADVTLEQLGDKILP  120

Query  495  PCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            PCP L +  +N PGS  I GCPLLL+QVT  +CG
Sbjct  121  PCPLLDEFLFNFPGSDGIIGCPLLLVQVTCLTCG  154



>ref|XP_009368754.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=461

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 105/140 (75%), Gaps = 0/140 (0%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALV  356
            PELVTP +PTP E+K LSDID+Q +LR   P +W Y +  S    DP +VI++ ++++LV
Sbjct  17   PELVTPASPTPCEQKILSDIDNQEALRCQTPFIWSYTSNPSSKEIDPVQVIRDAISRSLV  76

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
            ++YPLAGR+ EGPNKKL+VDCNGEGVLF+ A+A++ L  LGD +  PCP L+   Y+VPG
Sbjct  77   YYYPLAGRVREGPNKKLMVDCNGEGVLFIEADADVTLEQLGDTLQPPCPVLEDFLYDVPG  136

Query  537  SHRITGCPLLLIQVTRFSCG  596
            ++ I G PLL++QVTR  CG
Sbjct  137  TYDIVGTPLLIVQVTRLKCG  156



>ref|XP_008343918.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
 gb|AAU14879.2| alcohol acyl transferase [Malus domestica]
 gb|AGW30200.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 104/142 (73%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKDPAKVIKEGLAKA  350
            +PEL+TP   TP+E K LSDIDDQ SLR  +P +  Y++  S+   ++P K I+E L++A
Sbjct  13   QPELITPAKSTPQETKFLSDIDDQESLRVQIPIIMCYKDNPSLNKNRNPVKAIREALSRA  72

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGRL EGPN+KL+VDCNGEG+LFV A A++ L  LGD I  PCP L++  YN 
Sbjct  73   LVYYYPLAGRLREGPNRKLVVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLYNF  132

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I  CPLLLIQVT  +CG
Sbjct  133  PGSDGIIDCPLLLIQVTCLTCG  154



>ref|XP_006470742.1| PREDICTED: anthraniloyl-CoA:methanol acyltransferase-like [Citrus 
sinensis]
Length=447

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 94/127 (74%), Gaps = 3/127 (2%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYEN--KESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPN  398
            LSDIDDQ  L + +P ++FY+N    SM GKDP KVIKE L++ALV++YP AGRL EG +
Sbjct  33   LSDIDDQQGLWFQVPLIFFYKNNPSPSMKGKDPVKVIKEALSRALVYYYPFAGRLREGSD  92

Query  399  KKLIVDCNGEGVLFVTAEANIALHNLG-DFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQ  575
             KL+VDCNGEGVLF  A+A+ +L  LG D I  PCPYL +L Y+VPGS    GCPLLLIQ
Sbjct  93   GKLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDELLYDVPGSEGTLGCPLLLIQ  152

Query  576  VTRFSCG  596
            VTR  CG
Sbjct  153  VTRLICG  159



>ref|XP_010689156.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=443

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 82/141 (58%), Positives = 102/141 (72%), Gaps = 1/141 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            KPELV P  PTP+E KPLSDIDDQ  LR+ MP + FY    SM GKDP KV+K+ LAKAL
Sbjct  19   KPELVRPAQPTPQELKPLSDIDDQEGLRFQMPAIMFYRADPSMEGKDPVKVVKDALAKAL  78

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EGP +KL VDC GEG+ F+ A+A+  L + GD IH P P L+ L Y++P
Sbjct  79   VFYYPYAGRLVEGPTRKLSVDCTGEGLPFIEADADARLEDFGDEIHPPFP-LEDLLYDIP  137

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            G+  + G PL+++QVTR  CG
Sbjct  138  GTDGMLGTPLIIVQVTRLKCG  158



>gb|AGW30201.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   155 bits (392),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 104/142 (73%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKDPAKVIKEGLAKA  350
            +PEL+TP   TP+E K LSDIDDQ SLR  +P +  Y++  S+   ++P K I+E L++A
Sbjct  13   QPELITPAKSTPQETKFLSDIDDQESLRVQIPIIMCYKDNPSLNKNRNPVKAIREALSRA  72

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGRL EGPN+KL+VDCNGEG+LFV A A++ L  LGD I  PCP L++  YN 
Sbjct  73   LVYYYPLAGRLREGPNRKLVVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLYNF  132

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I  CPLLLIQVT  +CG
Sbjct  133  PGSDGIIDCPLLLIQVTCLTCG  154



>ref|XP_012065778.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Jatropha 
curcas]
Length=251

 Score =   150 bits (380),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 99/135 (73%), Gaps = 0/135 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+ P  PTP E K LSDIDDQ SLR+HMP + FY    SM GKDP KVI+E + K L
Sbjct  16   EPELLVPSNPTPHEFKLLSDIDDQDSLRFHMPLVQFYRYDPSMKGKDPVKVIREAIGKTL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EGP +KL+V+C GEGVLF+ A+A+++L + GD +  P P L++L ++VP
Sbjct  76   VFYYPFAGRLREGPERKLMVECTGEGVLFIEADADVSLEDFGDPLQPPFPCLEELLFDVP  135

Query  534  GSHRITGCPLLLIQV  578
            GS  I   PLLLIQV
Sbjct  136  GSSSILNSPLLLIQV  150



>ref|XP_004290447.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Fragaria vesca 
subsp. vesca]
Length=463

 Score =   155 bits (392),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PELV+P  PTPRE K LSDIDDQ  LR+ +P + FY    SM GKD  KVI+E +++AL
Sbjct  16   QPELVSPAKPTPRELKHLSDIDDQEGLRFQIPVIQFYRYDPSMKGKDCVKVIREAISQAL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EGP +KL+VDC GEG+LF+ A+A++ L   GD +  P P L++L YNVP
Sbjct  76   VFYYPFAGRLREGPGRKLMVDCTGEGILFIEADADVTLRQFGDALQPPFPCLEELLYNVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +   PLLLIQVTR  CG
Sbjct  136  GSDGVLNSPLLLIQVTRLKCG  156



>gb|AAS48090.1| alcohol acyl transferase [Pyrus communis]
Length=442

 Score =   155 bits (391),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKDPAKVIKEGLAKA  350
            +PEL+TP  PTP+E K LSDIDDQ  LR+ +P +  Y++  S+   ++P KVIKE L++A
Sbjct  13   QPELITPAKPTPQETKFLSDIDDQEGLRFQLPVIMCYKDNPSLNKNRNPIKVIKEALSRA  72

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGRL EGPN+KL+V+CNGEG+LFV A A++ L  LGD I  PCP L++  +N 
Sbjct  73   LVYYYPLAGRLREGPNRKLMVNCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNF  132

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPLLL+QVT  +CG
Sbjct  133  PGSDGIIGCPLLLVQVTCLTCG  154



>ref|XP_009368287.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=463

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/154 (53%), Positives = 109/154 (71%), Gaps = 1/154 (1%)
 Frame = +3

Query  138  LFPPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKD  314
            + PP        +PEL+TP  PTP+E K LSDIDDQ   R+ +P +  Y++  S+   ++
Sbjct  1    MMPPSVFQVKQLQPELITPAKPTPQETKFLSDIDDQEGFRFQVPIIMCYKDNPSVNKNRN  60

Query  315  PAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHS  494
            P +VI+E L++ALV++YPLAGRL EGPNKKL+VDCNGEG+LFV A A++ L  LGD I  
Sbjct  61   PVQVIREALSRALVYYYPLAGRLREGPNKKLVVDCNGEGILFVEASADVTLEQLGDKILP  120

Query  495  PCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            PCP L++  +N PGS  I GCPLLL+QVT  +CG
Sbjct  121  PCPLLEEFLFNFPGSDGIIGCPLLLVQVTCLTCG  154



>gb|AAT68601.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Petunia 
x hybrida]
 gb|AAU06226.1| benzoyl-CoA:benzyl alcohol/phenylethanol benzoyltransferase [Petunia 
x hybrida]
Length=460

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PEL+ P  PTPRE K LSDIDDQ  LR+ +P + FY    SM GKDP +VIK
Sbjct  11   FTVR-RQEPELIAPAKPTPRETKFLSDIDDQEGLRFQIPVINFYRKDSSMGGKDPVEVIK  69

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + +A+ LVF+YP AGRL EG ++KL+VDC GEGV+FV A A++ L   GD +  P P L+
Sbjct  70   KAIAETLVFYYPFAGRLREGNDRKLMVDCTGEGVMFVEANADVTLEEFGDELQPPFPCLE  129

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS  +  CPLLLIQVTR  CG
Sbjct  130  ELLYDVPGSAGVLHCPLLLIQVTRLRCG  157



>gb|KJB44361.1| hypothetical protein B456_007G247900 [Gossypium raimondii]
Length=449

 Score =   154 bits (390),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   KPEL+ P  PTP E K LSDIDDQ SLR+++P + FY    SM+GKDPA VI+
Sbjct  11   FNVR-RRKPELIAPARPTPHECKLLSDIDDQESLRFYIPVIQFYRYNPSMIGKDPAAVIR  69

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
              LA+ LV++YP AGRL EGPN KL VDC GEG L++ A A++AL + GD +  P P + 
Sbjct  70   GALAQTLVYYYPFAGRLREGPNCKLSVDCTGEGALYIEANADVALQDFGDILQPPFPCID  129

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            KL Y+VP   R+   PLL IQVTR  CG
Sbjct  130  KLLYDVPNPKRMLNDPLLFIQVTRLRCG  157



>ref|XP_010689157.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=443

 Score =   154 bits (389),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 101/140 (72%), Gaps = 1/140 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            KPELV P  PTPRE KPLSDIDDQ  LR+HMP + FY    SM  KDP KV+K+ LAKAL
Sbjct  19   KPELVCPAEPTPRELKPLSDIDDQEGLRFHMPAIMFYRADPSMEEKDPVKVVKDALAKAL  78

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EGP +KL VDC GEGV F+ AEA+  L + GD IH P P L+ L Y++P
Sbjct  79   VFYYPYAGRLVEGPTRKLSVDCTGEGVPFIEAEADARLEDFGDEIHPPFP-LQDLLYDMP  137

Query  534  GSHRITGCPLLLIQVTRFSC  593
            G+  + G PLL++QVTR  C
Sbjct  138  GTDGMLGTPLLIVQVTRLLC  157



>ref|XP_007147132.1| hypothetical protein PHAVU_006G098400g [Phaseolus vulgaris]
 gb|ESW19126.1| hypothetical protein PHAVU_006G098400g [Phaseolus vulgaris]
Length=485

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  RFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVI  329
            +F+VR   +P+LV P  PTP E K LSDIDDQ +LR+H+P +  Y  +ESM  KDP +VI
Sbjct  53   KFTVR-RCEPQLVAPAIPTPHELKLLSDIDDQEALRFHIPMIQIYGKQESMAEKDPVEVI  111

Query  330  KEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYL  509
            ++ L++ LVF+YP AGRL EGP +KL+VDC GEG +F+ A+A++ L   GD +  P P  
Sbjct  112  RQALSQTLVFYYPFAGRLREGPQRKLMVDCTGEGAMFIEADADVTLAEFGDSLQPPFPCF  171

Query  510  KKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             +L Y+VP S +IT  PLLL+QVTR  CG
Sbjct  172  HELMYDVPCSQQITETPLLLVQVTRLKCG  200



>ref|XP_007147134.1| hypothetical protein PHAVU_006G098600g [Phaseolus vulgaris]
 gb|ESW19128.1| hypothetical protein PHAVU_006G098600g [Phaseolus vulgaris]
Length=462

 Score =   154 bits (390),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  RFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVI  329
            +F+VR  ++P+LV P  PTP E K LSDIDDQ +LR+ +P +  Y  + SM  KDP +VI
Sbjct  15   KFTVR-RSQPQLVAPAIPTPHELKLLSDIDDQEALRFQVPMIQIYGKQASMAEKDPVEVI  73

Query  330  KEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYL  509
            ++ L++ LVF+YP AGRL EGP++KLIVDC GEGV+F+  +A++ L   GD +  P P  
Sbjct  74   RKALSQTLVFYYPFAGRLREGPHRKLIVDCTGEGVMFIEGDADVTLAEFGDSLQPPFPCF  133

Query  510  KKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             +L Y+VPGS +IT  PLLL+QVTR  CG
Sbjct  134  DELLYDVPGSQQITDTPLLLVQVTRLKCG  162



>gb|KDO48023.1| hypothetical protein CISIN_1g031330mg [Citrus sinensis]
Length=161

 Score =   147 bits (371),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +3

Query  165  LTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLA  344
            L   PEL+ P  PTPRE KPLSDIDDQ  LR+H+P + FY+    + GKDP KVI+E +A
Sbjct  10   LRRAPELIAPAKPTPRELKPLSDIDDQEGLRFHIPVIQFYKYNPFVNGKDPVKVIREAIA  69

Query  345  KALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQY  524
            + LV +YP AGRL EGPN+KL+VDC GEGVLF+ A+A++ L   GD +  P P L++L +
Sbjct  70   QTLVSYYPFAGRLREGPNRKLMVDCTGEGVLFIEADADVTLEQFGDALQPPFPGLEELLF  129

Query  525  NVPGSHRITGCPLLLIQVTRF  587
            +VPGS  +  CPLLLIQV  +
Sbjct  130  DVPGSAGVLNCPLLLIQVYTY  150



>gb|AGW30204.1| truncated alcohol acyl transferase [Malus domestica]
Length=323

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = +3

Query  180  ELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGK-DPAKVIKEGLAKALV  356
            EL+TP  PT +E K LSDIDDQ  LR+ +P +  Y++  S+    +P KVI+E L++ALV
Sbjct  15   ELITPAKPTLQETKFLSDIDDQEGLRFQVPVIMCYKDNPSLNKNCNPVKVIREALSRALV  74

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
            ++YPLAGRL EGPN+KL+VDCNGEG+LFV A A++ L  LGD I  PCP L++  +N PG
Sbjct  75   YYYPLAGRLKEGPNRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPG  134

Query  537  SHRITGCPLLLIQVTRFSCG  596
            S  I GCPLLL+QVT  +CG
Sbjct  135  SDGIIGCPLLLVQVTCLTCG  154



>ref|XP_012070283.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Jatropha 
curcas]
 gb|KDP39568.1| hypothetical protein JCGZ_02588 [Jatropha curcas]
Length=459

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 101/141 (72%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PEL+ P  PTP E K LSDIDDQ  LR+H+P + FY    SM GKDP KVI+E + K L
Sbjct  16   EPELLVPSKPTPHEFKLLSDIDDQDGLRFHIPVIQFYRYDPSMKGKDPVKVIREAIGKTL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EGP +KL+V+C GEGVLF+ A+A+++L + GD +  P P L+ L ++VP
Sbjct  76   VFYYPFAGRLREGPERKLMVECTGEGVLFIEADADVSLEDFGDALQPPFPCLEDLLFDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS  +    LLLIQVTR SCG
Sbjct  136  GSTSVLNSALLLIQVTRLSCG  156



