BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9218

Length=1761
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006360332.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    820   0.0      Solanum tuberosum [potatoes]
ref|XP_009619812.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    818   0.0      Nicotiana tomentosiformis
ref|XP_004247828.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    817   0.0      
ref|XP_009784398.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    815   0.0      Nicotiana sylvestris
gb|EYU32624.1|  hypothetical protein MIMGU_mgv1a005944mg                809   0.0      Erythranthe guttata [common monkey flower]
gb|AGC59769.1|  3-ketoacyl-CoA thiolase 1                               807   0.0      Rehmannia glutinosa [Chinese foxglove]
gb|AGC24176.1|  3-ketoacyl-CoA thiolase 2                               805   0.0      Rehmannia glutinosa [Chinese foxglove]
gb|ACV70033.1|  3-ketoacyl CoA thiolase 2                               796   0.0      Petunia x hybrida [garden petunia]
ref|XP_011073762.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    796   0.0      Sesamum indicum [beniseed]
emb|CDO99410.1|  unnamed protein product                                795   0.0      Coffea canephora [robusta coffee]
ref|XP_011091395.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    788   0.0      Sesamum indicum [beniseed]
ref|XP_008457258.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    788   0.0      Cucumis melo [Oriental melon]
ref|XP_007034449.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    786   0.0      
ref|XP_010069076.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    784   0.0      Eucalyptus grandis [rose gum]
gb|KJB72150.1|  hypothetical protein B456_011G161700                    782   0.0      Gossypium raimondii
ref|XP_006420604.1|  hypothetical protein CICLE_v10004931mg             782   0.0      Citrus clementina [clementine]
ref|XP_010522426.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    781   0.0      Tarenaya hassleriana [spider flower]
ref|NP_180873.1|  3-ketoacyl-CoA thiolase 2                             781   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010556945.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    780   0.0      Tarenaya hassleriana [spider flower]
gb|KHG05724.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    779   0.0      Gossypium arboreum [tree cotton]
ref|XP_010696158.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    778   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002881265.1|  hypothetical protein ARALYDRAFT_482251             777   0.0      
ref|XP_002285653.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    775   0.0      Vitis vinifera
emb|CDY37750.1|  BnaA04g19180D                                          774   0.0      Brassica napus [oilseed rape]
emb|CAN81585.1|  hypothetical protein VITISV_023191                     774   0.0      Vitis vinifera
ref|XP_006410451.1|  hypothetical protein EUTSA_v10016622mg             774   0.0      Eutrema salsugineum [saltwater cress]
ref|XP_009141289.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    773   0.0      Brassica rapa
ref|XP_009132912.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    773   0.0      Brassica rapa
ref|XP_006294172.1|  hypothetical protein CARUB_v10023167mg             772   0.0      Capsella rubella
emb|CDY23766.1|  BnaC04g43560D                                          771   0.0      Brassica napus [oilseed rape]
emb|CDY19452.1|  BnaC04g11470D                                          771   0.0      Brassica napus [oilseed rape]
ref|XP_012092655.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    771   0.0      Jatropha curcas
ref|XP_009143894.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    769   0.0      Brassica rapa
emb|CDX84701.1|  BnaA03g15290D                                          769   0.0      
ref|XP_010509924.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    768   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010413914.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    768   0.0      Camelina sativa [gold-of-pleasure]
emb|CAA63598.1|  glyoxysomal beta-ketoacyl-thiolase                     768   0.0      Brassica napus [oilseed rape]
emb|CDX79511.1|  BnaC03g18470D                                          767   0.0      
ref|XP_010243983.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    765   0.0      Nelumbo nucifera [Indian lotus]
ref|NP_001267690.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like        764   0.0      Cucumis sativus [cucumbers]
ref|XP_004138952.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    764   0.0      Cucumis sativus [cucumbers]
gb|EPS68937.1|  hypothetical protein M569_05826                         763   0.0      Genlisea aurea
pir||S72532  acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor...    760   0.0   
ref|XP_007225742.1|  hypothetical protein PRUPE_ppa005421mg             758   0.0      Prunus persica
ref|XP_008224585.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    758   0.0      Prunus mume [ume]
ref|XP_011002175.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    758   0.0      Populus euphratica
ref|XP_002299284.2|  hypothetical protein POPTR_0001s14280g             758   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010469514.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    757   0.0      Camelina sativa [gold-of-pleasure]
gb|AAQ77242.1|  acetoacetyl CoA thiolase                                753   0.0      Helianthus annuus
ref|XP_004296638.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    753   0.0      Fragaria vesca subsp. vesca
pdb|2WU9|A  Chain A, Crystal Structure Of Peroxisomal Kat2 From A...    743   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002518136.1|  3-ketoacyl-CoA thiolase B, putative                743   0.0      
ref|XP_006854408.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    743   0.0      Amborella trichopoda
ref|NP_001238475.1|  peroxisomal 3-ketoacyl-CoA thiolase                741   0.0      Glycine max [soybeans]
ref|XP_004497755.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    740   0.0      Cicer arietinum [garbanzo]
gb|KDO43599.1|  hypothetical protein CISIN_1g012506mg                   738   0.0      Citrus sinensis [apfelsine]
ref|XP_008800565.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    737   0.0      Phoenix dactylifera
ref|XP_011020687.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    737   0.0      Populus euphratica
ref|XP_009376354.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    737   0.0      Pyrus x bretschneideri [bai li]
ref|XP_009385864.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    736   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008438387.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    736   0.0      Cucumis melo [Oriental melon]
ref|XP_010935683.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    736   0.0      Elaeis guineensis
gb|KEH41248.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like protein     735   0.0      Medicago truncatula
ref|XP_003555712.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    735   0.0      Glycine max [soybeans]
ref|XP_008380600.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    734   0.0      Malus domestica [apple tree]
ref|XP_010099126.1|  3-ketoacyl-CoA thiolase 2                          734   0.0      
emb|CAA53078.1|  3-ketoacyl-CoA thiolase B                              732   0.0      Mangifera indica
gb|KDO43601.1|  hypothetical protein CISIN_1g012506mg                   732   0.0      Citrus sinensis [apfelsine]
pdb|2WUA|A  Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa ...    731   0.0      Helianthus annuus
ref|XP_010940650.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    729   0.0      Elaeis guineensis
ref|XP_011020688.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    729   0.0      Populus euphratica
gb|ACN39947.1|  unknown                                                 729   0.0      Picea sitchensis
gb|KJB72152.1|  hypothetical protein B456_011G161700                    728   0.0      Gossypium raimondii
ref|XP_006443651.1|  hypothetical protein CICLE_v10020068mg             726   0.0      Citrus clementina [clementine]
ref|NP_001131193.1|  acetyl-CoA C-acyltransferase-like protein          724   0.0      Zea mays [maize]
ref|XP_009400955.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    724   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001241698.1|  3-ketoacyl-CoA thiolase 2, peroxisomal precu...    723   0.0      
gb|KDO43600.1|  hypothetical protein CISIN_1g012506mg                   721   0.0      Citrus sinensis [apfelsine]
ref|XP_007145410.1|  hypothetical protein PHAVU_007G236600g             719   0.0      Phaseolus vulgaris [French bean]
ref|XP_008372446.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    718   0.0      
ref|XP_004954382.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    717   0.0      Setaria italica
ref|XP_009371217.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    715   0.0      Pyrus x bretschneideri [bai li]
ref|XP_008235516.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    715   0.0      Prunus mume [ume]
ref|XP_006368897.1|  hypothetical protein POPTR_0001s14290g             714   0.0      
ref|XP_011002176.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    713   0.0      Populus euphratica
gb|ABR16781.1|  unknown                                                 712   0.0      Picea sitchensis
ref|XP_007201004.1|  hypothetical protein PRUPE_ppa005303mg             711   0.0      Prunus persica
ref|XP_003570403.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    711   0.0      Brachypodium distachyon [annual false brome]
ref|XP_011034453.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    710   0.0      Populus euphratica
ref|XP_010457531.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    709   0.0      Camelina sativa [gold-of-pleasure]
gb|ACV70032.1|  3-ketoacyl CoA thiolase 1                               708   0.0      Petunia x hybrida [garden petunia]
pdb|2C7Y|A  Chain A, Plant Enzyme                                       706   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011006998.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    706   0.0      Populus euphratica
ref|XP_006649171.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    706   0.0      Oryza brachyantha
ref|XP_011083116.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    706   0.0      Sesamum indicum [beniseed]
dbj|BAI66423.1|  3-ketoacyl-CoA thiolase-like protein                   706   0.0      Triticum aestivum [Canadian hard winter wheat]
gb|EMT31542.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  705   0.0      
ref|XP_004290230.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    703   0.0      Fragaria vesca subsp. vesca
ref|XP_006350308.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    702   0.0      Solanum tuberosum [potatoes]
ref|XP_012085152.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    701   0.0      Jatropha curcas
ref|XP_009796304.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    702   0.0      Nicotiana sylvestris
ref|XP_004247103.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    701   0.0      
gb|ABR17647.1|  unknown                                                 701   0.0      Picea sitchensis
ref|XP_008804745.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    699   0.0      Phoenix dactylifera
ref|XP_007225741.1|  hypothetical protein PRUPE_ppa005421mg             697   0.0      
ref|XP_002521123.1|  3-ketoacyl-CoA thiolase B, putative                699   0.0      Ricinus communis
ref|NP_171965.1|  3-ketoacyl-CoA thiolase 1                             697   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009629663.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    699   0.0      Nicotiana tomentosiformis
ref|XP_009411367.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    697   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009336051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    697   0.0      
ref|XP_008804452.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    696   0.0      Phoenix dactylifera
gb|AAM61609.1|  putative acetyl-CoA acyltransferase                     695   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010933143.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    695   0.0      Elaeis guineensis
ref|XP_010484155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    694   0.0      Camelina sativa [gold-of-pleasure]
emb|CDX86611.1|  BnaC08g00920D                                          694   0.0      
ref|XP_009111084.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    693   0.0      Brassica rapa
dbj|BAJ87577.1|  predicted protein                                      694   0.0      Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010918893.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    692   0.0      Elaeis guineensis
emb|CDP03848.1|  unnamed protein product                                691   0.0      Coffea canephora [robusta coffee]
ref|XP_010038353.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    691   0.0      Eucalyptus grandis [rose gum]
gb|KHG13200.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    690   0.0      Gossypium arboreum [tree cotton]
ref|XP_002963753.1|  hypothetical protein SELMODRAFT_450889             689   0.0      Selaginella moellendorffii
ref|XP_010109695.1|  3-ketoacyl-CoA thiolase 2                          689   0.0      Morus notabilis
ref|XP_006307517.1|  hypothetical protein CARUB_v10009140mg             688   0.0      Capsella rubella
ref|XP_010484150.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    688   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_002974835.1|  hypothetical protein SELMODRAFT_101898             688   0.0      
ref|XP_002467133.1|  hypothetical protein SORBIDRAFT_01g020150          687   0.0      Sorghum bicolor [broomcorn]
gb|ACN29136.1|  unknown                                                 687   0.0      Zea mays [maize]
gb|KJB10128.1|  hypothetical protein B456_001G185200                    687   0.0      Gossypium raimondii
ref|XP_010475137.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    686   0.0      Camelina sativa [gold-of-pleasure]
emb|CDY15520.1|  BnaA08g28040D                                          685   0.0      Brassica napus [oilseed rape]
ref|XP_006662414.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    685   0.0      Oryza brachyantha
ref|XP_002889522.1|  hypothetical protein ARALYDRAFT_470458             682   0.0      
gb|EYU17978.1|  hypothetical protein MIMGU_mgv1a005895mg                682   0.0      Erythranthe guttata [common monkey flower]
ref|NP_001048523.1|  Os02g0817700                                       681   0.0      
gb|KHG11493.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    681   0.0      Gossypium arboreum [tree cotton]
ref|XP_002301570.1|  hypothetical protein POPTR_0002s22410g             679   0.0      Populus trichocarpa [western balsam poplar]
gb|KJB42405.1|  hypothetical protein B456_007G152600                    678   0.0      Gossypium raimondii
gb|KDO43602.1|  hypothetical protein CISIN_1g012506mg                   676   0.0      Citrus sinensis [apfelsine]
gb|AAB80634.1|  Strong similarity to Cucumis acetyl-CoA acyltrans...    677   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009796305.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    677   0.0      Nicotiana sylvestris
ref|NP_001064764.1|  Os10g0457600                                       677   0.0      
gb|EEC67095.1|  hypothetical protein OsI_33888                          676   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010684942.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    673   0.0      Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007049825.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    674   0.0      
gb|KJB42404.1|  hypothetical protein B456_007G152600                    672   0.0      Gossypium raimondii
gb|KJB72151.1|  hypothetical protein B456_011G161700                    670   0.0      Gossypium raimondii
ref|XP_004982961.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    669   0.0      Setaria italica
ref|XP_010547051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    670   0.0      Tarenaya hassleriana [spider flower]
ref|XP_001764272.1|  predicted protein                                  666   0.0      
ref|XP_001762605.1|  predicted protein                                  663   0.0      
gb|KFK42814.1|  hypothetical protein AALP_AA1G042000                    662   0.0      Arabis alpina [alpine rockcress]
ref|XP_010547050.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    662   0.0      Tarenaya hassleriana [spider flower]
ref|XP_003604976.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             660   0.0      Medicago truncatula
gb|KDO43604.1|  hypothetical protein CISIN_1g012506mg                   655   0.0      Citrus sinensis [apfelsine]
gb|AFK40880.1|  unknown                                                 656   0.0      Medicago truncatula
ref|XP_007153157.1|  hypothetical protein PHAVU_003G011600g             654   0.0      Phaseolus vulgaris [French bean]
ref|XP_009384048.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    654   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004506590.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    652   0.0      Cicer arietinum [garbanzo]
gb|EMS48058.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  649   0.0      Triticum urartu
ref|XP_004506669.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    649   0.0      Cicer arietinum [garbanzo]
gb|KHN15993.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  648   0.0      Glycine soja [wild soybean]
ref|XP_009336047.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    648   0.0      
ref|XP_003574006.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    647   0.0      Brachypodium distachyon [annual false brome]
ref|NP_001237076.1|  3-ketoacyl-CoA thiolase                            645   0.0      Glycine max [soybeans]
ref|NP_001242568.1|  uncharacterized protein LOC100789930               645   0.0      
ref|XP_003632434.2|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    644   0.0      
ref|XP_002865685.1|  KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA t...    641   0.0      Arabidopsis lyrata subsp. lyrata
ref|XP_006395129.1|  hypothetical protein EUTSA_v10004174mg             640   0.0      Eutrema salsugineum [saltwater cress]
gb|KCW50166.1|  hypothetical protein EUGRSUZ_K03601                     640   0.0      Eucalyptus grandis [rose gum]
ref|XP_006280441.1|  hypothetical protein CARUB_v10026373mg             637   0.0      Capsella rubella
ref|XP_006605730.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    635   0.0      
ref|XP_008454505.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    636   0.0      
ref|XP_010439766.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    635   0.0      Camelina sativa [gold-of-pleasure]
ref|NP_568704.2|  3-keto-acyl-CoA thiolase 2                            634   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008454504.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    635   0.0      
ref|XP_004152018.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    630   0.0      Cucumis sativus [cucumbers]
emb|CDY33940.1|  BnaA02g30470D                                          630   0.0      Brassica napus [oilseed rape]
ref|XP_010547052.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    627   0.0      Tarenaya hassleriana [spider flower]
ref|XP_010442336.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    628   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_009129750.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    627   0.0      Brassica rapa
gb|ADE77908.1|  unknown                                                 626   0.0      Picea sitchensis
ref|XP_007049826.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    627   0.0      
ref|XP_010439770.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    622   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010442338.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    621   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_006395130.1|  hypothetical protein EUTSA_v10004174mg             620   0.0      Eutrema salsugineum [saltwater cress]
gb|KDO65875.1|  hypothetical protein CISIN_1g0125222mg                  618   0.0      Citrus sinensis [apfelsine]
emb|CDY05657.1|  BnaC02g38800D                                          620   0.0      
gb|AAL25590.1|  At2g33150/F25I18.11                                     617   0.0      Arabidopsis thaliana [mouse-ear cress]
dbj|BAF02017.1|  peroxisomal-3-keto-acyl-CoA thiolase 1                 618   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482154.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    618   0.0      Camelina sativa [gold-of-pleasure]
ref|NP_851157.1|  3-keto-acyl-CoA thiolase 2                            616   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009129751.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    615   0.0      Brassica rapa
gb|AIB06952.1|  3-ketoacyl-CoA thiolase                                 614   0.0      Vanda hybrid cultivar
ref|XP_010482155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    612   0.0      Camelina sativa [gold-of-pleasure]
gb|KDO43603.1|  hypothetical protein CISIN_1g012506mg                   608   0.0      Citrus sinensis [apfelsine]
gb|EMS60447.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  607   0.0      Triticum urartu
gb|KCW57292.1|  hypothetical protein EUGRSUZ_H00090                     604   0.0      Eucalyptus grandis [rose gum]
gb|KDO43605.1|  hypothetical protein CISIN_1g012506mg                   597   0.0      Citrus sinensis [apfelsine]
gb|KCW50170.1|  hypothetical protein EUGRSUZ_K03601                     598   0.0      Eucalyptus grandis [rose gum]
gb|KCW50169.1|  hypothetical protein EUGRSUZ_K03601                     598   0.0      Eucalyptus grandis [rose gum]
gb|KJB42403.1|  hypothetical protein B456_007G152600                    593   0.0      Gossypium raimondii
dbj|BAD95031.1|  3-ketoacyl-CoA thiolase                                587   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_007034450.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    584   0.0      
ref|XP_005646163.1|  thiolase                                           587   0.0      Coccomyxa subellipsoidea C-169
gb|AFW74041.1|  hypothetical protein ZEAMMB73_080325                    584   0.0      
dbj|BAJ85217.1|  predicted protein                                      583   0.0      Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK94786.1|  unknown                                                 580   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007034451.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3    559   0.0      
gb|AFW74040.1|  hypothetical protein ZEAMMB73_080325                    556   0.0      
ref|XP_002989683.1|  hypothetical protein SELMODRAFT_447769             557   0.0      
gb|KDO65876.1|  hypothetical protein CISIN_1g0125222mg                  551   0.0      Citrus sinensis [apfelsine]
ref|XP_002991797.1|  hypothetical protein SELMODRAFT_236388             544   0.0      
gb|ACU21519.1|  unknown                                                 538   0.0      Glycine max [soybeans]
gb|AFW68657.1|  hypothetical protein ZEAMMB73_512974                    538   0.0      
ref|XP_002946078.1|  hypothetical protein VOLCADRAFT_102696             535   0.0      Volvox carteri f. nagariensis
gb|KJB10129.1|  hypothetical protein B456_001G185200                    528   0.0      Gossypium raimondii
gb|AEQ94132.1|  putative 3-ketoacyl CoA thiolase                        521   5e-179   Elaeis guineensis
gb|KDO65879.1|  hypothetical protein CISIN_1g0125222mg                  516   1e-176   Citrus sinensis [apfelsine]
gb|AFK34605.1|  unknown                                                 510   3e-175   Lotus japonicus
ref|XP_007049827.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3    509   1e-173   
ref|XP_001697225.1|  acetyl-CoA acyltransferase                         508   8e-172   Chlamydomonas reinhardtii
ref|XP_011400620.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             503   9e-170   Auxenochlorella protothecoides
ref|XP_007049828.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4    496   3e-168   
gb|KDO65878.1|  hypothetical protein CISIN_1g0125222mg                  478   3e-162   Citrus sinensis [apfelsine]
gb|AFW68656.1|  hypothetical protein ZEAMMB73_512974                    469   5e-159   
ref|XP_007513169.1|  unknown                                            474   7e-159   Bathycoccus prasinos
ref|XP_001418570.1|  predicted protein                                  467   2e-156   Ostreococcus lucimarinus CCE9901
gb|KDD73648.1|  beta-ketoacyl-ACP synthase                              466   1e-155   Helicosporidium sp. ATCC 50920
ref|XP_002500295.1|  acetyl-coa acyltransferase                         462   2e-154   Micromonas commoda
emb|CEF98532.1|  Thiolase-like, subgroup                                461   8e-154   Ostreococcus tauri
ref|XP_006307516.1|  hypothetical protein CARUB_v10009140mg             456   2e-153   
ref|XP_004339798.1|  acetylCoA acyltransferase, putative                454   3e-151   Acanthamoeba castellanii str. Neff
ref|XP_008844714.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    450   1e-149   
ref|XP_003283381.1|  acetyl-CoA C-acyltransferase                       448   7e-149   Dictyostelium purpureum
ref|XP_005348140.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    447   2e-148   Microtus ochrogaster [prairie voles]
ref|NP_666342.1|  3-ketoacyl-CoA thiolase B, peroxisomal precursor      446   3e-148   Mus musculus [mouse]
ref|XP_009066824.1|  hypothetical protein LOTGIDRAFT_134529             446   5e-148   Lottia gigantea
sp|P07871.2|THIKB_RAT  RecName: Full=3-ketoacyl-CoA thiolase B, p...    445   1e-147   Rattus norvegicus [brown rat]
ref|XP_005348137.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    444   2e-147   Microtus ochrogaster [prairie voles]
dbj|BAE35878.1|  unnamed protein product                                443   4e-147   Mus musculus [mouse]
ref|NP_570934.1|  3-ketoacyl-CoA thiolase A, peroxisomal precursor      443   4e-147   Mus musculus [mouse]
dbj|BAA14107.1|  peroxisomal 3-ketoacyl-CoA thiolase B                  443   6e-147   Rattus norvegicus [brown rat]
ref|XP_003221941.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    443   6e-147   Anolis carolinensis [Carolina anole]
gb|EDL76915.1|  rCG25819, isoform CRA_a                                 443   1e-146   Rattus norvegicus [brown rat]
ref|XP_002591918.1|  hypothetical protein BRAFLDRAFT_284464             442   1e-146   Branchiostoma floridae
dbj|BAA14106.1|  peroxisomal 3-ketoacyl-CoA thiolase A                  442   2e-146   Rattus norvegicus [brown rat]
ref|NP_001035108.1|  3-ketoacyl-CoA thiolase B, peroxisomal precu...    442   2e-146   Rattus norvegicus [brown rat]
dbj|BAE25296.1|  unnamed protein product                                441   4e-146   Mus musculus [mouse]
ref|NP_036621.1|  3-ketoacyl-CoA thiolase A, peroxisomal                441   5e-146   Rattus norvegicus [brown rat]
sp|P21775.2|THIKA_RAT  RecName: Full=3-ketoacyl-CoA thiolase A, p...    440   7e-146   Rattus norvegicus [brown rat]
ref|XP_003724378.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    439   6e-145   Strongylocentrotus purpuratus [purple urchin]
ref|XP_003132151.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    438   7e-145   Sus scrofa [pigs]
gb|ELU09588.1|  hypothetical protein CAPTEDRAFT_229355                  438   8e-145   Capitella teleta
ref|XP_004349337.1|  peroxisomal 3-ketoacyl-CoA thiolase B              437   8e-145   Capsaspora owczarzaki ATCC 30864
ref|XP_005150078.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    437   1e-144   Melopsittacus undulatus
ref|XP_007517129.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    437   1e-144   Erinaceus europaeus [common hedgehog]
ref|XP_005297192.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    436   5e-144   Chrysemys picta bellii
ref|XP_002759778.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    436   5e-144   Callithrix jacchus [common marmoset]
ref|XP_004676369.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    436   5e-144   Condylura cristata
ref|XP_002813979.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    435   9e-144   Pongo abelii [orang utan]
ref|XP_003992303.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    435   1e-143   Felis catus [cat]
ref|XP_003464147.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    435   1e-143   Cavia porcellus [guinea pig]
ref|XP_011570982.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    435   1e-143   Aquila chrysaetos canadensis
ref|XP_008853327.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    434   1e-143   
ref|XP_003256905.2|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    434   2e-143   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_006869210.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    434   3e-143   Chrysochloris asiatica
ref|NP_001598.1|  3-ketoacyl-CoA thiolase, peroxisomal isoform a        434   3e-143   Homo sapiens [man]
ref|XP_002742159.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    434   3e-143   Saccoglossus kowalevskii
ref|XP_008522879.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    434   3e-143   Equus przewalskii [Przewalski horse]
pdb|2IIK|A  Chain A, Crystal Structure Of Human Peroxisomal Acety...    433   3e-143   Homo sapiens [man]
ref|XP_004033892.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    433   4e-143   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_004642271.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    434   4e-143   
ref|XP_003781848.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    433   4e-143   
ref|XP_010559421.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    434   4e-143   Haliaeetus leucocephalus
ref|XP_005096572.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    433   5e-143   Aplysia californica
ref|XP_004823725.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    432   1e-142   
ref|XP_004419563.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    432   1e-142   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_001488609.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    432   1e-142   Equus caballus [domestic horse]
ref|XP_005317428.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    432   1e-142   
ref|NP_001072686.1|  3-ketoacyl-CoA thiolase, peroxisomal               432   1e-142   
ref|NP_001080604.1|  3-ketoacyl-CoA thiolase, peroxisomal               432   2e-142   
ref|XP_003930949.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    432   2e-142   
ref|XP_010355558.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    431   3e-142   
ref|XP_005491482.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    431   3e-142   
gb|KFP07326.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  430   4e-142   
gb|EPZ32623.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  430   4e-142   
ref|XP_002914680.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    431   4e-142   
ref|XP_011217238.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    431   4e-142   
ref|XP_005386652.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    431   4e-142   
ref|XP_004635291.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    431   4e-142   
ref|XP_643924.1|  acetyl-CoA C-acyltransferase                          430   5e-142   
ref|XP_011808722.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    430   7e-142   
ref|XP_007943890.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    430   7e-142   
dbj|BAE72965.1|  hypothetical protein                                   430   7e-142   
ref|XP_005317422.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    430   9e-142   
ref|XP_010393120.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    430   1e-141   
ref|XP_007127844.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    430   1e-141   
ref|XP_003456538.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    431   1e-141   
ref|XP_007969955.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    431   1e-141   
ref|XP_001088834.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    430   1e-141   
ref|XP_005849380.1|  hypothetical protein CHLNCDRAFT_143854             430   2e-141   
ref|NP_001187475.1|  peroxisomal 3-ketoacyl-CoA thiolase A              429   2e-141   
gb|KGL84935.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  427   2e-141   
ref|XP_003894723.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    430   2e-141   
ref|XP_008153138.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    429   2e-141   
ref|XP_006265991.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    429   2e-141   
ref|XP_005546711.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    430   3e-141   
ref|XP_004835307.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    429   3e-141   
ref|XP_007191535.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    429   3e-141   
ref|XP_011889662.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    429   3e-141   
ref|XP_004277954.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    428   3e-141   
ref|XP_011995559.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    428   3e-141   
ref|XP_007462753.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    428   3e-141   
ref|XP_008500452.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    429   3e-141   
ref|XP_534222.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal...    428   4e-141   
ref|XP_002111185.1|  expressed hypothetical protein                     428   6e-141   
ref|NP_001002207.1|  3-ketoacyl-CoA thiolase, peroxisomal               427   6e-141   
ref|XP_004412369.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    427   9e-141   
ref|XP_009537056.1|  hypothetical protein PHYSODRAFT_340572             426   1e-140   
ref|NP_001184217.1|  acetyl-Coenzyme A acyltransferase 1 (peroxis...    427   1e-140   
ref|XP_004377453.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    427   1e-140   
ref|XP_005509181.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    425   2e-140   
ref|XP_007253620.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    426   3e-140   
ref|XP_006986793.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    426   3e-140   
ref|NP_001029491.1|  3-ketoacyl-CoA thiolase, peroxisomal               426   4e-140   
ref|XP_004614628.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    426   4e-140   
ref|XP_010224152.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    426   5e-140   
ref|XP_010710649.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    426   6e-140   
ref|XP_004704131.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    425   6e-140   
ref|XP_006910841.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    425   6e-140   
ref|XP_005994280.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    425   8e-140   
ref|XP_010785602.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    424   1e-139   
ref|XP_005901200.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    424   1e-139   
ref|XP_010739674.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    424   1e-139   
gb|ETI53494.1|  hypothetical protein F443_03599                         424   1e-139   
ref|XP_010865004.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    424   2e-139   
gb|ETK93319.1|  hypothetical protein L915_03492                         423   3e-139   
ref|XP_005040594.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    423   4e-139   
ref|XP_006890653.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    423   5e-139   
ref|XP_008161239.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    422   7e-139   
ref|XP_006077082.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    422   8e-139   
ref|XP_003080093.1|  Dynein 1-alpha heavy chain, flagellar inner ...    459   9e-139   
ref|XP_010004292.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    422   9e-139   
ref|XP_005027361.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    420   1e-138   
ref|XP_004588416.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    422   1e-138   
ref|XP_006806602.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    423   2e-138   
ref|XP_005748614.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    423   3e-138   
ref|XP_002193705.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    421   3e-138   
ref|XP_007049829.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 5    417   3e-138   
ref|XP_005442450.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    419   5e-138   
ref|XP_008066531.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    421   5e-138   
ref|XP_011363629.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    420   7e-138   
gb|KFV08282.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  417   9e-138   
gb|ERZ96342.1|  hypothetical protein GLOINDRAFT_71751                   419   1e-137   
ref|XP_008900800.1|  hypothetical protein PPTG_08457                    419   2e-137   
ref|XP_005940527.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    421   2e-137   
ref|XP_004538713.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    419   2e-137   
ref|XP_010833811.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    418   3e-137   
ref|XP_009975644.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    417   5e-137   
ref|XP_003415748.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    417   6e-137   
ref|XP_002904159.1|  3-ketoacyl-CoA thiolase A                          417   7e-137   
ref|XP_008276561.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    417   7e-137   
ref|XP_005383786.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    417   1e-136   
ref|XP_009084024.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    417   1e-136   
ref|XP_005975939.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    417   1e-136   
ref|XP_008314704.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    417   2e-136   
ref|XP_006634258.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    416   2e-136   
ref|XP_010616927.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    416   2e-136   
ref|XP_011217239.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    414   4e-136   
ref|XP_004018276.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    413   4e-136   
ref|XP_003505982.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    415   6e-136   
ref|XP_006120630.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    413   6e-136   
ref|XP_004854313.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    414   9e-136   
ref|XP_007578554.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    414   1e-135   
gb|EGW00828.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  412   1e-135   
ref|XP_008942616.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    412   2e-135   
ref|XP_009642386.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    413   2e-135   
ref|XP_004880487.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    414   2e-135   
gb|EMC83181.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  411   3e-135   
gb|KFQ33519.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  410   5e-135   
gb|KFR17430.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  410   6e-135   
ref|XP_001373770.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    412   7e-135   
gb|EIE80258.1|  hypothetical protein RO3G_04963                         411   1e-134   
gb|ELK29226.1|  3-ketoacyl-CoA thiolase, peroxisomal                    409   1e-134   
ref|XP_002788186.1|  3-ketoacyl-CoA thiolase A, peroxisomal precu...    411   1e-134   
gb|EPQ17921.1|  3-ketoacyl-CoA thiolase, peroxisomal                    409   2e-134   
ref|XP_007644623.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    412   2e-134   
ref|XP_007066606.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    409   2e-134   
gb|KFW87055.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  409   2e-134   
gb|KFV86553.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  409   2e-134   
ref|XP_008929499.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    408   4e-134   
ref|XP_008250935.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    410   5e-134   
gb|KFO38323.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  409   5e-134   
ref|XP_009078375.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    408   7e-134   
ref|XP_006765161.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    409   7e-134   
ref|XP_008641380.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    408   7e-134   
ref|XP_005424411.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    409   9e-134   
gb|KFP39992.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  407   1e-133   
ref|XP_007081088.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    409   1e-133   
ref|XP_010190011.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    406   2e-133   
gb|KFQ63006.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  406   2e-133   
gb|KGL97637.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  406   2e-133   
ref|XP_005882731.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    409   2e-133   
ref|XP_009683500.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    409   2e-133   
gb|KFW73684.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  406   2e-133   
gb|KFM05271.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  406   2e-133   
gb|KFW09333.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  406   3e-133   
gb|KFQ13333.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  406   3e-133   
gb|KFV40730.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  405   3e-133   
gb|EOA95880.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  406   3e-133   
emb|CEI96344.1|  Putative Acetyl-CoA acyltransferase                    407   4e-133   
gb|KFP20301.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  405   5e-133   
ref|XP_009888784.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    406   5e-133   
gb|KFO74220.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  405   5e-133   
gb|KFV66334.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  405   5e-133   
gb|EFA76209.1|  acetyl-CoA C-acyltransferase                            407   6e-133   
emb|CEG63739.1|  Putative Acetyl-CoA acyltransferase                    407   6e-133   
gb|KFP47895.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  405   7e-133   
ref|XP_010293422.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    405   8e-133   
ref|XP_004538712.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    408   8e-133   
gb|KFO66172.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  405   9e-133   
ref|XP_008710007.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    409   9e-133   
emb|CCA20150.1|  3ketoacylCoA thiolase A putative                       406   1e-132   
ref|XP_008877314.1|  hypothetical protein H310_12126                    406   1e-132   
gb|KFQ52653.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  404   1e-132   
ref|XP_009580990.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    405   1e-132   
gb|KFO08431.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  404   1e-132   
ref|XP_009952311.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    409   1e-132   
ref|XP_010075883.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    404   2e-132   
gb|KFR09032.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  403   3e-132   
ref|XP_006200711.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    406   3e-132   
ref|XP_010980336.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    403   4e-132   
ref|XP_005241038.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    403   4e-132   
dbj|GAM22408.1|  hypothetical protein SAMD00019534_055830               405   4e-132   
dbj|GAN04244.1|  conserved hypothetical protein                         404   4e-132   
ref|XP_009923469.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    403   5e-132   
ref|XP_009274247.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    406   6e-132   
gb|KFV42249.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  402   6e-132   
dbj|GAN10585.1|  3-ketoacyl-CoA thiolase, peroxisomal precursor         403   1e-131   
ref|XP_002780408.1|  3-ketoacyl-CoA thiolase A, peroxisomal precu...    403   2e-131   
gb|EPB86339.1|  acetyl-CoA acyltransferase                              403   2e-131   
emb|CCI45800.1|  unnamed protein product                                402   5e-131   
emb|CCA76233.1|  probable POT1-acetyl-CoA C-acyltransferase, pero...    401   5e-131   
ref|XP_010144408.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    400   5e-131   
ref|XP_008349047.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    397   8e-131   
emb|CEG73130.1|  Putative Acetyl-CoA acyltransferase                    401   1e-130   
ref|XP_006169029.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    400   2e-130   
ref|XP_002780409.1|  3-ketoacyl-CoA thiolase A, peroxisomal precu...    401   2e-130   
ref|XP_010944140.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    399   2e-130   
ref|XP_004360305.1|  acetyl-CoA C-acyltransferase                       421   3e-130   
ref|XP_006109905.1|  PREDICTED: LOW QUALITY PROTEIN: acetyl-CoA a...    399   3e-130   
emb|CDS10007.1|  Putative Acetyl-CoA acyltransferase                    400   4e-130   
emb|CDJ43915.1|  acetyl-CoA acyltransferase B, putative                 407   6e-130   
dbj|BAK06976.1|  predicted protein                                      398   2e-129   
ref|XP_011480271.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    397   2e-129   
gb|KIM26928.1|  hypothetical protein M408DRAFT_72087                    397   3e-129   
ref|XP_009876634.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    395   3e-129   
emb|CDH52593.1|  3-ketoacyl-thiolase                                    397   3e-129   
ref|XP_009941382.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    395   4e-129   
gb|KDQ28695.1|  hypothetical protein PLEOSDRAFT_1054697                 396   5e-129   
gb|KFG51612.1|  putative acetyl-CoA acyltransferase B                   396   8e-129   
gb|KFH17089.1|  putative acetyl-CoA acyltransferase B                   396   1e-128   
ref|XP_008882673.1|  acetyl-CoA acyltransferase B, putative             396   1e-128   
gb|EIE78703.1|  hypothetical protein RO3G_03407                         395   1e-128   
gb|EPR64554.1|  putative acetyl-CoA acyltransferase B                   395   2e-128   
emb|CEP14254.1|  hypothetical protein                                   395   3e-128   
ref|XP_008949804.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    392   3e-128   
ref|XP_002365975.1|  acetyl-CoA acyltransferase B, putative             394   6e-128   
ref|XP_010114568.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    391   9e-128   
ref|XP_002180190.1|  beta-ketoacyl-coa thiolase                         392   1e-127   
gb|EHH51426.1|  hypothetical protein EGM_10792                          392   1e-127   
ref|XP_009707186.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    391   1e-127   
gb|EPB89779.1|  acetyl-CoA acyltransferase                              393   1e-127   
gb|ELK13640.1|  3-ketoacyl-CoA thiolase, peroxisomal                    392   1e-127   
ref|XP_006077081.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    394   1e-127   
dbj|BAG57147.1|  unnamed protein product                                390   2e-127   
ref|XP_009484735.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    390   2e-127   
gb|EPB90768.1|  acetyl-CoA acyltransferase                              392   2e-127   
ref|XP_005040595.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    392   2e-127   
gb|KFU95853.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  392   3e-127   
ref|XP_009897418.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    390   3e-127   
ref|XP_008584769.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    390   4e-127   
ref|XP_009820505.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    390   4e-127   
ref|XP_005527826.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    389   5e-127   
ref|XP_005634306.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    389   5e-127   
emb|CEP14538.1|  hypothetical protein                                   391   5e-127   
gb|EJY88018.1|  Acetyl-CoA acyltransferases family protein              391   5e-127   
ref|XP_009556582.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    389   6e-127   
ref|XP_002802920.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    389   7e-127   
ref|XP_011808723.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    389   9e-127   
ref|XP_010016183.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    389   1e-126   
ref|XP_010311931.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    389   1e-126   
dbj|GAN09045.1|  3-ketoacyl-CoA thiolase, peroxisomal precursor         390   1e-126   
emb|CEP15856.1|  hypothetical protein                                   390   2e-126   
gb|EWM24705.1|  3-ketoacyl- thiolase peroxisomal                        390   3e-126   
ref|XP_009473628.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    387   3e-126   
ref|XP_009963091.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    387   4e-126   
ref|XP_005695607.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    387   5e-126   
ref|XP_011241272.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    387   5e-126   



>ref|XP_006360332.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=465

 Score =   820 bits (2118),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/461 (88%), Positives = 443/461 (96%), Gaps = 1/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLLQHLRP+  +SSL++IESS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4     AIERQRVLLQHLRPSQTSSSLENIESSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+K+GGFKDTYPDD+LA+VLKA+IEKTN+NPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  64    LCKAKKGGFKDTYPDDILAAVLKAVIEKTNVNPSEVGDIVVGSVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  124   YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +  T+ QAQ+CLLPMGITSENVAHRFGVTRQEQDQAAV+SHRKAAAATA+GKFKDEIIPV
Sbjct  184   KVKTMVQAQDCLLPMGITSENVAHRFGVTRQEQDQAAVDSHRKAAAATASGKFKDEIIPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIRPNAS+ DLAKLKPVFKK GTTTAGNSSQVTDGAGAV
Sbjct  244   ATKIVDPKTGDEKPVTISVDDGIRPNASVSDLAKLKPVFKKSGTTTAGNSSQVTDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLEL+DIDLFEIN
Sbjct  304   LLMKRSIAMQKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLELEDIDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  364   EAFASQFVYCRKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGY-LSKDA  1489
             VSMCIGTGMGAA VFERGD+CDEL NARK+++H + LSKDA
Sbjct  424   VSMCIGTGMGAAAVFERGDSCDELRNARKIDSHNHLLSKDA  464



>ref|XP_009619812.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
tomentosiformis]
Length=464

 Score =   818 bits (2114),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 408/460 (89%), Positives = 439/460 (95%), Gaps = 0/460 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLLQHLRP+  +SSL++IESS++ASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4     AIERQRVLLQHLRPSQTSSSLENIESSIAASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRGGFKDTYPDDLLA VLKAL+EKTNL+PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKAKRGGFKDTYPDDLLAPVLKALMEKTNLSPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  124   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +   + QAQ+CLLPMGITSENVAHRFGVTRQEQDQAAV+SHRKAAAA+A+GKFKDEIIPV
Sbjct  184   KVKMMAQAQDCLLPMGITSENVAHRFGVTRQEQDQAAVDSHRKAAAASASGKFKDEIIPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDET VTISVDDGIRPNAS+ DLAKLKPVFKK GTTTAGNSSQVTDGAGAV
Sbjct  244   PTKIVDPKTGDETPVTISVDDGIRPNASVSDLAKLKPVFKKSGTTTAGNSSQVTDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA+QKGLPILGVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLEL+DIDLFEIN
Sbjct  304   LLMKRSLAMQKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLELEDIDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC+KKL LDPEKINVNGGAMA+GHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  364   EAFASQYVYCRKKLELDPEKINVNGGAMALGHPLGATGARCVATLLHEMKRRGKDCRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             VSMCIGTGMGAA VFERGD+CDEL NARK+ +H  LSKDA
Sbjct  424   VSMCIGTGMGAAAVFERGDSCDELCNARKIGSHNLLSKDA  463



>ref|XP_004247828.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=465

 Score =   817 bits (2110),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/461 (88%), Positives = 442/461 (96%), Gaps = 1/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLLQHLRP+  +SSL++IESS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4     AIERQRVLLQHLRPSQTSSSLENIESSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRGGFKDTYPDD+LA+VLKA+IEKTN+NPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  64    LCKAKRGGFKDTYPDDILAAVLKAVIEKTNVNPSEVGDIVVGSVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  124   YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +  ++ QAQ+CLLPMGITSENVAHRFGVTRQEQDQAAV+SHRKAAAATA+GKFKDEIIPV
Sbjct  184   KVKSMVQAQDCLLPMGITSENVAHRFGVTRQEQDQAAVDSHRKAAAATASGKFKDEIIPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIRPNAS+ DLAKLKPVFKK GTTTAGNSSQVTDGAGAV
Sbjct  244   ATKIVDPKTGDEKPVTISVDDGIRPNASVSDLAKLKPVFKKSGTTTAGNSSQVTDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLEL+DIDLFEIN
Sbjct  304   LLMKRSIAMQKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLELEDIDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  364   EAFASQFVYCRKKLELDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGY-LSKDA  1489
             VSMCIGTGMGAA VFERGD+CDEL NARK+++H + LSKDA
Sbjct  424   VSMCIGTGMGAAAVFERGDSCDELRNARKIDSHNHLLSKDA  464