>gb|KDO54865.1| hypothetical protein CISIN_1g048162mg [Citrus sinensis]
Length=152

 Score =   146 bits (369),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 90/120 (75%), Gaps = 3/120 (3%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYEN--KESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPN  398
            LSDIDDQ  L + +P ++FY+N    SM GKDP KVIKE L++ALV++YP AGRL EG N
Sbjct  33   LSDIDDQQGLWFQVPLIFFYKNNPSPSMKGKDPVKVIKEALSRALVYYYPFAGRLREGSN  92

Query  399  KKLIVDCNGEGVLFVTAEANIALHNLG-DFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQ  575
             KL+VDCNGEGVLF  A+A+ +L  LG D I  PCPYL +L Y+VPGS  I GCPLLLI+
Sbjct  93   GKLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDELLYDVPGSEGILGCPLLLIR  152



>ref|XP_003521736.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=464

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 106/150 (71%), Gaps = 3/150 (2%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   + EL+ P  PTPRE K LSDIDDQ  LR+ +P + FY N +    KDP +VI+
Sbjct  12   FTVR-RRQAELIAPAKPTPREVKKLSDIDDQEGLRFQIPFIQFYGNNKESSMKDPVEVIR  70

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGD--FIHSPCPY  506
            + L K LVF+YP AGRL EGP +KL+VDCNGEGVLF+ A+A++ LH  G    +H P P 
Sbjct  71   KALTKTLVFYYPFAGRLREGPGRKLMVDCNGEGVLFIEADADVTLHQFGPSYLLHPPFPC  130

Query  507  LKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            L++L ++VPGS  +T CPLLLIQVTR  CG
Sbjct  131  LEELLHDVPGSRGVTNCPLLLIQVTRLKCG  160



>gb|AGW30203.1| alcohol acyl transferase [Malus domestica]
Length=455

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 107/142 (75%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKDPAKVIKEGLAKA  350
            +PEL+TP  PTP+E K LSDIDDQ  LR+ +P +  Y++  S+   ++P KVI+E L++A
Sbjct  13   QPELITPAKPTPQETKFLSDIDDQEFLRFQVPIIMCYKDNPSLNKNRNPVKVIREALSRA  72

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGRL EGPN+KL+VDCNGEG+LF+ A A++ L  LGD I  PCP L++  +N 
Sbjct  73   LVYYYPLAGRLREGPNRKLVVDCNGEGILFIEASADVTLEQLGDKILPPCPLLEEFLFNF  132

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPL+L+QVT  +CG
Sbjct  133  PGSDGIIGCPLVLVQVTCLTCG  154



>ref|XP_006446261.1| hypothetical protein CICLE_v10015234mg [Citrus clementina]
 gb|ESR59501.1| hypothetical protein CICLE_v10015234mg [Citrus clementina]
Length=447

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYEN--KESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPN  398
            LSDIDDQ  L + +P ++FY+N    SM GKDP KVIKE L++ALV++YP AGRL EG +
Sbjct  33   LSDIDDQQGLWFQVPLIFFYKNNPSPSMKGKDPVKVIKEALSRALVYYYPFAGRLREGSD  92

Query  399  KKLIVDCNGEGVLFVTAEANIALHNLG-DFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQ  575
             KL+VDCNGEGVLF  A+A+ +L  LG D I  PCPYL +L Y+VPGS    GCPLLL Q
Sbjct  93   GKLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDELLYDVPGSEGTLGCPLLLFQ  152

Query  576  VTRFSCG  596
            VTR  CG
Sbjct  153  VTRLICG  159



>ref|XP_003554685.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
 gb|KHN43218.1| Benzyl alcohol O-benzoyltransferase [Glycine soja]
Length=464

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 107/149 (72%), Gaps = 2/149 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P TPTP + KPLSDIDDQ   R+ +P +  Y N+ SM GKDP +VI+
Sbjct  10   FTVR-RCQPELVAPATPTPHQLKPLSDIDDQDGFRFQVPIIQIYHNQPSMAGKDPVEVIR  68

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNL-GDFIHSPCPYL  509
            + LAK LVF+YP AGRL EGP++KL+VDC GEGV+F+ A+A++ L+   G+ +  P P  
Sbjct  69   QALAKTLVFYYPFAGRLREGPDRKLMVDCTGEGVMFIEADADVTLYQFGGEALQPPFPCF  128

Query  510  KKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            ++L YNVP +  IT  PLLLIQVTR  CG
Sbjct  129  QELLYNVPETEEITNTPLLLIQVTRLRCG  157



>ref|XP_010110389.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
 gb|EXC26221.1| Benzyl alcohol O-benzoyltransferase [Morus notabilis]
Length=493

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 103/143 (72%), Gaps = 3/143 (2%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKES---MVGKDPAKVIKEGLA  344
            +P LV P  PTP+E K LSDIDDQ  LR+H+P ++FY+N  +    +G+DP +VI+E L 
Sbjct  17   EPVLVKPSKPTPKEIKLLSDIDDQEGLRFHVPVIFFYKNNNNPSVKLGQDPNRVIREALG  76

Query  345  KALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQY  524
            +ALV++YP AGRL EG N KL+VDC GEGVLFV A+A++    LGD I  P P+L +  Y
Sbjct  77   RALVYYYPFAGRLREGSNGKLMVDCTGEGVLFVAAKADVGFDQLGDAIRPPSPFLDQFLY  136

Query  525  NVPGSHRITGCPLLLIQVTRFSC  593
            NVPGS  I GCPLLLIQVT+  C
Sbjct  137  NVPGSDGILGCPLLLIQVTQLKC  159



>gb|AHC32224.2| alcohol acyl transferase 1 [Eriobotrya japonica]
Length=459

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKDPAKVIKEGLAKA  350
            +PE +TP  P P+E K LSDIDDQ  LR+H+P +  Y++  S+   ++P KVI+E +++A
Sbjct  13   QPEFITPAKPMPQETKFLSDIDDQEGLRFHVPVIMCYKDNPSLNENRNPVKVIREAVSRA  72

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGRL E PN+KL+VDCN EG+LFV A AN+ L  LGD I  PCP L++  +NV
Sbjct  73   LVYYYPLAGRLREWPNRKLVVDCNSEGILFVEAFANVTLEQLGDKILPPCPLLEEFLFNV  132

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I GCPLLL+QVT  +CG
Sbjct  133  PGSDGIIGCPLLLVQVTCLTCG  154



>ref|XP_010689158.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Beta vulgaris 
subsp. vulgaris]
Length=443

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 102/140 (73%), Gaps = 1/140 (1%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALV  356
            PELV P  PTPRE KPLSDIDDQ  LR+HMP + FY+   SM G+DP +V+KEGLA+ALV
Sbjct  20   PELVCPAEPTPRELKPLSDIDDQEGLRFHMPAVMFYKADPSMDGRDPVEVVKEGLARALV  79

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
             FYP AGRL EG  +KL VDC GEGV+FV A+A+  L + GD IH P P L+ L Y++PG
Sbjct  80   LFYPYAGRLVEGQARKLSVDCTGEGVVFVEADADARLEDFGDEIHPPFP-LEDLLYDMPG  138

Query  537  SHRITGCPLLLIQVTRFSCG  596
            +  + G PLL+ QVTR  CG
Sbjct  139  TDAMLGTPLLIFQVTRLRCG  158



>ref|XP_006368247.1| hypothetical protein POPTR_0001s00950g [Populus trichocarpa]
 gb|ERP64816.1| hypothetical protein POPTR_0001s00950g [Populus trichocarpa]
Length=462

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 107/153 (70%), Gaps = 6/153 (4%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGK----DPA  320
            F+V+   +P L+ P  PTP E K LSD+DDQ  LR+HMP + F+ N     G     DP 
Sbjct  11   FTVK-RQEPRLILPAKPTPSEVKQLSDLDDQEGLRFHMPFIAFFRNTNKKGGNGTYPDPV  69

Query  321  KVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGE-GVLFVTAEANIALHNLGDFIHSP  497
            KVI++ LA ALV +YPLAGRL EG ++KL+VDC GE GVLF+ A+A+I L +LGD I  P
Sbjct  70   KVIRDALAHALVCYYPLAGRLKEGDSRKLMVDCTGELGVLFIEADADITLEHLGDAIQPP  129

Query  498  CPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            CPYL+   Y++PGS  I GCPL+LIQVTR +CG
Sbjct  130  CPYLEHFLYDIPGSSGIIGCPLMLIQVTRLTCG  162



>gb|AAW51125.1| putative alcohol acyl-transferases [Cucumis melo]
Length=459

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 101/142 (71%), Gaps = 0/142 (0%)
 Frame = +3

Query  171  TKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKA  350
            ++P+L+ P  PTP E K LSDIDDQ  LR+ +P + FY +   M G DPA+VIKE +AKA
Sbjct  12   SQPQLIPPSDPTPHEFKQLSDIDDQEGLRFQIPVIQFYRHDPRMAGTDPARVIKEAIAKA  71

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LVF+YP AGRL EGP +KL V+C GEGV+F+ A+A+++L   GD +  P P L++  ++V
Sbjct  72   LVFYYPFAGRLREGPGRKLFVECTGEGVMFIEADADVSLEQFGDALQPPFPCLEEPLFDV  131

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            P S  +  CPLLLIQVTR  CG
Sbjct  132  PNSSGVLDCPLLLIQVTRLKCG  153



>ref|XP_008797996.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Phoenix 
dactylifera]
Length=182

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKK  404
            LSD+DDQ  LR+ +P + FY +  SM G+DPA+VI+E LAKALV +YP AGRL EG  +K
Sbjct  30   LSDVDDQEGLRFQIPAIQFYRHDPSMAGRDPARVIREALAKALVHYYPFAGRLREGARRK  89

Query  405  LIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTR  584
            L+V+C GEGVLF+ A+A++ L   GD +  P PYL++L Y+V GS  +  CPLLL Q+ +
Sbjct  90   LVVECTGEGVLFIEADADVRLEQFGDALQPPSPYLEELLYDVEGSGDVLNCPLLLFQLEQ  149



>ref|XP_002264599.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Vitis vinifera]
 emb|CBI26419.3| unnamed protein product [Vitis vinifera]
Length=459

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            FSVR  +KPELV P  PTP E KPLSDIDDQ  LR+ +P + FY+   SM G+DPAKVIK
Sbjct  9    FSVR-RSKPELVAPAKPTPHEFKPLSDIDDQEGLRFQIPVIQFYKKVPSMHGRDPAKVIK  67

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + +A+ALVF+YP AGRL E   +KL+V+C GEG++F+ A+A++ L   GD +  P P L+
Sbjct  68   DAVARALVFYYPFAGRLREEAGRKLVVECTGEGIVFIEADADVTLEQFGDALQPPFPGLE  127

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+ PGS  +   PLLLIQVTR  CG
Sbjct  128  ELIYDAPGSGGVLNSPLLLIQVTRLQCG  155



>ref|XP_011082158.1| PREDICTED: methanol O-anthraniloyltransferase-like [Sesamum indicum]
Length=453

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 106/149 (71%), Gaps = 1/149 (1%)
 Frame = +3

Query  153  FSVRLTTK-PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVI  329
            F+  +T K PEL+ P  PTP E K LS +DDQ +LR H P + FY++K SM G +P K+I
Sbjct  4    FTFMVTPKEPELIVPAQPTPHEIKALSTLDDQETLRCHYPMIMFYKSKPSMEGLNPVKII  63

Query  330  KEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYL  509
            +E LAK LV++YP AGRL EGP+ K +VDC  EGV+FV A+A++++  LGD +  PC Y 
Sbjct  64   REALAKTLVYYYPYAGRLIEGPDNKFMVDCTAEGVVFVEADASVSIVQLGDTVQPPCRYP  123

Query  510  KKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            + L  +VPGS  + GCPL+L+QVTRF CG
Sbjct  124  ELLVSDVPGSDGMLGCPLMLVQVTRFKCG  152



>emb|CAA64636.1| hsr201 [Nicotiana tabacum]
Length=460

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   KPEL+ P  PTPRE K LSDIDDQ  LR+ +P + FY    SM  KDP KVIK
Sbjct  11   FTVR-RQKPELIAPAKPTPRETKFLSDIDDQEGLRFQIPVIQFYHKDSSMGRKDPVKVIK  69

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + +A+ LVF+YP AGRL EG  +KL+VDC GEG++FV A+A++ L   GD +  P P L+
Sbjct  70   KAIAETLVFYYPFAGRLREGNGRKLMVDCTGEGIMFVEADADVTLEQFGDELQPPFPCLE  129

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VP S  +  CPLLLIQVTR  CG
Sbjct  130  ELLYDVPDSAGVLNCPLLLIQVTRLRCG  157



>ref|XP_010275172.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nelumbo nucifera]
Length=459

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PEL+ P  PTP E K LSDIDDQ  LR+ +P + FY    SM G++P + I+
Sbjct  9    FTVR-RRQPELIAPAKPTPHEFKDLSDIDDQEGLRFQIPVIQFYRYDPSMEGRNPTQAIR  67

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + +AKALVF+YP AGRL EGP++KL V+C GEGV+F+ A+A++ L   GD +  P P L+
Sbjct  68   QAIAKALVFYYPFAGRLREGPHRKLTVECTGEGVMFIEADADVRLEQFGDALQPPFPCLE  127

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L ++VPGS  +  CPLLLIQVTR  CG
Sbjct  128  ELLFDVPGSGGVLNCPLLLIQVTRLMCG  155



>sp|Q8GT20.1|BEBT_TOBAC RecName: Full=Benzyl alcohol O-benzoyltransferase; AltName: Full=Benzoyl 
coenzyme A:benzyl alcohol benzoyl transferase [Nicotiana 
tabacum]
 gb|AAN09798.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Nicotiana 
tabacum]
Length=460

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   KPEL+ P  PTPRE K LSDIDDQ  LR+ +P + FY    SM  KDP KVIK
Sbjct  11   FTVR-RQKPELIAPAKPTPREIKFLSDIDDQEGLRFQIPVIQFYHKDSSMGRKDPVKVIK  69

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + +A+ LVF+YP AGRL EG  +KL+VDC GEG++FV A+A++ L   GD +  P P L+
Sbjct  70   KAIAETLVFYYPFAGRLREGNGRKLMVDCTGEGIMFVEADADVTLEQFGDELQPPFPCLE  129

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VP S  +  CPLLLIQVTR  CG
Sbjct  130  ELLYDVPDSAGVLNCPLLLIQVTRLRCG  157



>gb|ACT82248.1| alcohol acyltransferase [Vasconcellea cundinamarcensis]
Length=463

 Score =   153 bits (386),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 107/148 (72%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PEL+TP  PTPRE K LSDIDDQ  LR+ +P + FY+N  SM GK+PAK+IK
Sbjct  10   FNVR-RHEPELITPAKPTPREIKLLSDIDDQDGLRFQVPIIQFYKNNSSMQGKNPAKIIK  68

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
              LA+ LV +YPLAGRL EG  +KL+V+C GEG+LF+ A+A++ LH  GD +  P P L 
Sbjct  69   SALAETLVHYYPLAGRLREGFGRKLMVECTGEGILFIEADADVTLHEFGDDLPPPFPCLV  128

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS  I   PLLLIQVTR  CG
Sbjct  129  ELLYDVPGSSGIIDTPLLLIQVTRLKCG  156



>gb|AFK36385.1| unknown [Medicago truncatula]
Length=459

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+V+  + PE V P  PTP E K LSDIDDQ  LR+ +P + FY+   +M GKDP  +I+
Sbjct  7    FTVK-RSAPEFVRPSKPTPHEIKLLSDIDDQEGLRFQIPVIQFYKYDPNMAGKDPVDIIR  65

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            +  AK LVF+YP AGRL EGP +KL+VDC GEGVLF+ A+A+++L   GD +  P P L 
Sbjct  66   KASAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADADVSLKEFGDALQPPFPCLD  125

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L ++VPGS  +  CPLL+IQVTR  CG
Sbjct  126  ELLFDVPGSSEVLNCPLLVIQVTRLKCG  153



>gb|ACJ85557.1| unknown [Medicago truncatula]
Length=459

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+V+  + PE V P  PTP E K LSDIDDQ  LR+ +P + FY+   +M GKDP  +I+
Sbjct  7    FTVK-RSAPEFVRPSKPTPHEIKLLSDIDDQEGLRFQIPVIQFYKYDPNMAGKDPVDIIR  65

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            +  AK LVF+YP AGRL EGP +KL+VDC GEGVLF+ A+A+++L   GD +  P P L 
Sbjct  66   KASAKTLVFYYPFAGRLREGPGRKLMVDCTGEGVLFIEADADVSLKEFGDALQPPFPCLD  125

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L ++VPGS  +  CPLL+IQVTR  CG
Sbjct  126  ELLFDVPGSSEVLNCPLLVIQVTRLKCG  153



>ref|XP_002300497.2| hypothetical protein POPTR_0001s45180g [Populus trichocarpa]
 gb|EEE85302.2| hypothetical protein POPTR_0001s45180g [Populus trichocarpa]
Length=465

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P   TP E + LSDID Q  L++  PG   Y +  SM GKDP KVIK
Sbjct  9    FAVR-RCEPELVAPAKATPHEFRQLSDIDRQLYLQFQSPGYNLYAHNPSMQGKDPVKVIK  67

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E +A+ALV++YP AGR+ +GP+ KLIVDC GEGVLF+ A+A+  +   GD I SP P  +
Sbjct  68   EAIAQALVYYYPFAGRIRQGPDNKLIVDCTGEGVLFIEADADATVEQFGDPIPSPFPCFQ  127

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L YNVPGS  I   PLLL QVTR  CG
Sbjct  128  ELLYNVPGSEEILNTPLLLFQVTRLKCG  155



>gb|KDO36030.1| hypothetical protein CISIN_1g044203mg [Citrus sinensis]
Length=156

 Score =   145 bits (365),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 89/120 (74%), Gaps = 3/120 (3%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYEN--KESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPN  398
            LSDIDDQ  L + +P ++FY+N    SM GKDP KVIKE L++ALV++YP AGRL EG +
Sbjct  33   LSDIDDQQGLWFQVPLIFFYKNNPSPSMKGKDPVKVIKEALSRALVYYYPFAGRLREGSD  92

Query  399  KKLIVDCNGEGVLFVTAEANIALHNLG-DFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQ  575
             KL+VDCNGEGVLF  A+A+ +L  LG D I  PCPYL +L Y+VPGS    GCPLLLIQ
Sbjct  93   GKLMVDCNGEGVLFTEADADFSLDQLGDDEIKPPCPYLDELLYDVPGSEGTLGCPLLLIQ  152



>gb|ABX57719.1| acyltransferase [Vanda hybrid cultivar]
Length=447

 Score =   152 bits (384),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 106/148 (72%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            FSVR    P+LV P +PTPRE K LSDIDDQ  LR+ +P + FY ++ +M G++PA VI+
Sbjct  8    FSVR-RRPPQLVAPASPTPRELKRLSDIDDQEGLRFQIPVIQFYRHEPAMAGQNPASVIR  66

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + LA+ LVF+YP AGRL EG  KKL VDC GEGVLF+ AEA++ L + GD +H P P L+
Sbjct  67   DALARTLVFYYPFAGRLREGAGKKLFVDCTGEGVLFIEAEADVKLKDFGDALHPPFPCLE  126

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L ++V GS  +   PLLLIQVT  SCG
Sbjct  127  ELLFDVDGSSAVLNTPLLLIQVTLLSCG  154



>ref|XP_007147137.1| hypothetical protein PHAVU_006G098900g [Phaseolus vulgaris]
 gb|ESW19131.1| hypothetical protein PHAVU_006G098900g [Phaseolus vulgaris]
Length=478

 Score =   152 bits (385),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P RF+VR   +P+LV P  PTP E K LSDIDDQ  LRYH PG+  Y  + SM  KDPA+
Sbjct  7    PLRFTVR-RCQPQLVPPAIPTPHELKLLSDIDDQEGLRYHTPGIQIYGKQASMAEKDPAE  65

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VI++ L++ LVF+YPLAGR+ EGP++KL+VDC  EG +F+ A+A++ L   GD +  P P
Sbjct  66   VIRQALSQTLVFYYPLAGRVREGPHRKLVVDCTREGAMFIEADADVTLAEFGDSLQPPFP  125

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
               +L Y+VP S +IT  P +L+QVTR  CG
Sbjct  126  CFHELLYDVPDSQQITDTPPVLVQVTRLKCG  156



>ref|XP_010058385.1| PREDICTED: methanol O-anthraniloyltransferase-like [Eucalyptus 
grandis]
Length=397

 Score =   151 bits (381),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 105/142 (74%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGK-DPAKVIKEGLAKA  350
            KPEL++P   TPRE KPLSD+DDQ  LR+  P L+FY N   + G+ DPA+V+KE L KA
Sbjct  38   KPELISPSQATPRELKPLSDLDDQEGLRFQFPFLFFYPNNPPIRGREDPARVVKEALGKA  97

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGR+ +GPN+ L VDC GEG+LFV A+A+++L  LGD +  PC ++ ++  +V
Sbjct  98   LVYYYPLAGRIRKGPNRMLAVDCTGEGILFVEADADVSLEELGDSMRPPCGFVDEVLCDV  157

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
             GS  I GCPLLL+QVTR  CG
Sbjct  158  GGSGGIIGCPLLLVQVTRLKCG  179



>gb|KJB82514.1| hypothetical protein B456_013G200000 [Gossypium raimondii]
Length=450

 Score =   152 bits (383),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P +F+VR   +PELVTP  PTP E+K LSDIDDQASLR+ +  + FY+ + SM GKDP +
Sbjct  8    PLKFTVR-RCEPELVTPAKPTPYEQKLLSDIDDQASLRFQIRVINFYQYEPSMEGKDPVE  66

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VI+E LA+ LV +YP AGRL EG N KLIVDC GEGV+F+ A+A++ L   G+ +  P P
Sbjct  67   VIREALAQTLVCYYPFAGRLREGANGKLIVDCTGEGVMFIKADADVTLEQFGEPLRPPFP  126

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
               +L Y VPGS  +  CPLLLIQVTR  CG
Sbjct  127  CSDELLYIVPGSEGMLNCPLLLIQVTRLKCG  157



>dbj|BAF49304.1| putative acyltransferase [Clitoria ternatea]
Length=461

 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 96/139 (69%), Gaps = 0/139 (0%)
 Frame = +3

Query  180  ELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVF  359
            EL+ P  PTPRE K LSDIDDQ  LR+ +P + FY   E+M GKDP +VI++ LAK LVF
Sbjct  20   ELIAPAKPTPREVKLLSDIDDQEGLRFQIPVIQFYRYNETMAGKDPVEVIRKALAKTLVF  79

Query  360  FYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGS  539
            +YP AGRL EGP +KL+VDC GEGVLF+ A A++ L   GD +  P P L  L YN+P S
Sbjct  80   YYPFAGRLREGPGRKLMVDCTGEGVLFIEAHADVTLQQFGDSLQPPFPGLDHLLYNLPNS  139

Query  540  HRITGCPLLLIQVTRFSCG  596
              +   PLLLIQVTR  CG
Sbjct  140  DGVLNSPLLLIQVTRLKCG  158



>ref|XP_009386561.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Musa acuminata 
subsp. malaccensis]
Length=460

 Score =   152 bits (383),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 109/164 (66%), Gaps = 9/164 (5%)
 Frame = +3

Query  129  MACLFPPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVG  308
            MA   PP F+VR   +P LV P  PTP E K LSDIDDQ  LR H+P + FY N    + 
Sbjct  1    MAAPSPPTFTVR-RQEPVLVPPSEPTPHEFKRLSDIDDQDGLRTHIPVIQFYRNSVPSIS  59

Query  309  --------KDPAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIA  464
                    +DPAKVI+E L +ALV +YPLAGRL E P +KL+V+C GEGVLFV A+A+I+
Sbjct  60   TTGTGGGHRDPAKVIREALGRALVSYYPLAGRLREAPGRKLVVECTGEGVLFVEADADIS  119

Query  465  LHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            L   G+ +H P P+L +L ++VPGS  I  CPL+L+QVTR  CG
Sbjct  120  LEQFGEALHPPLPFLGELLHDVPGSGGILHCPLVLMQVTRLLCG  163



>gb|AAS79797.1| alcohol acyl transferase [Malus domestica]
Length=459

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = +3

Query  180  ELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGK-DPAKVIKEGLAKALV  356
            EL+TP  PT +E K LSDIDDQ  LR+ +P +  Y++  S+    +P KVI+E L++ALV
Sbjct  15   ELITPAKPTLQEAKFLSDIDDQEGLRFQVPVIMCYKDNPSLNKNCNPVKVIREALSRALV  74

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
            ++YPLAGRL EGPN+KL+VDCNGEG+LFV A A++ L  LGD I  PCP L++  +N PG
Sbjct  75   YYYPLAGRLKEGPNRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPG  134

Query  537  SHRITGCPLLLIQVTRFSCG  596
            S  I GCPLLL+QVT  +CG
Sbjct  135  SDGIIGCPLLLVQVTCLTCG  154



>ref|XP_010667734.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Beta vulgaris subsp. vulgaris]
Length=262

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 101/145 (70%), Gaps = 5/145 (3%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYEN----KESMVGK-DPAKVIKEGL  341
            PEL+TP   TP E K LS+IDDQ +LR+H+P + FY N    K ++VG+ DPA+VIKE +
Sbjct  21   PELITPAVSTPYEFKELSNIDDQEALRFHIPIILFYRNNNSSKSTVVGRQDPARVIKEAV  80

Query  342  AKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQ  521
            AKALV +YP AGRL E P +KL+V+CNGEG++F+ A+A++ L   GD I  P P  + L 
Sbjct  81   AKALVPYYPFAGRLREKPERKLVVECNGEGIIFIEADADVTLEEFGDIIQPPFPLKQLLF  140

Query  522  YNVPGSHRITGCPLLLIQVTRFSCG  596
            Y+VPGS      PLLL QVTR  CG
Sbjct  141  YDVPGSTAFLDTPLLLFQVTRLKCG  165



>ref|XP_009804829.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nicotiana sylvestris]
Length=460

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR    PEL+ P  PTPRE K LSDIDDQ  LR+ +P + FY    SM GKDP  +IK
Sbjct  11   FTVR-RQNPELIAPAKPTPRETKFLSDIDDQEGLRFQIPVIQFYSKNSSMEGKDPVNIIK  69

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + +A+ LVF+YP AGRL EG  +KL+VDC GEG++FV A+A++ L   GD +  P P L+
Sbjct  70   KAIAETLVFYYPFAGRLREGNGRKLMVDCTGEGIMFVEADADVTLEEFGDELQPPFPCLE  129

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VP S  +  CPLLLIQVTR  CG
Sbjct  130  ELLYDVPNSAGVLHCPLLLIQVTRLRCG  157



>ref|XP_008373476.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 104/142 (73%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKDPAKVIKEGLAKA  350
            +PEL+ P  PTPRE K LSDIDDQ  +R+ +P +  Y++  S+   ++P K I+E L++A
Sbjct  13   QPELIIPAKPTPRETKFLSDIDDQEGMRFQLPIIMCYKDNPSLNENRNPVKTIREALSRA  72

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGRL EGP++KL+VDCNGEG+LFV A AN+ L  LGD    PCP L++  +N 
Sbjct  73   LVYYYPLAGRLREGPDRKLMVDCNGEGILFVEASANVTLEQLGDKXLPPCPLLEEFLFNF  132

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
             GS  I GCPLLL+QVTR +CG
Sbjct  133  LGSDGIIGCPLLLVQVTRLTCG  154



>gb|AAR99826.1| alcohol acyl transferase [Malus domestica]
Length=470

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 104/140 (74%), Gaps = 1/140 (1%)
 Frame = +3

Query  180  ELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGK-DPAKVIKEGLAKALV  356
            EL+TP  PTP+E K LSDIDDQ  LR+ +P +  Y++  S+    +P KVI+E L++ALV
Sbjct  15   ELITPAKPTPQETKFLSDIDDQEGLRFQVPVIMCYKDNPSLNKNCNPVKVIREALSRALV  74

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
            ++YPLAGRL EGPN+KL+VDCNGEG+LFV A A++ L  LGD I  PCP L++  +N PG
Sbjct  75   YYYPLAGRLKEGPNRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPG  134

Query  537  SHRITGCPLLLIQVTRFSCG  596
            S  I GCPLLL+QVT  +CG
Sbjct  135  SDGIIGCPLLLVQVTCLTCG  154



>ref|XP_009803456.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X1 
[Nicotiana sylvestris]
Length=462

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   KPEL+ P+ PTPRE K LSDIDDQ  +R+ +P + FY    SM GKDP  VIK
Sbjct  11   FTVR-RQKPELIAPEKPTPRETKFLSDIDDQEGMRFQIPVIQFYSKNSSMEGKDPVNVIK  69

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + +A+ LVF+YP AGRL EG  +KL+VDC GEG++FV A+A++ L   GD +  P P L 
Sbjct  70   KAIAETLVFYYPFAGRLREGTGRKLMVDCTGEGIMFVEADADVTLEEFGDELQPPFPCLD  129

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L ++VP S  +  CPLLLIQVTR  CG
Sbjct  130  ELLFDVPHSAGVLNCPLLLIQVTRLICG  157



>ref|XP_009619718.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Nicotiana tomentosiformis]
Length=460