>ref|XP_009784398.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
sylvestris]
Length=464

 Score =   815 bits (2106),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/460 (88%), Positives = 439/460 (95%), Gaps = 0/460 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLLQHLRP+  +SSL++IESS++ASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4     AIERQRVLLQHLRPSQTSSSLENIESSIAASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRGGFKDTYPDDLLA VLKAL+EKTN++PSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKAKRGGFKDTYPDDLLAPVLKALMEKTNVSPSEIGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  124   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +   + QAQ+CLLPMGITSENVAHRFGVTRQEQDQAAV+SHRKAAAA+A+GKFKDEIIPV
Sbjct  184   KVKMMAQAQDCLLPMGITSENVAHRFGVTRQEQDQAAVDSHRKAAAASASGKFKDEIIPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDET VTISVDDGIRPNAS+ DLAKLKPVFKK GTTTAGNSSQVTDGAGAV
Sbjct  244   PTKIVDPKTGDETPVTISVDDGIRPNASVSDLAKLKPVFKKSGTTTAGNSSQVTDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLEL+DIDLFEIN
Sbjct  304   LLMKRSIAMQKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLELEDIDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC+KKL LDPEKINVNGGAMA+GHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  364   EAFASQYVYCRKKLELDPEKINVNGGAMALGHPLGATGARCVATLLHEMKRRGKDCRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             VSMCIGTGMGAA VFERGD+CDEL NARK+ +H  LSKDA
Sbjct  424   VSMCIGTGMGAAAVFERGDSCDELCNARKIGSHNLLSKDA  463



>gb|EYU32624.1| hypothetical protein MIMGU_mgv1a005944mg [Erythranthe guttata]
Length=464

 Score =   809 bits (2090),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/461 (87%), Positives = 435/461 (94%), Gaps = 0/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ERQRVLLQHLRP+  +SSL+ IESS+SAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4     AVERQRVLLQHLRPSFTSSSLEDIESSLSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKSKRGGFKDTYPDDLLAPVLRAVMEKTNVNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  124   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R  T+ QAQ+CLLPMGITSENVAHRFGVTRQEQDQAAV+SHRKAAAATA+GKFKDEI+PV
Sbjct  184   RVKTMAQAQDCLLPMGITSENVAHRFGVTRQEQDQAAVDSHRKAAAATASGKFKDEIVPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIRPN+S+ DL KLKPVFKKDG+TTA NSSQV+DGAGAV
Sbjct  244   KTKIVDPKTGDEKPVTISVDDGIRPNSSVADLGKLKPVFKKDGSTTAANSSQVSDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFR+F AVGVDPA+MGIGPAVAIPAAVK+AGLEL DIDLFEIN
Sbjct  304   LLMKRSIAMQKGLPILGVFRSFCAVGVDPAIMGIGPAVAIPAAVKAAGLELGDIDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ+LYCQKKL LDP KINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+G 
Sbjct  364   EAFASQFLYCQKKLELDPAKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGA  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD+CDELSNARK+E   +LSKDAR
Sbjct  424   VSMCIGTGMGAAAVFERGDSCDELSNARKIEAQNFLSKDAR  464



>gb|AGC59769.1| 3-ketoacyl-CoA thiolase 1 [Rehmannia glutinosa]
Length=464

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/461 (87%), Positives = 436/461 (95%), Gaps = 0/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A ERQRVLLQHLRP+  +SSL+ IESSVSAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4     ATERQRVLLQHLRPSFTSSSLEDIESSVSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKSKRGGFKDTYPDDLLAPVLRAVVEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  124   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R  ++ QAQ+CLLPMGITSENVAHRFGVTRQEQDQAAV+SHRKAAAATA+GKFKDEIIPV
Sbjct  184   RVKSMAQAQDCLLPMGITSENVAHRFGVTRQEQDQAAVDSHRKAAAATASGKFKDEIIPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PK+GDE  VTISVDDGIRPN S+ DL KLKPVFKKDG+TTAGNSSQV+DGAGAV
Sbjct  244   KTKIVDPKSGDEKPVTISVDDGIRPNTSVADLGKLKPVFKKDGSTTAGNSSQVSDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFR+FAAVGVDPA+MG+GPAVAIPAAVKSAGLEL DIDLFE+N
Sbjct  304   LLMKRSVAMQKGLPILGVFRSFAAVGVDPAIMGVGPAVAIPAAVKSAGLELGDIDLFEVN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLG TGARCVATLLHEMKRRGKDCR+GV
Sbjct  364   EAFASQFVYCRKKLELDPEKINVNGGAMAIGHPLGVTGARCVATLLHEMKRRGKDCRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD+CDELSNAR V TH +LSKDAR
Sbjct  424   VSMCIGTGMGAAAVFERGDSCDELSNARTVGTHNFLSKDAR  464



>gb|AGC24176.1| 3-ketoacyl-CoA thiolase 2 [Rehmannia glutinosa]
Length=464

 Score =   805 bits (2078),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/461 (87%), Positives = 434/461 (94%), Gaps = 0/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A ERQRVLLQHLRP+  +SSL+ IESSVSAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4     ATERQRVLLQHLRPSFTSSSLEDIESSVSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKSKRGGFKDTYPDDLLAPVLRAVVEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  124   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R  ++ QAQ+CLLPMGITSENVAHRFGVTRQEQDQAAV+SHRKAAAATA+GKFKDEIIPV
Sbjct  184   RVKSMAQAQDCLLPMGITSENVAHRFGVTRQEQDQAAVDSHRKAAAATASGKFKDEIIPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PK+GDE  VTISVDDGIRPN S+ DL KLKPVFKKDG+TTAGNSSQV+DGAGAV
Sbjct  244   KTKIVDPKSGDEKPVTISVDDGIRPNTSVADLGKLKPVFKKDGSTTAGNSSQVSDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFR+FAAVGVDPA+MG+GPAVAIPAAVKSAGLEL DIDLFEIN
Sbjct  304   LLMKRSVAMQKGLPILGVFRSFAAVGVDPAIMGVGPAVAIPAAVKSAGLELGDIDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLG TGARCV TLLHEMKRRGKDCR+GV
Sbjct  364   EAFASQFVYCRKKLELDPEKINVNGGAMAIGHPLGVTGARCVVTLLHEMKRRGKDCRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD+CDELSN R V TH +LSKDAR
Sbjct  424   VSMCIGTGMGAAAVFERGDSCDELSNTRTVGTHNFLSKDAR  464



>gb|ACV70033.1| 3-ketoacyl CoA thiolase 2 [Petunia x hybrida]
Length=463

 Score =   796 bits (2057),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/460 (87%), Positives = 434/460 (94%), Gaps = 1/460 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             +IERQRVLLQHLRP+  +SSL++++SS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4     SIERQRVLLQHLRPSQTSSSLENLDSSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRG FKDTYPDDLLA VLKAL+EKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKAKRGSFKDTYPDDLLAPVLKALMEKTNVSPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N      S NP
Sbjct  124   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRLGRFS-NP  182

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +  T+ QAQ+CLLPMG+TSENVAHRFGVTRQEQDQAAV+SHRKAAAATA+GKFKDEIIPV
Sbjct  183   KVKTMAQAQDCLLPMGVTSENVAHRFGVTRQEQDQAAVDSHRKAAAATASGKFKDEIIPV  242

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDET VTISVDDGIRPNAS+ DLAKL+PVFKKDGTTTAGNSSQVTDGAGAV
Sbjct  243   ATKIVDPKTGDETPVTISVDDGIRPNASVSDLAKLRPVFKKDGTTTAGNSSQVTDGAGAV  302

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA+QKGLPILGVFRTFAAVGVDPA+MGIGPAVAIPAAVKSAGLEL+DIDLFEIN
Sbjct  303   LLMKRSLAMQKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPAAVKSAGLELEDIDLFEIN  362

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC+KKL LDPEKINVNG AMA+GHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  363   EAFASQYVYCRKKLELDPEKINVNGSAMALGHPLGATGARCVATLLHEMKRRGKDCRFGV  422

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             VSMCIGTGMGAA VFERGD+CDEL NARK+++H  LSKDA
Sbjct  423   VSMCIGTGMGAAAVFERGDSCDELRNARKIDSHNLLSKDA  462



>ref|XP_011073762.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Sesamum 
indicum]
Length=464

 Score =   796 bits (2056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/461 (86%), Positives = 432/461 (94%), Gaps = 0/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLLQHLRP+  +S+L+ I SSVSAS+C AGDSAAY R+SV+GDD+VIVAA+RT 
Sbjct  4     AIDRQRVLLQHLRPSFTSSTLEDIGSSVSASICLAGDSAAYHRSSVFGDDVVIVAAHRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+AL+EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKSKRGGFKDTYPDDLLAPVLRALLEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT+N MAWEGSVNP
Sbjct  124   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTINPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R  T+ QAQ+CLLPMGITSENVAHRFGVTRQEQDQAAV+SHRKAAAATA+GKFKDEIIPV
Sbjct  184   RVKTMAQAQDCLLPMGITSENVAHRFGVTRQEQDQAAVDSHRKAAAATASGKFKDEIIPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIRPN S+ DL KLKPVFKKDG+TTAGNSSQV+DGA AV
Sbjct  244   KTKIVDPKTGDEKPVTISVDDGIRPNTSVADLGKLKPVFKKDGSTTAGNSSQVSDGAAAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QK LPILGVFR+FAAVGVDPA+MG+GPAVAIPAAVKSAGLEL DIDLFEIN
Sbjct  304   LLMKRSVAMQKRLPILGVFRSFAAVGVDPAIMGVGPAVAIPAAVKSAGLELGDIDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLG TGARCVATLLHEMKRRGKDCR+GV
Sbjct  364   EAFASQFVYCRKKLELDPEKINVNGGAMAIGHPLGTTGARCVATLLHEMKRRGKDCRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIGTGMGAA VFERGD+CDEL N R V+TH +LSKDAR
Sbjct  424   ISMCIGTGMGAAAVFERGDSCDELCNVRTVQTHNFLSKDAR  464



>emb|CDO99410.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   795 bits (2052),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/461 (86%), Positives = 434/461 (94%), Gaps = 3/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRV+LQHL+P+  +SSL++++SS+SASVCAAGDSAAY R S +GDD+VIVAAYRT 
Sbjct  4     AIERQRVVLQHLKPSFTSSSLENLDSSLSASVCAAGDSAAYHRTSAFGDDVVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YA   ETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  124   YA---ETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R  ++ +AQNCLLPMG+TSENVAHRF VTRQEQDQAAVESH+KAAAATA+G+FKDEIIPV
Sbjct  181   RVKSMAEAQNCLLPMGVTSENVAHRFNVTRQEQDQAAVESHKKAAAATASGRFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIRP+ ++ DLAKLKPVFKKDG+TTAGNSSQV+DGAGAV
Sbjct  241   ATKIVDPKTGDEKPVTISVDDGIRPSTTVADLAKLKPVFKKDGSTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA+QKGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGLEL+DIDLFEIN
Sbjct  301   LLMKRSLAMQKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLELEDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC++KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  361   EAFASQFVYCREKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD+CDEL NARK+E +  LSKDAR
Sbjct  421   VSMCIGTGMGAAAVFERGDSCDELCNARKIEANNLLSKDAR  461



>ref|XP_011091395.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=464

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/461 (87%), Positives = 438/461 (95%), Gaps = 0/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ERQRVLLQHLRP+  +SSL+ I+SS+SAS+C+AGDS+AY R++V+GDD+VIVAAYRTP
Sbjct  4     AVERQRVLLQHLRPSFTSSSLEDIDSSISASICSAGDSSAYHRSTVFGDDVVIVAAYRTP  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKSKRGGFKDTYPDDLLAPVLRALIEKTNVNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  124   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +  T+ QAQ+CLLPMGITSENVAHRFGVTRQEQDQAAVESH+KAAAATA+GKFKDEIIPV
Sbjct  184   KVKTMAQAQDCLLPMGITSENVAHRFGVTRQEQDQAAVESHKKAAAATASGKFKDEIIPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PK+GDE  VTISVDDGIRPN S+ +L KLKPVFKKDG+TTAGNSSQV+DGAGAV
Sbjct  244   KTKIVDPKSGDEKEVTISVDDGIRPNTSVAELGKLKPVFKKDGSTTAGNSSQVSDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFR+FAAVGVDPA+MG+GPAVAIPAAVKSAGLEL DIDLFEIN
Sbjct  304   LLMKRSVAMQKGLPILGVFRSFAAVGVDPAIMGVGPAVAIPAAVKSAGLELGDIDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LD EKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  364   EAFASQFVYCRKKLELDAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAAGVFERGD+CDEL N RKVET  +LSKDAR
Sbjct  424   VSMCIGTGMGAAGVFERGDSCDELCNVRKVETQNFLSKDAR  464



>ref|XP_008457258.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
melo]
Length=461

 Score =   788 bits (2034),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/459 (86%), Positives = 430/459 (94%), Gaps = 3/459 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLL HLRP+   SSL S +S +SAS C AGDSAAYQRNSV+GDD+VIVAAYRT 
Sbjct  4     AINRQKVLLHHLRPS---SSLHSHDSPLSASACLAGDSAAYQRNSVFGDDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDT+PDDLLA VLKALIEKTNLNPSEVGDI+VG+VL PGS RASECRMAAF
Sbjct  61    LCKSKRGGFKDTHPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLGPGSQRASECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  121   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMGITSENVAHRFGVTR++QDQAAVESH+KAAAATA+G+FKDEIIPV
Sbjct  181   KVKMFEQAQNCLLPMGITSENVAHRFGVTREQQDQAAVESHKKAAAATASGRFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKIV+PKTG+E +VT+SVDDGIRPNAS+GDLAKLKPVFKKDG+TTAGN+SQV+DGAGAV
Sbjct  241   STKIVDPKTGEEKSVTVSVDDGIRPNASLGDLAKLKPVFKKDGSTTAGNASQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  301   LLMKRSVAMKKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KL L+PEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  361   EAFASQFVYCRNKLELNPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  1486
             +SMCIGTGMGAA VFERGD  DEL NARKV+ H  LSKD
Sbjct  421   ISMCIGTGMGAAAVFERGDVADELCNARKVDNHNLLSKD  459



>ref|XP_007034449.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOY05375.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=464

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/460 (85%), Positives = 427/460 (93%), Gaps = 0/460 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ++LLQHL P+  +S+  +  S++SAS C AGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  4     AINRQQILLQHLNPSAPSSADQNYNSALSASACLAGDSAAYQRTNAFGDDVVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNP EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPGEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  124   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R   ++QAQNCLLPMG+TSENVAHRFGVTRQEQDQAAVESHRKAAAATA+GKFKDEIIPV
Sbjct  184   RVKQMEQAQNCLLPMGVTSENVAHRFGVTRQEQDQAAVESHRKAAAATASGKFKDEIIPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKIV+PKTGDE  VTISVDDGIRPN S+ DLAKL+PVFKKDG+TTAGNSSQV+DGAGAV
Sbjct  244   TTKIVDPKTGDEKPVTISVDDGIRPNTSLSDLAKLRPVFKKDGSTTAGNSSQVSDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+ KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDL+EIN
Sbjct  304   LLMKRSVAMLKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLYEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LDP+KINVNG AMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  364   EAFASQFVYCRKKLELDPKKINVNGAAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIGTGMGAA VFERGD  DEL NARKVET+ +LSKDA
Sbjct  424   ISMCIGTGMGAAAVFERGDHTDELCNARKVETNSFLSKDA  463



>ref|XP_010069076.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW57291.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=464

 Score =   784 bits (2025),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/461 (86%), Positives = 434/461 (94%), Gaps = 0/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLLQHLRP++++SS+    SS+SAS+CAAGDSAAYQR+  +GDDIVIVAAYRT 
Sbjct  4     AIERQRVLLQHLRPSSSSSSVHGDASSLSASICAAGDSAAYQRSGSFGDDIVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+ALI+KT +NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKSKRGGFKDTYPDDLLAPVLRALIDKTKINPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  124   YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +  +  QAQNCLLPMG+TSENVAHRFGVTRQEQDQAAVESHRKAAAATAAG+FKDEIIPV
Sbjct  184   KVKSFAQAQNCLLPMGVTSENVAHRFGVTRQEQDQAAVESHRKAAAATAAGRFKDEIIPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTI+VDDGIRP+A++ DLAKLKPVFKKDG TTAGNSSQV+DGAGAV
Sbjct  244   ATKIVDPKTGDEKPVTIAVDDGIRPSATLSDLAKLKPVFKKDGCTTAGNSSQVSDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  304   LLMKRSLAMEKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGL+PEK+NVNGGAMA+GHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  364   EAFASQFVYCRNKLGLEPEKVNVNGGAMAMGHPLGATGARCVATLLHEMKRRGKDCRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIGTGMGAA V ERGD+ DELSNARKV T+  LSKDAR
Sbjct  424   ISMCIGTGMGAAAVLERGDSVDELSNARKVGTNSLLSKDAR  464



>gb|KJB72150.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=464

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/461 (85%), Positives = 425/461 (92%), Gaps = 0/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4     AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESMT N MAWEGSVNP
Sbjct  124   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTTNPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R   ++QAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKAAAATA+GKFKDEI+PV
Sbjct  184   RVKQMEQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKAAAATASGKFKDEIVPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIR N S+ DL KLKPVFKK+GTTTAGNSSQV+DGAGAV
Sbjct  244   ATKIVDPKTGDEKPVTISVDDGIRANTSVSDLGKLKPVFKKNGTTTAGNSSQVSDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGLELDD+DLFEIN
Sbjct  304   LLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLELDDVDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YCQKKL LDP+KINVNGGAMAIGHPLG TGARCVATLLHEMKRRGKDCR+GV
Sbjct  364   EAFASQFVYCQKKLELDPQKINVNGGAMAIGHPLGVTGARCVATLLHEMKRRGKDCRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVET+  LSKDAR
Sbjct  424   VSMCIGTGMGAAAVFERGDCVDELCNARKVETNSLLSKDAR  464



>ref|XP_006420604.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 ref|XP_006489799.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR33844.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 gb|KDO43598.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=462

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/459 (85%), Positives = 429/459 (93%), Gaps = 2/459 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4     AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62    LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMG+TSENVAHRFGVTR+EQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   KVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIRPN S+ +LAKLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   ATKIVDPKTGDEKPVTISVDDGIRPNTSVSELAKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+LDDIDLFEIN
Sbjct  302   LLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGARCVATLLHEMKRRG+DCR+GV
Sbjct  362   EAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  1486
             +SMCIGTGMGAA VFERGD  DEL N RKVE++ +LSKD
Sbjct  422   ISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKD  460



>ref|XP_010522426.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Tarenaya hassleriana]
Length=464

 Score =   781 bits (2017),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/462 (85%), Positives = 430/462 (93%), Gaps = 4/462 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP+++ S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4     AIERQRVLLEHLRPSSSPSH--NFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+ALIEKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62    LCKSKRGGFKDTYPDDLLAPVLRALIEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +  + +QAQNCLLPMG+TSENVA RFGVTR+EQDQAAVESHRKAAAAT+AGKFKDEIIPV
Sbjct  182   KVKSFEQAQNCLLPMGVTSENVAGRFGVTREEQDQAAVESHRKAAAATSAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKIV+PKTGDE TVT++VDDGIRP+ ++ DLA+LKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   TTKIVDPKTGDEKTVTVAVDDGIRPSTTLSDLARLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV
Sbjct  362   EAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVET--HGYLSKDA  1489
             VSMCIGTGMGAA VFERGDA D LSNAR+VE      LSKD+
Sbjct  422   VSMCIGTGMGAAAVFERGDAVDSLSNARRVEAAHSSLLSKDS  463



>ref|NP_180873.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q56WD9.2|THIK2_ARATH RecName: Full=3-ketoacyl-CoA thiolase 2, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 2; AltName: Full=Beta-ketothiolase 
2; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
2; AltName: Full=Peroxisome defective protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG42910.1|AF327529_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK15577.1|AF349530_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAC04908.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25248.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25249.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK96606.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAL36070.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAM65085.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AEC08791.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=462

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/461 (85%), Positives = 425/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4     AIERQRVLLEHLRPSSSSSH--NYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62    LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                   QAQNCLLPMG+TSENVA RFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDE  +T+SVDDGIRP  ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   KTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKDAR
Sbjct  422   VSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR  462



>ref|XP_010556945.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Tarenaya hassleriana]
Length=463

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/462 (84%), Positives = 430/462 (93%), Gaps = 3/462 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP++  SS  + E+S+SAS C AGDSA+YQR S+YGDD+VIVAAYRT 
Sbjct  4     AIERQRVLLEHLRPSS--SSSHNFEASLSASACLAGDSASYQRASLYGDDVVIVAAYRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+ALIEK N+NP+EVGDI+VGTVLA GS RASECRMAAF
Sbjct  62    LCKSKRGGFKDTYPDDLLAPVLRALIEKKNVNPAEVGDIVVGTVLAAGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +  + +QA NCLLPMG+TSENVA RFGVTR+EQDQAAVESHRKAAAATA+GKFKDEIIPV
Sbjct  182   KVKSFEQAHNCLLPMGVTSENVAARFGVTREEQDQAAVESHRKAAAATASGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TT+IV+PKTGDE  VT++VDDGIRP+ ++ DLAKLKPVFKKDGTTTAGNSSQ++DGAGAV
Sbjct  242   TTRIVDPKTGDEKAVTVAVDDGIRPSTTLLDLAKLKPVFKKDGTTTAGNSSQISDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVK-SAGLELDDIDLFEI  1186
             LLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MG+GPAVAIP AVK +AGLELDDIDLFEI
Sbjct  302   LLMKRSVAMQKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPGAVKQAAGLELDDIDLFEI  361

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQ++YC+ KLGLDPE+INVNGGAMAIGHPLGATGARCV TLLHEMKRRG+DCRYG
Sbjct  362   NEAFASQFVYCRNKLGLDPERINVNGGAMAIGHPLGATGARCVGTLLHEMKRRGRDCRYG  421

Query  1367  VVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VVSMCIGTGMGAA VFERGD  D+LSNARKVE HG+LSKD+R
Sbjct  422   VVSMCIGTGMGAAAVFERGDGVDDLSNARKVEAHGFLSKDSR  463



>gb|KHG05724.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=464

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/461 (85%), Positives = 423/461 (92%), Gaps = 0/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLLQHL P+ ++ S     S++SAS C AGDSAAY R +V+GDD+VIVAAYRT 
Sbjct  4     AINRQQVLLQHLNPSASSFSSHQNNSALSASACLAGDSAAYLRTNVFGDDVVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESMT N MAWEGSVNP
Sbjct  124   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTTNPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R   ++QAQNCLLPMG+TSENVAHRFGVTRQEQDQAAVESHRKAAAATA+GKFKDEI+PV
Sbjct  184   RVKQMEQAQNCLLPMGVTSENVAHRFGVTRQEQDQAAVESHRKAAAATASGKFKDEIVPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIR N S+ DL KLKPVFKK+GTTTAGNSSQV+DGAGAV
Sbjct  244   ATKIVDPKTGDEKPVTISVDDGIRANTSVSDLGKLKPVFKKNGTTTAGNSSQVSDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+ KGLPILGVFRTF AVGVDPA+MG+GPAVAIPAAVKSAGLELDD+DLFEIN
Sbjct  304   LLMKRSVAMCKGLPILGVFRTFCAVGVDPAIMGVGPAVAIPAAVKSAGLELDDVDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YCQKKL LDP+KINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  364   EAFASQFVYCQKKLELDPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA V ERGD  DEL NARKVET+  LSKDAR
Sbjct  424   VSMCIGTGMGAAAVLERGDCVDELCNARKVETNSLLSKDAR  464



>ref|XP_010696158.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   778 bits (2009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/461 (86%), Positives = 426/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ++LL HLRP +  SS  + E+ +SAS CAAGDS+AY R + +GDD+VIVAA+RT 
Sbjct  4     AINRQKILLDHLRPPS--SSDHNYEAFLSASNCAAGDSSAYHRTTAFGDDVVIVAAHRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRG FKDTYPDDLLA VLKALIEKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62    LCKAKRGSFKDTYPDDLLAPVLKALIEKTNVNPAEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPE VPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPEIVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R   L QAQ+CLLPMGITSENVAHRFGVTR+EQDQAAVESHRKAAAATAAGKFKDEIIPV
Sbjct  182   RVKELAQAQDCLLPMGITSENVAHRFGVTREEQDQAAVESHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTI+VDDGIRPNAS+ DLAKLKPVFKK GTTTAGNSSQVTDGAGAV
Sbjct  242   RTKIVDPKTGDEKPVTITVDDGIRPNASLADLAKLKPVFKKSGTTTAGNSSQVTDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+ KGLPILGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVAMSKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ+LYC+KKL LDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFLYCRKKLDLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIGTGMGAA VFERGDA D+L NARKVE+HG LSKDA+
Sbjct  422   ISMCIGTGMGAAAVFERGDAADDLCNARKVESHGLLSKDAK  462



>ref|XP_002881265.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57524.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   777 bits (2006),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/461 (85%), Positives = 425/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4     AIERQRVLLEHLRPSSSSSH--NFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62    LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                   QAQNCLLPMG+TSENVA RFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDE  +T+SVDDGIRP  ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   KTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGL+PEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFVYCRNKLGLNPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NA+KVE  G LSKDAR
Sbjct  422   VSMCIGTGMGAAAVFERGDGVDELRNAKKVEAQGLLSKDAR  462



>ref|XP_002285653.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Vitis vinifera]
 emb|CBI33354.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/461 (86%), Positives = 427/461 (93%), Gaps = 3/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLLQHL P+++A+     ESS+SASVC AGDSAAYQR SV+GDD+VIVAAYRT 
Sbjct  4     AINRQRVLLQHLSPSSSAAED---ESSLSASVCVAGDSAAYQRTSVFGDDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+AL+EKTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  61    LCKSKRGGFKDTYPDDLLAPVLRALLEKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGS+NP
Sbjct  121   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSINP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QAQ+CLLPMGITSENVAHRFGVTRQEQDQAAVESH++AAAATA GKFKDEIIPV
Sbjct  181   KVKEFVQAQDCLLPMGITSENVAHRFGVTRQEQDQAAVESHKRAAAATATGKFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKIV+PKTGDE  VTISVDDGIRPNA++ DLAKLKPVFKK+GTTTAGNSSQV+DGAGAV
Sbjct  241   STKIVDPKTGDEKLVTISVDDGIRPNATMSDLAKLKPVFKKNGTTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN
Sbjct  301   LLMKRSVAMRKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLGATGARCV TLLHEMKRRGKDCR+GV
Sbjct  361   EAFASQFVYCRKKLDLDPEKINVNGGAMAIGHPLGATGARCVGTLLHEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NAR  E +  LSKDA+
Sbjct  421   VSMCIGTGMGAAAVFERGDCVDELRNARTAENNNLLSKDAQ  461



>emb|CDY37750.1| BnaA04g19180D [Brassica napus]
Length=462

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/461 (85%), Positives = 425/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLLQHLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4     AIERQRVLLQHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62    LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                   QAQ+CLLPMG+TSENVAHRFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKKFAQAQSCLLPMGVTSENVAHRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDET +T+SVDDGIRP+ ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   QTKLVDPKTGDETPITVSVDDGIRPSTTLATLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSLATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ+LYC+ KLGLD EK+NVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFLYCRNKLGLDEEKVNVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVE  GYLSKDAR
Sbjct  422   VSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGYLSKDAR  462



>emb|CAN81585.1| hypothetical protein VITISV_023191 [Vitis vinifera]
Length=461

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/461 (86%), Positives = 426/461 (92%), Gaps = 3/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLLQHL P+++A+     ESS+SASVC AGDSAAYQR SV+GDD+VIVAAYRT 
Sbjct  4     AINRQRVLLQHLSPSSSAAED---ESSLSASVCVAGDSAAYQRTSVFGDDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  61    LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGS+NP
Sbjct  121   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSINP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QAQ+CLLPMGITSENVAHRFGVTRQEQDQAAVESH++AAAATA GKFKDEIIPV
Sbjct  181   KVKEFVQAQDCLLPMGITSENVAHRFGVTRQEQDQAAVESHKRAAAATATGKFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKIV+PKTGDE  VTISVDDGIRPNA + DLAKLKPVFKK+GTTTAGNSSQV+DGAGAV
Sbjct  241   STKIVDPKTGDEKPVTISVDDGIRPNAIMSDLAKLKPVFKKNGTTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN
Sbjct  301   LLMKRSVAMRKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LDPEKINVNGGAMAIGHPLGATGARCV TLLHEMKRRGKDCR+GV
Sbjct  361   EAFASQFVYCRKKLDLDPEKINVNGGAMAIGHPLGATGARCVGTLLHEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NAR  E +  LSKDA+
Sbjct  421   VSMCIGTGMGAAAVFERGDCVDELRNARTAENNNLLSKDAQ  461



>ref|XP_006410451.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
 dbj|BAJ34444.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51904.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
Length=462

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/461 (85%), Positives = 425/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4     AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62    LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                   QAQNCLLPMG+TSENVA RFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDET +T+SVDDGIRP+ ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   KTKLVDPKTGDETPITVSVDDGIRPSTTLATLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVE HG LSKDAR
Sbjct  422   VSMCIGTGMGAAAVFERGDGVDELRNARKVEAHGLLSKDAR  462



>ref|XP_009141289.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
Length=462

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/461 (85%), Positives = 425/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4     AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62    LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                   QAQ+CLLPMG+TSENVAHRFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKKFAQAQSCLLPMGVTSENVAHRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDET +T+SVDDGIRP+ ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   QTKLVDPKTGDETPITVSVDDGIRPSTTLATLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSLATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ+LYC+ KLGLD EK+NVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFLYCRNKLGLDEEKVNVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVE  GYLSKDAR
Sbjct  422   VSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGYLSKDAR  462



>ref|XP_009132912.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brassica 
rapa]
Length=460

 Score =   773 bits (1995),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/461 (85%), Positives = 422/461 (92%), Gaps = 4/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP    SS  S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4     AIERQRVLLEHLRP----SSSHSFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  59

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  60    LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  119

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  120   YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  179

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                  +QAQNCLLPMG+TSENVAHRFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  180   AVKKFEQAQNCLLPMGVTSENVAHRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  239

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDET +T+SVDDGIR + ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  240   KTKLVDPKTGDETPITVSVDDGIRASTTLATLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  299

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+RS+A QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  300   LLMRRSVATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  359

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  360   EAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  419

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVE  G+LSKDAR
Sbjct  420   VSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGFLSKDAR  460



>ref|XP_006294172.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
 gb|EOA27070.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
Length=462

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/461 (85%), Positives = 423/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP   ASS  + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4     AIERQRVLLEHLRP--CASSSHNFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG  KDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62    LCKSKRGNLKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                   QAQNCLLPMG+TSENVA RFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKQFVQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTG+E  +T+SVDDGIR + ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   KTKLVDPKTGEEKPITVSVDDGIRASTTLATLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVET G LSKDAR
Sbjct  422   VSMCIGTGMGAAAVFERGDGVDELRNARKVETQGLLSKDAR  462



>emb|CDY23766.1| BnaC04g43560D [Brassica napus]
Length=462

 Score =   771 bits (1992),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/461 (85%), Positives = 425/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4     AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62    LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                   QAQ+CLLPMG+TSENVAHRFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKKFAQAQSCLLPMGVTSENVAHRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDET +T+SVDDGIRP+ ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   QTKLVDPKTGDETPITVSVDDGIRPSTTLATLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ+LYC+ KLGLD EK+NVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFLYCRNKLGLDAEKVNVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVE  GYLSKDAR
Sbjct  422   VSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGYLSKDAR  462



>emb|CDY19452.1| BnaC04g11470D [Brassica napus]
Length=463

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/461 (85%), Positives = 427/461 (93%), Gaps = 1/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP++++SS  S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4     AIERQRVLLEHLRPSSSSSSH-SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  62

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTVLAPGS RASECRM+AF
Sbjct  63    LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVLAPGSQRASECRMSAF  122

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  123   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  182

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                  +QAQNCLLPMG+TSENVA RFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  183   AVKKFEQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  242

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDE  +T+SVDDGIRP+ ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  243   KTKLVDPKTGDEKPITVSVDDGIRPSTTLATLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  302

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+RS+A QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  303   LLMRRSVATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  362

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  363   EAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  422

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVE+HG LSKDAR
Sbjct  423   VSMCIGTGMGAAAVFERGDGVDELRNARKVESHGLLSKDAR  463



>ref|XP_012092655.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Jatropha curcas]
 gb|KDP20330.1| hypothetical protein JCGZ_06416 [Jatropha curcas]
Length=462

 Score =   771 bits (1991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/460 (86%), Positives = 425/460 (92%), Gaps = 2/460 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLL HLRP++++S   + ESS+SAS C AGDSAAYQR +V+GDD+VIVAAYRTP
Sbjct  4     AINRQRVLLDHLRPSSSSSH--NYESSLSASACLAGDSAAYQRTAVFGDDVVIVAAYRTP  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDT+ DDLLA VLKALIEKTNLN SEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62    LCKSKRGGFKDTHADDLLAPVLKALIEKTNLNASEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT+N MAW+G VNP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTINQMAWDGDVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    ++AQNCLLPMG+TSENVAHRFGVTRQEQDQAAVESHRKAAAATA GKFKDEIIPV
Sbjct  182   KVKIFEKAQNCLLPMGVTSENVAHRFGVTRQEQDQAAVESHRKAAAATATGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIRPN S+ DLAKLKPVFKKDGTTTAGNSSQ+TDGAGAV
Sbjct  242   ATKIVDPKTGDEKPVTISVDDGIRPNTSLSDLAKLKPVFKKDGTTTAGNSSQITDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGLEL DIDLFEIN
Sbjct  302   LLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLELGDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LD EKINVNGGAMAIGHPLGATGARCVATLLHEMKRRG+DCR+GV
Sbjct  362   EAFASQFVYCRKKLELDSEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             VSMCIGTGMGAA VFERGD CDEL NARK ET   LSKDA
Sbjct  422   VSMCIGTGMGAAAVFERGDGCDELCNARKAETDKLLSKDA  461



>ref|XP_009143894.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
 emb|CDY17140.1| BnaA05g10480D [Brassica napus]
Length=462

 Score =   769 bits (1987),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/461 (84%), Positives = 425/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4     AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTVLAPGS RASECRM+AF
Sbjct  62    LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVLAPGSQRASECRMSAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                  +QAQNCLLPMG+TSENVA RFGV+RQ+QDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKKFEQAQNCLLPMGVTSENVAQRFGVSRQDQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDE  +T+SVDDGIRP  ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   KTKLVDPKTGDEKPITVSVDDGIRPTTTLATLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+RS+A QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMRRSVATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVE+HG LSKDAR
Sbjct  422   VSMCIGTGMGAAAVFERGDGVDELRNARKVESHGLLSKDAR  462



>emb|CDX84701.1| BnaA03g15290D [Brassica napus]
Length=462

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/461 (84%), Positives = 425/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4     AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62    LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                  +QAQNCLLPMG+TSENVAHRFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKKFEQAQNCLLPMGVTSENVAHRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDET +T+SVDDGIR + ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   KTKLVDPKTGDETPITVSVDDGIRASTTLATLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+RS+A QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMRRSVATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVE  G+LSKDAR
Sbjct  422   VSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGFLSKDAR  462



>ref|XP_010509924.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/461 (85%), Positives = 424/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP +++S   S E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4     AIERQRVLLEHLRPCSSSSH--SFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRG FKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62    LCKAKRGNFKDTYPDDLLAPVLRALIEKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                   QAQNCLLPMG+TSENVA RFGVTRQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKQFVQAQNCLLPMGVTSENVAQRFGVTRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDE  +T+SVDDGIR + ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   KTKLVDPKTGDEKPITVSVDDGIRASTTLATLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKDAR
Sbjct  422   VSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR  462



>ref|XP_010413914.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Camelina sativa]
Length=462

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/461 (84%), Positives = 425/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP +++S   S E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4     AIERQRVLLEHLRPCSSSSH--SFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRG FKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62    LCKAKRGNFKDTYPDDLLAPVLRALIEKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                   QAQNCLLPMG+TSENVA RFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKKFVQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDE ++T+SVDDGIR + ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   KTKLVDPKTGDEKSITVSVDDGIRASTTLATLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKDAR
Sbjct  422   VSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR  462



>emb|CAA63598.1| glyoxysomal beta-ketoacyl-thiolase [Brassica napus]
Length=462

 Score =   768 bits (1982),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/461 (84%), Positives = 424/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4     AMERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTV APGS RASECRM+AF
Sbjct  62    LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVWAPGSQRASECRMSAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                  +QAQNCLLPMG+TSENVA RFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKKFEQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDE  +T+SVDDGIRP  ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   KTKLVDPKTGDEKPITVSVDDGIRPTTTLATLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+RS+A QKGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMRRSVATQKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVE+HG LSKDAR
Sbjct  422   VSMCIGTGMGAAAVFERGDGVDELRNARKVESHGLLSKDAR  462



>emb|CDX79511.1| BnaC03g18470D [Brassica napus]
Length=462

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/461 (84%), Positives = 425/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4     AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62    LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                  +QAQNCLLPMG+TSENVAHRFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKKFEQAQNCLLPMGVTSENVAHRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDET +T+SVDDGIR + ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   KTKLVDPKTGDETPITVSVDDGIRASTTLATLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+RS+A +KGLP+LGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMRRSVATRKGLPVLGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFVYCRNKLGLDAEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVE  G+LSKDAR
Sbjct  422   VSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGFLSKDAR  462



>ref|XP_010243983.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nelumbo nucifera]
Length=460

 Score =   765 bits (1976),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/459 (85%), Positives = 421/459 (92%), Gaps = 4/459 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLL HLRP    SS    +SS+SASVC AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4     AINRQRVLLDHLRP----SSQTHHQSSLSASVCLAGDSAAYHRTAAFGDDVVIVAAYRTA  59

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGG+KDT+PDDLLA VLKALIEKTNLNP+EVGDIIVGTVLAPGS RA+ECRMAAF
Sbjct  60    LCKSKRGGYKDTHPDDLLAPVLKALIEKTNLNPNEVGDIIVGTVLAPGSQRATECRMAAF  119

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT+N M WEGS+NP
Sbjct  120   YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTINPMGWEGSINP  179

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             RA   Q A++CLLPMGITSENVAHRFGV+RQEQDQAAVESHRKAAAATA+GKFKDEIIPV
Sbjct  180   RAKDFQPAEDCLLPMGITSENVAHRFGVSRQEQDQAAVESHRKAAAATASGKFKDEIIPV  239

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKIV+PKTG+E  VTISVDDGIRP+ S+  LAKLKPVFK+DG+TTAGNSSQV+DGAGAV
Sbjct  240   TTKIVDPKTGNEKHVTISVDDGIRPDTSLATLAKLKPVFKRDGSTTAGNSSQVSDGAGAV  299

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLELDDIDLFEIN
Sbjct  300   LLMKRSVAMQKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLELDDIDLFEIN  359

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKL LDPEK+NVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  360   EAFASQYVYCCKKLELDPEKVNVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  419

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  1486
             +SMCIGTGMGAA VFERGD  D L NAR+V T+  LSKD
Sbjct  420   ISMCIGTGMGAAAVFERGDCVDPLCNARQVGTNNLLSKD  458



>ref|NP_001267690.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis sativus]
 emb|CAA47926.1| 3-ketoacyl-CoA thiolase [Cucumis sativus]
 gb|KGN56763.1| hypothetical protein Csa_3G133140 [Cucumis sativus]
Length=462

 Score =   764 bits (1974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/462 (83%), Positives = 425/462 (92%), Gaps = 4/462 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ +LL HLRP+   SS  + ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4     AINRQSILLHHLRPS---SSAYTNESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKSKRGGFKDTYPDDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61    ICKSKRGGFKDTYPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  121   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMAWEGSVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R  +++ AQNCLLPMG+TSENVA RFGV+R++QDQAA+ESHRKAAAATA+GKFKDEIIPV
Sbjct  181   RVKSIENAQNCLLPMGVTSENVAQRFGVSREKQDQAAIESHRKAAAATASGKFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKI++PKTG E  VTISVDDGIRPN +  DL KLK VFKKDGTTTAGNSSQV+DGAGAV
Sbjct  241   STKIIDPKTGQEKPVTISVDDGIRPNTTQADLGKLKAVFKKDGTTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTF+AVGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEIN
Sbjct  301   LLMKRSVAMRKGLPILGVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLELNDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  361   EAFASQFVYCRNKLGLDPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETH-GYLSKDAR  1492
             +SMCIGTGMGAA VFERGD  DEL NA+KVE     LSKDAR
Sbjct  421   ISMCIGTGMGAAAVFERGDCVDELCNAKKVEGGVNLLSKDAR  462



>ref|XP_004138952.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN61456.1| hypothetical protein Csa_2G129150 [Cucumis sativus]
Length=461

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/459 (85%), Positives = 427/459 (93%), Gaps = 3/459 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLL HLRP+++  S    +SS+SAS C AGDSAAYQR+SV+GDD+VIVAAYRT 
Sbjct  4     AINRQKVLLHHLRPSSSLPSH---DSSLSASACLAGDSAAYQRSSVFGDDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDT+PDDLLA VLKALIEKTNLNPSEVGDIIVG+VL PGS RASECRMAAF
Sbjct  61    LCKSKRGGFKDTHPDDLLAPVLKALIEKTNLNPSEVGDIIVGSVLGPGSQRASECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  121   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QA+NCLLPMGITSENVAHRFGVTR++QDQAAVESHRKAAAATA+G+FKDEIIPV
Sbjct  181   KVKMFEQAKNCLLPMGITSENVAHRFGVTREQQDQAAVESHRKAAAATASGRFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TK+V+PKTG+E + T+SVDDGIRPNAS+ DLAKLKPVFKKDG+TTAGN+SQV+DGAGAV
Sbjct  241   STKLVDPKTGEEKSFTVSVDDGIRPNASLADLAKLKPVFKKDGSTTAGNASQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+AI+KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  301   LLMKRSVAIKKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KL LDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  361   EAFASQFVYCRNKLELDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  1486
             +SMCIGTGMGAA VFERGD  DEL NARKV+ H  LSKD
Sbjct  421   ISMCIGTGMGAAAVFERGDVADELCNARKVDNHNLLSKD  459



>gb|EPS68937.1| hypothetical protein M569_05826, partial [Genlisea aurea]
Length=457