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   KPEL+ P  PTPRE K LSD DDQ  LR+ +P + FY    SM  KDP KVIK
Sbjct  11   FTVR-RQKPELIAPAKPTPRETKFLSDTDDQEGLRFQIPVIQFYHKDSSMGRKDPVKVIK  69

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + +A+ LVF+YP AGRL EG  +KL+VDC GEG++FV A+A++ L   GD +  P P L+
Sbjct  70   KAIAETLVFYYPFAGRLREGNGRKLMVDCTGEGIIFVEADADVTLEQFGDELQPPFPCLE  129

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VP S  +  CPLLLIQVTR  CG
Sbjct  130  ELLYDVPDSAGVLNCPLLLIQVTRLRCG  157



>ref|XP_008462818.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
melo]
Length=461

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 97/148 (66%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F VR   +PE V P  PTP E K LSDIDDQ   R+H+P L+FY N   M G DP KVIK
Sbjct  11   FEVR-RCQPEFVAPAKPTPYEFKQLSDIDDQECFRFHVPLLFFYANNPRMEGSDPVKVIK  69

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + +++ LVF+YP AGRL EGP KKL V+C  EG+LF+ A+AN+ L   GD +  P  +L 
Sbjct  70   KAISETLVFYYPFAGRLREGPGKKLFVECTAEGILFIEADANVDLQQFGDAVQPPFAFLD  129

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             + YNVP S  I   PLLL+QVTR  CG
Sbjct  130  DVLYNVPNSDGIINSPLLLVQVTRLRCG  157



>ref|XP_008355599.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=454

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 93/127 (73%), Gaps = 4/127 (3%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKD---PAKVIKEGLAKALVFFYPLAGRLTEGP  395
            LSDIDDQ  LR+  P L  Y+N   ++ KD   P KV+KE L+KALVF+YPLAGRL EGP
Sbjct  33   LSDIDDQEGLRFQTPVLMSYKNN-PLIPKDRTDPVKVLKEALSKALVFYYPLAGRLREGP  91

Query  396  NKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQ  575
            N+KL+V+C GEGVLF+ A+A++ L  LGD +  PCP+L++   + PGS  I GCPLLL+Q
Sbjct  92   NRKLMVECTGEGVLFIEADADVTLEQLGDALVPPCPFLEEFLCDAPGSDGILGCPLLLVQ  151

Query  576  VTRFSCG  596
            VTR  CG
Sbjct  152  VTRLKCG  158



>ref|XP_008362881.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=468

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 103/140 (74%), Gaps = 1/140 (1%)
 Frame = +3

Query  180  ELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGK-DPAKVIKEGLAKALV  356
            EL+TP  PT +E K LSDIDDQ  LR+ +P +  Y++  S+    +P KVI+E L++ALV
Sbjct  15   ELITPAKPTLQEAKFLSDIDDQEGLRFQVPVIMCYKDNPSLNKNCNPVKVIREALSRALV  74

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
            ++YPLAGRL EGPN+KL+VDCNGEG+LFV A A++ L  LGD I  PCP L++  +N PG
Sbjct  75   YYYPLAGRLKEGPNRKLMVDCNGEGILFVEASADVTLEQLGDKILPPCPLLEEFLFNFPG  134

Query  537  SHRITGCPLLLIQVTRFSCG  596
            S  I GCPLLL+QVT  +CG
Sbjct  135  SDGIIGCPLLLVQVTCLTCG  154



>ref|XP_011098396.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=460

 Score =   151 bits (381),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALV  356
            PEL+ P  PTP E KPLSDIDDQ SLR+ +P + FY    +M GKDP  VI++ +++ALV
Sbjct  16   PELIPPAKPTPHELKPLSDIDDQESLRFQVPAIQFYRRNPAMDGKDPVMVIRDAVSRALV  75

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
            F+YPLAGRL E   +KL+V+C GEGVLF+ A A++ L   GD +  P P L++L Y+VPG
Sbjct  76   FYYPLAGRLREAAGRKLVVECTGEGVLFIEAVADVTLQQFGDALLPPFPCLEELLYDVPG  135

Query  537  SHRITGCPLLLIQVTRFSCG  596
            S  +  CPLLLIQVTR  CG
Sbjct  136  SGGVVNCPLLLIQVTRLKCG  155



>ref|XP_011046335.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=452

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 89/124 (72%), Gaps = 0/124 (0%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKK  404
            LSDIDDQ  LR  +P + FY    SM  +DP KVIKE LAK LVF+YP AGRL EGP +K
Sbjct  33   LSDIDDQDGLRVQIPLILFYTYDPSMQRRDPVKVIKEALAKTLVFYYPFAGRLREGPKRK  92

Query  405  LIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTR  584
            L+V+C GEG+LF+ A+A++ L   GD ++ P P L++L ++VPGS  +  CPLLL+QVTR
Sbjct  93   LLVECTGEGILFIEADADVTLEQFGDALYPPIPCLEELLFDVPGSSGMINCPLLLVQVTR  152

Query  585  FSCG  596
              CG
Sbjct  153  LKCG  156



>emb|CDP09539.1| unnamed protein product [Coffea canephora]
Length=437

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 84/155 (54%), Positives = 105/155 (68%), Gaps = 7/155 (5%)
 Frame = +3

Query  153  FSVRLT-TKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENK------ESMVGK  311
             + R+T  KPELV P   TPRE K LSDIDDQ +LR  +P + FY N+      ES    
Sbjct  11   LTFRVTRQKPELVRPAKSTPRECKLLSDIDDQEALRIQIPFIQFYRNRDDPGINESRRRS  70

Query  312  DPAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIH  491
            DP KVI+E +AKALVF+YPLA RL EGP +KL+V+C GEGVLF+ A+A++ L   GD I 
Sbjct  71   DPVKVIREAIAKALVFYYPLAARLREGPGRKLMVECTGEGVLFIEADADVTLEQFGDAIQ  130

Query  492  SPCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             P P L++L Y+VP S  I  CP++LIQVTR  CG
Sbjct  131  PPFPCLEELLYDVPHSGGILHCPIVLIQVTRLRCG  165



>gb|AES82602.2| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=153

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/141 (53%), Positives = 103/141 (73%), Gaps = 1/141 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P  PTPRE K LSDIDDQ  LR++MP ++ Y ++ SM+ KDPAKV+K
Sbjct  8    FTVR-RCQPELVPPAAPTPREVKLLSDIDDQECLRFNMPIIFIYRHEPSMIEKDPAKVLK  66

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
              L++ LV++YPLAGR+ EG   KL+VDC GEGV+F+ AE ++ L   GD +H P P  +
Sbjct  67   RALSQTLVYYYPLAGRIREGARDKLMVDCTGEGVMFIEAETDVTLDEFGDALHPPFPCFQ  126

Query  513  KLQYNVPGSHRITGCPLLLIQ  575
            +L Y+VPG+++I   P+LLIQ
Sbjct  127  ELIYDVPGTNQIIDHPILLIQ  147



>ref|XP_006370914.1| hypothetical protein POPTR_0019s01690g [Populus trichocarpa]
 gb|ERP48711.1| hypothetical protein POPTR_0019s01690g [Populus trichocarpa]
Length=451

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKK  404
            LSDIDDQ  LR H+P + FY    SM  +DP +VIKE LAK LVF+YP AGRL EGP +K
Sbjct  33   LSDIDDQDGLRVHIPLILFYPYDHSMQRRDPVQVIKEALAKTLVFYYPFAGRLREGPKRK  92

Query  405  LIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTR  584
            L+V+C GEG+LF+ A A++ L   GD +  P P L++L ++VPGS  +  CPLLLIQVTR
Sbjct  93   LLVECTGEGILFIEANADVTLEQFGDALWPPIPCLEELLFDVPGSSGMINCPLLLIQVTR  152

Query  585  FSCG  596
              CG
Sbjct  153  LKCG  156



>ref|XP_011046333.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=452

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKK  404
            LSDIDDQ  LR  +P ++FY    SM  +DP +VIK+ LAK LVF+YP AGRL EGP +K
Sbjct  33   LSDIDDQDGLRVQIPLIYFYPYDPSMQRRDPVEVIKKALAKTLVFYYPFAGRLREGPKRK  92

Query  405  LIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTR  584
            L+V+C GEG+LF+ A+A++ L   GD ++ P P L++L Y+VPGS  +  CPLLLIQVTR
Sbjct  93   LLVECTGEGILFIEADADVTLEQFGDELYPPIPCLEELLYDVPGSSGMINCPLLLIQVTR  152

Query  585  FSCG  596
              CG
Sbjct  153  LKCG  156



>ref|XP_008373466.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=460

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 100/142 (70%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKDPAKVIKEGLAKA  350
            +PEL+ P   TP E K LSDIDDQ  LR+ +P +  Y++  S+   ++P KVI+E L++A
Sbjct  13   QPELIXPXKSTPXETKFLSDIDDQEGLRFQLPVIMCYKDNPSLNENRNPIKVIREALSRA  72

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGRL EGPN  L+VDCNGEG+LFV A  ++ L  LGD I  PCP L++  +N 
Sbjct  73   LVYYYPLAGRLXEGPNXMLMVDCNGEGILFVEASXDVTLEQLGDKILPPCPLLEEFLFNF  132

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            P S  I GCPLLL+QVTR  CG
Sbjct  133  PXSDGIIGCPLLLVQVTRLXCG  154



>ref|XP_002524018.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
 gb|EEF38386.1| 3'-N-debenzoyl-2'-deoxytaxol N-benzoyltransferase, putative [Ricinus 
communis]
Length=455

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 108/154 (70%), Gaps = 3/154 (2%)
 Frame = +3

Query  144  PPRFSVRLTT---KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKD  314
            PP  S+R      +PEL+ P  PTP E KPLSDIDDQ  LR+H+P +  Y++  SM GKD
Sbjct  3    PPTSSIRFQVHRREPELIVPAKPTPYEFKPLSDIDDQEGLRFHIPVVQIYKHDPSMQGKD  62

Query  315  PAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHS  494
            P KVIKE LAKALVF+YP AGRL E PN+KL+V+C  EGVLF+ A+A++ L    D +  
Sbjct  63   PVKVIKEALAKALVFYYPFAGRLREWPNRKLVVECTSEGVLFIEADADVTLEQCRDALQP  122

Query  495  PCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            P P L +L ++VPGS  +  CPLLLIQVTRF CG
Sbjct  123  PLPLLDELLFDVPGSSGVINCPLLLIQVTRFKCG  156



>ref|XP_008368021.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=455

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 101/140 (72%), Gaps = 1/140 (1%)
 Frame = +3

Query  180  ELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGK-DPAKVIKEGLAKALV  356
            EL+TP  PT +E K LSDIDDQ  LR+ +P +  Y++  S+    +P KVI+E L++ALV
Sbjct  15   ELITPAKPTXQETKFLSDIDDQEGLRFQVPVIMCYKDNPSLNKNCNPVKVIREALSRALV  74

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
            ++YPLAGRL EGPN KL VDCNGEG+LFV A A++ L  LGD I  PCP L++  +N PG
Sbjct  75   YYYPLAGRLKEGPNXKLXVDCNGEGILFVEASADVTLEQLGDXILPPCPLLEEFLFNFPG  134

Query  537  SHRITGCPLLLIQVTRFSCG  596
            S  I GCPLLL+QVT  +CG
Sbjct  135  SDGIIGCPLLLVQVTCLTCG  154



>ref|XP_010933015.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Elaeis guineensis]
Length=160

 Score =   143 bits (360),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 97/142 (68%), Gaps = 1/142 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F VR   +P LV P  PTP E K LSDIDDQ  LR+ +P + FY N  SM G+DPA+VI+
Sbjct  7    FKVR-RHEPVLVAPAEPTPHEFKRLSDIDDQEGLRFQIPVIQFYRNDPSMAGRDPARVIR  65

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E LAK LV +YP AGRL EG  +KL+V+C GEGVLF+ A+A++ L   GD +  P P L+
Sbjct  66   EALAKTLVHYYPFAGRLREGARRKLVVECTGEGVLFIEADADVRLEQFGDALQPPFPCLE  125

Query  513  KLQYNVPGSHRITGCPLLLIQV  578
            +L YNV GS  +   PLLLIQV
Sbjct  126  ELLYNVEGSGEVLNAPLLLIQV  147



>ref|XP_009365780.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=461

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 104/141 (74%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PELVTP +PTP E+K LS+ID+Q +LR  +P +W Y +  S    DP +VI++ L+++L
Sbjct  16   EPELVTPASPTPCEQKILSEIDNQEALRCQVPFIWSYTSNPSSKEIDPVQVIRDALSRSL  75

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            V++YPLAGR+ +GPNKKL+VDCNGEGVLF  A+A+  L  LGD +  PCP L+   Y+VP
Sbjct  76   VYYYPLAGRVRKGPNKKLMVDCNGEGVLFREADADFTLEQLGDTLQPPCPLLEDFLYDVP  135

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            G+  I G PLL++QVTR  CG
Sbjct  136  GTSDIVGTPLLIVQVTRLKCG  156



>ref|XP_006588255.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Glycine 
max]
Length=304

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 102/153 (67%), Gaps = 6/153 (4%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR    PELV P  PTPRE K LS IDDQ  LRY +P + FY  + +M GKDP +VI+
Sbjct  86   FTVR-RNPPELVAPANPTPRELKLLSGIDDQHGLRYQLPFVQFYRYQPAMAGKDPVQVIR  144

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + LAK LVF+Y  AGRL EGPN KL VDC+ EGVLF+ A+A++A+   GD    P P+  
Sbjct  145  KALAKTLVFYYRFAGRLREGPNGKLTVDCDEEGVLFIEADADVAIEQFGDNFMPPFPFFD  204

Query  513  KLQYNVPGSHRITGCPLLLI-----QVTRFSCG  596
            ++ YNVPGS  I  CPL+LI     QVTR  CG
Sbjct  205  EILYNVPGSDGIIECPLVLIQVISRQVTRLKCG  237



>ref|XP_003549135.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Glycine 
max]
 gb|KHN31562.1| 13-hydroxylupanine O-tigloyltransferase [Glycine soja]
Length=455

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 98/140 (70%), Gaps = 0/140 (0%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALV  356
            PELV P  PTP E K LSDIDDQ  LRY +P + F+  + SM GKDP +VI+E L+K LV
Sbjct  17   PELVAPANPTPHEVKLLSDIDDQNGLRYQLPLVLFFPYQPSMEGKDPVEVIREALSKTLV  76

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
            F+YP AGRL EGP+ KL+VDCNGEGV+F+ A+A++ +   G+    P P   +L YNVPG
Sbjct  77   FYYPFAGRLREGPDGKLMVDCNGEGVMFIEADADVTIEQFGNNFMPPFPCFDELLYNVPG  136

Query  537  SHRITGCPLLLIQVTRFSCG  596
            S  +   PLLLIQVTR  CG
Sbjct  137  SDGMIDTPLLLIQVTRLKCG  156



>ref|XP_008364483.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Malus domestica]
Length=437

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 93/125 (74%), Gaps = 1/125 (1%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESM-VGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNK  401
            LSDIDDQ  LR+ +P +  Y++  S+   ++P KVI+E L++ALV++YPLAGRL EGPN+
Sbjct  8    LSDIDDQEGLRFQVPIIMCYKDNPSLNKNRNPVKVIREALSRALVYYYPLAGRLREGPNR  67

Query  402  KLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVT  581
            KL+VDCNGEG+LFV A AN+ L  LGD I  PCP L++  +N P S+ I GCPLLL+QVT
Sbjct  68   KLMVDCNGEGILFVEAFANVTLEQLGDKILPPCPLLEEFLFNFPSSNGIIGCPLLLVQVT  127

Query  582  RFSCG  596
               CG
Sbjct  128  CLICG  132



>ref|XP_003518844.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Glycine max]
Length=459

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 103/148 (70%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR  ++ EL+ P  PTPRE K LSDIDDQ  LR+ +P + FY +  SM GKDP  VI+
Sbjct  7    FTVR-RSEAELIAPAKPTPREVKLLSDIDDQDGLRFQIPVIQFYRHDPSMAGKDPVDVIR  65

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + +AK LVF+YP AGRL EG  +KL+VDC GEGVLF+ A+A++ L   GD +  P P  +
Sbjct  66   KAVAKTLVFYYPFAGRLREGLGRKLMVDCTGEGVLFIEADADVTLKQFGDALQPPFPCWE  125

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS  +   PLLLIQVTR  CG
Sbjct  126  ELLYDVPGSQGVLNTPLLLIQVTRLKCG  153



>ref|XP_006370717.1| hypothetical protein POPTR_0001s45150g, partial [Populus trichocarpa]
 gb|ERP67286.1| hypothetical protein POPTR_0001s45150g, partial [Populus trichocarpa]
Length=334

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P   TP E + LSDID Q  L++  P    Y +  SM GKDP KVIK
Sbjct  9    FAVR-RCEPELVAPAKATPHEFRQLSDIDRQLYLQFQSPHYNLYAHNPSMQGKDPVKVIK  67

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E +A+ALV++YP AGR+ +GP+ KLIVDC GEGVLF+ A+A+  +   GD I SP P  +
Sbjct  68   EAIAQALVYYYPFAGRIRQGPDNKLIVDCTGEGVLFIEADADATVEQFGDPIPSPFPCFQ  127

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L YNVPGS  I   PLL+ QVTR  CG
Sbjct  128  ELLYNVPGSEGILNTPLLIFQVTRLKCG  155



>ref|XP_006370913.1| hypothetical protein POPTR_0019s01680g [Populus trichocarpa]
 gb|ERP48710.1| hypothetical protein POPTR_0019s01680g [Populus trichocarpa]
Length=452

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 90/124 (73%), Gaps = 0/124 (0%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKK  404
            LSDIDDQ  LR  +P ++FY    SM  +DP +VIKE LAK LVF+YP AGRL EGP +K
Sbjct  33   LSDIDDQDGLRVQIPLIYFYPYDPSMQRRDPVEVIKEALAKTLVFYYPFAGRLREGPKRK  92

Query  405  LIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTR  584
            L+V+C GEG+LF+ A+A++ L   G+ ++ P P L++L ++VPGS  +  CPLLLIQVTR
Sbjct  93   LLVECTGEGILFIEADADVTLEQFGNALYPPIPCLEELLFDVPGSSGMINCPLLLIQVTR  152

Query  585  FSCG  596
              CG
Sbjct  153  LKCG  156



>dbj|BAJ92444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   149 bits (377),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 81/149 (54%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  RFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVI  329
            RF+V      ELVTP  PTPRE K LSDIDDQ  LR+H+P + FY    SM G+DPA V+
Sbjct  28   RFTVSRKAA-ELVTPAGPTPRELKRLSDIDDQDGLRFHIPVIQFYRRDASMGGRDPAAVV  86

Query  330  KEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYL  509
            ++ +A+ALV +YP AGRL E   +KL VDC GEGVLF+ A+AN+ L + GD +  P P L
Sbjct  87   RDAVARALVHYYPFAGRLRELEGRKLAVDCTGEGVLFIEADANVRLEHFGDALQPPFPGL  146

Query  510  KKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            ++L ++VPGS  + G PLLL QVTR +CG
Sbjct  147  EELVFDVPGSSEVLGTPLLLFQVTRLACG  175



>gb|AFK34239.1| unknown [Medicago truncatula]
Length=445

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  F+VR  ++PELV P  PTPRE K LSDIDDQ  LR+++P ++ Y ++ SM  KDP K
Sbjct  5    PLLFTVR-RSQPELVPPAAPTPREVKLLSDIDDQEGLRFNIPMMFIYRHEPSMKEKDPVK  63

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            V++  L++ALV++YP AGR+ EG  +KL+VDC GEGV+FV AEA++ L   GD +H P P
Sbjct  64   VLRHALSQALVYYYPFAGRIREGAGRKLMVDCTGEGVMFVEAEADVTLDEFGDALHPPLP  123

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              ++L Y+VPGS  I   P+ LIQVTR  CG
Sbjct  124  CFEELLYDVPGSELIIDRPIRLIQVTRLKCG  154



>gb|ABR16595.1| unknown [Picea sitchensis]
Length=448

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 104/146 (71%), Gaps = 2/146 (1%)
 Frame = +3

Query  162  RLTTKPE-LVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEG  338
            ++T KP  LV P  PTP+E   LS+IDDQA LR+H+P + FY+   S  G+DPA+VI+EG
Sbjct  7    KVTRKPAVLVAPSRPTPKEFLYLSNIDDQAGLRFHIPVVQFYQFDPSKKGEDPARVIREG  66

Query  339  LAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKL  518
            LAKALVF+YP AGRL + P  KL+VDC GEGVLFV A+A++AL   GD +  P P  + L
Sbjct  67   LAKALVFYYPFAGRLRDAPAGKLVVDCTGEGVLFVEADADVALEEFGD-LQPPFPCWEDL  125

Query  519  QYNVPGSHRITGCPLLLIQVTRFSCG  596
             ++VP S  +T  PLLLIQVTR  CG
Sbjct  126  LHDVPASLTLTNSPLLLIQVTRLRCG  151



>gb|ABR16407.1| unknown [Picea sitchensis]
Length=448

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/146 (56%), Positives = 104/146 (71%), Gaps = 2/146 (1%)
 Frame = +3

Query  162  RLTTKPE-LVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEG  338
            ++T KP  LV P  PTP+E   LS+IDDQA LR+H+P + FY+   S  G+DPA+VI+EG
Sbjct  7    KVTRKPAVLVAPSRPTPKEFLYLSNIDDQAGLRFHIPVVQFYQFDPSKKGEDPARVIREG  66

Query  339  LAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKL  518
            LAKALVF+YP AGRL + P  KL+VDC GEGVLFV A+A++AL   GD +  P P  + L
Sbjct  67   LAKALVFYYPFAGRLRDAPAGKLVVDCTGEGVLFVEADADVALEEFGD-LQPPFPCWEDL  125

Query  519  QYNVPGSHRITGCPLLLIQVTRFSCG  596
             ++VP S  +T  PLLLIQVTR  CG
Sbjct  126  LHDVPASLTLTNSPLLLIQVTRLRCG  151



>ref|XP_007029776.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
 gb|EOY10278.1| Benzoyl coenzyme A: Benzyl alcohol benzoyl transferase [Theobroma 
cacao]
Length=540

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 102/148 (69%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F VR   +PELV P  PTPRE KPLSDIDD+   R+  P + FY    SM G+DPA+VI+
Sbjct  106  FKVR-RCEPELVVPAKPTPREYKPLSDIDDREGHRFEYPVIQFYRYSPSMQGRDPARVIR  164

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + LAK LVF+YP AGRL EGPN+KL VDC GEGVLF   +A++ L   G+ +  P P ++
Sbjct  165  DALAKTLVFYYPYAGRLREGPNRKLTVDCTGEGVLFSEGDADVTLEQFGEELQPPFPCME  224

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPG   +  CPLLLIQVTR  CG
Sbjct  225  ELLYDVPGYGGVLNCPLLLIQVTRLKCG  252



>ref|XP_004151857.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cucumis 
sativus]
 gb|KGN63330.1| hypothetical protein Csa_2G429030 [Cucumis sativus]
Length=461

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 97/148 (66%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F VR   +PELV P  PTP E K LSDIDDQ + R+ +P L+ Y +   M G DP KVIK
Sbjct  11   FQVR-RCEPELVAPAKPTPYEFKQLSDIDDQEAFRFQVPLLFLYAHNPRMEGSDPVKVIK  69

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + ++  LVF+YP AGRL EGP KKL V+C  EG+LF+ A+AN+AL   GD +  P  +L 
Sbjct  70   KAISDTLVFYYPFAGRLREGPGKKLFVECTAEGILFIEADANVALQQFGDAVQPPFAFLD  129

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             + YNVP S  I   PLLL+QVTR  CG
Sbjct  130  DVLYNVPSSDGIINSPLLLVQVTRLRCG  157



>ref|XP_006600094.1| PREDICTED: 13-hydroxylupanine O-tigloyltransferase-like [Glycine 
max]
 gb|KHN24394.1| 13-hydroxylupanine O-tigloyltransferase [Glycine soja]
Length=158

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 95/134 (71%), Gaps = 0/134 (0%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALV  356
            PELV P  PTPRE K LSDIDDQ  LRY +P + F+  + SM GKDP +VI+E L+K LV
Sbjct  17   PELVAPANPTPREVKLLSDIDDQNGLRYQLPLVLFFPYQPSMEGKDPVEVIREALSKTLV  76

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
            F+YP AGRL EGP+ KL+VDCNGEGV+F+ A+A++ +   G+    P P   +L YNVPG
Sbjct  77   FYYPFAGRLREGPDGKLMVDCNGEGVMFIEADADVTIEQFGNNFMPPFPCFDELLYNVPG  136

Query  537  SHRITGCPLLLIQV  578
            S  +   PLLLIQV
Sbjct  137  SDGMIDTPLLLIQV  150



>ref|XP_011041078.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X2 
[Populus euphratica]
Length=463

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P   TP E + LSDID Q  L++  P    Y +  SM GKDP KVIK
Sbjct  7    FAVR-RREPELVAPAKATPHEFRQLSDIDRQLYLQFQSPHYNLYAHNPSMQGKDPVKVIK  65

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E +A+ALV++YP AGR+ +GP+ KLIVDC GEGVLF+ A+A+  +   GD I SP P  +
Sbjct  66   EAIAQALVYYYPFAGRIRQGPDNKLIVDCTGEGVLFIEADADATVEQFGDPIPSPFPCFQ  125

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L YNVPGS  I   PLLL QVTR  CG
Sbjct  126  ELLYNVPGSDGILNTPLLLFQVTRLKCG  153



>gb|KDP39569.1| hypothetical protein JCGZ_02589 [Jatropha curcas]
Length=347

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 104/143 (73%), Gaps = 1/143 (1%)
 Frame = +3

Query  147  PRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKV  326
            P F V+   +PEL+TP  PTP E KPLSDIDDQ  LR  +P +  Y +  SM GKDP +V
Sbjct  6    PIFKVQ-RCEPELITPPKPTPHEFKPLSDIDDQEGLRIQIPFIQIYRHDPSMEGKDPVQV  64

Query  327  IKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPY  506
            I+  +AKALVF+YP AGRL EGPN+KLI++CNGEGVLF+ A+AN++L   GD +  P P+
Sbjct  65   IRNAIAKALVFYYPFAGRLREGPNRKLIMECNGEGVLFIEADANVSLDQSGDALQPPFPF  124

Query  507  LKKLQYNVPGSHRITGCPLLLIQ  575
            L +L ++VPGS  I  CP++LIQ
Sbjct  125  LDELLFDVPGSSGILHCPVILIQ  147



>ref|XP_003626384.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
Length=196

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 105/145 (72%), Gaps = 1/145 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  F+VR   +PELV P  PTPRE K LSDIDDQ  LR++MP ++ Y ++ SM+ KDPAK
Sbjct  5    PLLFTVR-RCQPELVPPAAPTPREVKLLSDIDDQECLRFNMPIIFIYRHEPSMIEKDPAK  63

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            V+K  L++ LV++YPLAGR+ EG   KL+VDC GEGV+F+ AE ++ L   GD +H P P
Sbjct  64   VLKRALSQTLVYYYPLAGRIREGARDKLMVDCTGEGVMFIEAETDVTLDEFGDALHPPFP  123

Query  504  YLKKLQYNVPGSHRITGCPLLLIQV  578
              ++L Y+VPG+++I   P+LLIQ+
Sbjct  124  CFQELIYDVPGTNQIIDHPILLIQM  148



>gb|AES82601.2| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=502

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  F+VR  ++PELV P  PTPRE K LSDIDDQ  LR+++P ++ Y ++ SM  KDP K
Sbjct  5    PLLFTVR-RSQPELVPPAAPTPREVKLLSDIDDQEGLRFNIPMMFIYRHEPSMKEKDPVK  63

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            V++  L++ALV++YP AGR+ EG  +KL+VDC GEGV+FV AEA++ L   GD +H P P
Sbjct  64   VLRHALSQALVYYYPFAGRIREGAGRKLMVDCTGEGVMFVEAEADVTLDEFGDALHPPLP  123

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              ++L Y+VPGS  I   P+ LIQVTR  CG
Sbjct  124  CFEELLYDVPGSELIIDRPIRLIQVTRLKCG  154



>ref|XP_003626388.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
 gb|AES82606.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=459

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P  PTPRE K LSDIDDQ  +R++ P ++ Y +K SMV KDP KV++
Sbjct  8    FTVR-RCQPELVPPAAPTPREVKLLSDIDDQEGMRFNSPVIFIYRHKPSMVEKDPLKVLR  66

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
              L++ LV++YPLAGR+ EG  +KL+VDC GEGV+F+ AEA++ L   GD +H P P  +
Sbjct  67   HALSRTLVYYYPLAGRIREGAGRKLMVDCTGEGVMFIEAEADVTLDQFGDALHPPFPCFQ  126

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS +I   P+  IQVTR  CG
Sbjct  127  QLLYDVPGSTQIIDRPIRQIQVTRLKCG  154



>ref|XP_003626383.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
Length=510

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/151 (53%), Positives = 107/151 (71%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  F+VR  ++PELV P  PTPRE K LSDIDDQ  LR+++P ++ Y ++ SM  KDP K
Sbjct  5    PLLFTVR-RSQPELVPPAAPTPREVKLLSDIDDQEGLRFNIPMMFIYRHEPSMKEKDPVK  63