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/460 (81%), Positives = 426/460 (93%), Gaps = 6/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A++RQRVLL+HLRP      +++ ESS+SAS+CAAGDSA Y R+SV+GDD+VIVAAYR+ 
Sbjct  4     AVDRQRVLLRHLRP------IENTESSISASICAAGDSAPYHRSSVFGDDVVIVAAYRSA  57

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG FKDTYP+D+LA VL+ALI+KTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  58    LCKSKRGSFKDTYPEDILAPVLRALIDKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  117

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAW+GSVNP
Sbjct  118   YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWDGSVNP  177

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R  T+ QAQ+CLLPMGITSENVA RFGV+R EQDQAAVESHRKAAAATA+GKFKDEIIP+
Sbjct  178   RVKTMAQAQDCLLPMGITSENVAQRFGVSRLEQDQAAVESHRKAAAATASGKFKDEIIPI  237

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTG+E  +T++VDDGIRP  S+ +L KLKPVFKKDG+TTAGNSSQV+DGAGAV
Sbjct  238   KTKLVDPKTGEEKEITVAVDDGIRPQTSVSELGKLKPVFKKDGSTTAGNSSQVSDGAGAV  297

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A QKGLPILGVFR+FAAVGVDPA+MGIGPAVAIPAAVK+AGLE+ DIDL+EIN
Sbjct  298   LLMKRSVAAQKGLPILGVFRSFAAVGVDPAIMGIGPAVAIPAAVKAAGLEISDIDLYEIN  357

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LDPEKINVNGGA+AIGHPLGATGARCV TLLHEMKRRG+DCR+GV
Sbjct  358   EAFASQFVYCRKKLELDPEKINVNGGAIAIGHPLGATGARCVGTLLHEMKRRGRDCRFGV  417

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIGTGMGAA VFERGD+CDELSNARK+E H +LS+DA
Sbjct  418   ISMCIGTGMGAAAVFERGDSCDELSNARKIERHNFLSRDA  457



>pir||S72532 acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor - cucurbit
 dbj|BAA11117.1| 3-ketoacyl-CoA thiolase [Cucurbita cv. Kurokawa Amakuri]
Length=461

 Score =   760 bits (1963),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/461 (84%), Positives = 425/461 (92%), Gaps = 3/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ +LL HLRP+++A S    ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4     AINRQSILLHHLRPSSSAYSH---ESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMA F
Sbjct  61    LCKSKRGGFKDTYPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMATF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             Y GFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMTVN MAW+GSVNP
Sbjct  121   YPGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTVNPMAWDGSVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R  +++ AQNCLLPMG+TSENVA RFGV+R+EQD+AAVESHRKAAAATA+GKFKDEIIPV
Sbjct  181   RVKSMENAQNCLLPMGVTSENVAQRFGVSREEQDKAAVESHRKAAAATASGKFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKI++PKTG+E  VTISVDDGIRPN +  DL KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  241   STKIIDPKTGEERPVTISVDDGIRPNTTQADLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFRTF AVGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEIN
Sbjct  301   LLMKRSVAMQKGLPILGVFRTFTAVGVDPAIMGVGPAVAIPAAVKAAGLELNDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGARCVATLLHEMKRRGKDCR+GV
Sbjct  361   EAFASQFVYCRNKLGLDPEKINVNGGAIAIGHPLGTTGARCVATLLHEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIGTGMGAA VFERGD  DEL NA+KVE    LSKDAR
Sbjct  421   ISMCIGTGMGAAAVFERGDCVDELCNAKKVEGINLLSKDAR  461



>ref|XP_007225742.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26941.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=462

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/462 (83%), Positives = 425/462 (92%), Gaps = 4/462 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIE-SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  286
             A  RQRVLL HLRP+  +SSL   + SS+SAS C AGDSAAY R +V+GDD+VIVAAYRT
Sbjct  4     AFNRQRVLLDHLRPS--SSSLHGTDPSSLSASACVAGDSAAYARKNVFGDDVVIVAAYRT  61

Query  287   PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  466
             P+CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAA
Sbjct  62    PICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAA  121

Query  467   FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  646
             FYAGFPETVP+RTVNRQCSSGLQAVADVAA+I+AGFYDIGIGAGLESMT N MAWEGSVN
Sbjct  122   FYAGFPETVPIRTVNRQCSSGLQAVADVAASIRAGFYDIGIGAGLESMTANPMAWEGSVN  181

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
             P+    +QAQNCLLPMG+TSENVAHRFGV+RQEQDQAAV+SHRKAAAATA GKFKDEIIP
Sbjct  182   PKVKIFEQAQNCLLPMGVTSENVAHRFGVSRQEQDQAAVDSHRKAAAATATGKFKDEIIP  241

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             V TKIV+PK+G+E  VTISVDDGIR N ++ DLAKLKPVFKKDG+TTAGNSSQV+DGAGA
Sbjct  242   VATKIVDPKSGEEKPVTISVDDGIR-NTTLADLAKLKPVFKKDGSTTAGNSSQVSDGAGA  300

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
             VLLMKRS+A +KGLPILGVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEI
Sbjct  301   VLLMKRSIAERKGLPILGVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEI  360

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQY+YC+ KLGLDPEKINVNGGA+AIGHPLGATGAR VATLLHEMKRRGKDCR+G
Sbjct  361   NEAFASQYVYCRNKLGLDPEKINVNGGALAIGHPLGATGARAVATLLHEMKRRGKDCRFG  420

Query  1367  VVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             V+SMCIGTGMGAA VFERGD+ DEL NARKVE+  +LSKDAR
Sbjct  421   VISMCIGTGMGAAAVFERGDSTDELCNARKVESLNHLSKDAR  462



>ref|XP_008224585.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=462

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/462 (82%), Positives = 425/462 (92%), Gaps = 4/462 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESS-VSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  286
             A  RQRVLL HLRP+  +SSL   +SS +SAS C AGDSAAY R +V+GDD+VIVAAYRT
Sbjct  4     AFNRQRVLLDHLRPS--SSSLHGTDSSSLSASACVAGDSAAYARTNVFGDDVVIVAAYRT  61

Query  287   PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  466
             P+CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAA
Sbjct  62    PICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAA  121

Query  467   FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  646
             FYAGFPETVP+RTVNRQCSSGLQAVADVAA+I+AGFYDIGIGAGLESMT N MAWEGSVN
Sbjct  122   FYAGFPETVPIRTVNRQCSSGLQAVADVAASIRAGFYDIGIGAGLESMTANPMAWEGSVN  181

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
             P+    +QAQNCLLPMG+TSENVAHRFGV+RQEQDQAAV+SHRKAAAATA GKFKDEIIP
Sbjct  182   PKVKIFEQAQNCLLPMGVTSENVAHRFGVSRQEQDQAAVDSHRKAAAATATGKFKDEIIP  241

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             V TKIV+PK+G+E  VTISVDDGIR N ++ DLAKLKPVFKKDG+TTAGNSSQV+DGAGA
Sbjct  242   VATKIVDPKSGEEKPVTISVDDGIR-NTTLADLAKLKPVFKKDGSTTAGNSSQVSDGAGA  300

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
             VLLMKRS+A +KGLPILGVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEI
Sbjct  301   VLLMKRSIAERKGLPILGVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEI  360

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQY+YC+ KLGLDPEKINVNGGA+AIGHPLGATGAR VATLLHEMKRRG+DCR+G
Sbjct  361   NEAFASQYVYCRNKLGLDPEKINVNGGALAIGHPLGATGARAVATLLHEMKRRGRDCRFG  420

Query  1367  VVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             V+SMCIGTGMGAA VFERGD+ DEL NARKVE+  +LSKDAR
Sbjct  421   VISMCIGTGMGAAAVFERGDSTDELCNARKVESPNHLSKDAR  462



>ref|XP_011002175.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Populus euphratica]
Length=462

 Score =   758 bits (1957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/461 (82%), Positives = 421/461 (91%), Gaps = 4/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLL HLRP+   SS  + ES++SAS C AGDSAAYQR S YGDD+VIVAAYRTP
Sbjct  4     AINRQRVLLDHLRPS---SSSHNFESTLSASACLAGDSAAYQRTSAYGDDVVIVAAYRTP  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
              CKSKRGGFKDT+ DDLLA VLKALIEKTNL+P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61    QCKSKRGGFKDTHADDLLAPVLKALIEKTNLDPREVGDIVVGSVLAPGSQRASECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAA+IKAGFY+IGIGAGLESMT+N M+W+G VNP
Sbjct  121   YAGFPETVPVRTVNRQCSSGLQAVADVAASIKAGFYEIGIGAGLESMTINQMSWDGDVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    Q+AQ+CLLPMG+TSENVAHRFGVTRQEQDQAAV+SHRKAAAATA+G+FKDEIIPV
Sbjct  181   KLKNFQKAQDCLLPMGVTSENVAHRFGVTRQEQDQAAVDSHRKAAAATASGRFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  + +SVDDGIRP  S+  L KLKPVFKKDGTTTAGNSSQ++DGAGAV
Sbjct  241   ATKIVDPKTGDEKPIIVSVDDGIRPETSVAGLGKLKPVFKKDGTTTAGNSSQISDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEIN
Sbjct  301   LLMKRSVAVQKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELEDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LDP+KINVNGGAMAIGHPLGATGARCVATLLHEMKRRG+DCR+GV
Sbjct  361   EAFASQFVYCRKKLELDPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSN-ARKVETHGYLSKDA  1489
             VSMCIGTGMGAA VFERGD CDEL N  RKVE++  LS+D+
Sbjct  421   VSMCIGTGMGAAAVFERGDGCDELCNGGRKVESNNLLSRDS  461



>ref|XP_002299284.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
 gb|EEE84089.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
Length=461

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/462 (82%), Positives = 421/462 (91%), Gaps = 5/462 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLL+HLRP    SS  + ES++SAS C AGDSAAYQR S YGDD+VIVAAYRTP
Sbjct  4     AINRQRVLLEHLRP----SSSHNFESTLSASACLAGDSAAYQRTSAYGDDVVIVAAYRTP  59

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
              CKSKRGGFKDT+ DDLLA VLKALIEKTNL+P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  60    QCKSKRGGFKDTHADDLLAPVLKALIEKTNLDPREVGDIVVGSVLAPGSQRASECRMAAF  119

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFY+IGIGAGLESMT+N M+W+G VNP
Sbjct  120   YAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYEIGIGAGLESMTINQMSWDGDVNP  179

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    Q+AQ+CLLPMGITSENVAHRFGVTRQEQDQAAV+SHRKAAAATA+G+FKDEIIPV
Sbjct  180   KLKNFQKAQDCLLPMGITSENVAHRFGVTRQEQDQAAVDSHRKAAAATASGRFKDEIIPV  239

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  + +SVDDGIRP  S+  L KLK VFKKDGTTTAGNSSQ++DGAGAV
Sbjct  240   ATKIVDPKTGDEKPIVVSVDDGIRPETSVAGLGKLKTVFKKDGTTTAGNSSQISDGAGAV  299

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEIN
Sbjct  300   LLMKRSVAVQKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELEDIDLFEIN  359

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LDP+KINVNGGAMAIGHPLGATGARCVATLLHEMKRRG+DCR+GV
Sbjct  360   EAFASQFVYCRKKLELDPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGV  419

Query  1370  VSMCIGTGMGAAGVFERGDACDELSN-ARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD CDEL N  RKVE++  LS+D+R
Sbjct  420   VSMCIGTGMGAAAVFERGDGCDELCNGGRKVESNNLLSRDSR  461



>ref|XP_010469514.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   757 bits (1955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/461 (84%), Positives = 424/461 (92%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP +++S   S ESS+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4     AIERQRVLLEHLRPCSSSSH--SFESSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRG FKDTYPDDLLA VL+ALI+KTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62    LCKAKRGNFKDTYPDDLLAPVLRALIDKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                   QAQNCLLPMG+TSENVA RFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKKFVQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDE  +T+SVDDGIR + ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   KTKLVDPKTGDEKPITVSVDDGIRASTTLATLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKDAR
Sbjct  422   VSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR  462



>gb|AAQ77242.1| acetoacetyl CoA thiolase [Helianthus annuus]
Length=449

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/448 (84%), Positives = 418/448 (93%), Gaps = 4/448 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP++ +SSL+++    S SVCAAGDSAAYQRNSV+GDD+VIVAAYR+P
Sbjct  4     AIERQRVLLEHLRPSSTSSSLENL----SVSVCAAGDSAAYQRNSVFGDDVVIVAAYRSP  59

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRGG KDTYPDD+LA VLKALIEKTN+NP+EVGDI+VG+VL  GS RASECRMAAF
Sbjct  60    LCKAKRGGLKDTYPDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAF  119

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  120   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNP  179

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +  T+ QAQ+CLLPMGITSENVA +F +TRQEQDQAAV SHRKAAAATAAG+FKDEIIP+
Sbjct  180   KVKTMAQAQDCLLPMGITSENVAQKFSITRQEQDQAAVGSHRKAAAATAAGRFKDEIIPI  239

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIRP  S+ DLAKLKPVF+KDG+TTAG SSQV+DGAGAV
Sbjct  240   KTKIVDPKTGDEKPVTISVDDGIRPGTSLADLAKLKPVFRKDGSTTAGTSSQVSDGAGAV  299

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFRTFAAVGV P++MGIGPAVAIPAAVK+AGL++DDIDLFEIN
Sbjct  300   LLMKRSIALQKGLPILGVFRTFAAVGVPPSIMGIGPAVAIPAAVKAAGLQIDDIDLFEIN  359

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YCQKKL +DP+KINVNGGAMAIGHPLGATGARCVATLLHEMKRRG+DCR+GV
Sbjct  360   EAFASQFVYCQKKLEIDPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGV  419

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNAR  1453
             VSMCIGTGMGAA VFERGDACDEL NA+
Sbjct  420   VSMCIGTGMGAAAVFERGDACDELCNAK  447



>ref|XP_004296638.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   753 bits (1944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/461 (84%), Positives = 422/461 (92%), Gaps = 6/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLL HLRP++++       SS+SASVCAAGDSAAY RN V+GDD+VIVAAYRTP
Sbjct  4     AINRQKVLLDHLRPSSSSDD-----SSLSASVCAAGDSAAYARNHVFGDDVVIVAAYRTP  58

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRGGFKDTY DDLLA VLKA++EKTNLNP EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  59    LCKAKRGGFKDTYADDLLAPVLKAVVEKTNLNPKEVGDIVVGTVLAPGSQRASECRMAAF  118

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N MAWEG VNP
Sbjct  119   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTANPMAWEGDVNP  178

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMGITSENVAHRFGV+RQEQDQAAV+SHRKAAAATAAG+FKDEIIPV
Sbjct  179   KVKIFEQAQNCLLPMGITSENVAHRFGVSRQEQDQAAVDSHRKAAAATAAGRFKDEIIPV  238

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PK+GDE  VTISVDDGIR N ++ DLAKLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  239   ATKIVDPKSGDEKPVTISVDDGIR-NTTLADLAKLKPVFKKDGTTTAGNSSQVSDGAGAV  297

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A QKGLPILGVFR+F AVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEIN
Sbjct  298   LLMKRSVADQKGLPILGVFRSFVAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEIN  357

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV
Sbjct  358   EAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  417

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIGTGMGAA VFERGD  DEL NARKV++  +LSKDAR
Sbjct  418   ISMCIGTGMGAAAVFERGDRTDELCNARKVDSLNFLSKDAR  458



>pdb|2WU9|A Chain A, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
 pdb|2WU9|B Chain B, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
Length=442

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/427 (87%), Positives = 397/427 (93%), Gaps = 0/427 (0%)
 Frame = +2

Query  212   AGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPS  391
             AGDSAAYQR S+YGDD+VIVAA+RTPLCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS
Sbjct  16    AGDSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPS  75

Query  392   EVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaG  571
             EVGDI+VGTVLAPGS RASECRMAAFYAGFPETV VRTVNRQCSSGLQAVADVAAAIKAG
Sbjct  76    EVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAG  135

Query  572   FYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQD  751
             FYDIGIGAGLESMT N MAWEGSVNP      QAQNCLLPMG+TSENVA RFGV+RQEQD
Sbjct  136   FYDIGIGAGLESMTTNPMAWEGSVNPAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQD  195

Query  752   QAAVESHRKaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAK  931
             QAAV+SHRKAAAATAAGKFKDEIIPV TK+V+PKTGDE  +T+SVDDGIRP  ++  L K
Sbjct  196   QAAVDSHRKAAAATAAGKFKDEIIPVKTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGK  255

Query  932   LKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGI  1111
             LKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGI
Sbjct  256   LKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGI  315

Query  1112  GPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPL  1291
             GPAVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPL
Sbjct  316   GPAVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPL  375

Query  1292  GATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHG  1471
             GATGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G
Sbjct  376   GATGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQG  435

Query  1472  YLSKDAR  1492
              LSKDAR
Sbjct  436   LLSKDAR  442



>ref|XP_002518136.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF44269.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=460

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/460 (83%), Positives = 424/460 (92%), Gaps = 4/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ++LL HLRP+ ++SSL + +SS+SAS C+AGDSAAYQR SVYGDD+VIVAA+RT 
Sbjct  4     AINRQKILLDHLRPS-SSSSLHNYDSSLSASACSAGDSAAYQRTSVYGDDVVIVAAHRTA  62

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDT+ DDLLA VLKALIEKT LNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  63    LCKSKRGGFKDTFADDLLAPVLKALIEKTKLNPSEVGDIVVGTVLAPGSQRASECRMAAF  122

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDI   AG+ESMT+N M+W+G VNP
Sbjct  123   YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDI---AGVESMTINPMSWDGDVNP  179

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMG+TSENVAHRFGVTRQEQDQAAV+SHRKAAAATAAGKFKDEI+PV
Sbjct  180   KVKAFEQAQNCLLPMGVTSENVAHRFGVTRQEQDQAAVDSHRKAAAATAAGKFKDEIVPV  239

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKT +E  +T+SVDDGIRPN S+ DL KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  240   ATKIVDPKTREEKPITVSVDDGIRPNTSVSDLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  299

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKR +A+ KGLPILGVFR+FAAVGVDPA+MGIGPAVAIPAAVK+AGLEL+DIDLFEIN
Sbjct  300   LLMKRCVAMHKGLPILGVFRSFAAVGVDPAIMGIGPAVAIPAAVKAAGLELNDIDLFEIN  359

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LDPE+INVNGGAMAIGHPLGATGARCVATLLHEMKRRG+DCR+GV
Sbjct  360   EAFASQFVYCRKKLELDPERINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGV  419

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             VSMCIGTGMGAA VFERGDACD+L NARKVET   LSKDA
Sbjct  420   VSMCIGTGMGAAAVFERGDACDDLCNARKVETSNLLSKDA  459



>ref|XP_006854408.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Amborella 
trichopoda]
 ref|XP_011627050.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Amborella 
trichopoda]
 gb|ERN15875.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
Length=460

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/457 (82%), Positives = 419/457 (92%), Gaps = 4/457 (1%)
 Frame = +2

Query  119   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  298
             RQ++LL HLRP+  ASS ++  S++ ASVC AGDSAAY R++ +GDD+VIVAAYRT  CK
Sbjct  7     RQKILLDHLRPS--ASSQEN--SNLQASVCLAGDSAAYARSAPFGDDVVIVAAYRTAQCK  62

Query  299   SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  478
             SKRGGFKDT+P+DLLA VLKALI+KT L+P EVGDI+VGTVLAPGS RASECRMAAFYAG
Sbjct  63    SKRGGFKDTFPEDLLAPVLKALIDKTKLDPREVGDIVVGTVLAPGSQRASECRMAAFYAG  122

Query  479   FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  658
             +PETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N+MAW+GS+NPRAS
Sbjct  123   YPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANSMAWDGSINPRAS  182

Query  659   TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTTK  838
             T  QAQ+CLLPMGITSENVAHRFGVTRQEQDQAAVESHR+AAAATAAGKFKDEIIPV TK
Sbjct  183   TNTQAQDCLLPMGITSENVAHRFGVTRQEQDQAAVESHRRAAAATAAGKFKDEIIPVDTK  242

Query  839   IVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLM  1018
             IV+PKTG E  VTISVDDGIRP+ S+ DLAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLM
Sbjct  243   IVDPKTGAEKRVTISVDDGIRPSTSLADLAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLM  302

Query  1019  KRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAF  1198
             +RS+A+QKGLPI GVFR+F AVGVDPAVMG+GPAVAIPAAVK+AGLEL+DIDLFEINEAF
Sbjct  303   RRSVALQKGLPIFGVFRSFVAVGVDPAVMGVGPAVAIPAAVKAAGLELNDIDLFEINEAF  362

Query  1199  ASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSM  1378
              SQ++YC+ KLGLDPEK+NVNGGAMAIGHPLGATGARCVATLLHEMKR+GKDCR+GV+SM
Sbjct  363   GSQFVYCRNKLGLDPEKVNVNGGAMAIGHPLGATGARCVATLLHEMKRQGKDCRFGVISM  422

Query  1379  CIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             CIGTGMGAA VFERGD  D L+NARK+     LSKDA
Sbjct  423   CIGTGMGAAAVFERGDGVDPLNNARKIGASNLLSKDA  459



>ref|NP_001238475.1| peroxisomal 3-ketoacyl-CoA thiolase [Glycine max]
 dbj|BAG09380.1| peroxisomal 3-ketoacyl-CoA thiolase precursor [Glycine max]
 gb|KHN21671.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=463

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/461 (81%), Positives = 416/461 (90%), Gaps = 3/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S +GDD+VIVAAYRT 
Sbjct  4     AINRQKILLHHLNPSSSTHPNES--SSLHASACVAGDSAAYQRTSTFGDDVVIVAAYRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
              CK+KRGGFKDT PDDLLA VLKA+IEKTN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62    HCKAKRGGFKDTLPDDLLAPVLKAVIEKTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N M W+GSVNP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMGWDGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMGITSENVA RFGV+R+EQDQAAVESHR+AAAATAAGKFKDEI+PV
Sbjct  182   KVKMFEQAQNCLLPMGITSENVAQRFGVSRKEQDQAAVESHRRAAAATAAGKFKDEIVPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKIV+PKTG+E +VTISVDDGIRP  ++ DL +LKPVFKKDG+TTAGNSSQVTDGA AV
Sbjct  242   TTKIVDPKTGEEKSVTISVDDGIRPGTTVSDLGRLKPVFKKDGSTTAGNSSQVTDGASAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVALQKGLPILGVFRTFAAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLG+TGARCVATLLHEMK+RG+DCR+GV
Sbjct  362   EAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGSTGARCVATLLHEMKKRGRDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIGTGMGAA VFE GD  DEL NARKV+    LSKDAR
Sbjct  422   ISMCIGTGMGAAAVFESGDCADELCNARKVDDL-LLSKDAR  461



>ref|XP_004497755.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=458

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/461 (82%), Positives = 422/461 (92%), Gaps = 6/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLLQHL P+ ++SS     +S+SAS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4     AINRQKVLLQHLNPSQSSSS-----TSLSASACLAGDSAAYHRTASFGDDVVIVAAYRTA  58

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRGGFKDT+ DDLLA VLKA+IEKTNLNPSEVGDI+VG+VL  GS RASECRMAAF
Sbjct  59    LCKAKRGGFKDTHADDLLAPVLKAVIEKTNLNPSEVGDIVVGSVLGGGSQRASECRMAAF  118

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  119   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMAWEGSVNP  178

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMGITSENV++RFGV+R+EQD+AAVESHR+AAAATA+GKFKDEIIPV
Sbjct  179   KVQMFEQAQNCLLPMGITSENVSNRFGVSRKEQDEAAVESHRRAAAATASGKFKDEIIPV  238

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E +VTISVDDGIRPNA++ DLAKLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  239   LTKIVDPKTGEEKSVTISVDDGIRPNATLSDLAKLKPVFKKDGTTTAGNSSQVSDGAGAV  298

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+AIQKGLPILGVFR+F AVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEIN
Sbjct  299   LLMKRSIAIQKGLPILGVFRSFVAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEIN  358

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLD +KINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  359   EAFASQFVYCRNKLGLDSQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  418

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIGTGMGAA VFERGD+ DEL NARKV+   YLSKDAR
Sbjct  419   ISMCIGTGMGAAAVFERGDSVDELRNARKVDDL-YLSKDAR  458



>gb|KDO43599.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=445

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/459 (82%), Positives = 413/459 (90%), Gaps = 19/459 (4%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4     AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62    LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIG                 SVNP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIG-----------------SVNP  164

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMG+TSENVAHRFGVTR+EQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  165   KVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQAAVDSHRKAAAATAAGKFKDEIIPV  224

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIRPN S+ +LAKLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  225   ATKIVDPKTGDEKPVTISVDDGIRPNTSVSELAKLKPVFKKDGTTTAGNSSQVSDGAGAV  284

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+LDDIDLFEIN
Sbjct  285   LLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEIN  344

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGARCVATLLHEMKRRG+DCR+GV
Sbjct  345   EAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGV  404

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  1486
             +SMCIGTGMGAA VFERGD  DEL N RKVE++ +LSKD
Sbjct  405   ISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKD  443



>ref|XP_008800565.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=461

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/460 (79%), Positives = 423/460 (92%), Gaps = 3/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLLQHL+P++ + +   +   +SAS+CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4     AINRQRVLLQHLQPSSPSPNESPM---LSASICAAGDSAAYQRSSCFGDDVVVVAAYRTP  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKSKRGGFKDTYP+DLLA+VLK L++KT LNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61    ICKSKRGGFKDTYPEDLLATVLKGLLDKTKLNPNEVGDIVVGTVLAPGSQRATECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPE VPVRTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT N+++WEGS+NP
Sbjct  121   YAGFPENVPVRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTANSVSWEGSINP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             + +TLQQAQ CLLPMGITSENVAHR+GVTRQEQDQAAVESHR+AAAATA+GKF+DEIIPV
Sbjct  181   KVNTLQQAQACLLPMGITSENVAHRYGVTRQEQDQAAVESHRRAAAATASGKFRDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKIV+PKTG E  VTIS+DDG RP++S+  LAKLKPVF+KDG+TTAGNSSQV+DGA AV
Sbjct  241   TTKIVDPKTGKEKQVTISMDDGFRPDSSLSSLAKLKPVFQKDGSTTAGNSSQVSDGAAAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +AI+KG PI GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL+++DIDLFE+N
Sbjct  301   LLMRRDVAIKKGFPIFGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLQIEDIDLFELN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGARCVATLL+EMKR+GKDCR+GV
Sbjct  361   EAFASQFVYCCKKLELDPAKVNVNGGAIALGHPLGATGARCVATLLNEMKRKGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             V+MCIG+GMGAA VFERGD  DEL NARK+++   LSKDA
Sbjct  421   VTMCIGSGMGAAAVFERGDGVDELCNARKIQSQNLLSKDA  460



>ref|XP_011020687.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Populus euphratica]
Length=460

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/457 (80%), Positives = 413/457 (90%), Gaps = 2/457 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL HLRP+  + S  + ES++SAS C AGDS AYQR S +GDD+VIVAAYRTP
Sbjct  4     AIDRQRVLLDHLRPS--SPSHHNFESTLSASACLAGDSTAYQRTSAFGDDVVIVAAYRTP  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSK G FKDT+ DDLLA VLKALIEKTN++P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  62    LCKSKGGSFKDTHADDLLAPVLKALIEKTNVDPREVGDIVVGSVLAPGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADV A+IKAGFY+IGIGAGLESMT+N MAW+G VNP
Sbjct  122   YAGFPETVPIRTVNRQCSSGLQAVADVVASIKAGFYEIGIGAGLESMTINPMAWDGDVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    Q+AQ+CLLPMG+TSENVAH FGVTRQEQDQAAV+SHRKAAAATA+G+FKDEIIPV
Sbjct  182   KVKDFQKAQDCLLPMGVTSENVAHCFGVTRQEQDQAAVDSHRKAAAATASGRFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  + ISVDDGIRPN ++ +L KLKP+FKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   PTKIVDPKTGDEKPIVISVDDGIRPNTTLIELGKLKPLFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+ KGLPILGVFRTF AVGVDPA+MG+GPAVAIPAAVK+AGL L+DIDLFEIN
Sbjct  302   LLMKRSVAMHKGLPILGVFRTFTAVGVDPAIMGVGPAVAIPAAVKAAGLALEDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LD +KINVNGGAMAIGHPLGATGARCVATLLHEMKRRG+DCR+GV
Sbjct  362   EAFASQFVYCRKKLELDSQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLS  1480
             VSMCIGTGMGAA VFERGD CDEL N RKVE++  LS
Sbjct  422   VSMCIGTGMGAAAVFERGDGCDELCNGRKVESNNLLS  458



>ref|XP_009376354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=459

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/462 (83%), Positives = 425/462 (92%), Gaps = 7/462 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLL HLRP +A SS     SS+SAS CAAGDSAAY R +V+GDD+VIVAAYRTP
Sbjct  4     AINRQRVLLDHLRPPSADSS-----SSLSASACAAGDSAAYARTNVFGDDVVIVAAYRTP  58

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT+ DDLLA VLKA++EKTN+NPSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  59    ICKAKRGGFKDTHADDLLAPVLKAVVEKTNVNPSEIGDIVVGTVLAPGSQRASECRMAAF  118

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAA+I+AGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  119   YAGFPETVPIRTVNRQCSSGLQAVADVAASIRAGFYDIGIGAGLESMTANPMAWEGSVNP  178

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMGITSENVAHRFGV+R+EQDQAAV+SHRKAAAATA GKFKDEIIPV
Sbjct  179   KVKIFEQAQNCLLPMGITSENVAHRFGVSRKEQDQAAVDSHRKAAAATATGKFKDEIIPV  238

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PK+G+E  VTISVDDGIR N ++ DLAKLKPVFKKDG+TTAGNSSQV+DGAGAV
Sbjct  239   ATKIVDPKSGEEKPVTISVDDGIR-NTTLADLAKLKPVFKKDGSTTAGNSSQVSDGAGAV  297

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A QKGLPILGVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  298   LLMKRSVAEQKGLPILGVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  357

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQYLYC+ KLGLDPEKINVNGGA+AIGHPLGATGAR VATLLHEMKRRGKDCR+GV
Sbjct  358   EAFASQYLYCRNKLGLDPEKINVNGGALAIGHPLGATGARTVATLLHEMKRRGKDCRFGV  417

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGY-LSKDAR  1492
             +SMCIGTGMGAA VFERGD+ D L NARKVETH + LSKDAR
Sbjct  418   ISMCIGTGMGAAAVFERGDSVDGLCNARKVETHIHLLSKDAR  459



>ref|XP_009385864.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=463

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/460 (80%), Positives = 422/460 (92%), Gaps = 2/460 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL+HLRP+ ++S   S    +SASVCAAGDSAAYQRNS +GDD+V+VAAYRT 
Sbjct  4     AIDRQRVLLRHLRPSPSSSPNGS--HLISASVCAAGDSAAYQRNSCFGDDVVVVAAYRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKSKRGGFKDTYP++LL  VLKAL++KTNLNP+EVGDI+VGTVLAPG+ RA+ECRMAAF
Sbjct  62    ICKSKRGGFKDTYPEELLTVVLKALLDKTNLNPNEVGDIVVGTVLAPGAQRATECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIK+GFYDIGIGAGLESMT N+M+W+GS+NP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKSGFYDIGIGAGLESMTTNSMSWDGSINP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             + +  QQAQNCLLPMGITSENVAHR+GVTRQEQDQAAV SHRKAAAATAAGKFK+EIIPV
Sbjct  182   KVNAFQQAQNCLLPMGITSENVAHRYGVTRQEQDQAAVNSHRKAAAATAAGKFKEEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKIV+PKTG+E  VTISVDDGIRP  SI  LAKLKPVFKKDG+TTAGNSSQV+DGAGAV
Sbjct  242   TTKIVDPKTGEEKQVTISVDDGIRPETSISSLAKLKPVFKKDGSTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A+Q G PILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGL+++DIDLFEIN
Sbjct  302   LLMRRDVAMQNGFPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLQIEDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC KKL LD  K+NVNGGA+A+GHPLGATGAR V+TLL+EMKRRGKDCR GV
Sbjct  362   EAFASQFVYCCKKLELDATKVNVNGGAIALGHPLGATGARSVSTLLNEMKRRGKDCRLGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIGTGMGAA VFERGDA D L+NAR++++H  LSKDA
Sbjct  422   ISMCIGTGMGAAAVFERGDATDGLTNARRMQSHNLLSKDA  461



>ref|XP_008438387.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Cucumis melo]
Length=462

 Score =   736 bits (1900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/462 (83%), Positives = 427/462 (92%), Gaps = 4/462 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ +LL HLRP+++A S    ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4     AINRQNILLHHLRPSSSAYSH---ESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTY DDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61    LCKSKRGGFKDTYADDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT+N MAWEGSVNP
Sbjct  121   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTINPMAWEGSVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R  +++ AQNCLLPMG+TSENVA RFGV+R++QDQAA+ESHRKAAAATA+GKFKDEIIPV
Sbjct  181   RVKSMENAQNCLLPMGVTSENVAQRFGVSREKQDQAAIESHRKAAAATASGKFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKI++PKTG E  VTISVDDGIRPN +  DL KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  241   STKIIDPKTGQEKPVTISVDDGIRPNTTQADLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTF+AVGVDPA+MG+GPA AIPAAVK+AGLEL+DIDLFEIN
Sbjct  301   LLMKRSVAMRKGLPILGVFRTFSAVGVDPAIMGVGPAAAIPAAVKAAGLELNDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC++KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  361   EAFASQFVYCREKLGLDPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETH-GYLSKDAR  1492
             +SMCIGTGMGAA VFERGD  DEL NA+KVE     LSKDAR
Sbjct  421   ISMCIGTGMGAAAVFERGDCVDELCNAKKVEGGVNLLSKDAR  462



>ref|XP_010935683.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/461 (79%), Positives = 418/461 (91%), Gaps = 3/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLLQHL+P+    SLD   S +SAS+CAAGDS AYQR+S +GDD+V+VAAYRTP
Sbjct  4     AINRQRVLLQHLQPST--PSLDE-SSMLSASICAAGDSTAYQRSSCFGDDVVVVAAYRTP  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKSKRGGFKDTYP+DLLA+VLK L++KT LNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61    ICKSKRGGFKDTYPEDLLATVLKGLLDKTKLNPNEVGDIVVGTVLAPGSQRATECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT N ++WEGS+NP
Sbjct  121   YAGFPETVPVRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTANVVSWEGSINP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +  TLQQAQ+CLLPMGITSENVA R+GVTRQEQD AAVESHR+AAAATA+GKF+DEI+PV
Sbjct  181   KVKTLQQAQDCLLPMGITSENVACRYGVTRQEQDWAAVESHRRAAAATASGKFRDEIVPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTIS+DDGIRP  S+  LAKLKPVF+KDG+TTAGNSSQV+DGA AV
Sbjct  241   VTKIVDPKTGDEKQVTISMDDGIRPETSLSGLAKLKPVFQKDGSTTAGNSSQVSDGAAAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +AI+KG PI GVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL+++DIDLFE+N
Sbjct  301   LLMRRDVAIKKGFPIFGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLQIEDIDLFELN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGARCV+TLL+EMKRRGKDCR+GV
Sbjct  361   EAFASQFVYCCKKLELDPAKVNVNGGAIALGHPLGATGARCVSTLLNEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             V+MCIG+GMGAA VFERGD  D L NARK+ +   LSKDAR
Sbjct  421   VTMCIGSGMGAAAVFERGDGVDALCNARKIPSQNLLSKDAR  461



>gb|KEH41248.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=462

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/461 (81%), Positives = 420/461 (91%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLLQHL P++ +S+  S  +S++AS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4     AINRQKVLLQHLNPSSFSSND-SSSTSLNASACLAGDSAAYHRTAAFGDDVVIVAAYRTA  62

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRGGFKDT+ DD+LA VLKA+IEKTNLNPSEVGDI+VG+VL  GS RASECRMAAF
Sbjct  63    LCKAKRGGFKDTHADDILAPVLKAVIEKTNLNPSEVGDIVVGSVLGAGSQRASECRMAAF  122

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N MAW+GSVNP
Sbjct  123   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMAWDGSVNP  182

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R    +QAQNCLLPMGITSENVA RFGV+R+EQD+AAVESHR+AAAATAAG+FKDEIIPV
Sbjct  183   RVKMFEQAQNCLLPMGITSENVASRFGVSRKEQDEAAVESHRRAAAATAAGRFKDEIIPV  242

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKIV+PKTG+E +VTISVDDGIRPNAS+ DL KLK VFKKDGTTTAGNSSQV+DGAGAV
Sbjct  243   STKIVDPKTGEEKSVTISVDDGIRPNASVSDLGKLKAVFKKDGTTTAGNSSQVSDGAGAV  302

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFR+F AVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEIN
Sbjct  303   LLMKRSIAMQKGLPILGVFRSFVAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEIN  362

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLD +KINVNGGAMAIGHPLGATGARCVATLLHEMK+RGKDCRYGV
Sbjct  363   EAFASQFVYCRNKLGLDSQKINVNGGAMAIGHPLGATGARCVATLLHEMKKRGKDCRYGV  422

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIGTGMGAA VFERGD+ DEL NARK +   +LSKDAR
Sbjct  423   ISMCIGTGMGAAAVFERGDSVDELCNARKGDNL-FLSKDAR  462



>ref|XP_003555712.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Glycine max]
 gb|KHN18010.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=461

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/461 (80%), Positives = 413/461 (90%), Gaps = 3/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S + DD+VIVAAYRT 
Sbjct  4     AISRQKILLHHLNPSSSTHVNES--SSLYASACVAGDSAAYQRTSTFRDDVVIVAAYRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
              CK KRGGFKDT PDDLLA VLKA+IE+TN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62    HCKGKRGGFKDTLPDDLLAPVLKAVIERTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N M W+GSVNP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMGWDGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMGITSENVA RFGV+R+EQDQAAVESHR+AAAATA+GKFKDEI+PV
Sbjct  182   KVKMFEQAQNCLLPMGITSENVAQRFGVSRKEQDQAAVESHRRAAAATASGKFKDEIVPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKIV+PKTG+E +VTISVDDGIRP  ++ DL +LKPVFKKDG+TTAGNSSQV+DGA AV
Sbjct  242   TTKIVDPKTGEEKSVTISVDDGIRPGTTVSDLGRLKPVFKKDGSTTAGNSSQVSDGAAAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVALQKGLPILGVFRTFAAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+  LGLDPEKINVNGGAMAIGHPLG+TGARCVATLLHEMK+RG+DCR+GV
Sbjct  362   EAFASQFVYCRNNLGLDPEKINVNGGAMAIGHPLGSTGARCVATLLHEMKKRGRDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIGTGMGAA VFE GD  DEL NARKV+    LSKDAR
Sbjct  422   ISMCIGTGMGAAAVFESGDCADELCNARKVDDL-LLSKDAR  461



>ref|XP_008380600.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=459

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/462 (83%), Positives = 424/462 (92%), Gaps = 7/462 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLL HLRP +A SS     SS+SAS CAAGDSAAY R  V+GDD+VIVAAYRTP
Sbjct  4     AINRQRVLLDHLRPPSADSS-----SSLSASACAAGDSAAYARTHVFGDDVVIVAAYRTP  58

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT+ DDLLA VLKA++E+TN+NPSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  59    ICKAKRGGFKDTHADDLLAPVLKAVVERTNVNPSEIGDIVVGTVLAPGSQRASECRMAAF  118

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAA+I+AGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  119   YAGFPETVPIRTVNRQCSSGLQAVADVAASIRAGFYDIGIGAGLESMTANPMAWEGSVNP  178

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMGITSENVAHRFGV+R+EQDQAAV+SHRKAAAATA GKFKDEIIPV
Sbjct  179   KVKMFEQAQNCLLPMGITSENVAHRFGVSRKEQDQAAVDSHRKAAAATATGKFKDEIIPV  238

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PK+G+E  VTISVDDGIR N ++ DLAKLKPVFKKDG+TTAGNSSQV+DGAGAV
Sbjct  239   ATKIVDPKSGEEKPVTISVDDGIR-NTTLADLAKLKPVFKKDGSTTAGNSSQVSDGAGAV  297

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A QKGLPILGVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  298   LLMKRSVAEQKGLPILGVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  357

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQYLYC+ KLGLDPEKINVNGGA+AIGHPLGATGAR VATLLHEMKRRGKDCR+GV
Sbjct  358   EAFASQYLYCRNKLGLDPEKINVNGGALAIGHPLGATGARAVATLLHEMKRRGKDCRFGV  417

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGY-LSKDAR  1492
             +SMCIGTGMGAA VFERGD+ D L NARKVE+H + LSKDAR
Sbjct  418   ISMCIGTGMGAAAVFERGDSVDGLCNARKVESHIHLLSKDAR  459



>ref|XP_010099126.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXB76920.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=464

 Score =   734 bits (1894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/432 (85%), Positives = 399/432 (92%), Gaps = 0/432 (0%)
 Frame = +2

Query  197   ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  376
             ASVC AGDSAAYQR +V+GDD+VIVAAYRTPLCKSKRGGFKDT+ DDLLA VLKALIEKT
Sbjct  33    ASVCLAGDSAAYQRTNVFGDDVVIVAAYRTPLCKSKRGGFKDTHADDLLAPVLKALIEKT  92

Query  377   NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaa  556
             NLNPSEVGDI+VGTVLAPGS RASECRMAAFYAGFPETVP+RTVNRQCSSGLQAVADVAA
Sbjct  93    NLNPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAA  152

Query  557   aikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVT  736
             AI+AGFYDIGIGAGLESMT+N MAWEGSVNP+    +QAQNCLLPMG+TSENVA RFGV+
Sbjct  153   AIRAGFYDIGIGAGLESMTMNPMAWEGSVNPKVKIFEQAQNCLLPMGVTSENVASRFGVS  212

Query  737   RQEQDQAAVESHRKaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASI  916
             R+EQDQAAVESHR+AAAATAAGKFKDEIIPV TKIV+PKTG E  VTISVDDGIRPN ++
Sbjct  213   RKEQDQAAVESHRRAAAATAAGKFKDEIIPVATKIVDPKTGGEKPVTISVDDGIRPNTTL  272

Query  917   GDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDP  1096
              DLAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A +KGLPILG+FR F AVGVDP
Sbjct  273   SDLAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAEKKGLPILGIFRNFVAVGVDP  332

Query  1097  AVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMA  1276
             A+MG+GPA AIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMA
Sbjct  333   AIMGVGPAFAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMA  392

Query  1277  IGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARK  1456
             IGHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFER    DEL NAR 
Sbjct  393   IGHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERAGHTDELCNARV  452

Query  1457  VETHGYLSKDAR  1492
               T+  LSKDAR
Sbjct  453   AATNSLLSKDAR  464



>emb|CAA53078.1| 3-ketoacyl-CoA thiolase B [Mangifera indica]
Length=430

 Score =   732 bits (1890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/425 (87%), Positives = 403/425 (95%), Gaps = 2/425 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLLQHLRP+N++S   + ES+++ASVCAAGDSAAY R SVYGDD+VIVAA+RT 
Sbjct  4     AINRQQVLLQHLRPSNSSSH--NYESALAASVCAAGDSAAYHRASVYGDDVVIVAAHRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VLKALIEKTNL+PSEVGDI+VGTVLA GS RASECRMAAF
Sbjct  62    LCKSKRGGFKDTYPDDLLAPVLKALIEKTNLDPSEVGDIVVGTVLAAGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPDTVPLRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QA+NCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKAAAATAAGKFKDEIIPV
Sbjct  182   KVKEFEQARNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTI+VDDGIRPNAS+ DLAKLKPVFKKDG+TTAGNSSQV+DGAGAV
Sbjct  242   ATKIVDPKTGDEKPVTITVDDGIRPNASLSDLAKLKPVFKKDGSTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRG+DCR+GV
Sbjct  362   EAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGV  421

Query  1370  VSMCI  1384
             +SMCI
Sbjct  422   ISMCI  426



>gb|KDO43601.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=437

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/426 (86%), Positives = 402/426 (94%), Gaps = 2/426 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4     AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62    LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMG+TSENVAHRFGVTR+EQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   KVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIRPN S+ +LAKLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   ATKIVDPKTGDEKPVTISVDDGIRPNTSVSELAKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+LDDIDLFEIN
Sbjct  302   LLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGARCVATLLHEMKRRG+DCR+GV
Sbjct  362   EAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGV  421

Query  1370  VSMCIG  1387
             +SMCIG
Sbjct  422   ISMCIG  427



>pdb|2WUA|A Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
 pdb|2WUA|B Chain B, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
Length=440

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/435 (83%), Positives = 404/435 (93%), Gaps = 4/435 (1%)
 Frame = +2

Query  149   PTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTY  328
             P++ +SSL+++    S SVCAAGDSAAYQRNSV+GDD+VIVAAYR+PLCK+KRGG KDTY
Sbjct  2     PSSTSSSLENL----SVSVCAAGDSAAYQRNSVFGDDVVIVAAYRSPLCKAKRGGLKDTY  57

Query  329   PDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTV  508
             PDD+LA VLKALIEKTN+NP+EVGDI+VG+VL  GS RASECRMAAFYAGFPETVPVRTV
Sbjct  58    PDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAFYAGFPETVPVRTV  117

Query  509   NRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLL  688
             NRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP+  T+ QAQ+CLL
Sbjct  118   NRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNPKVKTMAQAQDCLL  177

Query  689   PMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTTKIVNPKTGDET  868
             PMGITSENVA +F +TRQEQDQAAV SHRK AAATAAG+FKDEIIP+ TKIV+PKTGDE 
Sbjct  178   PMGITSENVAQKFSITRQEQDQAAVGSHRKTAAATAAGRFKDEIIPIKTKIVDPKTGDEK  237

Query  869   TVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGL  1048
              VTISVDDGIRP  S+ DLAKLKPVF+KDG+TTAG SSQV+DGAGAVLLMKRS+A+QKGL
Sbjct  238   PVTISVDDGIRPGTSLADLAKLKPVFRKDGSTTAGTSSQVSDGAGAVLLMKRSIALQKGL  297

Query  1049  PILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKK  1228
             PILGVFRTFAAVGV P++MGIGPAVAIPAAVK+AGL++DDIDLFEINEAFASQ++YCQKK
Sbjct  298   PILGVFRTFAAVGVPPSIMGIGPAVAIPAAVKAAGLQIDDIDLFEINEAFASQFVYCQKK  357

Query  1229  LGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAG  1408
             L +DP+KINVNGGAMAIGHPLGATGARCVATLLHEMKRRG+DCR+GVVSMCIGTGMGAA 
Sbjct  358   LEIDPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGVVSMCIGTGMGAAA  417

Query  1409  VFERGDACDELSNAR  1453
             VFERGDACDEL NA+
Sbjct  418   VFERGDACDELCNAK  432



>ref|XP_010940650.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/460 (80%), Positives = 425/460 (92%), Gaps = 3/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLLQHL+P +++S+   +   +SAS+CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4     AINRQRVLLQHLQPPSSSSNDAPM---LSASICAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKSKRGGFKDTYP+DLLA+VLKAL++KT LNP EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61    ICKSKRGGFKDTYPEDLLAAVLKALLDKTKLNPREVGDIVVGTVLAPGSQRANECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT N++AWEGS+NP
Sbjct  121   YAGFPETVPVRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTTNSVAWEGSINP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             + +TLQ+AQ+CLLPMGITSENVAHR+GVTR+EQDQ AVESHR+AAAATA+GKFKDEIIPV
Sbjct  181   KVNTLQKAQDCLLPMGITSENVAHRYGVTRKEQDQTAVESHRRAAAATASGKFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKIV+PKTG+E  VTIS+DDGIRP  S+  LAKLKPVFKKDG+TTAGNSSQV+DGAGAV
Sbjct  241   TTKIVDPKTGEEKQVTISIDDGIRPETSLSGLAKLKPVFKKDGSTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A+QKG PILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL+++DIDLFE+N
Sbjct  301   LLMRRDVAMQKGFPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLQIEDIDLFELN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGARCV TLL+EMKRRGKDCR+GV
Sbjct  361   EAFASQFVYCCKKLELDPAKVNVNGGAIALGHPLGATGARCVGTLLNEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             V+MCIG+GMGAA VFERGD  DEL N RK+++   LSKDA
Sbjct  421   VTMCIGSGMGAAAVFERGDGVDELCNTRKIQSQNLLSKDA  460



>ref|XP_011020688.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Populus euphratica]
Length=458

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/457 (80%), Positives = 411/457 (90%), Gaps = 4/457 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL HLRP+  + S  + ES++SAS C AGDS AYQR S +GDD+VIVAAYRTP
Sbjct  4     AIDRQRVLLDHLRPS--SPSHHNFESTLSASACLAGDSTAYQRTSAFGDDVVIVAAYRTP  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSK G FKDT+ DDLLA VLKALIEKTN++P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  62    LCKSKGGSFKDTHADDLLAPVLKALIEKTNVDPREVGDIVVGSVLAPGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADV A+IKAGFY+IGIGAGLESMT+N MAW+G VNP
Sbjct  122   YAGFPETVPIRTVNRQCSSGLQAVADVVASIKAGFYEIGIGAGLESMTINPMAWDGDVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    Q+AQ+CLLPMG+TSENVAH FGVTRQEQDQ  V+SHRKAAAATA+G+FKDEIIPV
Sbjct  182   KVKDFQKAQDCLLPMGVTSENVAHCFGVTRQEQDQ--VDSHRKAAAATASGRFKDEIIPV  239

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  + ISVDDGIRPN ++ +L KLKP+FKKDGTTTAGNSSQV+DGAGAV
Sbjct  240   PTKIVDPKTGDEKPIVISVDDGIRPNTTLIELGKLKPLFKKDGTTTAGNSSQVSDGAGAV  299

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+ KGLPILGVFRTF AVGVDPA+MG+GPAVAIPAAVK+AGL L+DIDLFEIN
Sbjct  300   LLMKRSVAMHKGLPILGVFRTFTAVGVDPAIMGVGPAVAIPAAVKAAGLALEDIDLFEIN  359

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LD +KINVNGGAMAIGHPLGATGARCVATLLHEMKRRG+DCR+GV
Sbjct  360   EAFASQFVYCRKKLELDSQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDCRFGV  419

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLS  1480
             VSMCIGTGMGAA VFERGD CDEL N RKVE++  LS
Sbjct  420   VSMCIGTGMGAAAVFERGDGCDELCNGRKVESNNLLS  456



>gb|ACN39947.1| unknown [Picea sitchensis]
 gb|ACN40646.1| unknown [Picea sitchensis]
Length=462

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/458 (80%), Positives = 411/458 (90%), Gaps = 4/458 (1%)
 Frame = +2

Query  119   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  298
             RQ+VLL HLRP    +      + + ASVC+AGDSAAY+R + +GDD+VIVAAYRTP+CK
Sbjct  9     RQQVLLDHLRP----ARFPKASTDLVASVCSAGDSAAYERAAEFGDDVVIVAAYRTPICK  64

Query  299   SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  478
             +KRGGFKDT PDDLLA VLKALI+KT +NP+EV DI+VGTVLAPGS RASECRMA+FYAG
Sbjct  65    AKRGGFKDTLPDDLLAPVLKALIDKTGINPNEVRDIVVGTVLAPGSQRASECRMASFYAG  124

Query  479   FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  658
             FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNPR  
Sbjct  125   FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTANPMAWEGSVNPRVE  184

Query  659   TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTTK  838
               +QAQ+CLLPMGITSENVA R+G++RQ+QDQAAVESHR+AAAATAAGKFKDEIIPV TK
Sbjct  185   IFKQAQDCLLPMGITSENVAERYGISRQDQDQAAVESHRRAAAATAAGKFKDEIIPVETK  244

Query  839   IVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLM  1018
             IV+PKTGDE  V ISVDDGIRP AS+ DLAKLKP FKK G+TTAGNSSQV+DGAGAVLLM
Sbjct  245   IVDPKTGDEKPVRISVDDGIRPTASLSDLAKLKPAFKKGGSTTAGNSSQVSDGAGAVLLM  304

Query  1019  KRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAF  1198
             KR++A+QKGLPILGVFR+F AVGVDPAVMG+GPAVAIPAAVK+AGLE+DDIDLFEINEAF
Sbjct  305   KRTVAMQKGLPILGVFRSFTAVGVDPAVMGVGPAVAIPAAVKAAGLEIDDIDLFEINEAF  364

Query  1199  ASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSM  1378
             ASQ+ YC +KL LDPEK+NVNGGA+A+GHPLGATGARCVATLLHEMKRRGKDCR+GV+SM
Sbjct  365   ASQFTYCSQKLELDPEKVNVNGGALALGHPLGATGARCVATLLHEMKRRGKDCRFGVISM  424

Query  1379  CIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             CIGTGMGAA VFERG A D+L NAR ++ H  LSKDA+
Sbjct  425   CIGTGMGAAAVFERGSAVDQLCNARPIKDHTSLSKDAQ  462



>gb|KJB72152.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=453

 Score =   728 bits (1879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/427 (85%), Positives = 397/427 (93%), Gaps = 0/427 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4     AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESMT N MAWEGSVNP
Sbjct  124   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTTNPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R   ++QAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKAAAATA+GKFKDEI+PV
Sbjct  184   RVKQMEQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKAAAATASGKFKDEIVPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIR N S+ DL KLKPVFKK+GTTTAGNSSQV+DGAGAV
Sbjct  244   ATKIVDPKTGDEKPVTISVDDGIRANTSVSDLGKLKPVFKKNGTTTAGNSSQVSDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGLELDD+DLFEIN
Sbjct  304   LLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLELDDVDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YCQKKL LDP+KINVNGGAMAIGHPLG TGARCVATLLHEMKRRGKDCR+GV
Sbjct  364   EAFASQFVYCQKKLELDPQKINVNGGAMAIGHPLGVTGARCVATLLHEMKRRGKDCRFGV  423

Query  1370  VSMCIGT  1390
             VSMCIGT
Sbjct  424   VSMCIGT  430



>ref|XP_006443651.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
 ref|XP_006480201.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR56891.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
Length=461

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/461 (79%), Positives = 409/461 (89%), Gaps = 3/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4     ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61    ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN+++  G VNP
Sbjct  121   YAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMGITSENVA RFGVTRQEQD AA+ESHR+AAAATA+GKFKDEIIPV
Sbjct  181   KVEIFTQARDCLLPMGITSENVAQRFGVTRQEQDLAAIESHRRAAAATASGKFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG E  VTISVDDGIRPN +I DLAKLKP FKKDGTTTAGN+SQV+DGAGAV
Sbjct  241   NTKIVDPKTGVEKRVTISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA+QKGLPILGVFR+FAAVGVDP+VMGIGPAVAIPAAVKSAGL+LDDI+LFEIN
Sbjct  301   LLMKRSLAVQKGLPILGVFRSFAAVGVDPSVMGIGPAVAIPAAVKSAGLQLDDINLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGARCVATLL EMKRRGKDCR+GV
Sbjct  361   EAFASQYVYCIKKLGLDPEKVNVNGGAVALGHPLGATGARCVATLLSEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIG+GMGAA V ERGD  DEL NAR V TH +LSKDA+
Sbjct  421   ISMCIGSGMGAAAVLERGDCVDELCNARMVPTHTHLSKDAK  461



>ref|NP_001131193.1| acetyl-CoA C-acyltransferase-like protein [Zea mays]
 gb|ACF79501.1| unknown [Zea mays]
 gb|AFW74042.1| LOW QUALITY PROTEIN: acetyl-CoA C-acyltransferase-like protein 
[Zea mays]
Length=461

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/461 (77%), Positives = 417/461 (90%), Gaps = 3/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4     AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61    ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             +AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAG+YDIGIGAGLESM++N++AWEG VNP
Sbjct  121   FAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGYYDIGIGAGLESMSINSIAWEGQVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             + S  Q+AQ+CLLPMGITSENVAHR+GVTRQEQDQAA ESHR+AAAATA+GKFKDEI+PV
Sbjct  181   KISAFQKAQDCLLPMGITSENVAHRYGVTRQEQDQAAAESHRRAAAATASGKFKDEIVPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E  V ISVDDGIRP  +   LAKLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  241   PTKIVDPKTGEEKEVVISVDDGIRPGTTASGLAKLKPVFKKDGTTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE+ DIDLFE+N
Sbjct  301   LLMKRSVALKKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLEIGDIDLFELN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARCVATLL+EMKRRG+DCR+GV
Sbjct  361   EAFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             V+MCIG+GMGAA VFERGDA D LSN R ++ H +LSKDA+
Sbjct  421   VTMCIGSGMGAAAVFERGDAVDGLSNVRDIQAHNFLSKDAK  461



>ref|XP_009400955.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009400962.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/460 (79%), Positives = 423/460 (92%), Gaps = 5/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLLQHL+P  ++SS     S VSASVCAAGDSAAYQRNS +GDD+V+VAAYRT 
Sbjct  4     AINRQRVLLQHLQPFPSSSS-----SLVSASVCAAGDSAAYQRNSSFGDDVVVVAAYRTA  58

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             + KSKRGGFKDTYP++LL +VLKAL++KTNLNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  59    ISKSKRGGFKDTYPEELLTAVLKALLDKTNLNPNEVGDIVVGTVLAPGSQRATECRMAAF  118

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT N++AW+GS+NP
Sbjct  119   YAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTANSVAWDGSINP  178

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             + +  QQ Q+CLLPMGITSENVA R+GVTRQEQDQAAVESHRKAAAATAAGKFK+EI+PV
Sbjct  179   KVNKFQQVQDCLLPMGITSENVAFRYGVTRQEQDQAAVESHRKAAAATAAGKFKEEIVPV  238

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E  VTISVDDGIRP  S+  LAKL+PVFKKDG+TTAGNSSQV+DGAGAV
Sbjct  239   ITKIVDPKTGEEKQVTISVDDGIRPETSLSGLAKLRPVFKKDGSTTAGNSSQVSDGAGAV  298

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A+QKG PILGVFR+FAAVGVDPAVMG+GPA+AIPAAVKSAGL+++D+DLFEIN
Sbjct  299   LLMRRDVAMQKGFPILGVFRSFAAVGVDPAVMGVGPAIAIPAAVKSAGLQIEDVDLFEIN  358

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LDP K+NVNGGA+A+GHPLGATGARCV+TLL+EMKRRGKDCR+GV
Sbjct  359   EAFASQFVYCRKKLELDPAKVNVNGGAIALGHPLGATGARCVSTLLNEMKRRGKDCRFGV  418

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIG+GMGAA VFERGDA D L+NAR++ +H  LS+DA
Sbjct  419   ISMCIGSGMGAAAVFERGDAVDGLTNARQIHSHNLLSEDA  458



>ref|NP_001241698.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
 gb|ACG36949.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
Length=461

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/461 (77%), Positives = 417/461 (90%), Gaps = 3/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4     AIDRQRVLLAHLLPSPSAASS---QPHLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61    ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             +AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAG+YDIGIGAGLESM++N++AWEG VNP
Sbjct  121   FAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGYYDIGIGAGLESMSINSIAWEGQVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             + S  Q+AQ+CLLPMGITSENVAHR+GVTRQEQDQAA ESHR+AAAATA+GKFKDEI+PV
Sbjct  181   KISAFQKAQDCLLPMGITSENVAHRYGVTRQEQDQAAAESHRRAAAATASGKFKDEIVPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E  V ISVDDGIRP  +   LAKLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  241   PTKIVDPKTGEEKEVVISVDDGIRPGTTASGLAKLKPVFKKDGTTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE+ DIDLFE+N
Sbjct  301   LLMKRSVALKKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLEIGDIDLFELN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARCVATLL+EMKRRG+DCR+GV
Sbjct  361   EAFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             V+MCIG+GMGAA VFERGDA D LSN R ++ H +LSKDA+
Sbjct  421   VTMCIGSGMGAAAVFERGDAVDGLSNVRDMQAHNFLSKDAK  461



>gb|KDO43600.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=438

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/459 (80%), Positives = 406/459 (88%), Gaps = 26/459 (6%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4     AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+V                   
Sbjct  62    LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVV-------------------  102

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
                  ETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  103   -----ETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  157

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMG+TSENVAHRFGVTR+EQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  158   KVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQAAVDSHRKAAAATAAGKFKDEIIPV  217

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIRPN S+ +LAKLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  218   ATKIVDPKTGDEKPVTISVDDGIRPNTSVSELAKLKPVFKKDGTTTAGNSSQVSDGAGAV  277

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+LDDIDLFEIN
Sbjct  278   LLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEIN  337

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGARCVATLLHEMKRRG+DCR+GV
Sbjct  338   EAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGV  397

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  1486
             +SMCIGTGMGAA VFERGD  DEL N RKVE++ +LSKD
Sbjct  398   ISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKD  436



>ref|XP_007145410.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
 gb|ESW17404.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
Length=458

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/461 (81%), Positives = 414/461 (90%), Gaps = 6/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ++LL HL P+++  S     SS+SAS CAAGDSAAY R S +GDD+VIVAAYRT 
Sbjct  4     AINRQKILLHHLNPSSSNHS-----SSLSASACAAGDSAAYHRTSTFGDDVVIVAAYRTA  58

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDT+ DDLLA VLKA+IE+TN+NPSEVGDIIVGTVLAPGS RASECRM+AF
Sbjct  59    LCKSKRGGFKDTHADDLLAPVLKAVIERTNVNPSEVGDIIVGTVLAPGSQRASECRMSAF  118

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  119   YAGFPETVPIRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTANPMAWEGSVNP  178

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMGITSENVAHRFGV+R+EQD AAVESHR+AAAATA+G+FKDEIIPV
Sbjct  179   KVKMFEQAQNCLLPMGITSENVAHRFGVSRKEQDLAAVESHRRAAAATASGRFKDEIIPV  238

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKIV+PK+G+E +VTISVDDGIR  A   DL +LKPVFKKDGTTTAGNSSQV+DGA AV
Sbjct  239   STKIVDPKSGEEKSVTISVDDGIRYGAKFSDLERLKPVFKKDGTTTAGNSSQVSDGAAAV  298

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A QKGLPILGVFRTF AVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEIN
Sbjct  299   LLMKRSVAQQKGLPILGVFRTFTAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEIN  358

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ+LYC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEM++RG+DCR+GV
Sbjct  359   EAFASQFLYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMRKRGRDCRFGV  418

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIGTGMGAA VFE GD  DEL NARKV+    LSKDAR
Sbjct  419   ISMCIGTGMGAAAVFESGDCADELCNARKVDDL-LLSKDAR  458



>ref|XP_008372446.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=453

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/450 (79%), Positives = 407/450 (90%), Gaps = 0/450 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ RQ+VLLQHLRP+++ SS D   +++SAS CAAGDSAAY R S +GDDIVIVAAYRT 
Sbjct  4     ALNRQKVLLQHLRPSSSVSSPDYESAALSASTCAAGDSAAYHRTSAFGDDIVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT PDDLLA VLKA+IE+TNLNP EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  64    ICKAKRGGFKDTLPDDLLAPVLKAVIERTNLNPKEVGDIVVGTVLAPGSLRAMECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAG+YDIGI AGLESMTV+ +     VNP
Sbjct  124   YAGFPDTVPIRTVNRQCSSGLQAVADVAAAIKAGYYDIGIAAGLESMTVDNIGGLSKVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMG+TSENVA R+GVTRQEQD+AAVESHR+AAAATA+GKFKDEI+PV
Sbjct  184   KVDIFAQARDCLLPMGVTSENVAQRYGVTRQEQDRAAVESHRRAAAATASGKFKDEIVPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKIV+PKTG+E  VTISVDDG RPNA++ DLAKLKP FK+DG+TTAGN+SQV+DGAGAV
Sbjct  244   STKIVDPKTGEERPVTISVDDGFRPNANMNDLAKLKPAFKRDGSTTAGNASQVSDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA QKGLPI GVFR+FAAVGVDPAVMG+GPA AIP AVKSAGLE+DDIDLFEIN
Sbjct  304   LLMKRSLAXQKGLPIXGVFRSFAAVGVDPAVMGVGPAAAIPVAVKSAGLEIDDIDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMKRRGKD R+GV
Sbjct  364   EAFASQYVYCVKKLELDPEKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGKDNRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKV  1459
             +SMCIG+GMGAA VFERGD+ DELSNAR V
Sbjct  424   ISMCIGSGMGAAAVFERGDSVDELSNARAV  453



>ref|XP_004954382.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   717 bits (1851),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/461 (77%), Positives = 414/461 (90%), Gaps = 3/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL H      +SS  S +  ++AS CAAGDSAAYQR S +GDD+V+VAAYRTP
Sbjct  4     AIDRQRVLLAH---LLPSSSSPSSQPQLAASECAAGDSAAYQRTSSFGDDVVVVAAYRTP  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP ++GDI+VGTVL PGS RA+ECRMAAF
Sbjct  61    ICKAKRGGFKDTYPEDLLTVVLKAVLDNTKINPGDIGDIVVGTVLGPGSQRANECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM++N++ WEG VNP
Sbjct  121   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSINSIGWEGQVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R S  Q+AQ+CLLPMGITSENVAHR+GVTRQEQDQAA ESHR+AAAATA+GKFKDEI+PV
Sbjct  181   RISAFQKAQDCLLPMGITSENVAHRYGVTRQEQDQAAAESHRRAAAATASGKFKDEIVPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E  V ISVDDGIRP  +   LAKLKP+FKKDGTTTAGNSSQV+DGAGAV
Sbjct  241   PTKIVDPKTGEEKKVVISVDDGIRPGTTASGLAKLKPIFKKDGTTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE++DIDLFE+N
Sbjct  301   LLMKRSVALKKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLEIEDIDLFELN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARCVATLL+EMKRRG+DCR+GV
Sbjct  361   EAFASQFVYCCNKLGLDRSKVNVNGGAIAMGHPLGATGARCVATLLNEMKRRGRDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             V+MCIG+GMGAA VFERGD  DELSN R +++H +LS+DA+
Sbjct  421   VTMCIGSGMGAAAVFERGDTVDELSNVRDIQSHNFLSRDAK  461



>ref|XP_009371217.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=453

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/450 (79%), Positives = 410/450 (91%), Gaps = 0/450 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ RQ+VLLQHLRP+++ SS D   +++SAS CAAGDSAAY R S +GDDIVIVAAYRT 
Sbjct  4     ALNRQKVLLQHLRPSSSVSSPDYESAALSASTCAAGDSAAYHRTSAFGDDIVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT PDDLLA VLKA+IE+TNLNP+EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  64    ICKAKRGGFKDTLPDDLLAPVLKAVIERTNLNPNEVGDIVVGTVLAPGSLRAIECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVAD+AAAIKAG+YDIGI AGLE MTV+ ++    VNP
Sbjct  124   YAGFPDTVPIRTVNRQCSSGLQAVADIAAAIKAGYYDIGIAAGLECMTVDNISGLSKVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++C+LPMG+TSENVA R+GVTR+EQD+AAVESHR+AAAA A+GKFKDEIIPV
Sbjct  184   KVDIFAQARDCVLPMGMTSENVAERYGVTREEQDRAAVESHRRAAAAAASGKFKDEIIPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKIV+PKTG+E  VTISVDDGIRPNA++ DLAKLKP FK+DG+TTAGN+SQV+DGAGAV
Sbjct  244   STKIVDPKTGEERPVTISVDDGIRPNANMNDLAKLKPAFKRDGSTTAGNASQVSDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMG+GPA AIP AVKSAGLELDDIDLFE+N
Sbjct  304   LLMKRSLAMQKGLPILGVFRSFAAVGVDPAVMGVGPAAAIPVAVKSAGLELDDIDLFEMN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMKRRGKD R+GV
Sbjct  364   EAFASQYVYCIKKLELDPEKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGKDNRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKV  1459
             +SMCIG+GMGAA VFERGD+ DELSNAR V
Sbjct  424   ISMCIGSGMGAAAVFERGDSVDELSNARAV  453



>ref|XP_008235516.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=467

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/464 (77%), Positives = 412/464 (89%), Gaps = 3/464 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSL---DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  280
             A  RQRVLLQHL P ++ SS        +++SAS+CAAGDSAAY R + +GDD+VIVAAY
Sbjct  4     AHNRQRVLLQHLLPNSSFSSAPPETHQSAALSASICAAGDSAAYHRTAAFGDDVVIVAAY  63

Query  281   RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  460
             RT +CK+KRGGFKDT PDDLLA VLKALIE+TNLNPSEVGDI+VGTV+APGS+RA+ECRM
Sbjct  64    RTAICKAKRGGFKDTSPDDLLAPVLKALIERTNLNPSEVGDIVVGTVMAPGSLRATECRM  123

Query  461   AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  640
             AAFYAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFY+IG+ AGLESM+V+ +     
Sbjct  124   AAFYAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYEIGVAAGLESMSVDKLGRMNK  183

Query  641   VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEI  820
             +NP+     QA++CLLPMGITSENVA R+GVTRQEQD+AAVESH +AAAATA+GKF+DEI
Sbjct  184   INPKVDIFAQARDCLLPMGITSENVAQRYGVTRQEQDKAAVESHSRAAAATASGKFQDEI  243

Query  821   IPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGA  1000
             IPV+TKIV+PKTG+E  VTISVDDGIRPNA++ DLAKLKP FK DG+TTAGN+SQV+DGA
Sbjct  244   IPVSTKIVDPKTGEERPVTISVDDGIRPNANMNDLAKLKPAFKADGSTTAGNASQVSDGA  303

Query  1001  GAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLF  1180
             GAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPA AIP AVKSAGLELDDIDLF
Sbjct  304   GAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPAVMGIGPAAAIPVAVKSAGLELDDIDLF  363

Query  1181  EINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR  1360
             EINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMKRRGKD R
Sbjct  364   EINEAFASQYVYCCKKLELDPEKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGKDHR  423

Query  1361  YGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +GV+SMCIG+GMGAA VFERGD+ DEL N R VE +  LS DAR
Sbjct  424   FGVISMCIGSGMGAAAVFERGDSVDELCNVRTVERNNLLSNDAR  467



>ref|XP_006368897.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
 gb|ERP65466.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
Length=455

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/461 (78%), Positives = 408/461 (89%), Gaps = 9/461 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A  RQRVLL HLR   ++SS ++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4     ASNRQRVLLGHLR---SSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDT+ DDLLA VLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55    LCKSKRGGFKDTHADDLLAPVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNR+CSSGLQAVADVAA+IKAGFY+IGIGAGLESMTVN+ AW G VNP
Sbjct  115   YAGFPETVPIRTVNRKCSSGLQAVADVAASIKAGFYEIGIGAGLESMTVNSRAWVGDVNP  174

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    Q+AQ+CLLPMG+TSENVAHRFGVTRQEQDQAAV+SHRKAAAA+A+G+FKDEIIPV
Sbjct  175   KVKRFQEAQDCLLPMGVTSENVAHRFGVTRQEQDQAAVDSHRKAAAASASGRFKDEIIPV  234

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKI +PKTGDE  + +SVDDGIRPN S+ DL KLK VFKKDGTTTAGNSSQ++DGA AV
Sbjct  235   ATKIADPKTGDEKPIIVSVDDGIRPNTSLADLGKLKAVFKKDGTTTAGNSSQISDGAAAV  294

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTF  VGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEIN
Sbjct  295   LLMKRSVAMRKGLPILGVFRTFVVVGVDPAIMGVGPAVAIPAAVKAAGLELEDIDLFEIN  354

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC KKL LD +KINVNGGA+AIGHPLG TGARCVAT+LHEMKRRG+DCR+GV
Sbjct  355   EAFASQFVYCCKKLELDLQKINVNGGAIAIGHPLGTTGARCVATILHEMKRRGRDCRFGV  414

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD CDEL NARKVE++  LSKD+R
Sbjct  415   VSMCIGTGMGAAAVFERGDGCDELCNARKVESNNLLSKDSR  455



>ref|XP_011002176.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/461 (78%), Positives = 407/461 (88%), Gaps = 9/461 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A  RQRVLL HL   + +SS ++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4     ASNRQRVLLGHL---HYSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDT+ DDLLASVLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55    LCKSKRGGFKDTHADDLLASVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNR+CSSGLQAVADVAA+IKAGFY+IGIGAGLESMTVN+ AW G VNP
Sbjct  115   YAGFPETVPIRTVNRKCSSGLQAVADVAASIKAGFYEIGIGAGLESMTVNSRAWAGDVNP  174

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    Q+AQ+CLLPMG+TSENVAHRF VTRQEQDQAAV+SHRKAAAA+A+G+FKDEIIPV
Sbjct  175   KVKRFQEAQDCLLPMGVTSENVAHRFSVTRQEQDQAAVDSHRKAAAASASGRFKDEIIPV  234

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  + +SVDDGIRPN S+ DL KLK VFKKDGTTTAGNSSQ++DGA AV
Sbjct  235   ATKIVDPKTGDEKPIIVSVDDGIRPNTSLADLGKLKAVFKKDGTTTAGNSSQISDGAAAV  294

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+ KGLPILGVFRTF  VGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEIN
Sbjct  295   LLMKRSVAMHKGLPILGVFRTFVVVGVDPAIMGVGPAVAIPAAVKAAGLELEDIDLFEIN  354

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC KKL LD +KINVNGGA+AIGHPLG TGARCVAT+LHEMKRRG+DCR+GV
Sbjct  355   EAFASQFVYCCKKLELDLQKINVNGGAIAIGHPLGTTGARCVATILHEMKRRGRDCRFGV  414

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD CDEL NARKVE++  LSKD+R
Sbjct  415   VSMCIGTGMGAAAVFERGDDCDELCNARKVESNNLLSKDSR  455



>gb|ABR16781.1| unknown [Picea sitchensis]
Length=462

 Score =   712 bits (1838),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/458 (79%), Positives = 407/458 (89%), Gaps = 4/458 (1%)
 Frame = +2

Query  119   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  298
             RQ+VLL HLRP +           + ASVCAAGDSAAY+R + +GDD+VIVAAYRTP+CK
Sbjct  9     RQQVLLDHLRPAH----FPKASKDLVASVCAAGDSAAYERAAEFGDDVVIVAAYRTPICK  64

Query  299   SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  478
             +KRGGFKDT  DDLLA VLKALI+KT LNP EVGDI+VGTVLAPGS RASECRMAAFYAG
Sbjct  65    AKRGGFKDTLADDLLAPVLKALIDKTGLNPVEVGDIVVGTVLAPGSQRASECRMAAFYAG  124

Query  479   FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  658
             FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAG+ESM+V  +A+EGSVNP+  
Sbjct  125   FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGVESMSVAPLAFEGSVNPKVE  184

Query  659   TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTTK  838
               +QAQ+CLLPMGITSENVA R+GV+RQ+QDQAAVESHR+AAAATAAGKFKDEIIPV TK
Sbjct  185   IFRQAQDCLLPMGITSENVAERYGVSRQDQDQAAVESHRRAAAATAAGKFKDEIIPVETK  244

Query  839   IVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLM  1018
             IV+PKTGDE  VTISVDDGIRP+AS+  L KLKP FKK G+TTAGNSSQV+DGAGAVLLM
Sbjct  245   IVDPKTGDEKPVTISVDDGIRPDASLSVLGKLKPAFKKGGSTTAGNSSQVSDGAGAVLLM  304

Query  1019  KRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAF  1198
             KR +A+QKGLPILGVFR+F AVGVDPAVMG+GPAVAIPAAVK+AGLE+DDIDLFEINEAF
Sbjct  305   KRVVAMQKGLPILGVFRSFTAVGVDPAVMGVGPAVAIPAAVKAAGLEIDDIDLFEINEAF  364

Query  1199  ASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSM  1378
             ASQ+ YC +KL LDPEK+NVNGGA+A+GHPLGATGARCVATLLHEMKRRGKDCR+GV+SM
Sbjct  365   ASQFTYCSQKLELDPEKVNVNGGAIALGHPLGATGARCVATLLHEMKRRGKDCRFGVISM  424

Query  1379  CIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             CIGTGMGAA VFER  A D+L NAR ++ H  LS+DA+
Sbjct  425   CIGTGMGAAAVFERSGAVDQLCNARPIKDHTSLSRDAQ  462



>ref|XP_007201004.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
 gb|EMJ02203.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
Length=467

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/464 (77%), Positives = 410/464 (88%), Gaps = 3/464 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPT---NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  280
             A  RQRVLLQHL P    +AA       +++SAS+CAAGDSAAY R + +GDD+VIVAAY
Sbjct  4     AHNRQRVLLQHLLPNCSFSAAPPETHQSAALSASICAAGDSAAYHRTAAFGDDVVIVAAY  63

Query  281   RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  460
             RT +CK+KRGGFKDT PDDLLA VLKALIE+TNLNP EVGDI+VGTV+APGS+RA+ECRM
Sbjct  64    RTAICKAKRGGFKDTSPDDLLAPVLKALIERTNLNPGEVGDIVVGTVMAPGSLRATECRM  123

Query  461   AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  640
             AAFYAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFY+IG+ AGLESM+V+ +     
Sbjct  124   AAFYAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYEIGVAAGLESMSVDKLGRMNK  183

Query  641   VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEI  820
             +NP+     QA++CLLPMGITSENVA R+GVTRQEQD+AAVESH +AAAATA+GKF+DEI
Sbjct  184   INPKVDIFAQARDCLLPMGITSENVAQRYGVTRQEQDKAAVESHSRAAAATASGKFQDEI  243

Query  821   IPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGA  1000
             +PV+TKIV+PKTG+E  VTISVDDGIRPNA++ DLAKLKP FK DG+TTAGN+SQV+DGA
Sbjct  244   VPVSTKIVDPKTGEERPVTISVDDGIRPNANMNDLAKLKPAFKADGSTTAGNASQVSDGA  303

Query  1001  GAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLF  1180
             GAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPA AIP AVKSAGLELDDIDLF
Sbjct  304   GAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPAVMGIGPAAAIPVAVKSAGLELDDIDLF  363

Query  1181  EINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR  1360
             EINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMKRRGKD R
Sbjct  364   EINEAFASQYVYCCKKLELDPEKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGKDHR  423

Query  1361  YGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +GV+SMCIG+GMGAA VFERGD+ DEL N R VE +  LS DAR
Sbjct  424   FGVISMCIGSGMGAAAVFERGDSVDELCNVRTVERNNLLSNDAR  467



>ref|XP_003570403.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brachypodium 
distachyon]
Length=461

 Score =   711 bits (1834),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/461 (77%), Positives = 408/461 (89%), Gaps = 3/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL HL P+ ++S+       +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4     AIDRQRVLLAHLAPSASSSAQGQ---QLSASACAAGDSAAYQRSSCFGDDVVIVAAYRTP  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP E+GDI+VGTVL PGS RA ECR A+ 
Sbjct  61    ICKAKRGGFKDTYPEDLLTPVLKAVLDNTGINPGEIGDIVVGTVLGPGSQRAIECRTASL  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
              AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM+VN M WEG VNP
Sbjct  121   LAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVNAMGWEGQVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R   LQ+AQ+CLLPMGITSENVAHR+GVTRQEQDQAA ESH +AAAATA+GKFKDEIIPV
Sbjct  181   RVIELQKAQDCLLPMGITSENVAHRYGVTRQEQDQAAAESHMRAAAATASGKFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKI++PKTG+E  V ISVDDGIRP  +   LAKLK VFKKDGTTTAGNSSQV+DGAGAV
Sbjct  241   PTKIIDPKTGEEKKVVISVDDGIRPGTTASGLAKLKTVFKKDGTTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R++A+ KGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE+DDIDLFE+N
Sbjct  301   LLMRRAVAMSKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLEIDDIDLFELN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC K LGLD  K+NVNGGA+A+GHPLGATGARC+ATLL+EMKRRG+DCR+GV
Sbjct  361   EAFASQFVYCCKTLGLDRSKVNVNGGAIAMGHPLGATGARCIATLLNEMKRRGRDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             V+MCIG+GMGAA VFERGD+ DELSN R V +  +LS+DA+
Sbjct  421   VTMCIGSGMGAAAVFERGDSVDELSNVRHVPSQNFLSRDAK  461



>ref|XP_011034453.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/461 (78%), Positives = 406/461 (88%), Gaps = 9/461 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A  RQRVLL HL   + +SS ++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4     ASNRQRVLLGHL---HYSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDT+ DDLLASVLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55    LCKSKRGGFKDTHADDLLASVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNR+CSSGLQAVADVAA+IKAGFY+IGIGAGLESMTVN+ AW G VNP
Sbjct  115   YAGFPETVPIRTVNRKCSSGLQAVADVAASIKAGFYEIGIGAGLESMTVNSRAWAGDVNP  174

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    Q+AQ+CLLPMG+TSENVAHRF VTRQEQDQAAV+SHRKAAAA+A+G+FKDEII V
Sbjct  175   KVKRFQEAQDCLLPMGVTSENVAHRFSVTRQEQDQAAVDSHRKAAAASASGRFKDEIISV  234

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  + +SVDDGIRPN S+ DL KLK VFKKDGTTTAGNSSQ++DGA AV
Sbjct  235   ATKIVDPKTGDEKPIIVSVDDGIRPNTSLADLGKLKAVFKKDGTTTAGNSSQISDGAAAV  294

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+ KGLPILGVFRTF  VGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDLFEIN
Sbjct  295   LLMKRSVAMHKGLPILGVFRTFVVVGVDPAIMGVGPAVAIPAAVKAAGLELEDIDLFEIN  354

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC KKL LD +KINVNGGA+AIGHPLG TGARCVAT+LHEMKRRG+DCR+GV
Sbjct  355   EAFASQFVYCCKKLELDLQKINVNGGAIAIGHPLGTTGARCVATILHEMKRRGRDCRFGV  414

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             VSMCIGTGMGAA VFERGD CDEL NARKVE++  LSKD+R
Sbjct  415   VSMCIGTGMGAAAVFERGDDCDELCNARKVESNNLLSKDSR  455



>ref|XP_010457531.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Camelina sativa]
Length=439

 Score =   709 bits (1830),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/448 (79%), Positives = 401/448 (90%), Gaps = 13/448 (3%)
 Frame = +2

Query  113   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  292
             +ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT L
Sbjct  5     MERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTAL  51

Query  293   CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  472
             CK+KRG FKDTYPDDLLASVL+ALIEKTN+NP+EVGDI+VGTVL PGS RASECRMAAFY
Sbjct  52    CKAKRGSFKDTYPDDLLASVLRALIEKTNVNPTEVGDIVVGTVLGPGSQRASECRMAAFY  111

Query  473   AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  652
             AGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+GSVNP+
Sbjct  112   AGFPQTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNPK  171

Query  653   ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVT  832
                 +QA +CLLPMGITSENVAHRF V+R+EQDQAAV+SHRKAA+ATA+GKFKDEIIPV 
Sbjct  172   VEKFEQAHSCLLPMGITSENVAHRFNVSREEQDQAAVDSHRKAASATASGKFKDEIIPVK  231

Query  833   TKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVL  1012
             TKIV+PKTGDE  +T+SVDDGIRPN ++  L KLKPVFKKDGTTTAGNSSQ++DGAGAVL
Sbjct  232   TKIVDPKTGDEKAITVSVDDGIRPNTTLSGLTKLKPVFKKDGTTTAGNSSQLSDGAGAVL  291

Query  1013  LMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINE  1192
             LM+R++A+QKGLPILGVFRTFAAVGVDPA+MG+GPA+AIPAAVK+AGLELDDIDLFEINE
Sbjct  292   LMRRNVAMQKGLPILGVFRTFAAVGVDPAIMGVGPALAIPAAVKAAGLELDDIDLFEINE  351

Query  1193  AFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVV  1372
             AFASQY+YC+ KLGL+PE INVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GVV
Sbjct  352   AFASQYVYCRNKLGLNPENINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGVV  411

Query  1373  SMCIGTGMGAAGVFERGDACDELSNARK  1456
             SMCIG+GMGAA VFERG + DEL N  +
Sbjct  412   SMCIGSGMGAAAVFERGGSVDELPNVSR  439