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            V++  L++ALV++YP AGR+ EG  +KL+VDC GEGV+FV AEA++ L   GD +H P P
Sbjct  64   VLRHALSQALVYYYPFAGRIREGAGRKLMVDCTGEGVMFVEAEADVTLDEFGDALHPPLP  123

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              ++L Y+VPGS  I   P+ LIQVTR  CG
Sbjct  124  CFEELLYDVPGSELIIDRPIRLIQVTRLKCG  154



>ref|XP_002298956.2| hypothetical protein POPTR_0001s45160g [Populus trichocarpa]
 gb|EEE83761.2| hypothetical protein POPTR_0001s45160g [Populus trichocarpa]
Length=465

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PEL+ P   TP E + LSDID Q  L++  P    Y +  SM GKDP KVIK
Sbjct  9    FAVR-RCEPELIAPAKATPHEFRQLSDIDRQLYLQFQSPHYNLYAHNPSMQGKDPVKVIK  67

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E +A+ALV++YP AGR+ +GP+ KLIVDC GEGVLF+ A+A+  +   GD I SP P  +
Sbjct  68   EAIAQALVYYYPFAGRIRQGPDNKLIVDCTGEGVLFIEADADATVEQFGDPIPSPFPCFQ  127

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L YNVPGS  I   PLLL QVTR  CG
Sbjct  128  ELLYNVPGSEGILNTPLLLFQVTRLKCG  155



>gb|KJB82513.1| hypothetical protein B456_013G199900 [Gossypium raimondii]
Length=461

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 104/151 (69%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P +F VR   +PELV P  PTP E+K L DIDDQASLR+ +  + FY+ + SM GKDPA+
Sbjct  8    PLKFIVR-RCEPELVAPAKPTPYEQKLLLDIDDQASLRFQVRVINFYQYEPSMEGKDPAE  66

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VI+E LA+ LV +YP AGRL EG N KLIVDC  EGV+F+ A+A++ L   G+ +  P P
Sbjct  67   VIREALAQTLVCYYPFAGRLREGANGKLIVDCTSEGVMFIKADADVTLEQFGEPLRPPFP  126

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
               +L YNVP S  +  CPLLLIQVTR  CG
Sbjct  127  CSDELLYNVPDSEGMLNCPLLLIQVTRLKCG  157



>ref|XP_003574156.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Brachypodium 
distachyon]
Length=463

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  RFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVI  329
            RF+VR     ELV P  PTPRE K LSDIDDQ  LR+H+P + FY  + SM G++PA V+
Sbjct  9    RFTVRRKAA-ELVAPAGPTPRELKRLSDIDDQDGLRFHIPVIQFYRRQASMAGRNPAAVV  67

Query  330  KEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYL  509
            +E +++ALV +YP AGRL E   +KL VDC GEGVLF  A+A++ L + GD +  P P L
Sbjct  68   REAVSRALVPYYPFAGRLRELEARKLAVDCTGEGVLFTEADADVRLEHFGDALQPPFPGL  127

Query  510  KKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             +L ++VPGS ++ G PLLL QVTR +CG
Sbjct  128  DELIFDVPGSSQVLGTPLLLFQVTRLACG  156



>ref|XP_011623977.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Amborella trichopoda]
Length=460

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            FSV ++ +P LVTP  PTP E KPLSDIDDQ   R+ +P + FY     M G+DPA+V++
Sbjct  8    FSVTVS-EPVLVTPSRPTPYEIKPLSDIDDQEGFRFQIPVVQFYRKDPQMDGRDPARVVR  66

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + L++ALV++YP AGRL EG N+KL V+C+GEGVLFV  +A+++L   GD +  P P  +
Sbjct  67   DALSEALVYYYPFAGRLREGENRKLSVECSGEGVLFVEGDADVSLEEFGDALQPPFPCWE  126

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            KL  +VPGS  + GCPLL IQVTR  CG
Sbjct  127  KLLIHVPGSDGVIGCPLLFIQVTRLRCG  154



>gb|KEH40971.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=461

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKK  404
            LSDIDDQ  LRY    + FY+   +M GKDP  +I++ LAK LVF+YP AGRL EGP++K
Sbjct  30   LSDIDDQEGLRYQTRLIQFYKYDPNMAGKDPVDIIRKALAKTLVFYYPFAGRLREGPSRK  89

Query  405  LIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTR  584
            L+VDCN EG+LF+ A+A++ L   G+ +H P P + +L Y+VPGS  +   PLLLIQVTR
Sbjct  90   LMVDCNDEGILFIEADADVTLEQFGEDLHPPFPCIDELLYDVPGSSVVLNTPLLLIQVTR  149

Query  585  FSCG  596
              CG
Sbjct  150  LKCG  153



>ref|XP_003536235.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Glycine 
max]
Length=454

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 105/149 (70%), Gaps = 2/149 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PEL+ P  PTPRE K LSDIDDQ  LR+ +P +  Y +  SM GKDP +VI+
Sbjct  7    FTVR-RREPELIAPAKPTPREVKLLSDIDDQDGLRFQIPVIQIYRHDPSMAGKDPVEVIR  65

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGE-GVLFVTAEANIALHNLGDFIHSPCPYL  509
            + LA+ LVF+YP AGRL EG ++KL+VDC GE GVLF+ A+A++ L + GD +  P P  
Sbjct  66   KALARTLVFYYPFAGRLREGRDRKLMVDCTGELGVLFIEADADVTLKHFGDALQPPFPCW  125

Query  510  KKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            ++L Y+VPGS  +   PLLLIQVTR  CG
Sbjct  126  EELLYDVPGSQGVLNTPLLLIQVTRLKCG  154



>ref|XP_008344828.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=188

 Score =   141 bits (355),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 88/120 (73%), Gaps = 4/120 (3%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKD---PAKVIKEGLAKALVFFYPLAGRLTEGP  395
            LSDIDDQ  LR+  P L  Y+N   ++ KD   P KV+KE L+KALVF+YPLAGRL EGP
Sbjct  33   LSDIDDQEGLRFQTPVLMSYKNN-PLIPKDRTDPVKVLKEALSKALVFYYPLAGRLREGP  91

Query  396  NKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQ  575
            N+KL+V+C GEGVLF+ A+A++ L  LGD +  PCP+L++   + PGS  I GCPLLL+Q
Sbjct  92   NRKLMVECTGEGVLFIEADADVTLEQLGDALVPPCPFLEEFLCDAPGSDGILGCPLLLVQ  151



>gb|ERM94783.1| hypothetical protein AMTR_s00011p00264170 [Amborella trichopoda]
Length=476

 Score =   147 bits (372),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            FSV ++ +P LVTP  PTP E KPLSDIDDQ   R+ +P + FY     M G+DPA+V++
Sbjct  8    FSVTVS-EPVLVTPSRPTPYEIKPLSDIDDQEGFRFQIPVVQFYRKDPQMDGRDPARVVR  66

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + L++ALV++YP AGRL EG N+KL V+C+GEGVLFV  +A+++L   GD +  P P  +
Sbjct  67   DALSEALVYYYPFAGRLREGENRKLSVECSGEGVLFVEGDADVSLEEFGDALQPPFPCWE  126

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            KL  +VPGS  + GCPLL IQVTR  CG
Sbjct  127  KLLIHVPGSDGVIGCPLLFIQVTRLRCG  154



>sp|Q5H873.1|HLTT_LUPAL RecName: Full=13-hydroxylupanine O-tigloyltransferase; AltName: 
Full=(-)-13alpha-hydroxymultiflorine/(+)-13alpha-hydroxylupanine 
O-tigloyltransferase; Short=HMT/HLTase; AltName: Full=Quinolizidine 
alkaloid O-tigloyltransferase [Lupinus albus]
 dbj|BAD89275.1| (-)-13alpha-hydroxymultiflorine/(+)-13alpha- hydroxylupanine 
O-tigloyltransferase [Lupinus albus]
Length=453

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F VR   + ELVTP  PTP+E K LSDIDDQ SLR   P +  Y N  SM GKDP ++I+
Sbjct  10   FKVRRNPQ-ELVTPAKPTPKEFKLLSDIDDQTSLRSLTPLVTIYRNNPSMEGKDPVEIIR  68

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E L+K LVF+YP AGRL  GPN KL+VDC GEGV+F+ A+A++ L   G  +H P P   
Sbjct  69   EALSKTLVFYYPFAGRLRNGPNGKLMVDCTGEGVIFIEADADVTLDQFGIDLHPPFPCFD  128

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS  I   PLLLIQVTR  CG
Sbjct  129  QLLYDVPGSDGILDSPLLLIQVTRLKCG  156



>gb|KEH40976.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=417

 Score =   146 bits (369),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 95/140 (68%), Gaps = 0/140 (0%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALV  356
            PE V P  PTP E K LSDIDDQ  LRY MP + FY     M  KDP  VI++ LAK LV
Sbjct  14   PEFVRPSKPTPHEIKLLSDIDDQEGLRYQMPVIQFYNYVPVMAEKDPVDVIRKALAKTLV  73

Query  357  FFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPG  536
            F+YP AGRL EGP +KL+VDC GEGVLF+ A+A++ + +LGD +H P   L +L Y+V G
Sbjct  74   FYYPFAGRLREGPGRKLMVDCTGEGVLFIEADADVTIKDLGDTLHPPFRCLDELLYDVLG  133

Query  537  SHRITGCPLLLIQVTRFSCG  596
            S  +   PLLLIQVTR  CG
Sbjct  134  SSDVLNTPLLLIQVTRLKCG  153



>ref|XP_011041077.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X1 
[Populus euphratica]
Length=467

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P   TP E + LSDID Q  L++  P    Y +  SM GKDP KVIK
Sbjct  7    FAVR-RREPELVAPAKATPHEFRQLSDIDRQLYLQFQSPHYNLYAHNPSMQGKDPVKVIK  65

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E +A+ALV++YP AGR+ +GP+ KLIVDC GEGVLF+ A+A+  +   GD I SP P  +
Sbjct  66   EAIAQALVYYYPFAGRIRQGPDNKLIVDCTGEGVLFIEADADATVEQFGDPIPSPFPCFQ  125

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L YNVPGS  I   PLLL Q+TR  CG
Sbjct  126  ELLYNVPGSDGILNTPLLLFQITRLKCG  153



>ref|XP_009374321.1| PREDICTED: methanol O-anthraniloyltransferase-like [Pyrus x bretschneideri]
Length=454

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 100/143 (70%), Gaps = 4/143 (3%)
 Frame = +3

Query  177  PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKD---PAKVIKEGLAK  347
            P+LV P  PTP E K LSDIDDQ  LR+  P L  Y+N   ++ KD   P KV+KE L+K
Sbjct  17   PQLVKPAKPTPHETKLLSDIDDQEGLRFQTPVLMSYKNN-PLIPKDRTDPVKVLKEALSK  75

Query  348  ALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYN  527
            ALVF+YPLAGRL EGPN+KL+V+C GEGVLF+ A+AN+ L  LGD I  P P+L++   +
Sbjct  76   ALVFYYPLAGRLREGPNRKLMVECTGEGVLFIEADANVTLEQLGDAIVPPSPFLEEFLCD  135

Query  528  VPGSHRITGCPLLLIQVTRFSCG  596
             P S  I GCPL L+QVTR  CG
Sbjct  136  APASDGILGCPLPLVQVTRLKCG  158



>ref|XP_012070282.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Jatropha 
curcas]
 gb|KDP39567.1| hypothetical protein JCGZ_02587 [Jatropha curcas]
Length=444

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/154 (51%), Positives = 103/154 (67%), Gaps = 1/154 (1%)
 Frame = +3

Query  138  LFPPRFSVRLTTK-PELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKD  314
            + PP    ++  + PEL+ P  PTPRE K LSDIDDQ  LR  +P +  Y    SM  KD
Sbjct  1    MAPPPLVFKVNRREPELIAPAKPTPREFKSLSDIDDQDGLRTQLPLIHIYRYHPSMERKD  60

Query  315  PAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHS  494
            P +V+K+ +A+ LVF+YP AGR+ E PN+KL+V+C GEG+LFV A+A++AL   GD I  
Sbjct  61   PVQVLKQAIAETLVFYYPFAGRIRERPNRKLVVECTGEGILFVEADADVALDQFGDAIRP  120

Query  495  PCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            P P   +L ++VPGS  I  CPLLLIQVTR  CG
Sbjct  121  PFPCFGELLFDVPGSSGIANCPLLLIQVTRLKCG  154



>ref|XP_004498016.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cicer arietinum]
Length=463

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 99/141 (70%), Gaps = 0/141 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PELV P  PTP E K LSDIDDQ  LR+ +P + FY    +M GKDP  VI++ LAK L
Sbjct  13   EPELVKPSKPTPNETKLLSDIDDQDGLRFQIPVVQFYNYDPNMKGKDPVDVIRKALAKTL  72

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            VF+YP AGRL EG ++KL+VDCNGEGVLF+ A+A++++   G  +  P P   +L ++VP
Sbjct  73   VFYYPFAGRLREGNDRKLMVDCNGEGVLFIEADADVSVEEFGGQLQPPFPCWDQLLFDVP  132

Query  534  GSHRITGCPLLLIQVTRFSCG  596
            GS ++   PLLLIQVTR  CG
Sbjct  133  GSSQVINTPLLLIQVTRLKCG  153



>ref|XP_008779983.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like, partial 
[Phoenix dactylifera]
Length=146

 Score =   139 bits (350),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 94/134 (70%), Gaps = 0/134 (0%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +P LV P  PTP E K LSD+DDQ  LR+ +P + FY +  SM G+DPA+VI+E LAKAL
Sbjct  13   EPVLVAPAEPTPHEFKRLSDVDDQEGLRFQIPVIQFYRHDPSMAGRDPARVIREALAKAL  72

Query  354  VFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVP  533
            V +YP AGRL EG  +KL+V+C GEGVLF+ A+A++ L   GD +  P P L++L Y+V 
Sbjct  73   VHYYPFAGRLREGARRKLVVECTGEGVLFIEADADVRLEQFGDALQPPFPCLEELLYDVE  132

Query  534  GSHRITGCPLLLIQ  575
            GS  +  CPLLL Q
Sbjct  133  GSGDVLNCPLLLFQ  146



>gb|ABN48480.1| quinolizidine alkaloid O-tigloyltransferase [Lupinus albus]
Length=453

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/148 (56%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F VR   + ELVTP  PTP+E K LSDIDDQ SLR   P +  Y N  SM GKDP  +I+
Sbjct  10   FKVRRNPQ-ELVTPAKPTPKEFKLLSDIDDQTSLRSLTPLVTIYRNNPSMEGKDPVAIIR  68

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            E L+K LVF+YP AGRL  GPN KL+VDC GEGV+F+ A+A++ L   G  +H P P   
Sbjct  69   EALSKTLVFYYPFAGRLRNGPNGKLMVDCTGEGVIFIEADADVTLDQFGIDLHPPFPCFD  128