>gb|ACV70032.1| 3-ketoacyl CoA thiolase 1 [Petunia x hybrida]
Length=462

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/461 (78%), Positives = 405/461 (88%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL+HL+P    +   S  SS++ S+CAAGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  4     AIQRQRVLLEHLQPIRHHTHDHS--SSLTTSICAAGDSAAYQRTAAFGDDVVIVAAYRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKSKRGGFKDT  DDLLA VLKA+IEKTNL+P EVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  62    ICKSKRGGFKDTLSDDLLAPVLKAVIEKTNLDPKEVGDIVVGTVLAPGSIRAMECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLE MTV+ +      N 
Sbjct  122   YAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLELMTVDNIGRVQQRNT  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +  T  QA++CLLPMGITSENVA RFGVTR EQDQAAV SH++AAAATA+GKFKDEIIPV
Sbjct  182   KVDTFAQARDCLLPMGITSENVAQRFGVTRLEQDQAAVNSHQRAAAATASGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+P+TG E  V ISVDDGIRPN ++  L KLKP FK DGTTTAGN+SQV+DGA AV
Sbjct  242   LTKIVDPQTGKEKPVVISVDDGIRPNTNLTSLGKLKPAFKNDGTTTAGNASQVSDGAAAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFR+FAAVGVDPAVMGIGPAVAIP AVKSAGL+LDDIDL+EIN
Sbjct  302   LLMKRSVAMKKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPPAVKSAGLDLDDIDLYEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YCQKKL LDPEK+NVNGGAMA+GHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  362   EAFASQFVYCQKKLNLDPEKVNVNGGAMALGHPLGATGARCVATLLHEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIG+GMGAA VFERGDA D+L NAR    + +LSKDA+
Sbjct  422   ISMCIGSGMGAAAVFERGDAVDDLCNARVSNNNSFLSKDAK  462



>pdb|2C7Y|A Chain A, Plant Enzyme
 pdb|2C7Y|B Chain B, Plant Enzyme
 pdb|2C7Z|A Chain A, Plant Enzyme Crystal Form Ii
Length=404

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/403 (88%), Positives = 379/403 (94%), Gaps = 0/403 (0%)
 Frame = +2

Query  218   DSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEV  397
             DSAAYQR S+YGDD+VIVAA+RTPLCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEV
Sbjct  1     DSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEV  60

Query  398   GDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFY  577
             GDI+VGTVLAPGS RASECRMAAFYAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFY
Sbjct  61    GDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFY  120

Query  578   DIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQA  757
             DIGIGAGLESMT N MAWEGSVNP      QAQNCLLPMG+TSENVA RFGV+RQEQDQA
Sbjct  121   DIGIGAGLESMTTNPMAWEGSVNPAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQA  180

Query  758   AVESHRKaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLK  937
             AV+SHRKAAAATAAGKFKDEIIPV TK+V+PKTGDE  +T+SVDDGIRP  ++  L KLK
Sbjct  181   AVDSHRKAAAATAAGKFKDEIIPVKTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGKLK  240

Query  938   PVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGP  1117
             PVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGP
Sbjct  241   PVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGP  300

Query  1118  AVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGA  1297
             AVAIPAAVK+AGLELDDIDLFEINEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGA
Sbjct  301   AVAIPAAVKAAGLELDDIDLFEINEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGA  360

Query  1298  TGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  1426
             TGARCVATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD
Sbjct  361   TGARCVATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGD  403



>ref|XP_011006998.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=457

 Score =   706 bits (1823),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/461 (77%), Positives = 407/461 (88%), Gaps = 7/461 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A  RQ+VLL HL+PT+ +  L       SAS+CAAGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4     AFNRQKVLLAHLQPTSPSPLL-------SASICAAGDSAAYHRTAAFGDDIVIVAAYRTA  56

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK++RGGFKDT+PDDLL  VLKA++EKTN+NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  57    ICKARRGGFKDTFPDDLLGFVLKAVVEKTNVNPSEVGDIVVGTVLAPGSERAIECRMAAF  116

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAG+YDIGI AGLE MTVN++     VNP
Sbjct  117   YAGFPDTVPLRTVNRQCSSGLQAVADVAASIKAGYYDIGIAAGLECMTVNSIRSVPQVNP  176

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R  T QQA++CLLPMG+TSENVA R+GVTRQ+QDQAAV+SHRKAAAA A+GKFKDEIIPV
Sbjct  177   RVETFQQARDCLLPMGLTSENVAQRYGVTRQDQDQAAVDSHRKAAAARASGKFKDEIIPV  236

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKIV+P+TG +  +TIS DDGIRPN ++ +L++LKP FKKDG+TTAGN+SQV+DGAGAV
Sbjct  237   TTKIVDPETGKQKVITISEDDGIRPNTNLAELSRLKPAFKKDGSTTAGNASQVSDGAGAV  296

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA QKGLPILGVFR+FAAVGVDPAVMG+GPA AIPAAV+SAGLEL+DIDLFEIN
Sbjct  297   LLMKRSLAAQKGLPILGVFRSFAAVGVDPAVMGVGPAAAIPAAVQSAGLELNDIDLFEIN  356

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCV TLL+EMKRRGKD R+GV
Sbjct  357   EAFASQYVYCIKKLELDPEKVNVNGGAIALGHPLGATGARCVGTLLNEMKRRGKDSRFGV  416

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIG+GMGAA VFERGD  D L N RKVE++  LSKDAR
Sbjct  417   ISMCIGSGMGAAAVFERGDCVDALCNVRKVESNDLLSKDAR  457



>ref|XP_006649171.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=449

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/448 (78%), Positives = 407/448 (91%), Gaps = 4/448 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL HL P++++S+    +  +SAS CAAGDSAAYQR S YGDD+V+VAAYRTP
Sbjct  4     AIDRQRVLLAHLLPSSSSSN----QPLLSASACAAGDSAAYQRTSAYGDDVVVVAAYRTP  59

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +C++KRGGFKDTYP+DLL +VLKA+++ T +NP E+GDI+VG+VL PGS RA ECR AAF
Sbjct  60    ICRAKRGGFKDTYPEDLLTTVLKAVLDNTRINPGEIGDIVVGSVLGPGSQRAVECRAAAF  119

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM+VN+M WEG VNP
Sbjct  120   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVNSMGWEGQVNP  179

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             + S +Q+AQ+CLLPMGITSENVAHRFGVTRQEQDQAA ESHR+AAAATAAGKFKDEI+PV
Sbjct  180   KVSEVQKAQDCLLPMGITSENVAHRFGVTRQEQDQAAAESHRRAAAATAAGKFKDEIVPV  239

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKIV+PKTG+E  V ISVDDGIRP  +   LAKLKPVF+KDG+TTAGNSSQV+DGAGAV
Sbjct  240   STKIVDPKTGEEKKVVISVDDGIRPGTTASGLAKLKPVFRKDGSTTAGNSSQVSDGAGAV  299

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A++KGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL+++DIDLFE+N
Sbjct  300   LLMRRDVAMKKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLQIEDIDLFELN  359

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARCVATLL+EMKRRG+DCR+GV
Sbjct  360   EAFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDCRFGV  419

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNAR  1453
             V+MCIG+GMGAA VFERGD+ D+ SN R
Sbjct  420   VTMCIGSGMGAAAVFERGDSVDQFSNVR  447



>ref|XP_011083116.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=463

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/460 (77%), Positives = 406/460 (88%), Gaps = 1/460 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A  RQR+LLQHLRPT++ S   S +SS+S S+C AGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4     ATNRQRILLQHLRPTSSVSHQTS-DSSLSPSICLAGDSAAYHRTAAFGDDIVIVAAYRTA  62

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKSKRGGFKDT PDDLLA+VLKALI++TNLNP+EVGDIIVGTVLAPGS+RA ECRMAA 
Sbjct  63    ICKSKRGGFKDTLPDDLLAAVLKALIDRTNLNPAEVGDIIVGTVLAPGSLRAIECRMAAL  122

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP++VPVRTVNRQCSSGLQAVADVAA I+AG+YDIGI AGLESMTV+ M     VNP
Sbjct  123   YAGFPDSVPVRTVNRQCSSGLQAVADVAAFIQAGYYDIGIAAGLESMTVDAMGAIQMVNP  182

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMG+TSENVA R+GVTR+EQDQAAV SH++AAAA A+GKFKDEIIPV
Sbjct  183   KVERFSQARDCLLPMGVTSENVAERYGVTREEQDQAAVISHQRAAAAAASGKFKDEIIPV  242

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKIV+P TG+   VTISVDDGIRPN ++ DLAKLKP FKK+GTTTAGN+SQV+DGAGAV
Sbjct  243   STKIVDPTTGEVRPVTISVDDGIRPNTNMKDLAKLKPAFKKNGTTTAGNASQVSDGAGAV  302

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA+QKGLPILG+FR+FAAVGVDP VMGIGPAVAIP AVKSAGLEL DIDLFEIN
Sbjct  303   LLMKRSLAMQKGLPILGIFRSFAAVGVDPGVMGIGPAVAIPPAVKSAGLELSDIDLFEIN  362

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC KKL LD EK+NVNGGAMA+GHPLGATGARCVATLL+EMKRRGKDCR+GV
Sbjct  363   EAFASQFVYCCKKLDLDREKVNVNGGAMALGHPLGATGARCVATLLNEMKRRGKDCRFGV  422

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIG+GMGAA V ERGD  D+L NAR V  + +LSKDA
Sbjct  423   ISMCIGSGMGAAAVLERGDCVDDLCNARAVSENNFLSKDA  462



>dbj|BAI66423.1| 3-ketoacyl-CoA thiolase-like protein [Triticum aestivum]
Length=459

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/460 (77%), Positives = 413/460 (90%), Gaps = 6/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL HL P+  ASS    ++ +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4     AIDRQRVLLAHLLPS--ASS----QTQLSASPCAAGDSAAYQRSSCFGDDVVIVAAYRTP  57

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  58    ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  117

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
              AG PETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESM+VN++ WEG VNP
Sbjct  118   LAGIPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMSVNSVGWEGQVNP  177

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R   LQ+AQ+CLLPMGITSENVA R+GVTR+EQD+AAVESH +AAAATA+GKFKDEIIPV
Sbjct  178   RVIELQKAQDCLLPMGITSENVAQRYGVTREEQDKAAVESHARAAAATASGKFKDEIIPV  237

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+++PKTG+E  V ISVDDGIRP  ++  LAKLK VFKKDGTTTAGNSSQV+DGAGAV
Sbjct  238   HTKLIDPKTGEEKKVVISVDDGIRPGTTLSGLAKLKTVFKKDGTTTAGNSSQVSDGAGAV  297

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+ KGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE+DDIDLFE+N
Sbjct  298   LLMKRSVAVSKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLEIDDIDLFELN  357

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARC++TLL+EMKRRG+DCR+GV
Sbjct  358   EAFASQFVYCCNKLGLDRSKVNVNGGAIAMGHPLGATGARCISTLLNEMKRRGRDCRFGV  417

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             V+MCIG+GMGAA VFERGD+ DELSN R +++H +LSKDA
Sbjct  418   VTMCIGSGMGAAAVFERGDSVDELSNVRHIQSHNFLSKDA  457



>gb|EMT31542.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Aegilops tauschii]
Length=459

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/460 (76%), Positives = 413/460 (90%), Gaps = 6/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL HL P+  ASS    ++ +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4     AIDRQRVLLAHLLPS--ASS----QTQLSASPCAAGDSAAYQRSSCFGDDVVIVAAYRTP  57

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  58    ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  117

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
              AG PETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESM+VN++ WEG VNP
Sbjct  118   LAGIPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMSVNSVGWEGQVNP  177

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R   LQ+AQ+CLLPMGITSENVA R+GVTR+EQD+AAVESH +AAAATA+GKFKDEIIPV
Sbjct  178   RVIELQKAQDCLLPMGITSENVAQRYGVTREEQDKAAVESHARAAAATASGKFKDEIIPV  237

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+++PKTG+E  V ISVDDGIRP  ++  LAKLK VFKKDGTTTAGNSSQV+DGAGAV
Sbjct  238   HTKLIDPKTGEEKKVVISVDDGIRPGTTLSGLAKLKTVFKKDGTTTAGNSSQVSDGAGAV  297

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+ KGLP+LGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE+DDIDLFE+N
Sbjct  298   LLMKRSVAVSKGLPVLGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLEIDDIDLFELN  357

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARC++TLL+EMKRRG+DCR+GV
Sbjct  358   EAFASQFVYCCNKLGLDRSKVNVNGGAIAMGHPLGATGARCISTLLNEMKRRGRDCRFGV  417

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             V+MCIG+GMGAA VFERGD+ DELSN R +++H +LSKDA
Sbjct  418   VTMCIGSGMGAAAVFERGDSVDELSNVRHIQSHNFLSKDA  457



>ref|XP_004290230.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Fragaria 
vesca subsp. vesca]
Length=456

 Score =   703 bits (1814),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/450 (78%), Positives = 405/450 (90%), Gaps = 2/450 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASS-LDSIESSV-SASVCAAGDSAAYQRNSVYGDDIVIVAAYR  283
             A+ RQ+VLLQHLRP ++ SS + + ESSV SA +CAAGDSAAY R   +GDDIVIVAAYR
Sbjct  4     ALNRQKVLLQHLRPNSSLSSAIQTHESSVLSAEICAAGDSAAYHRTGAFGDDIVIVAAYR  63

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             T +CK+KRGGFKDT  DDLLA VLKA+IE+TNLNPSEVGDI+VGTVLAPGS+RA ECRMA
Sbjct  64    TAVCKAKRGGFKDTLADDLLAPVLKAVIERTNLNPSEVGDIVVGTVLAPGSLRAIECRMA  123

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  643
             AFYAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAG+YDIGI AG+E MT++++     +
Sbjct  124   AFYAGFPDTVPIRTVNRQCSSGLQAVADVAAFIKAGYYDIGIAAGVECMTIDSIGSIHKI  183

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NP+A    QA++CLLPMG+TSENVA  +GVTRQEQDQAAVESHR+AAAATA+GKFKDEI+
Sbjct  184   NPKAEAFAQARDCLLPMGVTSENVAQCYGVTRQEQDQAAVESHRRAAAATASGKFKDEIV  243

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV+TKIV+PKTG+E  VTISVDDGIRPNA++ DLAKLKP FK DGTTTAGN+SQV+DGAG
Sbjct  244   PVSTKIVDPKTGEERHVTISVDDGIRPNANMTDLAKLKPAFKSDGTTTAGNASQVSDGAG  303

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRS+AIQKGLPI+GVFR+FAAVGVDPAVMG+GPA AIP AVKSAGLEL DIDLFE
Sbjct  304   AVLLMKRSVAIQKGLPIIGVFRSFAAVGVDPAVMGVGPAAAIPVAVKSAGLELGDIDLFE  363

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQY+YCQKKL LD +K+NVNGGA+A+GHPLGATGARCVATLL+EMKRRGKDCR+
Sbjct  364   INEAFASQYVYCQKKLELDSDKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGKDCRF  423

Query  1364  GVVSMCIGTGMGAAGVFERGDACDELSNAR  1453
             GV+SMCIG+GMGAA V ERGD+ DEL NAR
Sbjct  424   GVISMCIGSGMGAAAVLERGDSVDELCNAR  453



>ref|XP_006350308.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=456

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/461 (78%), Positives = 404/461 (88%), Gaps = 8/461 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HL+P  +        SS++ SVC AGDS+AY R S +GDD+VIVAAYRT 
Sbjct  4     AIERQRVLLEHLQPIRS--------SSITPSVCLAGDSSAYHRTSAFGDDVVIVAAYRTA  55

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT  DDLLA VLKA++EKTNLNP+EVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  56    ICKAKRGGFKDTLSDDLLAPVLKAVVEKTNLNPNEVGDIVVGTVLAPGSIRAMECRMAAF  115

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLE MTV+ +      NP
Sbjct  116   YAGFPDTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLELMTVDNIGLVQKANP  175

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMGITSENVA RFGVTR EQDQAAV SH++AAAATA+GKFKDEIIPV
Sbjct  176   KVDAFAQARDCLLPMGITSENVAQRFGVTRLEQDQAAVISHQRAAAATASGKFKDEIIPV  235

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+P+TGDE  V ISVDDGIRP  ++  LAKLKP FK+DG TTAGNSSQV+DGA AV
Sbjct  236   LTKIVDPQTGDEKPVVISVDDGIRPTTNLTGLAKLKPAFKRDGATTAGNSSQVSDGAAAV  295

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLEL++IDLFEIN
Sbjct  296   LLMKRSIAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLELNNIDLFEIN  355

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YCQKKL LDPE +NVNGGA+A+GHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  356   EAFASQYVYCQKKLNLDPENVNVNGGALALGHPLGATGARCVATLLHEMKRRGKDCRFGV  415

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIG+GMGAA VFERGDA D+L NAR    + +LSKDA+
Sbjct  416   ISMCIGSGMGAAAVFERGDAVDDLCNARANNNNNFLSKDAK  456



>ref|XP_012085152.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Jatropha curcas]
 gb|KDP26413.1| hypothetical protein JCGZ_17571 [Jatropha curcas]
Length=452

 Score =   701 bits (1810),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/446 (78%), Positives = 403/446 (90%), Gaps = 2/446 (0%)
 Frame = +2

Query  119   RQRVLLQHLRPTNAASSLDSIE--SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  292
             RQ+VLL HL+P +++S L   +  SS+S S+CAAG+ AAY+R +V GDD+VIVAAYRT +
Sbjct  7     RQKVLLGHLQPNSSSSFLSHTQKSSSLSTSICAAGNGAAYRRTAVSGDDVVIVAAYRTAI  66

Query  293   CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  472
             CK+K+GGFKDT PDDL+ SVLKALIEKTN+NPSEVGDI+VGTVLAPGS+RA ECRM AFY
Sbjct  67    CKAKKGGFKDTLPDDLIGSVLKALIEKTNVNPSEVGDIVVGTVLAPGSLRAIECRMGAFY  126

Query  473   AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  652
             AGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+ +     VNP+
Sbjct  127   AGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVDKIDIVSQVNPK  186

Query  653   ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVT  832
                  QA++CLLPMGITSENVA R+G+TR EQDQAAVESHRKAAAATA+GKFKDEI+PV+
Sbjct  187   VEIFAQARDCLLPMGITSENVAQRYGITRLEQDQAAVESHRKAAAATASGKFKDEIVPVS  246

Query  833   TKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVL  1012
             TKIV+PKTG++ +VTISVDDGIRP  +I DL+ LKP FKKDG TTAGN+SQV+DGAGAVL
Sbjct  247   TKIVDPKTGEQKSVTISVDDGIRPTTNIADLSMLKPAFKKDGCTTAGNASQVSDGAGAVL  306

Query  1013  LMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINE  1192
             LMKRS+A++KGLPILGVFR+FAAVGVDPAVMG+GPA AIPAAVK+AGLEL+DI LFEINE
Sbjct  307   LMKRSVALKKGLPILGVFRSFAAVGVDPAVMGVGPAYAIPAAVKAAGLELNDISLFEINE  366

Query  1193  AFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVV  1372
             AFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGARCV+T+LHEMKRRGKDCR+GV+
Sbjct  367   AFASQYVYCIKKLGLDPEKVNVNGGALALGHPLGATGARCVSTILHEMKRRGKDCRFGVI  426

Query  1373  SMCIGTGMGAAGVFERGDACDELSNA  1450
             SMCIG+GMGAA VFERGD  DELS+A
Sbjct  427   SMCIGSGMGAAAVFERGDGVDELSSA  452



>ref|XP_009796304.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Nicotiana sylvestris]
Length=486

 Score =   702 bits (1812),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/461 (77%), Positives = 407/461 (88%), Gaps = 3/461 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HL+P  ++S      SS++ S+C AGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  29    AIERQRVLLEHLQPIRSSSHQ---FSSLTPSICLAGDSAAYQRTAAFGDDVVIVAAYRTA  85

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFK+T  DDLLA VLKA++EKTNL+P+EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  86    ICKAKRGGFKNTLADDLLAPVLKAVVEKTNLSPNEVGDIVVGTVLAPGSLRAMECRMAAF  145

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLE MTV+ +     VNP
Sbjct  146   YAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLELMTVDNIGRVQQVNP  205

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMGITSENVA RFGVTR EQDQAAV SH++AAAATA+GKFKDEIIPV
Sbjct  206   KVDAFAQARDCLLPMGITSENVAQRFGVTRLEQDQAAVISHQRAAAATASGKFKDEIIPV  265

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+P+T  E  V ISVDDGIRPN ++ +LAKLKP FK DGTTTAG +SQV+DGA AV
Sbjct  266   LTKIVDPQTRREKPVVISVDDGIRPNTNLTNLAKLKPAFKSDGTTTAGTASQVSDGAAAV  325

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLELD+IDLFEIN
Sbjct  326   LLMKRSVAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDNIDLFEIN  385

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+KKL LD EK+NVNGGAMA+GHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  386   EAFASQFVYCRKKLNLDSEKVNVNGGAMALGHPLGATGARCVATLLHEMKRRGKDCRFGV  445

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIG+GMGAA VFERGDA D+L NAR    + +LSKDA+
Sbjct  446   ISMCIGSGMGAAAVFERGDAVDDLCNARVNNNNNFLSKDAK  486



>ref|XP_004247103.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=456

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/461 (78%), Positives = 404/461 (88%), Gaps = 8/461 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HL+P  +        SS++ SVC AGDS+AY R S +GDD+VIVAAYRT 
Sbjct  4     AIERQRVLLEHLQPIRS--------SSITPSVCLAGDSSAYHRTSAFGDDVVIVAAYRTA  55

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT  DDLLA VLKA++EKTNLNPSEVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  56    ICKAKRGGFKDTLSDDLLAPVLKAVVEKTNLNPSEVGDIVVGTVLAPGSIRAMECRMAAF  115

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLE MTV+ +      NP
Sbjct  116   YAGFPDTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLEFMTVDNIGLVVKANP  175

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMGITSENVA RFGVTR EQDQAAV SH++AAAATA+GKFKDEIIPV
Sbjct  176   KVDAFAQARDCLLPMGITSENVAQRFGVTRLEQDQAAVISHQRAAAATASGKFKDEIIPV  235

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+P+TG+E  V ISVDDGIRP  ++  LAKLKP FK+DG TTAGNSSQV+DGA AV
Sbjct  236   LTKIVDPQTGNEKPVVISVDDGIRPTTNLTGLAKLKPAFKRDGATTAGNSSQVSDGAAAV  295

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLEL++IDLFEIN
Sbjct  296   LLMKRSVAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLELNNIDLFEIN  355

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YCQKKL LDPE +NVNGGA+A+GHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  356   EAFASQYVYCQKKLNLDPENVNVNGGALALGHPLGATGARCVATLLHEMKRRGKDCRFGV  415

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIG+GMGAA VFERGDA D+L NAR    + +LSKDA+
Sbjct  416   ISMCIGSGMGAAAVFERGDAVDDLCNARANNNNNFLSKDAK  456



>gb|ABR17647.1| unknown [Picea sitchensis]
Length=462

 Score =   701 bits (1809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/458 (78%), Positives = 403/458 (88%), Gaps = 4/458 (1%)
 Frame = +2

Query  119   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  298
             RQ+V L HLRP +           + ASVCAAGDSAAY+R + +GDD+VIVAAYRTP+CK
Sbjct  9     RQQVSLDHLRPAH----FPKASKDLVASVCAAGDSAAYERAAEFGDDVVIVAAYRTPICK  64

Query  299   SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  478
             +KRGGFKDT  DDLLA VLKALI+KT LNP EVGDI+VGTVLAPGS RA ECRMAAFYAG
Sbjct  65    AKRGGFKDTLADDLLAPVLKALIDKTGLNPVEVGDIVVGTVLAPGSQRAIECRMAAFYAG  124

Query  479   FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  658
             FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAG+ESM+V  +A+EGSVNP+  
Sbjct  125   FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGVESMSVTPLAFEGSVNPKVE  184

Query  659   TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTTK  838
               +QAQ+CLLPMGITSENVA R+GV+RQ+QDQAAVESHR+AAAATAAGKFKDEIIPV TK
Sbjct  185   IFRQAQDCLLPMGITSENVAERYGVSRQDQDQAAVESHRRAAAATAAGKFKDEIIPVETK  244

Query  839   IVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLM  1018
             IV+PKTGDE  VTISVDDGIRP++S+  L KLKP FKK G+TTAGNSSQV+DGAGAVLLM
Sbjct  245   IVDPKTGDEKPVTISVDDGIRPDSSLSVLGKLKPAFKKGGSTTAGNSSQVSDGAGAVLLM  304

Query  1019  KRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAF  1198
             KR +A+QKGLPILGVFR+F AVGVDPAVMG+GPAVAIPAAVK+AGLE+DDIDLFEINEAF
Sbjct  305   KRVVAMQKGLPILGVFRSFTAVGVDPAVMGVGPAVAIPAAVKAAGLEIDDIDLFEINEAF  364

Query  1199  ASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSM  1378
             ASQ+ YC +KL LDPEK+NVNGGA+A+GHPLGATGA CVATLLHEMK RGKDCR+GV+SM
Sbjct  365   ASQFTYCSQKLELDPEKVNVNGGAIALGHPLGATGALCVATLLHEMKLRGKDCRFGVISM  424

Query  1379  CIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             CIGTGMGAA VFER  A D+L NAR ++ H  LS+DA+
Sbjct  425   CIGTGMGAAAVFERSGAVDQLCNARPIKDHTSLSRDAQ  462



>ref|XP_008804745.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Phoenix dactylifera]
Length=460

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/460 (76%), Positives = 411/460 (89%), Gaps = 4/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLLQHL P++ +        ++S S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4     AIGRQRVLLQHLHPSSGSDD----HPTLSTSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKSKRGGFKDT+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60    ICKSKRGGFKDTHPEDLLAPVLKALLDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVAD+AA+IKAGFYDIGI AG+ESMTVN++     VNP
Sbjct  120   YAGFPETVPLRTVNRQCSSGLQAVADIAASIKAGFYDIGIAAGMESMTVNSVGRIVPVNP  179

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             RA    QA++CLLPMG+TSE VA R+GVTRQEQDQAAVESHR+AAAATAAGKFK+EIIPV
Sbjct  180   RAEMFAQARDCLLPMGMTSEIVAQRYGVTRQEQDQAAVESHRRAAAATAAGKFKEEIIPV  239

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKIV+PK+G+E  VTISVDDG+RP+ S+  LAKLKP FKKDG+TTAGN+SQV+DGAGAV
Sbjct  240   TTKIVDPKSGEEKQVTISVDDGVRPDTSMSVLAKLKPAFKKDGSTTAGNASQVSDGAGAV  299

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM++ +A+QKG PILGVFR+FAAVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDLFEIN
Sbjct  300   LLMRKDVAMQKGFPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKAAGLQIDDIDLFEIN  359

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGAR V+TLL+EMKRRGKDCR+GV
Sbjct  360   EAFASQFVYCCKKLELDPSKVNVNGGAIALGHPLGATGARSVSTLLNEMKRRGKDCRFGV  419

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIG+GMGAA VFERGD  D+LSN R+++++  LSKDA
Sbjct  420   ISMCIGSGMGAAAVFERGDVVDQLSNVRRIQSNNLLSKDA  459



>ref|XP_007225741.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26940.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=429

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/462 (76%), Positives = 392/462 (85%), Gaps = 37/462 (8%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIE-SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  286
             A  RQRVLL HLRP+  +SSL   + SS+SAS C AGDSAAY R +V+GDD+VIVAAYRT
Sbjct  4     AFNRQRVLLDHLRPS--SSSLHGTDPSSLSASACVAGDSAAYARKNVFGDDVVIVAAYRT  61

Query  287   PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  466
             P+CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAA
Sbjct  62    PICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAA  121

Query  467   FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  646
             FYAGFP                                 GIGAGLESMT N MAWEGSVN
Sbjct  122   FYAGFP---------------------------------GIGAGLESMTANPMAWEGSVN  148

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
             P+    +QAQNCLLPMG+TSENVAHRFGV+RQEQDQAAV+SHRKAAAATA GKFKDEIIP
Sbjct  149   PKVKIFEQAQNCLLPMGVTSENVAHRFGVSRQEQDQAAVDSHRKAAAATATGKFKDEIIP  208

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             V TKIV+PK+G+E  VTISVDDGIR N ++ DLAKLKPVFKKDG+TTAGNSSQV+DGAGA
Sbjct  209   VATKIVDPKSGEEKPVTISVDDGIR-NTTLADLAKLKPVFKKDGSTTAGNSSQVSDGAGA  267

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
             VLLMKRS+A +KGLPILGVFR+F+AVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEI
Sbjct  268   VLLMKRSIAERKGLPILGVFRSFSAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEI  327

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQY+YC+ KLGLDPEKINVNGGA+AIGHPLGATGAR VATLLHEMKRRGKDCR+G
Sbjct  328   NEAFASQYVYCRNKLGLDPEKINVNGGALAIGHPLGATGARAVATLLHEMKRRGKDCRFG  387

Query  1367  VVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             V+SMCIGTGMGAA VFERGD+ DEL NARKVE+  +LSKDAR
Sbjct  388   VISMCIGTGMGAAAVFERGDSTDELCNARKVESLNHLSKDAR  429



>ref|XP_002521123.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF41274.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=467

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/464 (77%), Positives = 410/464 (88%), Gaps = 3/464 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSV--SASVCAAGDSAAYQRNSVYGDDIVIVAAYR  283
             A+ RQ++LL HL+P++  SSL   + SV  S S+CAAGDS AY R + + DD+VIVAAYR
Sbjct  4     AVNRQKILLGHLQPSSPLSSLSQTQESVRLSTSICAAGDSTAYHRTAAFNDDVVIVAAYR  63

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             T +CKSKR GFKDT+PDDLL SVLKALIEKTN+NP+EVGDI+VGTVLAPGS+RA+ECRMA
Sbjct  64    TAICKSKRRGFKDTHPDDLLGSVLKALIEKTNVNPNEVGDIVVGTVLAPGSVRATECRMA  123

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTV-NTMAWEGS  640
             AF+AGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLE MT+ N  +    
Sbjct  124   AFFAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLECMTLDNIRSTPSQ  183

Query  641   VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEI  820
              NPR  +  QA++CLLPMGITSENVA R+GVTR EQDQAAVESHRKAAAATA+GKF+DEI
Sbjct  184   PNPRVESFTQARDCLLPMGITSENVAQRYGVTRLEQDQAAVESHRKAAAATASGKFRDEI  243

Query  821   IPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGA  1000
             IPV+TKIV+PKTG+E TV+I VDDGIRPN +I DL+KLKP FKKDG+TTAGN+SQV+DGA
Sbjct  244   IPVSTKIVDPKTGEEKTVSILVDDGIRPNTNIADLSKLKPAFKKDGSTTAGNASQVSDGA  303

Query  1001  GAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLF  1180
             GAVLL KRS+A+QKGLPILGVFR+FAAVGVDPAVMG+GPA AIPAAVK+AGLELD+IDLF
Sbjct  304   GAVLLAKRSVAVQKGLPILGVFRSFAAVGVDPAVMGVGPAFAIPAAVKAAGLELDNIDLF  363

Query  1181  EINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR  1360
             EINEAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCVATLLHEMKR GKDCR
Sbjct  364   EINEAFASQYVYCCKKLELDPEKVNVNGGAIALGHPLGATGARCVATLLHEMKRCGKDCR  423

Query  1361  YGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +GV+SMCIGTGMGAA VFERGD  DEL NAR V  +  LSKDA 
Sbjct  424   FGVISMCIGTGMGAAAVFERGDCVDELCNARPVNGNDLLSKDAH  467



>ref|NP_171965.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
 sp|Q8LF48.2|THIK1_ARATH RecName: Full=3-ketoacyl-CoA thiolase 1, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 1; AltName: Full=Beta-ketothiolase 
1; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM20592.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AAO30078.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AEE27736.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=443

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/450 (79%), Positives = 404/450 (90%), Gaps = 10/450 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4     ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRG FKDT+PD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  54    LCKAKRGSFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMAAF  113

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+GSVNP
Sbjct  114   YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNP  173

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                  +QA NCLLPMGITSENVAHRF V+R+EQDQAAV+SHRKAA+ATA+GKFKDEI PV
Sbjct  174   NVKKFEQAHNCLLPMGITSENVAHRFNVSREEQDQAAVDSHRKAASATASGKFKDEITPV  233

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  +T+SVDDGIRPN ++  LAKLKPVFK+DGTTTAGNSSQ++DGAGAV
Sbjct  234   KTKIVDPKTGDEKPITVSVDDGIRPNTTLSGLAKLKPVFKEDGTTTAGNSSQLSDGAGAV  293

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R++A+QKGLPILGVFRTF+AVGVDPA+MG+GPAVAIPAAVK+AGLEL+D+DLFEIN
Sbjct  294   LLMRRNVAMQKGLPILGVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLELNDVDLFEIN  353

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLD EKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  354   EAFASQFVYCRNKLGLDAEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  413

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKV  1459
             VSMCIG+GMGAA VFERG   DEL + RKV
Sbjct  414   VSMCIGSGMGAAAVFERGGGVDELCDVRKV  443



>ref|XP_009629663.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Nicotiana 
tomentosiformis]
Length=494

 Score =   699 bits (1804),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/462 (77%), Positives = 407/462 (88%), Gaps = 1/462 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESS-VSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  286
             AIERQRVLL+HL+P  ++S     +SS ++ S+C AGDSAAY+R + + DD+VIVAAYRT
Sbjct  33    AIERQRVLLEHLQPIRSSSHHTHDQSSSLTPSICLAGDSAAYRRTAAFDDDVVIVAAYRT  92

Query  287   PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  466
              +CK+KRGGFKDT  DDLLA VLKA++EKTNL+P+EVGDI+VGTVLAPGS+RA ECRMAA
Sbjct  93    AICKAKRGGFKDTLADDLLAPVLKAVVEKTNLSPNEVGDIVVGTVLAPGSLRAMECRMAA  152

Query  467   FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  646
             FYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLE MTV+ +     VN
Sbjct  153   FYAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLELMTVDNIGRVQQVN  212

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
             P+     QA++CLLPMGITSENVA RFGVTR EQDQAAV SH++AAAATA+GKFKDEIIP
Sbjct  213   PKVDAFAQARDCLLPMGITSENVAQRFGVTRLEQDQAAVISHQRAAAATASGKFKDEIIP  272

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             V TKIV+P+T  E  V ISVDDGIRPN ++ +LAKLKP FK DGTTTAG +SQV+DGA A
Sbjct  273   VLTKIVDPQTRREKPVVISVDDGIRPNTNLINLAKLKPAFKSDGTTTAGTASQVSDGAAA  332

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
             VLLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLELD+IDLFEI
Sbjct  333   VLLMKRSVAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDNIDLFEI  392

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQ++YC+KKL LD EK+NVNGGAMA+GHPLGATGARCVATLLHEMKRRGKDCR+G
Sbjct  393   NEAFASQFVYCRKKLNLDSEKVNVNGGAMALGHPLGATGARCVATLLHEMKRRGKDCRFG  452

Query  1367  VVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             V+SMCIG+GMGAA VFERGDA D+L NAR    + +LSKDA+
Sbjct  453   VISMCIGSGMGAAAVFERGDAVDDLCNARVNNNNNFLSKDAK  494



>ref|XP_009411367.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   697 bits (1799),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/460 (77%), Positives = 409/460 (89%), Gaps = 5/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL HL+P+    S       +S  VCAAGDSA YQR+S +GDD+VIVAA RT 
Sbjct  4     AIERQRVLLHHLQPSPPLRS-----PILSTEVCAAGDSAKYQRSSCFGDDVVIVAACRTA  58

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKSKRGGFKDT+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59    ICKSKRGGFKDTHPEDLLAPVLKALLDKTQLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN++   G VNP
Sbjct  119   YAGFPDTVPLRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNSVGLNGPVNP  178

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +A T  QA++CLLPMGITSENVA R+G+TRQEQD AAVESHR+AAAATAAGKFK+EIIPV
Sbjct  179   KAETFPQARDCLLPMGITSENVADRYGITRQEQDYAAVESHRRAAAATAAGKFKEEIIPV  238

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+   VTISVDDGIR + S+  LAKLKP FKKDG+TTAGN+SQV+DGAGAV
Sbjct  239   VTKIVDPKTGEHKRVTISVDDGIRLDTSMSVLAKLKPAFKKDGSTTAGNASQVSDGAGAV  298

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A+QKGLPILGVFR+FAAVGV+P VMGIGPAVAIPAAV++AGL+ DDID+FEIN
Sbjct  299   LLMRRDVAMQKGLPILGVFRSFAAVGVEPGVMGIGPAVAIPAAVRAAGLQPDDIDIFEIN  358

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC KKL LDPEK+NVNGGA+A+GHPLGATGARCV+TLL+EMKRRGKDCR+GV
Sbjct  359   EAFASQFVYCCKKLELDPEKVNVNGGAIALGHPLGATGARCVSTLLNEMKRRGKDCRFGV  418

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIG+GMGAA VFE GD  D+L+NAR+VE + +LSKDA
Sbjct  419   ISMCIGSGMGAAAVFEHGDVVDQLTNARQVEANSFLSKDA  458



>ref|XP_009336051.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=453

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/450 (77%), Positives = 402/450 (89%), Gaps = 0/450 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ RQRVLLQHLRP ++ SS +     +SAS+CAAGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4     AMNRQRVLLQHLRPNSSVSSSNYESDPLSASICAAGDSAAYHRTAAFGDDVVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT PDDLLA VLK +IE+TNLNPSEVGDI+VGTV+APGS+RA+ECRMAAF
Sbjct  64    ICKAKRGGFKDTLPDDLLAPVLKEVIERTNLNPSEVGDIVVGTVMAPGSLRATECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAG+YDIGI AGLES+TV+ +     +NP
Sbjct  124   YAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGYYDIGIAAGLESLTVDKLGRSRKINP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMGITSENVA R+GVTR+EQD+AAVESHR+AA ATA+GKFKDEI+PV
Sbjct  184   KVDIFAQARDCLLPMGITSENVAQRYGVTREEQDRAAVESHRRAAVATASGKFKDEIVPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKIV+PKTG+E  VTISVDDGIRPN ++ DLAKLKP FK DG+TTAGN+SQV+DGAGAV
Sbjct  244   STKIVDPKTGEERPVTISVDDGIRPNTNMNDLAKLKPAFKPDGSTTAGNASQVSDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA+QKGLPILGVFR+FAA+GVDPAVMG+GPA AIP AVKSAGLELDDIDLFEIN
Sbjct  304   LLMKRSLAMQKGLPILGVFRSFAAIGVDPAVMGVGPAAAIPVAVKSAGLELDDIDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGAT    VATLL+EMKRRG+D R+GV
Sbjct  364   EAFASQYVYCCKKLGLDPEKVNVNGGAIALGHPLGATXXXXVATLLNEMKRRGRDHRFGV  423

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKV  1459
             +SMCIG+GMGAA VFERGD+ DEL NAR V
Sbjct  424   ISMCIGSGMGAAAVFERGDSVDELCNARTV  453



>ref|XP_008804452.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=460

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/460 (76%), Positives = 407/460 (88%), Gaps = 4/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ VLLQHLRP    SS      ++SAS+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4     AINRQSVLLQHLRP----SSDFGDRPALSASICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKS RGGF++T+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60    ICKSSRGGFRNTHPEDLLAPVLKALLDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVAD+AAAIK+GFY+IGI AG+ESMTV+ + W G  NP
Sbjct  120   YAGFPETVPLRTVNRQCSSGLQAVADIAAAIKSGFYEIGIAAGMESMTVDKIRWIGPANP  179

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             RA    QA++CLLPMG+TSE VA R+G+TRQEQDQAAVESHR+AAAA AAGKFK+EIIPV
Sbjct  180   RAEMFAQARDCLLPMGMTSEIVAERYGITRQEQDQAAVESHRRAAAANAAGKFKEEIIPV  239

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKI++PKTG+E  V ISVDDGIRP+ S+  LAKLKP FKKDG+TTAGN+SQV+DGAGAV
Sbjct  240   TTKIIDPKTGEEKQVIISVDDGIRPDTSMSVLAKLKPAFKKDGSTTAGNASQVSDGAGAV  299

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A++KGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAV +AGL+ DDIDLFEIN
Sbjct  300   LLMRRDVAMKKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVNAAGLQTDDIDLFEIN  359

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC KKL LDP K+NVNGGA+A+GHPLG TGARCV+TLL+EMKRRGKDCR+GV
Sbjct  360   EAFASQFVYCCKKLELDPSKVNVNGGALALGHPLGDTGARCVSTLLNEMKRRGKDCRFGV  419

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIG+GMGAA VFERGD  D+LSNAR++ ++  LSKDA
Sbjct  420   ISMCIGSGMGAAAVFERGDVVDQLSNARRIRSNNLLSKDA  459



>gb|AAM61609.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
Length=443

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/450 (78%), Positives = 403/450 (90%), Gaps = 10/450 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4     ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRG FKDT+PD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  54    LCKAKRGSFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMAAF  113

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+GSVNP
Sbjct  114   YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNP  173

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                  +QA NCLLPMGITSENVAHRF V+R+EQDQAAV+SHRKAA+ATA+GKFKDEI PV
Sbjct  174   NVKKFEQAHNCLLPMGITSENVAHRFNVSREEQDQAAVDSHRKAASATASGKFKDEITPV  233

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  +T+SVDDGIRPN ++  LAKLKPVFK+DGTTTAGNSSQ++DGAGAV
Sbjct  234   KTKIVDPKTGDEKPITVSVDDGIRPNTTLSGLAKLKPVFKEDGTTTAGNSSQLSDGAGAV  293

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R++A+QKGLPILGVFRTF+AVGVDPA+MG+GPAVAIPAAVK+AGLEL+D+DLFEIN
Sbjct  294   LLMRRNVAMQKGLPILGVFRTFSAVGVDPAIMGVGPAVAIPAAVKAAGLELNDVDLFEIN  353

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLG D EKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  354   EAFASQFVYCRNKLGQDAEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  413

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKV  1459
             VSMCIG+GMGAA VFERG   DEL + RKV
Sbjct  414   VSMCIGSGMGAAAVFERGGDVDELCDVRKV  443



>ref|XP_010933143.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/460 (76%), Positives = 405/460 (88%), Gaps = 4/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLLQH  P++A+        ++S S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4     AISRQRVLLQHFHPSSASDD----HPTLSTSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKSKRGGFKDT+P+DLLA VLK L++KT LNPSEVGDI+VGTVLA GS RA ECRMAAF
Sbjct  60    ICKSKRGGFKDTHPEDLLAPVLKELLDKTKLNPSEVGDIVVGTVLASGSQRAIECRMAAF  119

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV ++TVNRQCSSGLQAVAD+AAAIKAG YDIGI AG+ESMTVN++  +G VNP
Sbjct  120   YAGFPETVSLKTVNRQCSSGLQAVADIAAAIKAGLYDIGIAAGMESMTVNSVRLKGPVNP  179

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             RA    QA++CLLPMG+TSE VA R+G+TR+EQDQAAVESH +AAAA AAGKFK+EIIPV
Sbjct  180   RAEMFAQARDCLLPMGMTSEIVAQRYGITRREQDQAAVESHSRAAAAAAAGKFKEEIIPV  239

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKIV+PKTG+E  VTISVDDGIRP  S+  LAKLKP FKKDGTTTAGN+SQV+DGAGAV
Sbjct  240   TTKIVDPKTGEEKRVTISVDDGIRPGTSVSVLAKLKPAFKKDGTTTAGNASQVSDGAGAV  299

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A+QKGLPILGVFR+F AVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDLFEIN
Sbjct  300   LLMRRDVAMQKGLPILGVFRSFGAVGVDPAVMGIGPAVAIPAAVKAAGLQIDDIDLFEIN  359

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC KKL LDP K+NVNGGA+A+GHPLGATGARCV TLL+EMKRRGK CR+GV
Sbjct  360   EAFASQFVYCCKKLELDPSKVNVNGGAIALGHPLGATGARCVITLLNEMKRRGKKCRFGV  419

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIG+GMGAA VFERGD  D+LSNAR++++   LSKDA
Sbjct  420   ISMCIGSGMGAAAVFERGDVVDQLSNARRIQSTSLLSKDA  459



>ref|XP_010484155.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=440

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/447 (78%), Positives = 395/447 (88%), Gaps = 13/447 (3%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT 
Sbjct  4     AMERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTA  50

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRG FKDTYPDDLLASVL+A+I KTN+NPSEVGDI+VGTVL  GS RA+ECRMAAF
Sbjct  51    LCKAKRGSFKDTYPDDLLASVLRAMIVKTNVNPSEVGDIVVGTVLGTGSQRATECRMAAF  110

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+G VNP
Sbjct  111   YAGFPQTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGLVNP  170

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QA +CLLPMGITSENVAHRF V+R+EQDQAAV+SHRKAA+ATA+GKFKDEI PV
Sbjct  171   KVEKFEQAHSCLLPMGITSENVAHRFNVSREEQDQAAVDSHRKAASATASGKFKDEITPV  230

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+P TGDE  + +SVDDGIRPN ++  L KLK VFKKDGTTTAGNSSQ++DGAGAV
Sbjct  231   KTKIVDPNTGDEKAIIVSVDDGIRPNTTLSGLTKLKSVFKKDGTTTAGNSSQLSDGAGAV  290

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R++A+QKGLPILGVFRTFAAVGVDP +MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  291   LLMRRNVAMQKGLPILGVFRTFAAVGVDPEIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  350

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC+ KLGL+PEKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  351   EAFASQYVYCRNKLGLNPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  410

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNA  1450
             VSMCIG+GMGAA VFERG + DEL N+
Sbjct  411   VSMCIGSGMGAAAVFERGGSVDELPNS  437



>emb|CDX86611.1| BnaC08g00920D [Brassica napus]
Length=451

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/451 (81%), Positives = 408/451 (90%), Gaps = 3/451 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL HLRP   +SS     SS+S S C AGDSAAYQR S+YGDD+VIVAA RT 
Sbjct  4     AIERQRVLLHHLRPPPPSSSQ---ASSLSVSACLAGDSAAYQRTSLYGDDVVIVAAQRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRG FKDTYPD+LLA VL+A+IEKT LNPSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61    LCKAKRGSFKDTYPDELLAPVLRAVIEKTKLNPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT +   W+GSVNP
Sbjct  121   YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTSPRGWKGSVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQ+CLLPMGITSENVAHRFGV+R+EQDQAAV+SHRKAA+ATA+GKFKDEI PV
Sbjct  181   KVKKFEQAQSCLLPMGITSENVAHRFGVSREEQDQAAVDSHRKAASATASGKFKDEITPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              T+IV+PKT DE  +T+SVDDGIRP+ ++  LAKLKPVFK+DG+TTAGNSSQV+DGAGAV
Sbjct  241   NTRIVDPKTCDEKPITVSVDDGIRPSTTLSGLAKLKPVFKQDGSTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFRTFAAVGVDPAVMG+GPA AIPAAVK+AGLELDDIDLFEIN
Sbjct  301   LLMKRSVAMQKGLPILGVFRTFAAVGVDPAVMGVGPAAAIPAAVKAAGLELDDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  361   EAFASQFVYCRNKLGLDPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVE  1462
             V+MCIG+GMGAAGVFERGD  DELSN RKVE
Sbjct  421   VTMCIGSGMGAAGVFERGDGVDELSNVRKVE  451



>ref|XP_009111084.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Brassica rapa]
Length=451

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/451 (80%), Positives = 410/451 (91%), Gaps = 3/451 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ERQRVLL HL+P  ++SS     SS+S S C AGDS AYQR S+YGDD+VIVAA RT 
Sbjct  4     AMERQRVLLHHLQPLPSSSSQ---ASSLSVSACLAGDSNAYQRTSLYGDDVVIVAAQRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRG FKDTYPD+LLASVL+A+IEKT L+PSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61    LCKAKRGSFKDTYPDELLASVLRAVIEKTKLDPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT +   W+GSVNP
Sbjct  121   YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTSPRGWKGSVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQ+CLLPMGITSENVAHRFGV+R+EQDQAAV+SHRKAA+ATA+GKFKDEI PV
Sbjct  181   KVKKFEQAQSCLLPMGITSENVAHRFGVSREEQDQAAVDSHRKAASATASGKFKDEITPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              T+IV+PKTGDE  +T+SVDDGIRP+ ++  LAKLKPVFK+DG+TTAGNSSQV+DGAGAV
Sbjct  241   NTRIVDPKTGDEKPITVSVDDGIRPSTTLSGLAKLKPVFKQDGSTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+AI+KGLPILGVFRTFAAVGVDPAVMG+GPA AIPAAVK+AGLE+DDIDLFEIN
Sbjct  301   LLMKRSVAIKKGLPILGVFRTFAAVGVDPAVMGVGPAAAIPAAVKAAGLEVDDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDP+KINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  361   EAFASQFVYCRNKLGLDPQKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVE  1462
             VSMCIG+GMGAAGVFERGD  DELSN RKVE
Sbjct  421   VSMCIGSGMGAAGVFERGDGVDELSNVRKVE  451



>dbj|BAJ87577.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/460 (77%), Positives = 408/460 (89%), Gaps = 5/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL HL P+ A++      S +SAS CAAGDSAAYQR S +GDD+VIVAAYRTP
Sbjct  4     AIDRQRVLLAHLLPSPASAG-----SQLSASACAAGDSAAYQRTSCFGDDVVIVAAYRTP  58

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  59    ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  118

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
              AG PETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM+VN++ WEG VNP
Sbjct  119   LAGIPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVNSVGWEGQVNP  178

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R   LQ+AQ+CLLPMGITSENVA R+GVTRQEQD+AA ESH +AAAATA+GKFKDEIIPV
Sbjct  179   RVIELQKAQDCLLPMGITSENVAERYGVTRQEQDKAAAESHARAAAATASGKFKDEIIPV  238

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKI++PKTG+E  V ISVDDGIRP  +   LAKLK VFKKDGTTTAGNSSQV+DGAGAV
Sbjct  239   HTKIIDPKTGEEKKVVISVDDGIRPGTTPSGLAKLKTVFKKDGTTTAGNSSQVSDGAGAV  298

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+ KGLPILGVFR+F AVGVDPAVMGIGPAVAIPAAVKSAGLE+DDIDLFE+N
Sbjct  299   LLMKRSVAVSKGLPILGVFRSFVAVGVDPAVMGIGPAVAIPAAVKSAGLEIDDIDLFELN  358

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARC++TLL+EMKRRG+DCR+GV
Sbjct  359   EAFASQFVYCCNKLGLDRSKVNVNGGAIAMGHPLGATGARCISTLLNEMKRRGRDCRFGV  418

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             V+MCIG+GMGAA VFERGD+ DELSN R +++H +LSKDA
Sbjct  419   VTMCIGSGMGAAAVFERGDSVDELSNVRHIQSHNFLSKDA  458



>ref|XP_010918893.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   692 bits (1785),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/460 (76%), Positives = 412/460 (90%), Gaps = 4/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLLQHLRP++ +        +++ S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4     AINRQRVLLQHLRPSSGSDD----RPALTTSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKS RGGFK+T+P+DLLA +LKAL++KT +NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60    ICKSNRGGFKNTHPEDLLAPLLKALLDKTKVNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVAD+AAAIK+GFY+IGI AG+ESMTV+ + W G  NP
Sbjct  120   YAGFPETVPLRTVNRQCSSGLQAVADIAAAIKSGFYEIGIAAGMESMTVDKIGWIGQTNP  179

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             RA    QA++CLLPMG+TSE VA R+G+TRQEQDQAAVESHR+AAAATAAGKFK+EIIPV
Sbjct  180   RAEMFAQAKDCLLPMGMTSEIVAERYGITRQEQDQAAVESHRRAAAATAAGKFKEEIIPV  239

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKI++PKTG+E  V ISVDDGIRP+ S+  LAKLKP FKKDG+TTAGN+SQV+DGAGAV
Sbjct  240   TTKIIDPKTGEEKQVIISVDDGIRPDTSMSVLAKLKPAFKKDGSTTAGNASQVSDGAGAV  299

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDLFEIN
Sbjct  300   LLMRRDVAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKAAGLQIDDIDLFEIN  359

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKL LDP K+NVNGGAMA GHPLGATGARCV+TLL+EMKRRGKDCR+GV
Sbjct  360   EAFASQYVYCCKKLELDPSKVNVNGGAMAFGHPLGATGARCVSTLLNEMKRRGKDCRFGV  419

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIG+GMGAA VFERGD  D+LSNAR+++++  LSKDA
Sbjct  420   ISMCIGSGMGAAAVFERGDVVDQLSNARRIQSNNQLSKDA  459



>emb|CDP03848.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/463 (76%), Positives = 404/463 (87%), Gaps = 2/463 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASS--LDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  283
             AI RQ+VLL+HL+PT+  S        SS+S S+C AGDSAAYQR + +GDD+VIVAAYR
Sbjct  4     AIFRQKVLLEHLQPTSCFSHQLTHEESSSISPSICLAGDSAAYQRTAAFGDDVVIVAAYR  63

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             T +CKSKRGGFKDT  DDLLA VLKALI+KTN+NPSEVGDI+VGTV+APGS RA+ECRMA
Sbjct  64    TAICKSKRGGFKDTLADDLLAPVLKALIDKTNINPSEVGDIVVGTVVAPGSQRATECRMA  123

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  643
             AFYAGFPETVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESMT N+       
Sbjct  124   AFYAGFPETVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLESMTTNSNVSIQQA  183

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NPR  +  QA++CLLPMGITSENVA R+GVTRQEQDQAAV SH++AAAATA+GK+KDEII
Sbjct  184   NPRVDSFPQARDCLLPMGITSENVAERYGVTRQEQDQAAVMSHKRAAAATASGKYKDEII  243

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV TKI +PK G+E  VT+SVDDGIRP+ ++ DLAKLKP FKKDGTTTAGN+SQ++DGAG
Sbjct  244   PVFTKIKDPKNGEEKPVTVSVDDGIRPSTNLTDLAKLKPAFKKDGTTTAGNASQISDGAG  303

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRSLA++KGLPILG+FR+F+  GVDPAVMGIGPAVAIPAA KSAGL +DDIDLFE
Sbjct  304   AVLLMKRSLAMEKGLPILGIFRSFSVAGVDPAVMGIGPAVAIPAAAKSAGLGVDDIDLFE  363

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQY+YC KKL LD EK+NVNGGAMA+GHPLGATGARCVATLLHEMKRRG+DCR+
Sbjct  364   INEAFASQYVYCCKKLELDMEKVNVNGGAMALGHPLGATGARCVATLLHEMKRRGRDCRF  423

Query  1364  GVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             GV+SMCIG+GMGAAGVFERGD+ D+L NAR V     LSKD +
Sbjct  424   GVISMCIGSGMGAAGVFERGDSTDDLCNARPVSKVNLLSKDVK  466



>ref|XP_010038353.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 ref|XP_010038354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW50167.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
 gb|KCW50168.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=466

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/463 (76%), Positives = 406/463 (88%), Gaps = 2/463 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAA--GDSAAYQRNSVYGDDIVIVAAYR  283
             A++RQRVLL+HL+P+ ++ S      S   S  A   GD AAYQR + +GDD+VIVAAYR
Sbjct  4     ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64    TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  643
             AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+ +     V
Sbjct  124   AFYAGFPETVPLRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVDQVRAVPKV  183

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NPR  +  QA++CLLPMGITSENVA RFGVTRQEQDQAAVESHR+A AAT +GKFKDEII
Sbjct  184   NPRVHSFAQARDCLLPMGITSENVAQRFGVTRQEQDQAAVESHRRAYAATQSGKFKDEII  243

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV+TK V+PKTG+E  VTISVDDGIRPN +I DLAKLKP F+KDG TTAGN+SQV+DGAG
Sbjct  244   PVSTKFVDPKTGEEKPVTISVDDGIRPNTNINDLAKLKPAFRKDGATTAGNASQVSDGAG  303

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL LDDIDL E
Sbjct  304   AVLLMKRSVAVQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLTLDDIDLLE  363

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMKR+G+D R+
Sbjct  364   INEAFASQYVYCCKKLGLDPEKVNVNGGALALGHPLGATGARCVATLLNEMKRQGRDSRF  423

Query  1364  GVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             GV+SMCIG+GMGAA VFERGD  DEL NAR ++ +  LS+DA+
Sbjct  424   GVISMCIGSGMGAAAVFERGDCADELCNARPIKINNLLSRDAQ  466



>gb|KHG13200.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
 gb|KHG18802.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=454

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/453 (78%), Positives = 401/453 (89%), Gaps = 3/453 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLL HL+P++   S  S  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4     AINRQQVLLNHLQPSS--QSHQSPAAILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT  DDLLA VLKA+I++T LNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62    ICKAKRGGFKDTLADDLLAPVLKAVIDRTKLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS-VN  646
             YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESMT N  A + S VN
Sbjct  122   YAGFPDTVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLESMTTNGSAPDQSKVN  181

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
             P+  +  QA++CLLPMGITSENVA R+GVTRQEQDQAAVESHR+AAAATA+GKFK+EI+P
Sbjct  182   PKVESFAQARDCLLPMGITSENVAQRYGVTRQEQDQAAVESHRRAAAATASGKFKEEIVP  241

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             V+TKIV+PKTG+E  VTISVDDGIRP+ ++  LAKLKP FKKDGTTTAGN+SQV+DGAGA
Sbjct  242   VSTKIVDPKTGEEKAVTISVDDGIRPDTNMAGLAKLKPAFKKDGTTTAGNASQVSDGAGA  301

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
             VLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE+DDIDLFEI
Sbjct  302   VLLMKRSLALQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLEIDDIDLFEI  361

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLG TGARCV TLL+EMKRRGKDCR+G
Sbjct  362   NEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGVTGARCVGTLLNEMKRRGKDCRFG  421

Query  1367  VVSMCIGTGMGAAGVFERGDACDELSNARKVET  1465
             V+SMCIGTGMGAA VFERGD  DEL NAR V+ 
Sbjct  422   VISMCIGTGMGAAAVFERGDCVDELCNARAVKN  454



>ref|XP_002963753.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
 gb|EFJ35624.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
Length=462

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/458 (77%), Positives = 404/458 (88%), Gaps = 5/458 (1%)
 Frame = +2

Query  119   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  298
             RQ++LL HLRP++A   ++ +      S+C+AGDSAAY R + Y DD+V+VAAYRTP+CK
Sbjct  10    RQQILLDHLRPSSAPRPVNLV-----TSICSAGDSAAYHRTTDYSDDVVVVAAYRTPICK  64

Query  299   SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  478
             SKRGGFKDTYP+DLL  VLKA++EK  LNP+EVGDI+VGTVLAPGS RA+ECRMAAFYAG
Sbjct  65    SKRGGFKDTYPEDLLTPVLKAVVEKVGLNPAEVGDIVVGTVLAPGSQRANECRMAAFYAG  124

Query  479   FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  658
             FPETVPVRTVNRQCSSGLQAVADV AAIKAGFYDIGIGAGLESMT N +AWEGSVNP+  
Sbjct  125   FPETVPVRTVNRQCSSGLQAVADVVAAIKAGFYDIGIGAGLESMTANLVAWEGSVNPKVE  184

Query  659   TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTTK  838
               Q+AQ+CLLPMGITSENVA R+GV+R+EQD+AAV SHR+AAAATA G+FKDEIIPV TK
Sbjct  185   MNQKAQDCLLPMGITSENVAERYGVSRKEQDEAAVRSHRRAAAATATGRFKDEIIPVHTK  244

Query  839   IVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLM  1018
             +V+PKTG+E  V IS DDG+RPNA++ DLAKLKP FKK GTTTAGNSSQV+DGAGAVLLM
Sbjct  245   LVDPKTGEEKPVVISADDGMRPNANVADLAKLKPAFKKGGTTTAGNSSQVSDGAGAVLLM  304

Query  1019  KRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAF  1198
             KRS+AIQ+GLPILGVFR+FAAVGVDPAVMGIGPAVAIP AVK AGLE+ DIDLFE+NEAF
Sbjct  305   KRSVAIQRGLPILGVFRSFAAVGVDPAVMGIGPAVAIPKAVKDAGLEISDIDLFELNEAF  364

Query  1199  ASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSM  1378
             ASQ+ Y  KKL LD EK+NVNGGAMA+GHPLGATGARCVATLLHEM +RGKDCR+GV+SM
Sbjct  365   ASQFTYSCKKLDLDIEKVNVNGGAMALGHPLGATGARCVATLLHEMSKRGKDCRFGVISM  424

Query  1379  CIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             CIG+GMGAA VFERG+A D LSNAR V+ +  LSKDAR
Sbjct  425   CIGSGMGAAAVFERGNAVDNLSNARPVQNNSLLSKDAR  462



>ref|XP_010109695.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXC24165.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=452

 Score =   689 bits (1778),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/450 (77%), Positives = 404/450 (90%), Gaps = 5/450 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A ERQRVLLQHL PT   SS  +  +S+SAS+CAAG S AYQR + +GDDIVIVAA RT 
Sbjct  4     AAERQRVLLQHLSPT---SSQTNDTASLSASICAAGQSGAYQRTAAFGDDIVIVAACRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT  DDLLA+VLKA+IE+TNL+PSE+GDI+VGTVLAPGS+RA ECRMAA 
Sbjct  61    ICKAKRGGFKDTPVDDLLAAVLKAVIERTNLDPSEIGDIVVGTVLAPGSVRAIECRMAAI  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV--  643
             YAG P+TVPVRTVNRQCSSGLQAVAD+AA+IKAG+YDIGIGAG+E MT+++MA    V  
Sbjct  121   YAGIPDTVPVRTVNRQCSSGLQAVADIAASIKAGYYDIGIGAGVECMTIDSMALSEHVAK  180

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NPR     QA++CLLPMG+TSENVA R+GVTR+EQDQAAVESHR+AAAA AAGKFK+EII
Sbjct  181   NPRLQVFTQARDCLLPMGMTSENVAERYGVTRREQDQAAVESHRRAAAAIAAGKFKEEII  240

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV+TKIV+PKTG+E  V ISVD+G+RPN ++ DLAKLKP F+KDG+TTAGN+SQV+DG+G
Sbjct  241   PVSTKIVDPKTGEEKPVIISVDEGVRPNTNLNDLAKLKPAFRKDGSTTAGNASQVSDGSG  300

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRSLAI+KGLP+LGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLEL+DIDLFE
Sbjct  301   AVLLMKRSLAIKKGLPVLGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLELNDIDLFE  360

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGAR V+TLL+EMKRRGKDCR+
Sbjct  361   INEAFASQYVYCIKKLGLDPEKVNVNGGALALGHPLGATGARSVSTLLNEMKRRGKDCRF  420

Query  1364  GVVSMCIGTGMGAAGVFERGDACDELSNAR  1453
             G++SMCIG+GMGAA V ERGD+ DEL NAR
Sbjct  421   GIISMCIGSGMGAAAVLERGDSVDELRNAR  450



>ref|XP_006307517.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
 gb|EOA40415.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
Length=444

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/446 (78%), Positives = 398/446 (89%), Gaps = 10/446 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ERQRVLLQHL+P++++ S  S  + +          AAYQ  S YGDD+VIVAA RT 
Sbjct  4     AMERQRVLLQHLQPSSSSDSALSPSACL----------AAYQNTSKYGDDVVIVAAQRTA  53

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRG FKDTYPD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMA+F
Sbjct  54    ICKAKRGSFKDTYPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMASF  113

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP TVP+RTVNRQC+SGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+GSVNP
Sbjct  114   YAGFPLTVPIRTVNRQCASGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNP  173

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QA +CLLPMGITSENV+HRF ++R+EQDQAAV+SHRKAA+ATA+GKF+DEIIPV
Sbjct  174   KVKNFEQAHSCLLPMGITSENVSHRFNISREEQDQAAVDSHRKAASATASGKFEDEIIPV  233

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  +T+SVDDGIRPN ++  L KLKPVFKKDGTTTAGNSSQ++DGAGAV
Sbjct  234   KTKIVDPKTGDEKPITVSVDDGIRPNTTLSGLMKLKPVFKKDGTTTAGNSSQLSDGAGAV  293

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+RS+A++KGLPILGVFRTFAAVGVDPA+MGIGPAVAIP AVK+A LELDDIDLFEIN
Sbjct  294   LLMRRSVAMEKGLPILGVFRTFAAVGVDPAIMGIGPAVAIPTAVKAASLELDDIDLFEIN  353

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLG++PEKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  354   EAFASQFVYCRNKLGINPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  413

Query  1370  VSMCIGTGMGAAGVFERGDACDELSN  1447
             VSMCIG+GMGAA VFERGD+ DEL N
Sbjct  414   VSMCIGSGMGAAAVFERGDSVDELRN  439



>ref|XP_010484150.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=446

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/453 (77%), Positives = 395/453 (87%), Gaps = 19/453 (4%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT 
Sbjct  4     AMERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTA  50

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRG FKDTYPDDLLASVL+A+I KTN+NPSEVGDI+VGTVL  GS RA+ECRMAAF
Sbjct  51    LCKAKRGSFKDTYPDDLLASVLRAMIVKTNVNPSEVGDIVVGTVLGTGSQRATECRMAAF  110

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+G VNP
Sbjct  111   YAGFPQTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGLVNP  170

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QA +CLLPMGITSENVAHRF V+R+EQDQAAV+SHRKAA+ATA+GKFKDEI PV
Sbjct  171   KVEKFEQAHSCLLPMGITSENVAHRFNVSREEQDQAAVDSHRKAASATASGKFKDEITPV  230

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTT------AGNSSQVT  991
              TKIV+P TGDE  + +SVDDGIRPN ++  L KLK VFKKDGTTT      AGNSSQ++
Sbjct  231   KTKIVDPNTGDEKAIIVSVDDGIRPNTTLSGLTKLKSVFKKDGTTTAALLDGAGNSSQLS  290

Query  992   DGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDI  1171
             DGAGAVLLM+R++A+QKGLPILGVFRTFAAVGVDP +MG+GPAVAIPAAVK+AGLELDDI
Sbjct  291   DGAGAVLLMRRNVAMQKGLPILGVFRTFAAVGVDPEIMGVGPAVAIPAAVKAAGLELDDI  350

Query  1172  DLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGK  1351
             DLFEINEAFASQY+YC+ KLGL+PEKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGK
Sbjct  351   DLFEINEAFASQYVYCRNKLGLNPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGK  410

Query  1352  DCRYGVVSMCIGTGMGAAGVFERGDACDELSNA  1450
             DCR+GVVSMCIG+GMGAA VFERG + DEL N+
Sbjct  411   DCRFGVVSMCIGSGMGAAAVFERGGSVDELPNS  443



>ref|XP_002974835.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
 gb|EFJ24355.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
Length=454

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/458 (77%), Positives = 404/458 (88%), Gaps = 5/458 (1%)
 Frame = +2

Query  119   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  298
             RQ++LL HLRP++A   ++ +      S+C+AGDSAAY R + Y DD+V+VAAYRTP+CK
Sbjct  2     RQQILLDHLRPSSAPRPVNLV-----TSICSAGDSAAYHRTTDYSDDVVVVAAYRTPICK  56

Query  299   SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  478
             SKRGGFKDTYP+DLL  VLKA++EK  LNP+EVGDI+VGTVLAPGS RA+ECRMAAFYAG
Sbjct  57    SKRGGFKDTYPEDLLTPVLKAVVEKVGLNPAEVGDIVVGTVLAPGSQRANECRMAAFYAG  116

Query  479   FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  658
             FPETVPVRTVNRQCSSGLQAVADV AAIKAGFYDIGIGAGLESMT N +AWEGSVNP+  
Sbjct  117   FPETVPVRTVNRQCSSGLQAVADVVAAIKAGFYDIGIGAGLESMTANLVAWEGSVNPKVE  176

Query  659   TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTTK  838
               Q+AQ+CLLPMGITSENVA R+GV+R+EQD+AAV SHR+AAAATA G+FKDEIIPV TK
Sbjct  177   MNQKAQDCLLPMGITSENVAERYGVSRKEQDEAAVRSHRRAAAATATGRFKDEIIPVHTK  236

Query  839   IVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLM  1018
             +V+PKTG+E  V IS DDG+RPNA++ DLAKLKP FKK GTTTAGNSSQV+DGAGAVLLM
Sbjct  237   LVDPKTGEEKPVVISADDGMRPNANVADLAKLKPAFKKGGTTTAGNSSQVSDGAGAVLLM  296

Query  1019  KRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAF  1198
             KRS+AIQ+GLPILGVFR+FAAVGVDPAVMGIGPAVAIP AVK AGLE+ DIDLFE+NEAF
Sbjct  297   KRSVAIQRGLPILGVFRSFAAVGVDPAVMGIGPAVAIPKAVKDAGLEISDIDLFELNEAF  356

Query  1199  ASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSM  1378
             ASQ+ Y  KKL LD EK+NVNGGA+A+GHPLGATGARCVATLLHEM +RGKDCR+GV+SM
Sbjct  357   ASQFTYSCKKLDLDMEKVNVNGGAIALGHPLGATGARCVATLLHEMSKRGKDCRFGVISM  416

Query  1379  CIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             CIG+GMGAA VFERG+A D LSNAR V+ +  LSKDAR
Sbjct  417   CIGSGMGAAAVFERGNAVDNLSNARPVQNNSLLSKDAR  454



>ref|XP_002467133.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
 gb|EER94131.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
Length=462

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/460 (75%), Positives = 402/460 (87%), Gaps = 2/460 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL+HL  + AA++      ++SAS CAAGDSAAY R   + DD+VIVAAYRT 
Sbjct  4     AIDRQRVLLRHL--SPAAAAESPAPPAISASACAAGDSAAYHRTPAFADDVVIVAAYRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT+ +DLL  V KAL++KT L+PSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  62    ICKAKRGGFKDTFAEDLLVPVFKALVDKTKLDPSEVGDIVVGTVLAPGSQRAIECRMAAL  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP++TVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN ++ +G VNP
Sbjct  122   YAGFPDTVPLKTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNKVSLDGQVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMG+TSENVAHRFG+TR EQDQAAVESHRKAAAA AAGKFK+EI+PV
Sbjct  182   KVELFSQARDCLLPMGLTSENVAHRFGITRLEQDQAAVESHRKAAAAAAAGKFKEEIVPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E  + +S DDGIRP+ S+  L+KLKP F KDGTTTAGN+SQV+DGAGAV
Sbjct  242   HTKIVDPKTGEEKKIVVSADDGIRPDTSLAVLSKLKPAFSKDGTTTAGNASQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A++KGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDLFEIN
Sbjct  302   LLMRRDVAMKKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQMDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKL LDP K+NVNGGAMA+GHPLG TGARCV+TLL+EMKRRGKDCR+GV
Sbjct  362   EAFASQYVYCCKKLELDPAKVNVNGGAMALGHPLGCTGARCVSTLLNEMKRRGKDCRFGV  421

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIG+GMGAA VFERGD  DEL+N+R + TH +LSKDA
Sbjct  422   ISMCIGSGMGAAAVFERGDCVDELTNSRGIPTHNWLSKDA  461



>gb|ACN29136.1| unknown [Zea mays]
 gb|AFW68658.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=461

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/460 (74%), Positives = 400/460 (87%), Gaps = 3/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A++RQRVLL+HL   N A++      ++SAS CAAGDSAAY R   + DD+VIVAAYRT 
Sbjct  4     AVDRQRVLLRHL---NPAAAGSPAPPAISASACAAGDSAAYHRRPAFADDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT+ +DLL  V KAL++KT L+PSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61    ICKAKRGGFKDTFAEDLLVPVFKALVDKTKLDPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP++TVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN ++ +G  NP
Sbjct  121   YAGFPDTVPLKTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNKVSLDGQANP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMG+TSENVAHRFG+TR EQDQAAVESHRKAAAA AAGKFK+EI+PV
Sbjct  181   KVELFSQARDCLLPMGLTSENVAHRFGITRLEQDQAAVESHRKAAAAAAAGKFKEEIVPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E  + IS DDGIR + S+  L+KLKP F KDG+TTAGN+SQV+DGAGAV
Sbjct  241   HTKIVDPKTGEEKKIVISADDGIRVDTSLAVLSKLKPAFSKDGSTTAGNASQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A++KGLP+LGVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDLFEIN
Sbjct  301   LLMRRDVAMKKGLPVLGVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQMDDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKL LDP K+NVNGGAMA+GHPLGATGARCV+TLL+EMKRRGKDCR+GV
Sbjct  361   EAFASQYVYCCKKLKLDPAKVNVNGGAMALGHPLGATGARCVSTLLNEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIG+GMGAA VFERGD  DEL+NAR + TH +LSKDA
Sbjct  421   ISMCIGSGMGAAAVFERGDGVDELTNARGISTHNWLSKDA  460



>gb|KJB10128.1| hypothetical protein B456_001G185200 [Gossypium raimondii]
Length=465

 Score =   687 bits (1773),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/462 (76%), Positives = 402/462 (87%), Gaps = 1/462 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ RQRVLL HLRP++++SS     +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4     ALNRQRVLLHHLRPSSSSSSSHESAATLFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  64    ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMA-WEGSVN  646
             YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT + +      VN
Sbjct  124   YAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTTDKVVPGVPKVN  183

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
             P+  +  QA++CLLPMGITSENVA  +GVTRQEQDQAAVESHR+AAAATA+GKFKDEI+P
Sbjct  184   PKVESFAQARDCLLPMGITSENVAEHYGVTRQEQDQAAVESHRRAAAATASGKFKDEIVP  243

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             V TKIV+PKTG+E   TI VDDGIRPN ++ DLAKLKP FKKDGTTTAGN+SQV+DGAGA
Sbjct  244   VLTKIVDPKTGEEKAATIMVDDGIRPNTNMADLAKLKPAFKKDGTTTAGNASQVSDGAGA  303

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
              LLMKRSLA+QKG PILGVFR+FAAVGVDPAVMGIGPAVAIPAA+KSAGLELDDIDLFEI
Sbjct  304   ALLMKRSLAMQKGFPILGVFRSFAAVGVDPAVMGIGPAVAIPAAIKSAGLELDDIDLFEI  363

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLGATGARCV TLL+EMKRRGKDCR+G
Sbjct  364   NEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGATGARCVGTLLNEMKRRGKDCRFG  423

Query  1367  VVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             V+SMCIG+GMGAA VFERGD  D+  NAR V+ +  LSKDAR
Sbjct  424   VISMCIGSGMGAAAVFERGDCVDDFCNARAVQKNDLLSKDAR  465



>ref|XP_010475137.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like [Camelina 
sativa]
Length=446

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/450 (77%), Positives = 394/450 (88%), Gaps = 14/450 (3%)
 Frame = +2

Query  113   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  292
             +ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT L
Sbjct  5     MERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTAL  51

Query  293   CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  472
             CK+KRG FKDTYP+DLLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RA+ECRMAAFY
Sbjct  52    CKAKRGSFKDTYPEDLLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRATECRMAAFY  111

Query  473   AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  652
             AGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+G     
Sbjct  112   AGFPQTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKG-CKGT  170

Query  653   ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVT  832
                 +QA +CLLPMGITSENVAHRF V+R+EQDQAAV+SHRKAA+AT++GKFKDEI PV 
Sbjct  171   VEKFEQAHSCLLPMGITSENVAHRFNVSREEQDQAAVDSHRKAASATSSGKFKDEITPVK  230

Query  833   TKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVL  1012
             TKIV+P TGDE  +T+SVDDGIRPN ++  L KL PVFKKDGTTTAGNSSQ++DGAGAVL
Sbjct  231   TKIVDPNTGDEKAITVSVDDGIRPNTTLSGLTKLIPVFKKDGTTTAGNSSQLSDGAGAVL  290

Query  1013  LMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINE  1192
             LM+RS+A+QKGLPILGVFR+FAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEINE
Sbjct  291   LMRRSVAMQKGLPILGVFRSFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEINE  350

Query  1193  AFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVV  1372
             AFASQY+YC+ KLG++PEKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGK CR+GVV
Sbjct  351   AFASQYVYCRNKLGINPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKYCRFGVV  410

Query  1373  SMCIGTGMGAAGVFERGDACDELSNARKVE  1462
             SMCIG+GMGAA VFERG + DEL N  K E
Sbjct  411   SMCIGSGMGAAAVFERGGSVDELRNVSKGE  440



>emb|CDY15520.1| BnaA08g28040D [Brassica napus]
Length=451

 Score =   685 bits (1768),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/451 (80%), Positives = 403/451 (89%), Gaps = 3/451 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ERQRVLL H           S ++S+S S C AG SAAYQR S+YGDD+VIVAA RT 
Sbjct  4     AMERQRVLLHH---LQPPLPSSSSQASLSVSACLAGGSAAYQRTSLYGDDVVIVAAQRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRG FKDTYPD+LLASVL+A+IEKT L+PSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61    LCKAKRGSFKDTYPDELLASVLRAVIEKTKLDPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT +   W+GSVNP
Sbjct  121   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTSPRGWKGSVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQ+CLLPMGITSENVAHRFGV+R+EQDQAAV+SHRKAA+ATA+GKFKDEI PV
Sbjct  181   KVQKFEQAQSCLLPMGITSENVAHRFGVSREEQDQAAVDSHRKAASATASGKFKDEITPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              T+IV+PKTGDE  +T+SVDDGIRP+ ++  LAKLKPVFKKDG+TTAGNSSQV+DGAGAV
Sbjct  241   NTRIVDPKTGDEKPITVSVDDGIRPSTTLSGLAKLKPVFKKDGSTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+AI+K LPILGVFRTFAAVGVDPAVMG+GPA AIPAAVK+AGLELDDIDLFEIN
Sbjct  301   LLMKRSVAIKKELPILGVFRTFAAVGVDPAVMGVGPAAAIPAAVKAAGLELDDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGL PEKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  361   EAFASQFVYCRNKLGLVPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVE  1462
             VSMCIG+GMGAAGVFERGD  DELSN RKVE
Sbjct  421   VSMCIGSGMGAAGVFERGDGVDELSNVRKVE  451



>ref|XP_006662414.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=460

 Score =   685 bits (1767),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/460 (74%), Positives = 398/460 (87%), Gaps = 5/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLL HL P    ++      + +AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4     AINRQRVLLAHLEPAATPAA-----PAFTASACAAGDSAAYHRGACFADDVVIVAAYRTA  58

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59    ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+ TVNRQCSSGLQAV++VA+ IKAG YDIGI AGLESMTVN ++ +G +NP
Sbjct  119   YAGFPDTVPLMTVNRQCSSGLQAVSNVASNIKAGLYDIGIAAGLESMTVNKVSLDGQLNP  178

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMG+TSENVA RFGVTR EQDQAAVESHRKAAAA AAGKFK+EI+PV
Sbjct  179   KVELFSQARDCLLPMGLTSENVAKRFGVTRMEQDQAAVESHRKAAAAAAAGKFKEEIVPV  238

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E  + +S DDGIRP  S+  L+KLKP F KDGTTTAGN+SQV+DGAGAV
Sbjct  239   HTKIVDPKTGEEKEIVVSADDGIRPGTSLAVLSKLKPAFSKDGTTTAGNASQVSDGAGAV  298

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A+QKGLP+LGVFR+FAAVGVDPAVMG+GPAVAIPAAVK+AGL++DD+DLFEIN
Sbjct  299   LLMRRDIAMQKGLPVLGVFRSFAAVGVDPAVMGVGPAVAIPAAVKAAGLQIDDVDLFEIN  358

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKLGLDP K+NVNGGAMA+GHPLGATGARCV+TLL+EMKRRGKDCR+GV
Sbjct  359   EAFASQYVYCCKKLGLDPTKVNVNGGAMALGHPLGATGARCVSTLLNEMKRRGKDCRFGV  418

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIG+GMGAA VFERGDA DEL+NAR + +H +LSKDA
Sbjct  419   ISMCIGSGMGAAAVFERGDAVDELTNARGIPSHNWLSKDA  458



>ref|XP_002889522.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65781.1| hypothetical protein ARALYDRAFT_470458, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=419

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/421 (80%), Positives = 384/421 (91%), Gaps = 4/421 (1%)
 Frame = +2

Query  197   ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  376
             AS C A +SAAYQ    YGDD+VIVAA RTPLCK+KRG FKDTYPD+LLASVL+ LIEKT
Sbjct  1     ASPCLAKESAAYQ----YGDDVVIVAAQRTPLCKAKRGSFKDTYPDELLASVLRGLIEKT  56

Query  377   NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaa  556
             N+NPSEVGDI+VGTVL PGS RASECRMAAFYAGFPETVP+R VNRQCSSGLQAVADVAA
Sbjct  57    NVNPSEVGDIVVGTVLGPGSQRASECRMAAFYAGFPETVPIRIVNRQCSSGLQAVADVAA  116

Query  557   aikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVT  736
             AI+AGFYDIGIGAGLESMT N   W+G VNP+    +QA +CLLPMGITSENVA+RF V+
Sbjct  117   AIRAGFYDIGIGAGLESMTTNPRGWKGPVNPKVKKFEQAHSCLLPMGITSENVANRFNVS  176

Query  737   RQEQDQAAVESHRKaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASI  916
             R+EQDQAAV+SHRKAA ATA+GKFKDEI+PV TKIV+PKTGDE ++T+SVDDGIRPN ++
Sbjct  177   REEQDQAAVDSHRKAAFATASGKFKDEILPVKTKIVDPKTGDEKSITVSVDDGIRPNTTL  236

Query  917   GDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDP  1096
               LAKL+PVFK+DGTTTAGNSSQ++DGAGAVLLM+R++A+QKGLPILGVFRTFAAVGVDP
Sbjct  237   SGLAKLRPVFKEDGTTTAGNSSQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFAAVGVDP  296

Query  1097  AVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMA  1276
             A+MG+GPAVAIPAAVK+AGLEL+DIDLFEINEAFASQ++YC+ KLG+DPEK+NVNGGA+A
Sbjct  297   AIMGVGPAVAIPAAVKAAGLELNDIDLFEINEAFASQFVYCRNKLGIDPEKVNVNGGAIA  356

Query  1277  IGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARK  1456
             IGHPLGATGARCVATLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG   DEL + RK
Sbjct  357   IGHPLGATGARCVATLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGGVDELCDVRK  416

Query  1457  V  1459
             V
Sbjct  417   V  417



>gb|EYU17978.1| hypothetical protein MIMGU_mgv1a005895mg [Erythranthe guttata]
Length=466

 Score =   682 bits (1760),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/463 (75%), Positives = 398/463 (86%), Gaps = 4/463 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A  RQ++LL HLRPT++   L S + S+S +VC AGDSAAY R   +GDDIVIVAAYRT 
Sbjct  4     AANRQKILLDHLRPTSSVPHLIS-QPSLSRAVCLAGDSAAYHRTPAFGDDIVIVAAYRTA  62

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKS RGGFKDT PDDLLA+VLKALI++TNLNP+EVGDI+VGTVLAPGS+RA ECRMAA 
Sbjct  63    LCKSTRGGFKDTLPDDLLAAVLKALIDRTNLNPAEVGDIVVGTVLAPGSLRAIECRMAAL  122

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV--  643
             YAGFP+ VP+RTVNRQCSSGLQAVADVAA IKAG+YDIGI AGLESMT +      ++  
Sbjct  123   YAGFPDKVPIRTVNRQCSSGLQAVADVAAFIKAGYYDIGIAAGLESMTADFATSANTIEK  182

Query  644   -NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEI  820
              NP+     QA++CLLPMG TSENVA R+GVTR+EQDQAAV SH++AAAA AAGKFKDEI
Sbjct  183   INPKVEAFPQARDCLLPMGATSENVAERYGVTREEQDQAAVVSHQRAAAARAAGKFKDEI  242

Query  821   IPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGA  1000
             IPV TKIV+PKTG+   V ISVD+GIRP+ ++ DLAKLKP FK +GTTTAGN+SQ++DGA
Sbjct  243   IPVHTKIVDPKTGEAKPVVISVDEGIRPSTNMIDLAKLKPAFKNNGTTTAGNASQISDGA  302

Query  1001  GAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLF  1180
             GAVLLMKRSLAIQKGLPILG+FR+FAAVGVDP VMGIGPAVAIPAAV SAGLE+ DIDLF
Sbjct  303   GAVLLMKRSLAIQKGLPILGIFRSFAAVGVDPGVMGIGPAVAIPAAVNSAGLEIADIDLF  362

Query  1181  EINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR  1360
             EINEAFASQ++YC KKL LDPEK+NVNGGAMA+GHPLGATGARCVATLL+EMKRRGKDCR
Sbjct  363   EINEAFASQFVYCCKKLDLDPEKVNVNGGAMALGHPLGATGARCVATLLNEMKRRGKDCR  422

Query  1361  YGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +GV+SMCIG+GMGAA V ERGD  DELSNA+ +    +LSKDA
Sbjct  423   FGVISMCIGSGMGAAAVLERGDCVDELSNAQAISAQNFLSKDA  465



>ref|NP_001048523.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|AAO72588.1| 3-ketoacyl-CoA thiolase-like protein [Oryza sativa Japonica Group]
 dbj|BAD21525.1| putative 3-ketoacyl-CoA thiolase; acetyl-CoA acyltransferase 
[Oryza sativa Japonica Group]
 dbj|BAF10437.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|EAY88029.1| hypothetical protein OsI_09452 [Oryza sativa Indica Group]
Length=448