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+VPGS  I   PLLLIQVTR  CG
Sbjct  129  QLLYDVPGSDGILDSPLLLIQVTRLKCG  156



>ref|XP_004305015.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=445

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 105/143 (73%), Gaps = 2/143 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFY--ENKESMVGKDPAKVIKEGLAK  347
            +PEL+TP  PTP+EK+ LS+ID Q  LR+  P +  Y  +N  SM  KDP +VI++ L++
Sbjct  15   QPELLTPAKPTPQEKRLLSEIDIQEGLRFQTPFILSYKNDNPNSMKQKDPVEVIRDALSR  74

Query  348  ALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYN  527
            ALV++YP AGR+ EG N KL VDCNGEG+LF+ A+A+++L  LGD +  PCP+L+   ++
Sbjct  75   ALVYYYPFAGRVREGRNGKLFVDCNGEGILFIEADADVSLEQLGDSLQPPCPFLEDFLFD  134

Query  528  VPGSHRITGCPLLLIQVTRFSCG  596
            VPGS  I G PLLL+QVTR +CG
Sbjct  135  VPGSDDILGTPLLLVQVTRLTCG  157



>ref|XP_010058392.1| PREDICTED: methanol O-anthraniloyltransferase-like [Eucalyptus 
grandis]
Length=483

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 103/137 (75%), Gaps = 1/137 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGK-DPAKVIKEGLAKA  350
            KPEL++P   TPRE KPLSD+DDQ  LR+ +P L+FY N   + G+ DPA+V+KE L KA
Sbjct  18   KPELISPSQATPRELKPLSDLDDQEGLRFQIPFLFFYPNSPPIRGREDPARVVKEALRKA  77

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGR+ EGPN+KL+VDC GEG+LFV A+A+ +L  LGD +  PC ++ ++  +V
Sbjct  78   LVYYYPLAGRIREGPNRKLVVDCTGEGILFVKADADFSLEELGDSMRPPCGFVDEVLCDV  137

Query  531  PGSHRITGCPLLLIQVT  581
             GS  I GCPLLL+QV 
Sbjct  138  AGSGGIIGCPLLLVQVV  154



>ref|XP_003616154.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
 gb|AES99112.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=460

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 104/151 (69%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  F+VR   +PELV P  PTPRE K LSDIDDQ  LR+++P ++ Y  + SM  KDP K
Sbjct  5    PLLFTVR-RCQPELVPPVAPTPREVKLLSDIDDQEGLRFNVPVIFIYRREPSMAEKDPIK  63

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            V++  L++ LV++YP AGR+ EG  +KL+VDC GEGV+F+ AEA++ L   GD +H P P
Sbjct  64   VLRHALSRTLVYYYPFAGRIREGARRKLMVDCTGEGVVFIEAEADVTLDQFGDALHPPFP  123

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
              ++L Y+VPGS  I   P+ LIQVTR  CG
Sbjct  124  CFQQLLYDVPGSEHIIDRPIRLIQVTRLKCG  154



>gb|KJB78759.1| hypothetical protein B456_013G017100 [Gossypium raimondii]
Length=388

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 99/142 (70%), Gaps = 1/142 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  F+VR   KPELV P  PTP E+K LSDIDDQ SLR   P + FY  + SM GKD A+
Sbjct  8    PLAFTVR-RCKPELVAPAKPTPHEQKLLSDIDDQESLRAQFPAIQFYRYEPSMKGKDIAE  66

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            VIKE LA+ LVF+YP AGRL EG N KLIVDCNGEGV+F+ A+A+I L   G+ I  P P
Sbjct  67   VIKEALAQTLVFYYPFAGRLKEGANGKLIVDCNGEGVMFIKADADITLEQFGEPIQPPFP  126

Query  504  YLKKLQYNVPGSHRITGCPLLL  569
              ++L ++VPGS  +  CPLL+
Sbjct  127  CFEELLFDVPGSQAMLNCPLLI  148



>gb|AES82607.2| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=459

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  F+VR   +PELV P  PTP E K LSDIDDQ  LR+++P ++ Y ++ SM  KDP K
Sbjct  5    PLLFTVR-RCQPELVPPAAPTPCEVKLLSDIDDQEGLRFNIPMIFIYHHEPSMAEKDPVK  63

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            V++  L++ALV++YP AGR+ EG ++KL+VDC GEGV+F+ AEA++ L   GD +H P P
Sbjct  64   VLRHALSQALVYYYPFAGRIREGASRKLMVDCTGEGVMFIEAEADVTLDQFGDALHPPFP  123

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
               +L Y+V GS +I   P+ LIQVTR  CG
Sbjct  124  CFHQLLYDVRGSEQIMDRPIRLIQVTRLKCG  154



>gb|ERM94786.1| hypothetical protein AMTR_s00011p00264530 [Amborella trichopoda]
Length=160

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 100/141 (71%), Gaps = 1/141 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            FSV ++ KP LV+P  PTP E KPLSDIDDQ   R+ +P + FY     M G+DPA+V+ 
Sbjct  8    FSVTVS-KPMLVSPSRPTPYEIKPLSDIDDQEGFRFQIPVIQFYRKDPKMDGRDPARVVT  66

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + L++ALV++YP AGRL EG NKKL V+C+GEGVLFV  +A+++L   GD +  P P  +
Sbjct  67   DALSEALVYYYPFAGRLIEGENKKLSVECSGEGVLFVEGDADVSLEEFGDALKPPFPCWE  126

Query  513  KLQYNVPGSHRITGCPLLLIQ  575
            KL  +VPGS  + GCPLLLIQ
Sbjct  127  KLLMHVPGSDGVIGCPLLLIQ  147



>ref|XP_004986631.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Setaria 
italica]
Length=463

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/149 (53%), Positives = 105/149 (70%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  RFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVI  329
            +F+VR     ELV P  PTPRE K LSDIDDQ S+R H+P +  Y   E+MVG+DP +VI
Sbjct  9    KFTVR-RRPAELVAPAAPTPRELKLLSDIDDQESVRLHVPAILLYRRNEAMVGRDPVQVI  67

Query  330  KEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYL  509
            ++ +A+ALV +YPLAGRL E    KL VDC GEGVLF+ A+A++ L +LG+ +  P P L
Sbjct  68   RDAVARALVHYYPLAGRLREVDGGKLAVDCTGEGVLFIEADADVRLEHLGEPLLPPFPCL  127

Query  510  KKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            ++L ++VPGS  I   PL+L QVTR +CG
Sbjct  128  QELLFDVPGSFAIVDAPLMLFQVTRLACG  156



>ref|XP_010918388.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Elaeis guineensis]
Length=192

 Score =   139 bits (351),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = +3

Query  225  LSDIDDQASLR-YHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNK  401
            LSDID+  +LR   +P + +Y N+ SM+G+DP KVIK+ L+KALV++YPLAGRL EG  +
Sbjct  30   LSDIDNHENLRILQVPMIQYYSNEPSMIGQDPVKVIKDALSKALVYYYPLAGRLREGTKR  89

Query  402  KLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVT  581
            KL+V+C GEGVLF+ A+ANI L   GD +  P P L++L Y++PGS  I  CPLLLIQ+ 
Sbjct  90   KLVVECTGEGVLFIEAKANIRLEQFGDQLPPPVPCLEELLYDIPGSAGIIDCPLLLIQIA  149



>gb|KCW84614.1| hypothetical protein EUGRSUZ_B01445, partial [Eucalyptus grandis]
Length=392

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 102/148 (69%), Gaps = 3/148 (2%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F VR   + ELV P  PTPRE K LSDIDD+  LR+ +P + FY   ++  G+DPA+ I+
Sbjct  9    FKVR-RCEAELVRPAKPTPREYKRLSDIDDREGLRFLIPVIQFYRGDDT--GRDPARAIR  65

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            EGLA ALVF+YP AGRL E P +KL+VDCN E V FV A A++ L   GD +HSP P L+
Sbjct  66   EGLANALVFYYPFAGRLREWPGRKLVVDCNEEAVAFVEASADVTLDQFGDALHSPFPCLE  125

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L +++PGS  +   PLLLIQVTR  CG
Sbjct  126  ELLFDIPGSFSVLDSPLLLIQVTRLKCG  153



>ref|XP_008373467.1| PREDICTED: methanol O-anthraniloyltransferase-like [Malus domestica]
Length=459

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 78/142 (55%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESM-VGKDPAKVIKEGLAKA  350
            +PEL+TP  PTP E K LSD+DDQ  LR+ +P +  Y++  S+    +P KVI+E L++A
Sbjct  13   QPELITPAKPTPHETKFLSDMDDQEGLRFQVPIIMCYKDNPSLNKHHNPVKVIREALSRA  72

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGRL EGPN+KL+VDCNGEG+LF+ A A++ L  LG+ I   CP L++  YN 
Sbjct  73   LVYYYPLAGRLREGPNRKLMVDCNGEGILFIEAFADVTLEQLGEKILPHCPPLEEFLYNF  132

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS RI  CPLLL+QVT   CG
Sbjct  133  PGSDRIISCPLLLVQVTCLICG  154



>ref|XP_010058390.1| PREDICTED: methanol O-anthraniloyltransferase-like [Eucalyptus 
grandis]
Length=465

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 104/142 (73%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGK-DPAKVIKEGLAKA  350
            +PEL++P   TPRE KPLSD+D Q  LR+ +P L FY    SM G+ DPA+V+KE LAKA
Sbjct  23   EPELISPAGDTPRELKPLSDLDGQDWLRFMLPLLLFYPQSPSMKGREDPARVVKEALAKA  82

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YPLAGR+ EGP+ KL VDC GEG+LFV A+A+++L  LGD +  PC ++ ++  +V
Sbjct  83   LVYYYPLAGRIREGPDCKLGVDCTGEGILFVEADADVSLQELGDSMKPPCGFVNEVLCDV  142

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
             GS  I GCPLL +QVTR  CG
Sbjct  143  AGSGGIIGCPLLSVQVTRLKCG  164



>ref|XP_011040637.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Populus 
euphratica]
Length=465

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 101/156 (65%), Gaps = 1/156 (1%)
 Frame = +3

Query  129  MACLFPPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVG  308
            MA   P  F+VR   +PELV P   TP E + LSDID Q  L++  P    Y +  SM G
Sbjct  1    MAASTPLAFAVR-RCEPELVAPAKATPHELRQLSDIDRQLYLQFQSPNYNLYAHNPSMQG  59

Query  309  KDPAKVIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFI  488
            KDP KVIKE +A+ LV++YP AGR+ +GP+ KLIV+C GEGVLF+ A+A+  +   GD I
Sbjct  60   KDPVKVIKEAIAQTLVYYYPFAGRIRQGPDNKLIVECTGEGVLFIEADADATVEQFGDPI  119

Query  489  HSPCPYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
             SP P  ++L YNVPGS  I   PLL  QVTR +CG
Sbjct  120  PSPFPCFEELLYNVPGSAGIHNTPLLCFQVTRLNCG  155



>ref|XP_010045974.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Eucalyptus 
grandis]
Length=406

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 102/148 (69%), Gaps = 3/148 (2%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F VR   + ELV P  PTPRE K LSDIDD+  LR+ +P + FY   ++  G+DPA+ I+
Sbjct  9    FKVR-RCEAELVRPAKPTPREYKRLSDIDDREGLRFLIPVIQFYRGDDT--GRDPARAIR  65

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            EGLA ALVF+YP AGRL E P +KL+VDCN E V FV A A++ L   GD +HSP P L+
Sbjct  66   EGLANALVFYYPFAGRLREWPGRKLVVDCNEEAVAFVEASADVTLDQFGDALHSPFPCLE  125

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L +++PGS  +   PLLLIQVTR  CG
Sbjct  126  ELLFDIPGSFSVLDSPLLLIQVTRLKCG  153



>ref|XP_002298962.2| hypothetical protein POPTR_0001s45210g [Populus trichocarpa]
 gb|EEE83767.2| hypothetical protein POPTR_0001s45210g [Populus trichocarpa]
Length=469

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 100/148 (68%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   +PELV P   TP E KPLSDID Q  L++  P   FY +  SM GKDP KVI+
Sbjct  9    FNVR-RCEPELVAPAKATPHESKPLSDIDRQLYLQFQSPHYNFYAHNPSMQGKDPVKVIR  67

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            EG+A+ALV++YP AGR+ + P  KL+VDC GEGVLF+ A+A+  L   GD I  P P  +
Sbjct  68   EGIAQALVYYYPYAGRIRQEPENKLVVDCTGEGVLFIEADADGTLEQFGDPIQPPFPCAE  127

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L YNVPGS  I   PLL+IQ+TR  CG
Sbjct  128  ELLYNVPGSAGIINTPLLIIQITRLKCG  155



>ref|XP_011085897.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=465

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 0/124 (0%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKK  404
            LSDIDDQ + R+H+P + F+    +M  KDP KV ++ LAKALVF+YPLAGRL E   +K
Sbjct  32   LSDIDDQEAFRFHLPLIAFFPKNPAMDIKDPVKVFRDALAKALVFYYPLAGRLRETAGRK  91

Query  405  LIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTR  584
            L+V+C GEG LF+ A+A++ L   GD +  P P L++L Y+VPGS  +  CPLLLIQ TR
Sbjct  92   LVVECTGEGALFIEADADVRLQQFGDTLQPPFPCLEELLYDVPGSGGVVNCPLLLIQATR  151

Query  585  FSCG  596
              CG
Sbjct  152  LKCG  155



>ref|XP_004294711.1| PREDICTED: methanol O-anthraniloyltransferase-like [Fragaria 
vesca subsp. vesca]
Length=461

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 106/152 (70%), Gaps = 3/152 (2%)
 Frame = +3

Query  147  PRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVG-KDPAK  323
            P F V    +P+LVTP  PTPRE K LSDIDDQ  LR+ +P +   +N  SM   KDP  
Sbjct  10   PVFQV-YRMQPQLVTPARPTPREIKMLSDIDDQEGLRFQIPVIIACKNNPSMSNRKDPVP  68

Query  324  VI-KEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPC  500
            VI +E +++ALV++YPLAGRL EGPN+KL+VDCNGEGVLFV A+A++ L  LGD I  PC
Sbjct  69   VIIREAISRALVYYYPLAGRLREGPNRKLMVDCNGEGVLFVEAKADVTLEQLGDAIRPPC  128

Query  501  PYLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            P+L+    +VPGS  I G PLLL QVT   CG
Sbjct  129  PFLEGFLCDVPGSDGILGYPLLLFQVTILRCG  160



>ref|XP_010040516.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X1 
[Eucalyptus grandis]
 gb|KCW45153.1| hypothetical protein EUGRSUZ_L01233 [Eucalyptus grandis]
Length=458

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 102/148 (69%), Gaps = 3/148 (2%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F VR   + ELV P  PTPRE K LSDIDD+  LR+ +P + FY   ++  G+DPA+ I+
Sbjct  9    FKVR-RCEAELVRPAKPTPREYKRLSDIDDREGLRFLIPVIQFYRGDDT--GRDPARAIR  65