 Score =   681 bits (1758),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/448 (77%), Positives = 397/448 (89%), Gaps = 5/448 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL H        S  S +S +SAS CAAGDSAAYQR S YGDD+V+VAAYRTP
Sbjct  4     AIDRQRVLLAH-----LLPSSSSDQSLLSASACAAGDSAAYQRTSAYGDDVVVVAAYRTP  58

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP E+GDI+VGTVL PGS RA ECR AAF
Sbjct  59    ICKAKRGGFKDTYPEDLLTVVLKAVLDNTKINPGEIGDIVVGTVLGPGSQRAIECRAAAF  118

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAG PE VPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM+VN M WEG VNP
Sbjct  119   YAGVPENVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVNAMGWEGQVNP  178

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             + + +Q+AQ+CLLPMGITSENVAHR+GVTRQEQDQAA ESHR+AAAATAAGKFKDEI+PV
Sbjct  179   KVNEVQKAQDCLLPMGITSENVAHRYGVTRQEQDQAAAESHRRAAAATAAGKFKDEIVPV  238

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E  V ISVDDGIRP  +   LAKLKPVF+KDGTTTAGNSSQV+DGAGAV
Sbjct  239   PTKIVDPKTGEEKKVVISVDDGIRPGTTASGLAKLKPVFRKDGTTTAGNSSQVSDGAGAV  298

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A++KGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGL+++DIDLFE+N
Sbjct  299   LLMRRDVAMKKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLQIEDIDLFELN  358

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC  KLGLD  K+NVNGGA+A+GHPLGATGARCVATLL+EMKRRG+DCR+GV
Sbjct  359   EAFASQFVYCCNKLGLDRSKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDCRFGV  418

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNAR  1453
             V+MCIG+GMGAA VFERGD+ D+ SN R
Sbjct  419   VTMCIGSGMGAAAVFERGDSVDQFSNVR  446



>gb|KHG11493.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=463

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/461 (76%), Positives = 401/461 (87%), Gaps = 2/461 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ RQRVLL HLRP++++SS     +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4     ALNRQRVLLHHLRPSSSSSSH-ESAAALFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  62

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  63    ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  122

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMA-WEGSVN  646
             YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT + +      VN
Sbjct  123   YAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTTDKVVPGVPKVN  182

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
              +  +  QA++CLLPMGITSENVA  +GVTRQEQDQAAVESHR+AAAATA+GKFKDEI+P
Sbjct  183   AKVESFAQARDCLLPMGITSENVAEHYGVTRQEQDQAAVESHRRAAAATASGKFKDEIVP  242

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             V TKIV+PKTG+E   TI VDDGIRPN ++ DLAKLKP FKKDGTTTAGN+SQV+DGAGA
Sbjct  243   VLTKIVDPKTGEEKAATIMVDDGIRPNTNMADLAKLKPAFKKDGTTTAGNASQVSDGAGA  302

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
             VLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAA+KSAGLELDDIDLFEI
Sbjct  303   VLLMKRSLAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAIKSAGLELDDIDLFEI  362

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLGATGARCV TLL+EMKRRGKDCR+G
Sbjct  363   NEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGATGARCVGTLLNEMKRRGKDCRFG  422

Query  1367  VVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             V+SMCIG+GMGAA VFERGD  DE  NAR V  +  LSKDA
Sbjct  423   VISMCIGSGMGAASVFERGDCVDEFCNARAVHKNELLSKDA  463



>ref|XP_002301570.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
 gb|EEE80843.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
Length=457

 Score =   679 bits (1751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/461 (76%), Positives = 405/461 (88%), Gaps = 7/461 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A  RQ+VLL HL+PT+ +  L       SAS+CAAGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4     AFNRQKVLLAHLQPTSPSPLL-------SASICAAGDSAAYHRTAAFGDDIVIVAAYRTA  56

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK++RGGFKDT+PDDLL  VLKA++EKTN+NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  57    ICKARRGGFKDTFPDDLLGFVLKAVVEKTNVNPSEVGDIVVGTVLAPGSERAIECRMAAF  116

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAG+YDIGI AGLE MTVN +     VNP
Sbjct  117   YAGFPDTVPLRTVNRQCSSGLQAVADVAASIKAGYYDIGIAAGLECMTVNGIRSVPQVNP  176

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R    QQA++CLLPMG+TSENVA R+GVTRQ+QDQAAV+SHRKAAAA A+GKFKDEIIPV
Sbjct  177   RVEAFQQARDCLLPMGLTSENVAQRYGVTRQDQDQAAVDSHRKAAAARASGKFKDEIIPV  236

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKIV+P+TG +  +TIS DDGIRPN+++ +L++LKP FKKDG+TTAGN+SQV+DGAGAV
Sbjct  237   TTKIVDPETGIQKVITISEDDGIRPNSNLAELSRLKPAFKKDGSTTAGNASQVSDGAGAV  296

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA QKGLPILGVFR+FAAVGVDPAVMG+GPA AIPAAV++AGLEL+DIDLFEIN
Sbjct  297   LLMKRSLAAQKGLPILGVFRSFAAVGVDPAVMGVGPAAAIPAAVQAAGLELNDIDLFEIN  356

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKL LDPEK+NVNGGA+A+GHPLGATGARCV TLL+EMKRRGKD R+GV
Sbjct  357   EAFASQYVYCIKKLELDPEKVNVNGGAIALGHPLGATGARCVGTLLNEMKRRGKDSRFGV  416

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             +SMCIG+GMGAA VFERGD  D L N RKV ++  LSKDAR
Sbjct  417   ISMCIGSGMGAAAVFERGDCVDALCNVRKVGSNDLLSKDAR  457



>gb|KJB42405.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=454

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/452 (77%), Positives = 399/452 (88%), Gaps = 3/452 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLL HL+P++ +    +  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4     AINRQQVLLNHLQPSSQSHQSSA--AILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT  DDLLA VL+A+I++T LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  62    ICKAKRGGFKDTLADDLLAPVLRAVIDRTKLNPSEVGDIVVGTVLAPGSQRAMECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS-VN  646
             YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESMT N  A + S VN
Sbjct  122   YAGFPDTVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLESMTTNGSAPDQSKVN  181

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
             P+  +  QA++CLLPMGITSENVA R+GVTRQEQDQAAVESHR+AAAATA+GKFK+EI+P
Sbjct  182   PKVKSFAQARDCLLPMGITSENVAQRYGVTRQEQDQAAVESHRRAAAATASGKFKEEIVP  241

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             V+TKIV+PKTG+E  VTISVDDGIRP+ +   LAKLKP FKKDGTTTAGN+SQV+DGAGA
Sbjct  242   VSTKIVDPKTGEEKAVTISVDDGIRPDTNTAGLAKLKPAFKKDGTTTAGNASQVSDGAGA  301

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
             VLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGLE+DDIDLFEI
Sbjct  302   VLLMKRSLALQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLEIDDIDLFEI  361

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLG TGARCV TLL+EMKRRGKDCR+G
Sbjct  362   NEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGVTGARCVGTLLYEMKRRGKDCRFG  421

Query  1367  VVSMCIGTGMGAAGVFERGDACDELSNARKVE  1462
             V+SMCIGTGMGAA VFERGD  DEL NAR V+
Sbjct  422   VISMCIGTGMGAAAVFERGDCVDELCNARAVK  453



>gb|KDO43602.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=406

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/401 (86%), Positives = 375/401 (94%), Gaps = 2/401 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4     AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62    LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMG+TSENVAHRFGVTR+EQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   KVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIRPN S+ +LAKLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   ATKIVDPKTGDEKPVTISVDDGIRPNTSVSELAKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+LDDIDLFEIN
Sbjct  302   LLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARC  1312
             EAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TG  C
Sbjct  362   EAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGNCC  402



>gb|AAB80634.1| Strong similarity to Cucumis acetyl-CoA acyltransferase (gb|D70895) 
[Arabidopsis thaliana]
Length=460

 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/467 (76%), Positives = 404/467 (87%), Gaps = 27/467 (6%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4     ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  290   LCKSKRGGFKDTYPDDLLASVLK---ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  460
             LCK+KRG FKDT+PD+LLASVL+   ALIEKTN+NPSEVGDI+VGTVL PGS RASECRM
Sbjct  54    LCKAKRGSFKDTFPDELLASVLRVCLALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRM  113

Query  461   AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIG-------IGAGLESMTVN  619
             AAFYAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIG       IGAGLESMT N
Sbjct  114   AAFYAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGKIVTIFGIGAGLESMTTN  173

Query  620   TMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataa  799
                W+GSVNP     +QA NCLLPMGITSENVAHRF V+R+EQDQAAV+SHRKAA+ATA+
Sbjct  174   PRGWKGSVNPNVKKFEQAHNCLLPMGITSENVAHRFNVSREEQDQAAVDSHRKAASATAS  233

Query  800   GKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAG--  973
             GKFKDEI PV TKIV+PKTGDE  +T+SVDDGIRPN ++  LAKLKPVFK+DGTTTAG  
Sbjct  234   GKFKDEITPVKTKIVDPKTGDEKPITVSVDDGIRPNTTLSGLAKLKPVFKEDGTTTAGTF  293

Query  974   -----NSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAA  1138
                  NSSQ++DGAGAVLLM+R++A+QKGLPILGVFRTF+AVGVDPA+MG+GPAVAIPAA
Sbjct  294   PRLIGNSSQLSDGAGAVLLMRRNVAMQKGLPILGVFRTFSAVGVDPAIMGVGPAVAIPAA  353

Query  1139  VKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVA  1318
             VK+AGLEL+D+DLFEINEAFASQ++YC+ KLGLD EKINVNGGA+AIGHPLGATGARCVA
Sbjct  354   VKAAGLELNDVDLFEINEAFASQFVYCRNKLGLDAEKINVNGGAIAIGHPLGATGARCVA  413

Query  1319  TLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  1459
             TLLHEMKRRGKDCR+GVVSMCIG+GMGAA VFERG   DEL + RKV
Sbjct  414   TLLHEMKRRGKDCRFGVVSMCIGSGMGAAAVFERGGGVDELCDVRKV  460



>ref|XP_009796305.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Nicotiana sylvestris]
Length=462

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/431 (79%), Positives = 386/431 (90%), Gaps = 0/431 (0%)
 Frame = +2

Query  200   SVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTN  379
             S+C AGDSAAYQR + +GDD+VIVAAYRT +CK+KRGGFK+T  DDLLA VLKA++EKTN
Sbjct  32    SICLAGDSAAYQRTAAFGDDVVIVAAYRTAICKAKRGGFKNTLADDLLAPVLKAVVEKTN  91

Query  380   LNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaa  559
             L+P+EVGDI+VGTVLAPGS+RA ECRMAAFYAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  92    LSPNEVGDIVVGTVLAPGSLRAMECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAAS  151

Query  560   ikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTR  739
             IKAGFYDIGIGAGLE MTV+ +     VNP+     QA++CLLPMGITSENVA RFGVTR
Sbjct  152   IKAGFYDIGIGAGLELMTVDNIGRVQQVNPKVDAFAQARDCLLPMGITSENVAQRFGVTR  211

Query  740   QEQDQAAVESHRKaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIG  919
              EQDQAAV SH++AAAATA+GKFKDEIIPV TKIV+P+T  E  V ISVDDGIRPN ++ 
Sbjct  212   LEQDQAAVISHQRAAAATASGKFKDEIIPVLTKIVDPQTRREKPVVISVDDGIRPNTNLT  271

Query  920   DLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPA  1099
             +LAKLKP FK DGTTTAG +SQV+DGA AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPA
Sbjct  272   NLAKLKPAFKSDGTTTAGTASQVSDGAAAVLLMKRSVAMQKGLPILGVFRSFAAVGVDPA  331

Query  1100  VMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAI  1279
             VMGIGPAVAIPAAVKSAGLELD+IDLFEINEAFASQ++YC+KKL LD EK+NVNGGAMA+
Sbjct  332   VMGIGPAVAIPAAVKSAGLELDNIDLFEINEAFASQFVYCRKKLNLDSEKVNVNGGAMAL  391

Query  1280  GHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  1459
             GHPLGATGARCVATLLHEMKRRGKDCR+GV+SMCIG+GMGAA VFERGDA D+L NAR  
Sbjct  392   GHPLGATGARCVATLLHEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDAVDDLCNARVN  451

Query  1460  ETHGYLSKDAR  1492
               + +LSKDA+
Sbjct  452   NNNNFLSKDAK  462



>ref|NP_001064764.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|AAK54299.1|AC034258_17 putative thiolase [Oryza sativa Japonica Group]
 gb|AAP54100.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26678.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|EAZ16317.1| hypothetical protein OsJ_31778 [Oryza sativa Japonica Group]
 dbj|BAG92981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=461

 Score =   677 bits (1746),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/460 (74%), Positives = 397/460 (86%), Gaps = 3/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLL HL     A+S  +   +++AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4     AINRQRVLLAHL---EPAASPAAAAPAITASACAAGDSAAYHRGACFADDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61    ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+ TVNRQCSSGLQAVA+VA+ IKAG YDIGI AGLESMTVN +  +G VNP
Sbjct  121   YAGFPDTVPLMTVNRQCSSGLQAVANVASNIKAGLYDIGIAAGLESMTVNQVRLDGQVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMG+TSENVA RFG+TR EQDQAAVESHRKAAAA A+GKFK+EI+PV
Sbjct  181   KVELFSQARDCLLPMGLTSENVAKRFGITRMEQDQAAVESHRKAAAAAASGKFKEEIVPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E  + +S DDGIRP  S+  L+KLKP F KDGTTTAGN+SQV+DGAGAV
Sbjct  241   HTKIVDPKTGEEKEIVVSADDGIRPGTSLAVLSKLKPAFSKDGTTTAGNASQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A+QKGLPI+GVFR+FAAVGVDPA+MG+GPAVAIPAAVK+AGL++DD+DLFEIN
Sbjct  301   LLMRRDIAMQKGLPIVGVFRSFAAVGVDPAIMGVGPAVAIPAAVKAAGLQIDDVDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKLGLDP K+NVNGGAMA+GHPLGATGAR V+TLL+EMKRRGKDCR+GV
Sbjct  361   EAFASQYVYCCKKLGLDPAKVNVNGGAMALGHPLGATGARSVSTLLNEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIG+GMGAA VFERGDA DEL+NAR + TH  LSKDA
Sbjct  421   ISMCIGSGMGAAAVFERGDAVDELTNARCIPTHNRLSKDA  460



>gb|EEC67095.1| hypothetical protein OsI_33888 [Oryza sativa Indica Group]
Length=461

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/460 (74%), Positives = 396/460 (86%), Gaps = 3/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQRVLL HL P  + ++      +++AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4     AINRQRVLLAHLEPAASPAAA---APAITASACAAGDSAAYHRGACFADDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61    ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+ TVNRQCSSGLQAVA+VA+ IKAG YDIGI AGLESMTVN +  +G VNP
Sbjct  121   YAGFPDTVPLMTVNRQCSSGLQAVANVASNIKAGLYDIGIAAGLESMTVNQVRLDGQVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMG+TSENVA RFG+TR EQDQAAVESHRKAAAA A+GKFK+EI+PV
Sbjct  181   KVELFSQARDCLLPMGLTSENVAKRFGITRMEQDQAAVESHRKAAAAAASGKFKEEIVPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PK G+E  + +S DDGIRP  S+  L+KLKP F KDGTTTAGN+SQV+DGAGAV
Sbjct  241   HTKIVDPKNGEEKEIVVSADDGIRPGTSLAVLSKLKPAFSKDGTTTAGNASQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A+QKGLPI+GVFR+FAAVGVDPAVMG+GPAVAIPAAVK+AGL++DD+DLFEIN
Sbjct  301   LLMRRDIAMQKGLPIVGVFRSFAAVGVDPAVMGVGPAVAIPAAVKAAGLQIDDVDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKLGLDP K+NVNGGAMA+GHPLGATGAR V+TLL+EMKRRGKDCR+GV
Sbjct  361   EAFASQYVYCCKKLGLDPAKVNVNGGAMALGHPLGATGARSVSTLLNEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIG+GMGAA VFERGDA DEL+NAR + TH  LSKDA
Sbjct  421   ISMCIGSGMGAAAVFERGDAVDELTNARCIPTHNRLSKDA  460



>ref|XP_010684942.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=453

 Score =   673 bits (1737),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/453 (75%), Positives = 390/453 (86%), Gaps = 4/453 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ RQ+VLLQHL PT    S      + S SVC++GD   Y RN+ +GDD+VIVAA RTP
Sbjct  4     ALNRQKVLLQHLNPT----STRPHNVTFSTSVCSSGDDGTYHRNAAFGDDVVIVAACRTP  59

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT  DDLLA VLKALI+KTN+ PSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60    ICKAKRGGFKDTLADDLLAPVLKALIQKTNVKPSEVGDIVVGTVLAPGSARAMECRMAAF  119

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAG+ESMT++ +     +NP
Sbjct  120   YAGFPDTVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGVESMTIDRVDGPRHINP  179

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMGITSENVA  +GVTRQEQDQAAVESHR+AAAATA+GKF+ EI+PV
Sbjct  180   KVENFPQAKDCLLPMGITSENVAQYYGVTRQEQDQAAVESHRRAAAATASGKFRQEIVPV  239

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKIV+PKTG+E  VTIS+DDGIRP  ++ DL KLKP FKKDGT+TAGNSSQ++DGAGAV
Sbjct  240   STKIVDPKTGEENYVTISLDDGIRPGTNLADLTKLKPSFKKDGTSTAGNSSQISDGAGAV  299

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA  KGLPILGVFR+FAAVGVDPAVMGIGPA AIPAAVKSAGL+LDDI+LFEIN
Sbjct  300   LLMKRSLATNKGLPILGVFRSFAAVGVDPAVMGIGPAFAIPAAVKSAGLKLDDINLFEIN  359

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKL LDP K+NVNGGA+A+GHPLGATGARCVATLL+EM RRG DCR+GV
Sbjct  360   EAFASQYVYCCKKLNLDPAKVNVNGGALALGHPLGATGARCVATLLNEMNRRGTDCRFGV  419

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETH  1468
             +SMCIG+GMGAA VFERGD  + L+N R  +T+
Sbjct  420   ISMCIGSGMGAAAVFERGDHANGLTNTRAAQTN  452



>ref|XP_007049825.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOX93982.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=470

 Score =   674 bits (1738),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/467 (74%), Positives = 401/467 (86%), Gaps = 6/467 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  274
             A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4     ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  275   AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  454
             A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64    ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  455   RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWE  634
             RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA  IKAG YDIGI AGLESMT + +   
Sbjct  124   RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVALCIKAGLYDIGIAAGLESMTTDKVVPG  183

Query  635   GS-VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFK  811
              S VNP+  +  QA++CLLPMGITSENVA R+GVTRQEQDQAAVESHR+AAAATA+GKFK
Sbjct  184   VSKVNPQVESFAQARDCLLPMGITSENVAQRYGVTRQEQDQAAVESHRRAAAATASGKFK  243

Query  812   DEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVT  991
             DEIIPV+TKIV+PKTG+E  VTI VDDGIRPN ++ DLAKLKP F+KDG TTAGN+SQV+
Sbjct  244   DEIIPVSTKIVDPKTGEEKPVTIVVDDGIRPNTNMADLAKLKPAFRKDGATTAGNASQVS  303

Query  992   DGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDI  1171
             DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAG+EL DI
Sbjct  304   DGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGIELADI  363

Query  1172  DLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGK  1351
             DLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLGATGARCV TLL+EMKRRGK
Sbjct  364   DLFEINEAFASQYVYCCKKLELDSEKVNVNGGAIALGHPLGATGARCVGTLLYEMKRRGK  423

Query  1352  DCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             DCR+GV+SMCIG+GMGAA VFERGD  DE  N R V+ + +LSKDAR
Sbjct  424   DCRFGVISMCIGSGMGAAAVFERGDCVDEFCNVRAVKYNEFLSKDAR  470



>gb|KJB42404.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=453

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/452 (77%), Positives = 398/452 (88%), Gaps = 4/452 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLL HL+P++ +    +  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4     AINRQQVLLNHLQPSSQSHQSSA--AILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT  DDLLA VL+A+I++T LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  62    ICKAKRGGFKDTLADDLLAPVLRAVIDRTKLNPSEVGDIVVGTVLAPGSQRAMECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS-VN  646
             YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESMT N  A + S VN
Sbjct  122   YAGFPDTVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLESMTTNGSAPDQSKVN  181

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
             P+  +  QA++CLLPMGITSENVA R+GVTRQEQDQAAVESHR+AAAATA+GKFK+EI+P
Sbjct  182   PKVKSFAQARDCLLPMGITSENVAQRYGVTRQEQDQAAVESHRRAAAATASGKFKEEIVP  241

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             V+TKIV+PKTG+E  VTISVDDGIRP+ +   LAKLKP FKKDGTTTAGN+SQV+DGAGA
Sbjct  242   VSTKIVDPKTGEEKAVTISVDDGIRPDTNTAGLAKLKPAFKKDGTTTAGNASQVSDGAGA  301

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
             VLLMKRSLA+QKGLPILGVF +FAAVGVDPAVMGIGPAVAIPAAVKSAGLE+DDIDLFEI
Sbjct  302   VLLMKRSLALQKGLPILGVF-SFAAVGVDPAVMGIGPAVAIPAAVKSAGLEIDDIDLFEI  360

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQ++Y  KKLGLD EK+NVNGGA+A+GHPLG TGARCV TLL+EMKRRGKDCR+G
Sbjct  361   NEAFASQFVYSCKKLGLDREKVNVNGGAIALGHPLGVTGARCVGTLLYEMKRRGKDCRFG  420

Query  1367  VVSMCIGTGMGAAGVFERGDACDELSNARKVE  1462
             V+SMCIGTGMGAA VFERGD  DEL NAR V+
Sbjct  421   VISMCIGTGMGAAAVFERGDCVDELCNARAVK  452



>gb|KJB72151.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=415

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/401 (84%), Positives = 369/401 (92%), Gaps = 0/401 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4     AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESMT N MAWEGSVNP
Sbjct  124   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTTNPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R   ++QAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKAAAATA+GKFKDEI+PV
Sbjct  184   RVKQMEQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKAAAATASGKFKDEIVPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIR N S+ DL KLKPVFKK+GTTTAGNSSQV+DGAGAV
Sbjct  244   ATKIVDPKTGDEKPVTISVDDGIRANTSVSDLGKLKPVFKKNGTTTAGNSSQVSDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGLELDD+DLFEIN
Sbjct  304   LLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLELDDVDLFEIN  363

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARC  1312
             EAFASQ++YCQKKL LDP+KINVNGGAMAIGHPLG TG  C
Sbjct  364   EAFASQFVYCQKKLELDPQKINVNGGAMAIGHPLGVTGISC  404



>ref|XP_004982961.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   669 bits (1727),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/460 (73%), Positives = 399/460 (87%), Gaps = 3/460 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQR+LL+HL   + A++      ++SAS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4     AIDRQRILLRHL---DPAAAPSPAPPAISASACAAGDSAAYHRRAAFADDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT+ +DLL  VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61    ICKAKRGGFKDTFAEDLLVPVLKALVDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP++TVNRQCSSGLQAVADVAAAIKAG YDIGI AGLESMTVN ++ +  VNP
Sbjct  121   YAGFPDTVPLKTVNRQCSSGLQAVADVAAAIKAGLYDIGIAAGLESMTVNKVSLDSQVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMG+TSENVAHRFG+TR EQDQAAVESHRKAA A AAGKFK+EI+PV
Sbjct  181   KVELFSQARDCLLPMGLTSENVAHRFGITRLEQDQAAVESHRKAAEAAAAGKFKEEILPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E  + +S DDGIR   S+  L+KLKP F KDGTTTAGN+SQV+DGAGAV
Sbjct  241   HTKIVDPKTGEEKEIVVSADDGIRAGTSLAVLSKLKPAFSKDGTTTAGNASQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A++KGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAV++AGL++ DIDLFEIN
Sbjct  301   LLMRRDVAMKKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVQAAGLQIGDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKL LDP K+NVNGGA+A+GHPLGATGARCV+TLL+EMKRRGKDCR+GV
Sbjct  361   EAFASQYVYCCKKLELDPTKVNVNGGAIALGHPLGATGARCVSTLLNEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +SMCIG+GMGAA VFERGD  DEL+NAR + +  +LSKDA
Sbjct  421   ISMCIGSGMGAAAVFERGDGVDELTNARDIPSLNWLSKDA  460



>ref|XP_010547051.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Tarenaya hassleriana]
Length=468

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/465 (73%), Positives = 405/465 (87%), Gaps = 4/465 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAA--SSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  283
             AI+RQR+LL+HL P +++  S +D   + +SA  CAAGD +AY   + +GDDIVIVAA+R
Sbjct  4     AIDRQRILLRHLNPVSSSLSSRIDHDPAILSAVNCAAGDFSAYSPMAAFGDDIVIVAAHR  63

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             T +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+A
Sbjct  64    TAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVA  123

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--  637
             A+YAGFP++VP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGI AG+ESM+ + +A  G  
Sbjct  124   AYYAGFPDSVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIAAGVESMSTDHVAGGGFR  183

Query  638   SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDE  817
              VNP+     +A++CLLPMGITSENVA R+GVTR+EQD AAVESH++AAAATA+GKFKDE
Sbjct  184   VVNPKVEDFPKARDCLLPMGITSENVAERYGVTREEQDMAAVESHKRAAAATASGKFKDE  243

Query  818   IIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDG  997
             I+PV+TKIV+P+T  E  VT+SVDDGIRPN+SI DLAKLKP FK  G+TTAGN+SQV+DG
Sbjct  244   IVPVSTKIVDPETKQEKAVTVSVDDGIRPNSSIADLAKLKPAFKPGGSTTAGNASQVSDG  303

Query  998   AGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDL  1177
             AGAVLLMKRSLA+QKGLPILGVFR+FA  GVDPAVMG+GPA AIPAA K AGL + DIDL
Sbjct  304   AGAVLLMKRSLAVQKGLPILGVFRSFAVTGVDPAVMGVGPAFAIPAAAKLAGLRVSDIDL  363

Query  1178  FEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDC  1357
             FEINEAFASQ++Y  KKL LD EK+NVNGGA+A+GHPLGATGARCVATLLHEMKRRGKDC
Sbjct  364   FEINEAFASQFVYSCKKLELDREKVNVNGGAIALGHPLGATGARCVATLLHEMKRRGKDC  423

Query  1358  RYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             R+GV+SMCIGTGMGAA VFERGDA D+LSNAR V  +G+LSKDA+
Sbjct  424   RFGVISMCIGTGMGAAAVFERGDAVDDLSNARTVNLNGHLSKDAK  468



>ref|XP_001764272.1| predicted protein [Physcomitrella patens]
 gb|EDQ70826.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   666 bits (1718),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/458 (74%), Positives = 398/458 (87%), Gaps = 4/458 (1%)
 Frame = +2

Query  119   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  298
             RQ++LL HL+P     +     ++V  S+C+A DSA Y R + + DD+VIVAAYRTP+CK
Sbjct  7     RQQLLLDHLKPETGRRA----AANVVTSICSANDSAPYARTTDFLDDVVIVAAYRTPICK  62

Query  299   SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  478
             +KRGGFKDTYPDDLLA VL+A++EKT +NP+E+GDI++GTVLAPG+ RA+ECRMAAFYAG
Sbjct  63    AKRGGFKDTYPDDLLAPVLRAVVEKTGVNPAEIGDIVIGTVLAPGAQRANECRMAAFYAG  122

Query  479   FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  658
             FPETVP+RTVNRQCSSGLQAVADV AAIKAGFYDIGIG GLESMTVN MAWEG+VNP+  
Sbjct  123   FPETVPIRTVNRQCSSGLQAVADVVAAIKAGFYDIGIGGGLESMTVNPMAWEGAVNPKVE  182

Query  659   TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTTK  838
               Q+AQ+CLLPMGITSENVA R+GV R++QD+AAV+SH KAAAA A+G+FKDEIIPV TK
Sbjct  183   ADQRAQDCLLPMGITSENVAERYGVDRRQQDEAAVKSHAKAAAARASGRFKDEIIPVHTK  242

Query  839   IVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLM  1018
             IV+PKTG+E  V IS DDGIRP  S+ DL+KLK VFKK GTTTAGNSSQV+DGAGAVLLM
Sbjct  243   IVDPKTGEEKQVVISEDDGIRPGTSLADLSKLKTVFKKSGTTTAGNSSQVSDGAGAVLLM  302

Query  1019  KRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAF  1198
             KR  A+++ LPILGVFR+FAAVGVDPAVMGIGPAVAIPAA+K+AGLE++DIDLFEINEAF
Sbjct  303   KRKTALERNLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAIKAAGLEINDIDLFEINEAF  362

Query  1199  ASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSM  1378
             ASQ+ YC ++LGLD EKINVNGGA+A+GHPLGATGARC ATLLHEMK+RGKDCR+GV+SM
Sbjct  363   ASQFTYCAQELGLDEEKINVNGGAIALGHPLGATGARCTATLLHEMKKRGKDCRFGVISM  422

Query  1379  CIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             CIG+GMGAA VFE+G A D LSN R V  +  LS+DA+
Sbjct  423   CIGSGMGAAAVFEQGGAIDPLSNVRAVGQNNLLSRDAK  460



>ref|XP_001762605.1| predicted protein [Physcomitrella patens]
 gb|EDQ72728.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   663 bits (1710),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/458 (74%), Positives = 395/458 (86%), Gaps = 9/458 (2%)
 Frame = +2

Query  119   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  298
             RQ+VLL HL+P     +         +S+C+A DSA Y R + + DD+VIVAAYRT +C+
Sbjct  7     RQQVLLDHLKPETGRRA---------SSICSANDSAPYARTTDFLDDVVIVAAYRTAICR  57

Query  299   SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  478
             +KRGGFKDTYPDDLLA VL+A++EKT ++P+E+GDI++G+VLAPG+ RA+ECRMAAF+AG
Sbjct  58    AKRGGFKDTYPDDLLAPVLRAVVEKTGVSPAEIGDIVIGSVLAPGAQRANECRMAAFFAG  117

Query  479   FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRAS  658
             FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIG GLESMTVN MAWEGSVNPR  
Sbjct  118   FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGGGLESMTVNPMAWEGSVNPRVE  177

Query  659   TLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTTK  838
               Q+AQ+CLLPMGITSENVA R+GV R++QD+AAV+SH KAAAA A+G+FKDEIIPV TK
Sbjct  178   ADQRAQDCLLPMGITSENVAERYGVGRRQQDEAAVKSHAKAAAARASGRFKDEIIPVQTK  237

Query  839   IVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLM  1018
             IVNPKTGDE  V IS DDGIRP  S+ DL+KLK VFKK GTTTAGNSSQV+DGA AVLLM
Sbjct  238   IVNPKTGDEKKVVISEDDGIRPGTSLADLSKLKTVFKKSGTTTAGNSSQVSDGAAAVLLM  297

Query  1019  KRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAF  1198
             KR  A++K LP+LGVFR+FAAVGVDP+VMGIGPAVAIPAAVK+AGLEL DIDLFEINEAF
Sbjct  298   KRRTALEKNLPVLGVFRSFAAVGVDPSVMGIGPAVAIPAAVKAAGLELSDIDLFEINEAF  357

Query  1199  ASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSM  1378
             ASQ+ YC ++LGLD EK+NVNGGAMA+GHPLGATGARC ATLLHEMK+RGKDCR+G+VSM
Sbjct  358   ASQFTYCAQELGLDEEKVNVNGGAMALGHPLGATGARCTATLLHEMKKRGKDCRFGIVSM  417

Query  1379  CIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             CIG+GMGAA VFE+G A D LSNAR V  +  LS+DA+
Sbjct  418   CIGSGMGAAAVFEQGGAIDPLSNARAVGQNNLLSRDAK  455



>gb|KFK42814.1| hypothetical protein AALP_AA1G042000 [Arabis alpina]
Length=439

 Score =   662 bits (1708),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/439 (79%), Positives = 398/439 (91%), Gaps = 7/439 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL HL+P +++S+     +S+S S C AG++   QR S Y DD+VIVAA RT 
Sbjct  4     AIERQRVLLHHLQPLSSSSN----AASLSVSACFAGEN---QRTSQYEDDVVIVAAQRTA  56

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+KRG FKDTYPD+LLA VL+ALIEKT+LNPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  57    LCKAKRGSFKDTYPDELLAPVLRALIEKTHLNPSEVGDIVVGTVLGPGSQRASECRMAAF  116

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+GSVNP
Sbjct  117   YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNP  176

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QA++CLLPMGITSENVAHRF V+R+EQD+AAV+SHRKAA+ATA+GKFKDEI+PV
Sbjct  177   KVKKFEQAESCLLPMGITSENVAHRFDVSREEQDEAAVDSHRKAASATASGKFKDEIVPV  236

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  +T+SVDDGIRP  ++  LAKLKPVFKKDG+TTAGNSSQ++DGAGAV
Sbjct  237   NTKIVDPKTGDEKPITVSVDDGIRPGTTLSGLAKLKPVFKKDGSTTAGNSSQLSDGAGAV  296

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+RS+A++KGLPIL VFRTFAAVGVDPA+MG+GPA AIPAAVK+AGLEL+DIDLFEIN
Sbjct  297   LLMRRSVAMRKGLPILCVFRTFAAVGVDPAIMGVGPAAAIPAAVKAAGLELNDIDLFEIN  356

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+GV
Sbjct  357   EAFASQFVYCRNKLGLDPEKINVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRFGV  416

Query  1370  VSMCIGTGMGAAGVFERGD  1426
             VSMCIG+GMGAAGVFERGD
Sbjct  417   VSMCIGSGMGAAGVFERGD  435



>ref|XP_010547050.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Tarenaya hassleriana]
Length=474

 Score =   662 bits (1709),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/471 (72%), Positives = 405/471 (86%), Gaps = 10/471 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAA--SSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  283
             AI+RQR+LL+HL P +++  S +D   + +SA  CAAGD +AY   + +GDDIVIVAA+R
Sbjct  4     AIDRQRILLRHLNPVSSSLSSRIDHDPAILSAVNCAAGDFSAYSPMAAFGDDIVIVAAHR  63

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             T +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+A
Sbjct  64    TAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVA  123

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--  637
             A+YAGFP++VP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGI AG+ESM+ + +A  G  
Sbjct  124   AYYAGFPDSVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIAAGVESMSTDHVAGGGFR  183

Query  638   SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDE  817
              VNP+     +A++CLLPMGITSENVA R+GVTR+EQD AAVESH++AAAATA+GKFKDE
Sbjct  184   VVNPKVEDFPKARDCLLPMGITSENVAERYGVTREEQDMAAVESHKRAAAATASGKFKDE  243

Query  818   IIPVTTK------IVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNS  979
             I+PV+TK      IV+P+T  E  VT+SVDDGIRPN+SI DLAKLKP FK  G+TTAGN+
Sbjct  244   IVPVSTKLDGSCKIVDPETKQEKAVTVSVDDGIRPNSSIADLAKLKPAFKPGGSTTAGNA  303

Query  980   SQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLE  1159
             SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FA  GVDPAVMG+GPA AIPAA K AGL 
Sbjct  304   SQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFAVTGVDPAVMGVGPAFAIPAAAKLAGLR  363

Query  1160  LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMK  1339
             + DIDLFEINEAFASQ++Y  KKL LD EK+NVNGGA+A+GHPLGATGARCVATLLHEMK
Sbjct  364   VSDIDLFEINEAFASQFVYSCKKLELDREKVNVNGGAIALGHPLGATGARCVATLLHEMK  423

Query  1340  RRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             RRGKDCR+GV+SMCIGTGMGAA VFERGDA D+LSNAR V  +G+LSKDA+
Sbjct  424   RRGKDCRFGVISMCIGTGMGAAAVFERGDAVDDLSNARTVNLNGHLSKDAK  474



>ref|XP_003604976.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Medicago truncatula]
 gb|AES87173.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=435

 Score =   660 bits (1704),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/439 (76%), Positives = 385/439 (88%), Gaps = 8/439 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ERQRVLLQHL P +  SS  S  + +SAS+C+AG +   +      +D+VIVAAYRT 
Sbjct  4     AVERQRVLLQHLNPNSVTSSHHS--THLSASLCSAGQTGGSE------NDVVIVAAYRTA  55

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT PDDLLASVLKA+IEKTN+ PSEVGDI+VGTVL PGS RA ECRMAAF
Sbjct  56    ICKAKRGGFKDTLPDDLLASVLKAVIEKTNVEPSEVGDIVVGTVLGPGSERAIECRMAAF  115

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLE MT +T++     NP
Sbjct  116   YAGFPDTVPLRTVNRQCSSGLQAVADVAAYIKAGFYDIGIGAGLECMTQDTISGVRKTNP  175

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLL MGITSENVA R+GVTRQEQDQAAVESHR+AAAATA+GKFKDEIIPV
Sbjct  176   KVEIFAQARDCLLSMGITSENVAQRYGVTRQEQDQAAVESHRRAAAATASGKFKDEIIPV  235

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TK V+PKTG+E  + +SVDDGIRPNA++ DLAKLKP FKKDGTTTAGN+SQV+DGA AV
Sbjct  236   STKFVDPKTGEEKQIIVSVDDGIRPNANLVDLAKLKPAFKKDGTTTAGNASQVSDGAAAV  295

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILG+FR+F+AVGVDPAVMG+GPA AIPAAVKSAGLEL +IDL+EIN
Sbjct  296   LLMKRSVAVQKGLPILGIFRSFSAVGVDPAVMGVGPAFAIPAAVKSAGLELSNIDLYEIN  355

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++Y  KKLGLDP K+NVNGGAMA GHPLGATGARCVATLL+EMKRRGKDCR+GV
Sbjct  356   EAFASQFVYSCKKLGLDPTKVNVNGGAMAFGHPLGATGARCVATLLNEMKRRGKDCRFGV  415

Query  1370  VSMCIGTGMGAAGVFERGD  1426
             +SMCIG+GMGAA VFERGD
Sbjct  416   ISMCIGSGMGAAAVFERGD  434



>gb|KDO43604.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=388

 Score =   655 bits (1690),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/378 (87%), Positives = 359/378 (95%), Gaps = 0/378 (0%)
 Frame = +2

Query  353   LKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGL  532
             L+A+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAFYAGFPETVPVRTVNRQCSSGL
Sbjct  9     LQAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVPVRTVNRQCSSGL  68

Query  533   QavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSEN  712
             QAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP+    +QAQNCLLPMG+TSEN
Sbjct  69    QAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNPKVKAFEQAQNCLLPMGVTSEN  128

Query  713   VAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDD  892
             VAHRFGVTR+EQDQAAV+SHRKAAAATAAGKFKDEIIPV TKIV+PKTGDE  VTISVDD
Sbjct  129   VAHRFGVTRKEQDQAAVDSHRKAAAATAAGKFKDEIIPVATKIVDPKTGDEKPVTISVDD  188

Query  893   GIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRT  1072
             GIRPN S+ +LAKLKPVFKKDGTTTAGNSSQV+DGAGAVLLMKRS+A++KGLPILGVFRT
Sbjct  189   GIRPNTSVSELAKLKPVFKKDGTTTAGNSSQVSDGAGAVLLMKRSVAMRKGLPILGVFRT  248

Query  1073  FAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKI  1252
             FAAVGVDPA+MG+GPAVAIPAAVKSAGL+LDDIDLFEINEAFASQ++YC+ KLGLDPEKI
Sbjct  249   FAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEINEAFASQFVYCRNKLGLDPEKI  308

Query  1253  NVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDAC  1432
             NVNGGA+AIGHPLG TGARCVATLLHEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD  
Sbjct  309   NVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDCA  368

Query  1433  DELSNARKVETHGYLSKD  1486
             DEL N RKVE++ +LSKD
Sbjct  369   DELCNVRKVESNNFLSKD  386



>gb|AFK40880.1| unknown [Medicago truncatula]
Length=435

 Score =   656 bits (1692),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/439 (76%), Positives = 382/439 (87%), Gaps = 8/439 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ERQRVLLQHL P +  SS  S  + +SAS+C+AG +   +      +D+VIVAAYRT 
Sbjct  4     AVERQRVLLQHLNPNSVTSSHHS--THLSASLCSAGQTGGSE------NDVVIVAAYRTA  55

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT PDDLLASVLKA+IEKTN+ PSEVGDI+VGTVL PGS RA ECRMAAF
Sbjct  56    ICKAKRGGFKDTLPDDLLASVLKAVIEKTNVEPSEVGDIVVGTVLGPGSERAIECRMAAF  115

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+T P+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLE MT +T++     NP
Sbjct  116   YAGFPDTAPLRTVNRQCSSGLQAVADVAAYIKAGFYDIGIGAGLECMTQDTISGVRKTNP  175

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLL MGITSENV  R+GVTRQEQDQAAVESHR+AAAATA+GKFKDEIIPV
Sbjct  176   KVEIFAQARDCLLSMGITSENVTQRYGVTRQEQDQAAVESHRRAAAATASGKFKDEIIPV  235

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TK V+PKTG+E  + +SVDDGIRPNA++ DLAKLKP FKKDGTTTAGN+SQV+DGA AV
Sbjct  236   STKFVDPKTGEEKQIIVSVDDGIRPNANLVDLAKLKPAFKKDGTTTAGNASQVSDGAAAV  295

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILG+FR+F+AVGVDPAVMG+GPA AIPAAVKSAGLEL +IDL+EIN
Sbjct  296   LLMKRSVAVQKGLPILGIFRSFSAVGVDPAVMGVGPAFAIPAAVKSAGLELSNIDLYEIN  355

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++Y  KKLGLDP K+NVNGGAMA GHPLGATGARCVATLL+EMKRRGKDCR+GV
Sbjct  356   EAFASQFVYSCKKLGLDPTKVNVNGGAMAFGHPLGATGARCVATLLNEMKRRGKDCRFGV  415

Query  1370  VSMCIGTGMGAAGVFERGD  1426
             +SMCIG GMGAA VFERGD
Sbjct  416   ISMCIGFGMGAAAVFERGD  434



>ref|XP_007153157.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
 gb|ESW25151.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
Length=445

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/442 (75%), Positives = 391/442 (88%), Gaps = 4/442 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSI---ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  280
             AI+RQRVLL+HL+P++++S+        + +SAS C AG+S+  QR     DD+VIVAAY
Sbjct  4     AIQRQRVLLEHLQPSSSSSNFSHQTHQSTDLSASSCFAGNSSHGQRGGSE-DDVVIVAAY  62