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            EGLA ALVF+YP AGRL E P +KL+VDCN EGV FV A A++ L   GD +H P P L+
Sbjct  66   EGLANALVFYYPFAGRLREWPGRKLVVDCNEEGVAFVEASADVTLDQFGDALHPPFPCLE  125

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L +++PGS  +   PLLLIQVTR  CG
Sbjct  126  ELLFDIPGSFSVLDSPLLLIQVTRLKCG  153



>ref|XP_004494963.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Cicer arietinum]
Length=456

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 105/148 (71%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F+VR   + ELV+P  PTPRE K LS+IDDQ  LR+++P ++ Y ++ SM+ KDP KV+K
Sbjct  8    FTVR-RCQSELVSPIAPTPREIKLLSNIDDQEGLRFNIPLIFIYRHEPSMIEKDPVKVLK  66

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
              L++ LV++YP AGR+ EG N+KL+VDCNGEGV+F+ AEA++ L   GD +  P P  +
Sbjct  67   HSLSQTLVYYYPFAGRIREGDNRKLMVDCNGEGVMFIEAEADVTLDQFGDTLQPPFPCFQ  126

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L Y+ P   +I  CPLL IQVTR  CG
Sbjct  127  QLLYDAPDIGQIIDCPLLHIQVTRIKCG  154



>ref|XP_010040517.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like isoform X2 
[Eucalyptus grandis]
Length=461

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 102/148 (69%), Gaps = 3/148 (2%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F VR   + ELV P  PTPRE K LSDIDD+  LR+ +P + FY   ++  G+DPA+ I+
Sbjct  12   FKVR-RCEAELVRPAKPTPREYKRLSDIDDREGLRFLIPVIQFYRGDDT--GRDPARAIR  68

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            EGLA ALVF+YP AGRL E P +KL+VDCN EGV FV A A++ L   GD +H P P L+
Sbjct  69   EGLANALVFYYPFAGRLREWPGRKLVVDCNEEGVAFVEASADVTLDQFGDALHPPFPCLE  128

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            +L +++PGS  +   PLLLIQVTR  CG
Sbjct  129  ELLFDIPGSFSVLDSPLLLIQVTRLKCG  156



>ref|XP_003626386.1| Alcohol acetyltransferase [Medicago truncatula]
 gb|AES82604.1| benzyl alcohol O-benzoyltransferase [Medicago truncatula]
Length=462

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/142 (54%), Positives = 103/142 (73%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKAL  353
            +PELV P  PTPRE K LSDIDDQ  LR++MP ++ Y ++ SMV KDP KV+K  L+K L
Sbjct  15   QPELVPPAAPTPREVKLLSDIDDQECLRFNMPIIFIYRHEPSMVKKDPVKVLKCALSKTL  74

Query  354  VFFYPLAGRLTEGPNKKLIVDCN-GEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            V++YPLAGR+ EG   KL+VDC  GEGV+F+ AEA++ L+  GD +H P P  ++L Y+V
Sbjct  75   VYYYPLAGRIREGARDKLMVDCTGGEGVMFIEAEADVTLNEFGDALHPPFPCFQELIYDV  134

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            P + +I   P+LLIQ+TR  CG
Sbjct  135  PSTKQIIDHPILLIQITRLKCG  156



>ref|XP_003626389.1| Benzoyl coenzyme A benzyl alcohol benzoyl transferase [Medicago 
truncatula]
Length=560

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 105/151 (70%), Gaps = 1/151 (1%)
 Frame = +3

Query  144  PPRFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAK  323
            P  F+VR   +PELV P  PTP E K LSDIDDQ  LR+++P ++ Y ++ SM  KDP K
Sbjct  5    PLLFTVR-RCQPELVPPAAPTPCEVKLLSDIDDQEGLRFNIPMIFIYHHEPSMAEKDPVK  63

Query  324  VIKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCP  503
            V++  L++ALV++YP AGR+ EG ++KL+VDC GEGV+F+ AEA++ L   GD +H P P
Sbjct  64   VLRHALSQALVYYYPFAGRIREGASRKLMVDCTGEGVMFIEAEADVTLDQFGDALHPPFP  123

Query  504  YLKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
               +L Y+V GS +I   P+ LIQVTR  CG
Sbjct  124  CFHQLLYDVRGSEQIMDRPIRLIQVTRLKCG  154



>ref|XP_011624423.1| PREDICTED: benzyl alcohol O-benzoyltransferase [Amborella trichopoda]
Length=258

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 102/144 (71%), Gaps = 1/144 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            FSV ++ KP LV+P  PTP E KPLSDIDDQ   R+ +P + FY     M G+DPA+V+ 
Sbjct  8    FSVTVS-KPMLVSPSRPTPYEIKPLSDIDDQEGFRFQIPVIQFYRKDPKMDGRDPARVVT  66

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + L++ALV++YP AGRL EG NKKL V+C+GEGVLFV  +A+++L   GD +  P P  +
Sbjct  67   DALSEALVYYYPFAGRLIEGENKKLSVECSGEGVLFVEGDADVSLEEFGDALKPPFPCWE  126

Query  513  KLQYNVPGSHRITGCPLLLIQVTR  584
            KL  +VPGS  + GCPLLLIQ+ +
Sbjct  127  KLLMHVPGSDGVIGCPLLLIQIEQ  150



>ref|NP_001064997.1| Os10g0503300 [Oryza sativa Japonica Group]
 dbj|BAF26911.1| Os10g0503300 [Oryza sativa Japonica Group]
 gb|EAY79120.1| hypothetical protein OsI_34226 [Oryza sativa Indica Group]
 gb|EAZ16606.1| hypothetical protein OsJ_32078 [Oryza sativa Japonica Group]
Length=475

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 104/150 (69%), Gaps = 3/150 (2%)
 Frame = +3

Query  150  RFSVRLTTKP-ELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKV  326
            +F+VR   KP ELV P  PTPRE K LSDIDDQ  LR+H+P + FY    +M G+DPA V
Sbjct  10   KFTVR--RKPAELVAPAGPTPRELKKLSDIDDQDGLRFHIPVIQFYRRSAAMGGRDPAPV  67

Query  327  IKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPY  506
            I+  +A+ALV +YP AGRL E   +KL VDC GEGVLF+ A+A++ L + G  +  P P 
Sbjct  68   IRAAVARALVSYYPFAGRLRELEGRKLAVDCTGEGVLFIEADADVRLEHFGGALQPPFPC  127

Query  507  LKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            L++L ++VPGS  + G PLLL QVTR +CG
Sbjct  128  LEELVFDVPGSSEVLGSPLLLFQVTRLACG  157



>sp|Q8GT21.1|BEBT_CLABR RecName: Full=Benzyl alcohol O-benzoyltransferase; AltName: Full=Benzoyl 
coenzyme A:benzyl alcohol benzoyl transferase [Clarkia 
breweri]
 gb|AAN09796.1| benzoyl coenzyme A: benzyl alcohol benzoyl transferase [Clarkia 
breweri]
Length=456

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 99/142 (70%), Gaps = 1/142 (1%)
 Frame = +3

Query  174  KPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYE-NKESMVGKDPAKVIKEGLAKA  350
            KPEL+ P   TP E K LSD++DQ  LR+ +P + FY+ N ESM  +DP +VI+EG+A+A
Sbjct  15   KPELIRPAKQTPHEFKKLSDVEDQEGLRFQIPVIQFYKHNNESMQERDPVQVIREGIARA  74

Query  351  LVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNV  530
            LV++YP AGRL E   +KL+V+C GEGV+F+ A+A++ L   GD +  P P   +L ++V
Sbjct  75   LVYYYPFAGRLREVDGRKLVVECTGEGVMFIEADADVTLEQFGDALQPPFPCFDQLLFDV  134

Query  531  PGSHRITGCPLLLIQVTRFSCG  596
            PGS  I   PLLLIQVTR  CG
Sbjct  135  PGSGGILDSPLLLIQVTRLKCG  156



>ref|XP_004986643.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Setaria 
italica]
Length=463

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 78/149 (52%), Positives = 104/149 (70%), Gaps = 1/149 (1%)
 Frame = +3

Query  150  RFSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVI  329
            +F+VR     ELV P  PTPRE K LSDIDDQ  +R H+P +  Y   E+MVG+DP +VI
Sbjct  9    KFTVR-RRPAELVAPAAPTPRELKLLSDIDDQEFVRLHVPAILLYRRNEAMVGRDPVQVI  67

Query  330  KEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYL  509
            ++ +A+ALV +YPLAGRL E    KL VDC GEGVLF+ A+A++ L +LG+ +  P P L
Sbjct  68   RDAVARALVHYYPLAGRLREVDGGKLAVDCTGEGVLFIEADADVRLEHLGEPLLPPFPCL  127

Query  510  KKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            ++L ++VPGS  I   PL+L QVTR +CG
Sbjct  128  QELLFDVPGSSAIVDAPLMLFQVTRLACG  156



>ref|XP_007145940.1| hypothetical protein PHAVU_007G280800g [Phaseolus vulgaris]
 gb|ESW17934.1| hypothetical protein PHAVU_007G280800g [Phaseolus vulgaris]
Length=458

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 93/139 (67%), Gaps = 0/139 (0%)
 Frame = +3

Query  180  ELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVF  359
            ELV P   TPRE K LSDIDDQ  LR+ +P + FY    S  G+DP  VI+E LAK LVF
Sbjct  15   ELVAPAKATPREVKLLSDIDDQDGLRFQIPVIQFYRYDPSQAGRDPVAVIREALAKTLVF  74

Query  360  FYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGS  539
            +YP AGRL EGP +KL+VDC GEGVLF+ A+A++ L + G  +  P P  + L Y++P S
Sbjct  75   YYPFAGRLREGPGRKLMVDCTGEGVLFIEADADVTLDHFGHSLQPPFPCWENLLYDLPSS  134

Query  540  HRITGCPLLLIQVTRFSCG  596
              +   PLLLIQVTR  CG
Sbjct  135  QGVLHTPLLLIQVTRLKCG  153



>ref|XP_011085899.1| PREDICTED: benzyl alcohol O-benzoyltransferase-like [Sesamum 
indicum]
Length=464

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 86/124 (69%), Gaps = 0/124 (0%)
 Frame = +3

Query  225  LSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIKEGLAKALVFFYPLAGRLTEGPNKK  404
            LSDIDDQ  LR+ +P + F+    +M  KDP KV ++ LAKALVF+YP AGRL E   +K
Sbjct  32   LSDIDDQEGLRFQLPLIAFFPKNPAMDRKDPVKVFRDALAKALVFYYPFAGRLRETAGRK  91

Query  405  LIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLKKLQYNVPGSHRITGCPLLLIQVTR  584
            L+V+C GEG LF+ A+A++ L   GD +  P P L++L Y+VPGS  +  CPLLLIQVTR
Sbjct  92   LVVECTGEGALFIEADADVGLQQFGDTLQPPFPCLEELLYDVPGSGGMVNCPLLLIQVTR  151

Query  585  FSCG  596
              CG
Sbjct  152  LKCG  155



>gb|AAG13627.1|AC078840_18 putative hypersensitivity-related (hsr)protein [Oryza sativa 
Japonica Group]
 gb|ABB47848.2| benzoyl-CoA:benzyl alcohol/phenylethanol benzoyltransferase, 
putative, expressed [Oryza sativa Japonica Group]
Length=553

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 104/150 (69%), Gaps = 3/150 (2%)
 Frame = +3

Query  150  RFSVRLTTKP-ELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKV  326
            +F+VR   KP ELV P  PTPRE K LSDIDDQ  LR+H+P + FY    +M G+DPA V
Sbjct  10   KFTVR--RKPAELVAPAGPTPRELKKLSDIDDQDGLRFHIPVIQFYRRSAAMGGRDPAPV  67

Query  327  IKEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPY  506
            I+  +A+ALV +YP AGRL E   +KL VDC GEGVLF+ A+A++ L + G  +  P P 
Sbjct  68   IRAAVARALVSYYPFAGRLRELEGRKLAVDCTGEGVLFIEADADVRLEHFGGALQPPFPC  127

Query  507  LKKLQYNVPGSHRITGCPLLLIQVTRFSCG  596
            L++L ++VPGS  + G PLLL QVTR +CG
Sbjct  128  LEELVFDVPGSSEVLGSPLLLFQVTRLACG  157



>ref|XP_007147135.1| hypothetical protein PHAVU_006G098700g [Phaseolus vulgaris]
 gb|ESW19129.1| hypothetical protein PHAVU_006G098700g [Phaseolus vulgaris]
Length=457

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 99/148 (67%), Gaps = 1/148 (1%)
 Frame = +3

Query  153  FSVRLTTKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVIK  332
            F++R   +PELV P  PTP E K LSDIDDQ+ LR+H   +  Y+N+ SM  KDP  VI+
Sbjct  10   FTMR-KCQPELVAPAIPTPDETKLLSDIDDQSYLRFHYSIIQIYQNESSMANKDPVIVIR  68

Query  333  EGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYLK  512
            + LA+ALVF+YP AGRL EG  +KL+VDC GEGV+FV A+A++ L   GD +  P  Y K
Sbjct  69   QALARALVFYYPFAGRLREGRGRKLMVDCGGEGVMFVEADADVTLEQFGDNLQPPFIYSK  128

Query  513  KLQYNVPGSHRITGCPLLLIQVTRFSCG  596
                +VP S  I   PLLLIQVTR  CG
Sbjct  129  AFLCDVPDSEDIKKLPLLLIQVTRLKCG  156



>emb|CDP22130.1| unnamed protein product [Coffea canephora]
Length=161

 Score =   136 bits (343),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 97/143 (68%), Gaps = 3/143 (2%)
 Frame = +3

Query  153  FSVRLT-TKPELVtpktptprekkpLSDIDDQASLRYHMPGLWFYENKESMVGKDPAKVI  329
             + R+T  KPELV P   TPRE K LSDIDDQ  LR+ +P + FY + +    +DP KVI
Sbjct  6    LTFRVTRQKPELVRPAKSTPRECKVLSDIDDQEGLRFQIPVIQFYRSDDGR--RDPVKVI  63

Query  330  KEGLAKALVFFYPLAGRLTEGPNKKLIVDCNGEGVLFVTAEANIALHNLGDFIHSPCPYL  509
            +E +AKALVF+YP AGRL E   +KL+VDC GEGV+F+ A+A + L   GD +  P P L
Sbjct  64   REAIAKALVFYYPFAGRLRECARRKLVVDCTGEGVMFIEADAEVTLEQYGDELQPPFPCL  123

Query  510  KKLQYNVPGSHRITGCPLLLIQV  578
            ++L Y+VP S  +  CPLLLIQV
Sbjct  124  EELLYDVPESAGVLHCPLLLIQV  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 805030520163