Query  281   RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  460
             RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63    RTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  461   AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  640
             AAFYAGFPETVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESM+ +T+    +
Sbjct  123   AAFYAGFPETVPLRTVNRQCSSGLQAVADVAAYIKAGFYDIGIGAGLESMSYDTVNRLSN  182

Query  641   VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEI  820
             +NP+  T  QA++CLLPMGITSENVA R+GVTR EQDQAAVESH++AAAATA+GKFK+EI
Sbjct  183   INPKVETFAQARDCLLPMGITSENVAQRYGVTRLEQDQAAVESHKRAAAATASGKFKEEI  242

Query  821   IPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGA  1000
             IPV+TK V+PKTG E  + +SVDDGIRPN +I DLAKLKP F KDGTTTAGN+SQ++DGA
Sbjct  243   IPVSTKFVDPKTGVEKKIIVSVDDGIRPNTNIVDLAKLKPAFHKDGTTTAGNASQISDGA  302

Query  1001  GAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLF  1180
             GAVLLMKR +A+QKGLPILG+FR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLEL +I L+
Sbjct  303   GAVLLMKRRVAVQKGLPILGIFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLELGNIGLY  362

Query  1181  EINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR  1360
             EINEAFASQY+YC KKLGLDP K+NVNGGA+A+GHPLGATGARCVATLL+EMKR GKDCR
Sbjct  363   EINEAFASQYVYCCKKLGLDPRKVNVNGGAIALGHPLGATGARCVATLLNEMKRHGKDCR  422

Query  1361  YGVVSMCIGTGMGAAGVFERGD  1426
             YGV+SMCIG+GMGAA VFERG+
Sbjct  423   YGVISMCIGSGMGAAAVFERGE  444



>ref|XP_009384048.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=451

 Score =   654 bits (1687),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/450 (76%), Positives = 390/450 (87%), Gaps = 6/450 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQR+LL HLRP+ +A        S+S +VC+A  SA   R+S +GDD+VIVAA RT 
Sbjct  4     AIERQRILLHHLRPSPSADP-----PSISTAVCSASGSAK-DRSSCFGDDVVIVAACRTA  57

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCK+++GGFKDTYPDDLLA VLKAL++KT LNPSEVGDIIVGTVLAPGS RA ECRM AF
Sbjct  58    LCKARKGGFKDTYPDDLLAPVLKALLDKTRLNPSEVGDIIVGTVLAPGSQRAIECRMGAF  117

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVAD+AAAIKAGFYD GIGAG+ESMTV+ + W+   NP
Sbjct  118   YAGFPDTVPLRTVNRQCSSGLQAVADIAAAIKAGFYDFGIGAGVESMTVDPVRWDWPANP  177

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
              A    QA++CLLPMGITSENVA R+G+TRQEQDQAAVESHRKAAAA AAGKFK+EIIPV
Sbjct  178   NAQLFAQARDCLLPMGITSENVAERYGITRQEQDQAAVESHRKAAAAVAAGKFKEEIIPV  237

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTG+   VT+S DDGIRP+ SI  L+KLKP FKKDGTTTAGNSSQVTDGA AV
Sbjct  238   VTKVVDPKTGEHKQVTVSADDGIRPDTSISVLSKLKPAFKKDGTTTAGNSSQVTDGAAAV  297

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R  A++KGLP+LGVFR+F AVGV+P +MGIGP  AIPAAVK+AGLELDDIDLFEIN
Sbjct  298   LLMRRDAAMKKGLPVLGVFRSFVAVGVEPNIMGIGPVAAIPAAVKAAGLELDDIDLFEIN  357

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKL LDP K+NVNGGAMA+GHPLG TGARCV+TLL+EMKRRGKDCR+GV
Sbjct  358   EAFASQYVYCCKKLKLDPAKVNVNGGAMALGHPLGCTGARCVSTLLYEMKRRGKDCRFGV  417

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKV  1459
             +SMCIG+GMGAA VFERGD  D+LSNAR+V
Sbjct  418   ISMCIGSGMGAAAVFERGDGVDQLSNARQV  447



>ref|XP_004506590.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   652 bits (1681),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/442 (75%), Positives = 388/442 (88%), Gaps = 9/442 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSI---ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  280
             AIERQRVLL+HL+P ++ S+  S     + +SAS C+AG +   +      +D+VIVAAY
Sbjct  4     AIERQRVLLEHLQPNSSNSAFLSHTHQSTDLSASFCSAGQTGGSE------NDVVIVAAY  57

Query  281   RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  460
             RT +CK+KRGGFKDT PDDLLA VLKA+IEKTN+ PSEVGDIIVGTVL PGS +A+ECRM
Sbjct  58    RTAICKAKRGGFKDTLPDDLLAPVLKAVIEKTNVEPSEVGDIIVGTVLGPGSEKATECRM  117

Query  461   AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  640
             AAFYAGFPETVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLE M+ + ++   +
Sbjct  118   AAFYAGFPETVPLRTVNRQCSSGLQAVADVAAYIKAGFYDIGIGAGLECMSQDNISRLRN  177

Query  641   VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEI  820
             +NP+  T  QA++CLLPMGITSENVA R+GVTRQEQDQAAVESHR+AAAATAAGKFK+EI
Sbjct  178   INPKVETFAQARDCLLPMGITSENVAERYGVTRQEQDQAAVESHRRAAAATAAGKFKEEI  237

Query  821   IPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGA  1000
             IPV+TKIV+PKTG+E  + +SVDDG RPNA++ DLAKLKP FKKDGTTTAGN+SQ++DGA
Sbjct  238   IPVSTKIVDPKTGEEKQIIVSVDDGFRPNANLTDLAKLKPAFKKDGTTTAGNASQISDGA  297

Query  1001  GAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLF  1180
              AVLLMKRS+A+QKGLPILG+FR+FAAVGVDPAVMG+GPA AIPAAVKSAGLEL +IDLF
Sbjct  298   AAVLLMKRSVAVQKGLPILGIFRSFAAVGVDPAVMGVGPAFAIPAAVKSAGLELGNIDLF  357

Query  1181  EINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR  1360
             EINEAFASQ++Y  KKLGLD  K+NVNGGA+A+GHPLGATGAR VATLL+EMKRRGKDCR
Sbjct  358   EINEAFASQFVYSCKKLGLDRSKVNVNGGAIALGHPLGATGARSVATLLNEMKRRGKDCR  417

Query  1361  YGVVSMCIGTGMGAAGVFERGD  1426
             YGV+SMCIG+GMGAA VFERGD
Sbjct  418   YGVISMCIGSGMGAAAVFERGD  439



>gb|EMS48058.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=453

 Score =   649 bits (1675),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/431 (75%), Positives = 379/431 (88%), Gaps = 15/431 (3%)
 Frame = +2

Query  197   ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  376
             AS CAAGDSAAYQR+S +GDD+VIVAAYRTP+CK+KRGGFKDTYP+DLL  VLKA+++KT
Sbjct  36    ASACAAGDSAAYQRSSCFGDDVVIVAAYRTPICKAKRGGFKDTYPEDLLTPVLKAVLDKT  95

Query  377   NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaa  556
              +NP+++GD++VGTVL PGS RA ECR A+  AG PETVPVRTVNRQCSSGLQAVADVAA
Sbjct  96    GINPAQIGDVVVGTVLGPGSQRAIECRTASLLAGIPETVPVRTVNRQCSSGLQAVADVAA  155

Query  557   aikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVT  736
             AIKAGFYDIGIGAGLESM+VN++ WEG VNPR   LQ+AQ+CLLPMGITSENVA R+GVT
Sbjct  156   AIKAGFYDIGIGAGLESMSVNSVGWEGQVNPRVIELQKAQDCLLPMGITSENVAQRYGVT  215

Query  737   RQEQDQAAVESHRKaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASI  916
             R+EQD+AAVESH +AAAATA+GKFKDEIIPV TK+++PKTG+E  V ISVDDGIRP  ++
Sbjct  216   REEQDKAAVESHARAAAATASGKFKDEIIPVHTKLIDPKTGEEKKVVISVDDGIRPGTTL  275

Query  917   GDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDP  1096
               LAKLK VFKKDGTTTAGNSSQV+DGAGAVLLMKRS               FAAVGVDP
Sbjct  276   SGLAKLKTVFKKDGTTTAGNSSQVSDGAGAVLLMKRS---------------FAAVGVDP  320

Query  1097  AVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMA  1276
             AVMG+GPAVAIPAAVKSAGL++DDIDLFE+NEAFASQ++YC  KLGLD  K+NVNGGA+A
Sbjct  321   AVMGVGPAVAIPAAVKSAGLDIDDIDLFELNEAFASQFVYCCNKLGLDRSKVNVNGGAIA  380

Query  1277  IGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARK  1456
             +GHPLGATGARC++TLL+EMKRRG+DCR+GVV+MCIG+GMGAA VFERGD+ DELSN R 
Sbjct  381   MGHPLGATGARCISTLLNEMKRRGRDCRFGVVTMCIGSGMGAAAVFERGDSVDELSNVRH  440

Query  1457  VETHGYLSKDA  1489
             +++H +LSKDA
Sbjct  441   IQSHNFLSKDA  451



>ref|XP_004506669.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/442 (75%), Positives = 385/442 (87%), Gaps = 9/442 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAAS---SLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  280
             AIERQRVLL+HL+P ++ S   S     + +SAS C+AG +   +      +D+VIVAAY
Sbjct  4     AIERQRVLLEHLQPNSSNSVFLSHTHQSTDLSASFCSAGQTGGSE------NDVVIVAAY  57

Query  281   RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  460
             RT +CK+KRGGFKDT PDDLLA VLKA+IEKTN+ PSEVGDI+VGTVL PGS +A+ECRM
Sbjct  58    RTAICKAKRGGFKDTLPDDLLAPVLKAVIEKTNVEPSEVGDIVVGTVLGPGSEKATECRM  117

Query  461   AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  640
             AAFYAGFPETVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLE M+ + +     
Sbjct  118   AAFYAGFPETVPLRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLECMSQDNILRHRK  177

Query  641   VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEI  820
              NP+  T  +A++CLLPMGITSENVA R+GVTRQEQDQAAVESHR+AAAATAAGKFK+EI
Sbjct  178   TNPKVETFAKARDCLLPMGITSENVAERYGVTRQEQDQAAVESHRRAAAATAAGKFKEEI  237

Query  821   IPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGA  1000
             IPV+TKIV+PKTG+E  + +SVDDG RPN+++ DLAKL+P FKKDGTTTAGN+SQV+DGA
Sbjct  238   IPVSTKIVDPKTGEEKQIIVSVDDGFRPNSNLTDLAKLRPAFKKDGTTTAGNASQVSDGA  297

Query  1001  GAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLF  1180
              AVLLMKRS+A+QKGLPILG+FR+FAAVGVDPAVMG+GPA AIPAAVKSAGLEL +IDLF
Sbjct  298   AAVLLMKRSVAVQKGLPILGIFRSFAAVGVDPAVMGVGPAFAIPAAVKSAGLELGNIDLF  357

Query  1181  EINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR  1360
             EINEAFASQ++Y  KKLGLDP K+NVNGGA+A+GHPLGATGAR VATLL+EMKRRGKDCR
Sbjct  358   EINEAFASQFVYSCKKLGLDPSKVNVNGGAIALGHPLGATGARTVATLLNEMKRRGKDCR  417

Query  1361  YGVVSMCIGTGMGAAGVFERGD  1426
             YGV+SMCIG+GMGAA VFERGD
Sbjct  418   YGVISMCIGSGMGAAAVFERGD  439



>gb|KHN15993.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   648 bits (1672),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/442 (75%), Positives = 390/442 (88%), Gaps = 4/442 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSL---DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  280
             AI+RQRVLL+HL+P +++S+        + +SAS+C AG+S+  Q      DD+VIVAAY
Sbjct  4     AIQRQRVLLEHLQPISSSSNFSSQTHQSTDLSASLCFAGNSSHGQTGG-SDDDVVIVAAY  62

Query  281   RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  460
             RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63    RTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  461   AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  640
             AAFYAGFPETVP+RTVNRQCSSGLQAV+DVAA IKAGFYDIGIGAGLESMTV+ +    +
Sbjct  123   AAFYAGFPETVPLRTVNRQCSSGLQAVSDVAAYIKAGFYDIGIGAGLESMTVDRVNRLPN  182

Query  641   VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEI  820
             +NP+  T  +A++CLLPMGITSENVA R+GVTR EQDQAAVESH++AAAATAAGKFK+EI
Sbjct  183   INPKVETFAEARDCLLPMGITSENVAQRYGVTRLEQDQAAVESHKRAAAATAAGKFKEEI  242

Query  821   IPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGA  1000
             IPV+TK V+PKTG E  + +SVDDGIRPN ++ DLAKLKP F+KDGTTTAGN+SQ++DGA
Sbjct  243   IPVSTKFVDPKTGVEKKIIVSVDDGIRPNTNLADLAKLKPAFQKDGTTTAGNASQISDGA  302

Query  1001  GAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLF  1180
              AVLLMKR +A+QKGLPILG+FR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLEL +IDLF
Sbjct  303   AAVLLMKRRVAVQKGLPILGIFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLELGNIDLF  362

Query  1181  EINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR  1360
             EINEAFASQY+YC KKLGLDP K+NVNGGA+A+GHPLG TGARCVATLL+EMKR GKDCR
Sbjct  363   EINEAFASQYVYCLKKLGLDPRKVNVNGGAIALGHPLGVTGARCVATLLNEMKRGGKDCR  422

Query  1361  YGVVSMCIGTGMGAAGVFERGD  1426
             +GV+SMCIG+GMGAA VFERGD
Sbjct  423   FGVISMCIGSGMGAAAVFERGD  444



>ref|XP_009336047.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=443

 Score =   648 bits (1671),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/450 (72%), Positives = 385/450 (86%), Gaps = 10/450 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ +Q+VLLQHLRP ++ SS +   + +SAS+CAAGDSAAY R + +   I++  AYRT 
Sbjct  4     AMNKQKVLLQHLRPNSSVSSSNYESAPLSASICAAGDSAAYHRTAAFAVKIMLNRAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT PDDLL  VLKA+IE+TNLNPS V D++VGTV+APGS+RA+E RM AF
Sbjct  64    ICKAKRGGFKDTLPDDLLPPVLKAVIERTNLNPSAVADVVVGTVMAPGSLRATESRMVAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YA FP+TVP+RTVNRQCSSGLQAV DVAA+IKAG+YDIGI AG+ES+TV+ +     +NP
Sbjct  124   YASFPDTVPIRTVNRQCSSGLQAVFDVAASIKAGYYDIGIAAGVESLTVDKLGRSRKINP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMGITSENVA R+GVTR+EQD+AAVESHR+AA ATA+GKFKDEIIPV
Sbjct  184   KVDIFAQARDCLLPMGITSENVAQRYGVTREEQDRAAVESHRRAAVATASGKFKDEIIPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             +TKIV+PKTG+E  VTISV+DG+RPN ++ DLAKLKP FK DG+TTAGN+SQV       
Sbjct  244   STKIVDPKTGEERPVTISVEDGMRPNTNMNDLAKLKPAFKPDGSTTAGNASQV-------  296

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
                KRSLA+QKGLPILGVFR+FAAVGVDPAVMG+GPA AIP AVKS GLELDDIDLFEIN
Sbjct  297   ---KRSLAMQKGLPILGVFRSFAAVGVDPAVMGVGPAAAIPVAVKSPGLELDDIDLFEIN  353

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMKRRG+D R+GV
Sbjct  354   EAFASQYVYCCKKLGLDPEKVNVNGGAIALGHPLGATGARCVATLLNEMKRRGRDHRFGV  413

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKV  1459
             +SMCIG+GMGAA VFERGD+ DEL NAR V
Sbjct  414   ISMCIGSGMGAAAVFERGDSVDELCNARTV  443



>ref|XP_003574006.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brachypodium 
distachyon]
Length=453

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/459 (73%), Positives = 392/459 (85%), Gaps = 11/459 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A++RQR+LL+HL P   A+  +   S++SAS CAAG          + DD+VIVAAYRT 
Sbjct  4     ALDRQRILLRHLEP---AAGPNPAASAISASACAAG--------GCFADDVVIVAAYRTA  52

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CKSKRGGFKDT P+DLL  V KAL++KT LNPSE+GDI+VGTVLAPGS RA ECRMAA 
Sbjct  53    ICKSKRGGFKDTLPEDLLVPVFKALVDKTKLNPSEIGDIVVGTVLAPGSQRAIECRMAAL  112

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAG YDIGI AGLESMTVN ++ EG VNP
Sbjct  113   YAGFPDTVPLRTVNRQCSSGLQAVADVAAAIKAGMYDIGIAAGLESMTVNKVSLEGQVNP  172

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMG+TSENVA RFG+TR EQDQAAVESHRKAAAA AAGKFK+EI+PV
Sbjct  173   KVELFSQARDCLLPMGLTSENVAKRFGITRVEQDQAAVESHRKAAAAAAAGKFKEEIVPV  232

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E  + +S DDGIR N ++  L+KLKP F KDGTTTAGN+SQV+DGAGAV
Sbjct  233   HTKIVDPKTGEEKEIIVSADDGIRSNTTLAVLSKLKPAFSKDGTTTAGNASQVSDGAGAV  292

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A QKGLPILG++R+FAAVGVDPAVMG+GPAVAIPAAVK+AGL+++D+DLFEIN
Sbjct  293   LLMRRDVATQKGLPILGIYRSFAAVGVDPAVMGVGPAVAIPAAVKAAGLQINDVDLFEIN  352

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC KKL LDP KINVNGGAMA+GHPLGATGARCV+TLL+EMKRRGKDCR+GV
Sbjct  353   EAFASQFVYCAKKLELDPVKINVNGGAMALGHPLGATGARCVSTLLNEMKRRGKDCRFGV  412

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  1486
             +SMCIG+GMGAA VFERGDA DEL+NAR   +   LSKD
Sbjct  413   ISMCIGSGMGAAAVFERGDAVDELTNARGTPSLNLLSKD  451



>ref|NP_001237076.1| 3-ketoacyl-CoA thiolase [Glycine max]
 ref|XP_006605407.1| PREDICTED: 3-ketoacyl-CoA thiolase isoform X1 [Glycine max]
 gb|AAQ93070.1| 3-ketoacyl-CoA thiolase [Glycine max]
 gb|KHM99006.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/442 (75%), Positives = 388/442 (88%), Gaps = 4/442 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSL---DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  280
             AI+RQRVLL HL+P +++S+        + +SAS+C A +S+  Q      DD+VIVAAY
Sbjct  4     AIQRQRVLLDHLQPISSSSNFSSQTHQSTDLSASLCFAKNSSHGQIGG-SDDDVVIVAAY  62

Query  281   RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  460
             RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN+NP+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63    RTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVNPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  461   AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  640
             AAFYAGFPETVP+RTVNRQCSSGLQAV+DVAA IKAGFY+IGIGAGLESMTV+ +    +
Sbjct  123   AAFYAGFPETVPLRTVNRQCSSGLQAVSDVAAYIKAGFYEIGIGAGLESMTVDRVNRLRN  182

Query  641   VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEI  820
             +NP+  T  +A++CLLPMGITSENVA R+GVTR EQDQAAVESH++AAAATAAGKFK+EI
Sbjct  183   INPKVETFAEARDCLLPMGITSENVAQRYGVTRLEQDQAAVESHQRAAAATAAGKFKEEI  242

Query  821   IPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGA  1000
             IPV+TK V+PKTG E  + +SVDDGIRPN ++ DLAKLKP F+KDGTTTAGN+SQ++DGA
Sbjct  243   IPVSTKFVDPKTGVEKKIVVSVDDGIRPNTNLVDLAKLKPAFQKDGTTTAGNASQISDGA  302

Query  1001  GAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLF  1180
              AVLLMKR +A+QKGLPILG+FR+FAAVGVDPAVMG+GPAVAIPAAVKS GLEL +IDLF
Sbjct  303   AAVLLMKRRVAVQKGLPILGIFRSFAAVGVDPAVMGVGPAVAIPAAVKSVGLELGNIDLF  362

Query  1181  EINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR  1360
             EINEAFASQY+YC KKLGLDP K+NVNGGA+A+GHPLG TGARCVATLL+EMKRRGKDCR
Sbjct  363   EINEAFASQYVYCLKKLGLDPRKVNVNGGAIALGHPLGVTGARCVATLLNEMKRRGKDCR  422

Query  1361  YGVVSMCIGTGMGAAGVFERGD  1426
             YGV+SMCIG+GMGAA VFERGD
Sbjct  423   YGVISMCIGSGMGAAAVFERGD  444



>ref|NP_001242568.1| uncharacterized protein LOC100789930 [Glycine max]
 gb|ACU23006.1| unknown [Glycine max]
Length=445

 Score =   645 bits (1664),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/442 (75%), Positives = 389/442 (88%), Gaps = 4/442 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSL---DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  280
             AI+RQRVLL+HL+P +++S+        + +SAS+C AG+S+  Q      DD+VIVAAY
Sbjct  4     AIQRQRVLLEHLQPISSSSNFSSQTHQSTDLSASLCFAGNSSHGQTGG-SDDDVVIVAAY  62

Query  281   RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  460
             RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63    RTAICKAKRGGFKDTPPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  461   AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS  640
             AAFYAGFPETVP+RTVNRQCSSGLQAV+DVAA IKAGFYDIGIGAGLESMTV+ +    +
Sbjct  123   AAFYAGFPETVPLRTVNRQCSSGLQAVSDVAAYIKAGFYDIGIGAGLESMTVDRVNRLPN  182

Query  641   VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEI  820
             +NP+  T  +A++CLLPMGITSENVA R+GVTR EQDQAAVESH++AAAATAAGKFK+EI
Sbjct  183   INPKVETFAEARDCLLPMGITSENVAQRYGVTRLEQDQAAVESHKRAAAATAAGKFKEEI  242

Query  821   IPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGA  1000
             IPV+TK V+PKTG E  + +SVDDGIRPN ++ DLAKLKP F+KDGTTTAGN+SQ++DGA
Sbjct  243   IPVSTKFVDPKTGVEKKIIVSVDDGIRPNTNLADLAKLKPAFQKDGTTTAGNASQISDGA  302

Query  1001  GAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLF  1180
              AVLLMKR +A+QKGLPILG+FR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLEL +IDLF
Sbjct  303   AAVLLMKRRVAVQKGLPILGIFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLELGNIDLF  362

Query  1181  EINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR  1360
             EINEAFASQY+YC KKLGLDP K+NVNGGA+A+GHPLG TGARCVATLL+EMKR GKDCR
Sbjct  363   EINEAFASQYVYCLKKLGLDPRKVNVNGGAIALGHPLGVTGARCVATLLNEMKRGGKDCR  422

Query  1361  YGVVSMCIGTGMGAAGVFERGD  1426
             +GV+SMCIG+GMGA  VFERGD
Sbjct  423   FGVISMCIGSGMGATAVFERGD  444



>ref|XP_003632434.2| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Vitis 
vinifera]
 emb|CBI37268.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   644 bits (1662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/441 (75%), Positives = 389/441 (88%), Gaps = 3/441 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSI-ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  286
             AI RQRVLL+HLRP++++ S   I ESS+SAS+C AG+ A    +S  GDDIV+VAA RT
Sbjct  4     AINRQRVLLEHLRPSSSSPSPSPINESSLSASICLAGNRATNPVDS--GDDIVVVAACRT  61

Query  287   PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  466
              +CK+KRGGFKDT PDD+LA VLKALIEKTN++PSEVGDI+VGTVLAPGS RA ECRMAA
Sbjct  62    AICKAKRGGFKDTLPDDILAPVLKALIEKTNVDPSEVGDIVVGTVLAPGSQRAIECRMAA  121

Query  467   FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  646
             FYAGFP+TVP+RTVNRQCSSGLQAV DV AAI+AG YDIGIGAGLESMT + +A   +VN
Sbjct  122   FYAGFPDTVPIRTVNRQCSSGLQAVVDVVAAIRAGLYDIGIGAGLESMTTDNIAGVTTVN  181

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
             P+     QA++CLLPMG+TSENVA R+GVTRQEQDQAAVESHR+AAAA+AAGKFK+EIIP
Sbjct  182   PKVDIFAQARDCLLPMGLTSENVAKRYGVTRQEQDQAAVESHRRAAAASAAGKFKEEIIP  241

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             V+TKIV+PKTG+   V ISVDDGIRP+ ++  LAKLKP F KDG+TTAGN+SQV+DGAG 
Sbjct  242   VSTKIVDPKTGEVKPVIISVDDGIRPDTNMKSLAKLKPAFAKDGSTTAGNASQVSDGAGG  301

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
              LLMKRSLA+++GLPILG+FR++AAVGV+P VMG+GPAVAIP A K+AGLE+ DIDLFEI
Sbjct  302   ALLMKRSLAMKRGLPILGLFRSYAAVGVEPGVMGVGPAVAIPIAAKNAGLEVADIDLFEI  361

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQY+YC KKL LDP+K+NVNGGA+A+GHPLGATGARCV+TLL+EMKRRGKDCRYG
Sbjct  362   NEAFASQYVYCCKKLDLDPKKVNVNGGALALGHPLGATGARCVSTLLYEMKRRGKDCRYG  421

Query  1367  VVSMCIGTGMGAAGVFERGDA  1429
             V+SMCIG+GMGAA VFERGD+
Sbjct  422   VISMCIGSGMGAAAVFERGDS  442



>ref|XP_002865685.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41944.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
Length=457

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/450 (72%), Positives = 390/450 (87%), Gaps = 5/450 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ERQ++LL+HL P ++ +S  + E S+ + V  A + +     + +GDDIVIVAAYRT 
Sbjct  4     AVERQKILLRHLNPISSTNSSLNHEPSLFSLVNCASEVSPM---AAFGDDIVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  61    ICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--SV  643
             +AGFP+TVPVRTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ + +   G  + 
Sbjct  121   FAGFPDTVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDHIPGGGFHAS  180

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NPRA    +A++CLLPMGITSENVA RFGVTR+EQD AAVESH++AAAA  +GK KDEII
Sbjct  181   NPRAQDFPKARDCLLPMGITSENVAERFGVTREEQDMAAVESHKRAAAAITSGKLKDEII  240

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV TKIV+P+T  E  + +SVDDG+RPN+++ DLAKLK VFK++G+TTAGN+SQ++DGAG
Sbjct  241   PVATKIVDPETKAEKAIVVSVDDGVRPNSNLADLAKLKTVFKQNGSTTAGNASQISDGAG  300

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRSLA++KGLPILGVFR+FA  GVDP+VMGIGPAVAIPAA K AGL + DIDLFE
Sbjct  301   AVLLMKRSLAMKKGLPILGVFRSFAVTGVDPSVMGIGPAVAIPAATKLAGLNVSDIDLFE  360

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+
Sbjct  361   INEAFASQYVYCCKKLELDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRF  420

Query  1364  GVVSMCIGTGMGAAGVFERGDACDELSNAR  1453
             GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  421   GVISMCIGTGMGAAAVFERGDSVDNLSNAR  450



>ref|XP_006395129.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32415.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=460

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/457 (70%), Positives = 391/457 (86%), Gaps = 2/457 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A ERQ++LL+HL P  ++SS  ++     A + A   ++ +   + +GDDIVIVAAYRT 
Sbjct  4     ATERQKILLRHLNPIYSSSSSLTLIKDEPALLSAVNCASEFSPMAAFGDDIVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  64    ICKAKRGGFKDTRPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--SV  643
             +AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+Y+IGIGAG+ESM+++  A  G  S 
Sbjct  124   FAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYEIGIGAGVESMSIDHTAGGGFQST  183

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NPRA    +A++CLLPMGITSENVA R+GVTR+EQD AAVESH++AAAA A+GK K+EI+
Sbjct  184   NPRAQDFPKARDCLLPMGITSENVAERYGVTREEQDMAAVESHKRAAAAIASGKLKEEIV  243

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV TKIV+P T +E  V ISVDDG+RPN+++ DLAKLK VFK DG+TTAGN+SQ++DGAG
Sbjct  244   PVATKIVDPSTKEEKAVVISVDDGVRPNSNMADLAKLKTVFKPDGSTTAGNASQISDGAG  303

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRSLA++KGLPILG+FR+FA  GV+PAVMG+GPA AIPAA   AGL++ DIDLFE
Sbjct  304   AVLLMKRSLAMKKGLPILGIFRSFAVTGVEPAVMGVGPAYAIPAATNLAGLKVSDIDLFE  363

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+
Sbjct  364   INEAFASQYVYCCKKLELDLEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRF  423

Query  1364  GVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  1474
             GV+SMCIGTGMGAA VFERGD+ DELSNA+     G+
Sbjct  424   GVISMCIGTGMGAAAVFERGDSVDELSNAQVANGDGH  460



>gb|KCW50166.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=474

 Score =   640 bits (1652),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/432 (77%), Positives = 380/432 (88%), Gaps = 2/432 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAA--GDSAAYQRNSVYGDDIVIVAAYR  283
             A++RQRVLL+HL+P+ ++ S      S   S  A   GD AAYQR + +GDD+VIVAAYR
Sbjct  4     ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64    TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  643
             AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+ +     V
Sbjct  124   AFYAGFPETVPLRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVDQVRAVPKV  183

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NPR  +  QA++CLLPMGITSENVA RFGVTRQEQDQAAVESHR+A AAT +GKFKDEII
Sbjct  184   NPRVHSFAQARDCLLPMGITSENVAQRFGVTRQEQDQAAVESHRRAYAATQSGKFKDEII  243

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV+TK V+PKTG+E  VTISVDDGIRPN +I DLAKLKP F+KDG TTAGN+SQV+DGAG
Sbjct  244   PVSTKFVDPKTGEEKPVTISVDDGIRPNTNINDLAKLKPAFRKDGATTAGNASQVSDGAG  303

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL LDDIDL E
Sbjct  304   AVLLMKRSVAVQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLTLDDIDLLE  363

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATGARCVATLL+EMKR+G+D R+
Sbjct  364   INEAFASQYVYCCKKLGLDPEKVNVNGGALALGHPLGATGARCVATLLNEMKRQGRDSRF  423

Query  1364  GVVSMCIGTGMG  1399
             GV+S+ I + +G
Sbjct  424   GVISILITSCLG  435



>ref|XP_006280441.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
 gb|EOA13339.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
Length=457

 Score =   637 bits (1644),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/457 (71%), Positives = 391/457 (86%), Gaps = 5/457 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A ERQ++LL+HL P ++ SS  + E +V +SV  A + +     + +GDDIVIVAAYRT 
Sbjct  4     AAERQKILLRHLNPISSFSSSLNHEPTVLSSVNCASEVSPM---AAFGDDIVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA+
Sbjct  61    ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAAY  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--SV  643
             +AGFP++VP+RTVNRQCSSGLQAVADVAA+IKAG+YDIGIGAG+ESM+ + M+  G  + 
Sbjct  121   FAGFPDSVPIRTVNRQCSSGLQAVADVAASIKAGYYDIGIGAGVESMSTDHMSGGGFQAS  180

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NPRA    +A++CLLPMG+TSENVA R+GVTR+EQD AAV SH++AAAA A+GK KDEII
Sbjct  181   NPRAQNFPKARDCLLPMGVTSENVAERYGVTREEQDMAAVVSHKRAAAAIASGKLKDEII  240

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV TKIV+P+T  E  + +SVDDG+RPN+++ DLAKLK VFKKDG+TTAGN+SQ++DGAG
Sbjct  241   PVATKIVDPETKAEKAIVVSVDDGVRPNSNMADLAKLKTVFKKDGSTTAGNASQISDGAG  300

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLL+KRSLA++KGLPILGVFR+FA  GVDP+VMGIGP+VAIPAA   AGL + DIDLFE
Sbjct  301   AVLLIKRSLAMKKGLPILGVFRSFAVTGVDPSVMGIGPSVAIPAATNLAGLNVSDIDLFE  360

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+
Sbjct  361   INEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRF  420

Query  1364  GVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  1474
             GV+SMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  421   GVISMCIGTGMGAAAVFERGDSVDNLSNARVANGDGH  457



>ref|XP_006605730.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Glycine max]
Length=410

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/398 (80%), Positives = 359/398 (90%), Gaps = 2/398 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S + DD+VIVAAYRT 
Sbjct  4     AISRQKILLHHLNPSSSTHVNES--SSLYASACVAGDSAAYQRTSTFRDDVVIVAAYRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
              CK KRGGFKDT PDDLLA VLKA+IE+TN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62    HCKGKRGGFKDTLPDDLLAPVLKAVIERTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N M W+GSVNP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMGWDGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMGITSENVA RFGV+R+EQDQAAVESHR+AAAATA+GKFKDEI+PV
Sbjct  182   KVKMFEQAQNCLLPMGITSENVAQRFGVSRKEQDQAAVESHRRAAAATASGKFKDEIVPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKIV+PKTG+E +VTISVDDGIRP  ++ DL +LKPVFKKDG+TTAGNSSQV+DGA AV
Sbjct  242   TTKIVDPKTGEEKSVTISVDDGIRPGTTVSDLGRLKPVFKKDGSTTAGNSSQVSDGAAAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MG+GPA AIP AVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVALQKGLPILGVFRTFAAVGVDPAIMGVGPAAAIPVAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATG  1303
             EAFASQ++YC+  LGLDPEKINVNGGAMAIGHPLG+TG
Sbjct  362   EAFASQFVYCRNNLGLDPEKINVNGGAMAIGHPLGSTG  399



>ref|XP_008454505.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Cucumis melo]
Length=461

 Score =   636 bits (1641),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/450 (74%), Positives = 392/450 (87%), Gaps = 7/450 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  283
             A+ RQ+VLLQHL+P++++ S     +S+S SVCAAG+SA+  Y R + +GDDIVIVAA R
Sbjct  13    ALNRQKVLLQHLQPSSSSGS-----ASLSTSVCAAGESASNSYHRTAAFGDDIVIVAANR  67

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  68    TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  127

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  643
             AF AGFP+TV +RTVNRQCSSGLQAVADVAAAIK G+YDIGIGAGLE M++N + +  S 
Sbjct  128   AFCAGFPDTVSIRTVNRQCSSGLQAVADVAAAIKVGYYDIGIGAGLECMSINDIEFAVSD  187

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             +P  + +QQA++C+LPMGITSENVA ++GVTR+EQDQAAVESHR+AAAA+A+GKFKDEII
Sbjct  188   SPNVNGIQQARDCMLPMGITSENVAQQYGVTREEQDQAAVESHRRAAAASASGKFKDEII  247

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV TKI++PK+G    V +SVDDGIRP+ ++  LAKLKP FKK+G TTAGNSSQV+DGA 
Sbjct  248   PVYTKIIDPKSGVVKPVIVSVDDGIRPSTNMEILAKLKPAFKKNGCTTAGNSSQVSDGAA  307

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRSLAIQKGLPILGVFR+F+ VGVDPAVMGIGPAVAIPAAVKSAGL L DIDLFE
Sbjct  308   AVLLMKRSLAIQKGLPILGVFRSFSVVGVDPAVMGIGPAVAIPAAVKSAGLTLQDIDLFE  367

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLGATGARCVATLL EMKRRG+D R+
Sbjct  368   INEAFASQYVYCCKKLKLDTEKVNVNGGAIALGHPLGATGARCVATLLSEMKRRGRDSRF  427

Query  1364  GVVSMCIGTGMGAAGVFERGDACDELSNAR  1453
             GV+SMCIGTGMGAA V ERGD  DE  NAR
Sbjct  428   GVISMCIGTGMGAAAVIERGDYVDEFCNAR  457



>ref|XP_010439766.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Camelina sativa]
Length=456

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/457 (72%), Positives = 391/457 (86%), Gaps = 6/457 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A ERQ++LL+HL P  ++SSL+   S +S   CA+  S      + +GDDIVIVAAYRT 
Sbjct  4     AAERQKILLRHLNPIPSSSSLNHESSVLSPVNCASEVSPM----AAFGDDIVIVAAYRTA  59

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA+
Sbjct  60    ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAAY  119

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--SV  643
             +AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ ++M   G  + 
Sbjct  120   FAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDSMPGGGFQTS  179

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NPRA    +A++CLLPMG+TSENVA R+GVTR+EQD AAVESH++AAAA A+GK KDEII
Sbjct  180   NPRALEFPKARDCLLPMGVTSENVAKRYGVTREEQDMAAVESHKRAAAAIASGKLKDEII  239

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV TKIV+P+T  E  + +SVDDG+RPN+++ DLAKLK VFKKDG+TTAGN+SQ++DGAG
Sbjct  240   PVATKIVDPETKAEKAIVVSVDDGVRPNSNMADLAKLKTVFKKDGSTTAGNASQISDGAG  299

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRSLA++KGLPILGVFR+FA  GVDP+VMGIGPAVAIPAA   AGL + DIDLFE
Sbjct  300   AVLLMKRSLAMKKGLPILGVFRSFAVTGVDPSVMGIGPAVAIPAATNLAGLNVSDIDLFE  359

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQY+Y  KKL LD +K+NVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+
Sbjct  360   INEAFASQYVYSCKKLDLDMKKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRF  419

Query  1364  GVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  1474
             GVVSMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  420   GVVSMCIGTGMGAAAVFERGDSVDNLSNARVANGEGH  456



>ref|NP_568704.2| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 ref|NP_001032037.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q570C8.2|THIK5_ARATH RecName: Full=3-ketoacyl-CoA thiolase 5, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 5; AltName: Full=Beta-ketothiolase 
5; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17877.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC23571.1| peroxisomal 3-keto-acyl-CoA thiolase 2 precursor [Arabidopsis 
thaliana]
 dbj|BAB09441.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAL84980.1| AT5g48880/K24G6_22 [Arabidopsis thaliana]
 gb|AED95737.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95738.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=457

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/451 (71%), Positives = 390/451 (86%), Gaps = 7/451 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ERQ++LL+HL P ++++S    E S+ + V    + +     + +GDDIVIVAAYRT 
Sbjct  4     AMERQKILLRHLNPVSSSNSSLKHEPSLLSPVNCVSEVSPM---AAFGDDIVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  61    ICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTM---AWEGS  640
             +AGFP++VPVRTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ + +    + GS
Sbjct  121   FAGFPDSVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDHIPGGGFHGS  180

Query  641   VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEI  820
              NPRA    +A++CLLPMGITSENVA RFGVTR+EQD AAVESH++AAAA A+GK KDEI
Sbjct  181   -NPRAQDFPKARDCLLPMGITSENVAERFGVTREEQDMAAVESHKRAAAAIASGKLKDEI  239

Query  821   IPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGA  1000
             IPV TKIV+P+T  E  + +SVDDG+RPN+++ DLAKLK VFK++G+TTAGN+SQ++DGA
Sbjct  240   IPVATKIVDPETKAEKAIVVSVDDGVRPNSNMADLAKLKTVFKQNGSTTAGNASQISDGA  299

Query  1001  GAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLF  1180
             GAVLLMKRSLA++KGLPILGVFR+FA  GV+P+VMGIGPAVAIPAA K AGL + DIDLF
Sbjct  300   GAVLLMKRSLAMKKGLPILGVFRSFAVTGVEPSVMGIGPAVAIPAATKLAGLNVSDIDLF  359

Query  1181  EINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR  1360
             EINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR
Sbjct  360   EINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCR  419

Query  1361  YGVVSMCIGTGMGAAGVFERGDACDELSNAR  1453
             +GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  420   FGVISMCIGTGMGAAAVFERGDSVDNLSNAR  450



>ref|XP_008454504.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Cucumis melo]
Length=502

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/450 (74%), Positives = 392/450 (87%), Gaps = 7/450 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  283
             A+ RQ+VLLQHL+P++++ S     +S+S SVCAAG+SA+  Y R + +GDDIVIVAA R
Sbjct  54    ALNRQKVLLQHLQPSSSSGS-----ASLSTSVCAAGESASNSYHRTAAFGDDIVIVAANR  108

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  109   TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  168

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  643
             AF AGFP+TV +RTVNRQCSSGLQAVADVAAAIK G+YDIGIGAGLE M++N + +  S 
Sbjct  169   AFCAGFPDTVSIRTVNRQCSSGLQAVADVAAAIKVGYYDIGIGAGLECMSINDIEFAVSD  228

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             +P  + +QQA++C+LPMGITSENVA ++GVTR+EQDQAAVESHR+AAAA+A+GKFKDEII
Sbjct  229   SPNVNGIQQARDCMLPMGITSENVAQQYGVTREEQDQAAVESHRRAAAASASGKFKDEII  288

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV TKI++PK+G    V +SVDDGIRP+ ++  LAKLKP FKK+G TTAGNSSQV+DGA 
Sbjct  289   PVYTKIIDPKSGVVKPVIVSVDDGIRPSTNMEILAKLKPAFKKNGCTTAGNSSQVSDGAA  348

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRSLAIQKGLPILGVFR+F+ VGVDPAVMGIGPAVAIPAAVKSAGL L DIDLFE
Sbjct  349   AVLLMKRSLAIQKGLPILGVFRSFSVVGVDPAVMGIGPAVAIPAAVKSAGLTLQDIDLFE  408

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLGATGARCVATLL EMKRRG+D R+
Sbjct  409   INEAFASQYVYCCKKLKLDTEKVNVNGGAIALGHPLGATGARCVATLLSEMKRRGRDSRF  468

Query  1364  GVVSMCIGTGMGAAGVFERGDACDELSNAR  1453
             GV+SMCIGTGMGAA V ERGD  DE  NAR
Sbjct  469   GVISMCIGTGMGAAAVIERGDYVDEFCNAR  498



>ref|XP_004152018.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Cucumis sativus]
 gb|KGN58339.1| hypothetical protein Csa_3G624070 [Cucumis sativus]
Length=452

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/450 (74%), Positives = 388/450 (86%), Gaps = 7/450 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  283
             A  RQ+VLLQHL+P++++ S     +S+S SVC AG+SA+  Y R + +GDDIVIVAA R
Sbjct  4     AFNRQKVLLQHLQPSSSSES-----ASLSTSVCVAGESASNSYHRTAAFGDDIVIVAANR  58

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  59    TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  118

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  643
             AF AGFP+TV +RTVNRQCSSGLQAVADVAAAIK G+YDIGIGAGLE M++N + +  S 
Sbjct  119   AFCAGFPDTVSIRTVNRQCSSGLQAVADVAAAIKVGYYDIGIGAGLECMSINDIEFAVSD  178

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NP  + + QA++C+LPMGITSENVA ++GVTR+EQDQAAVESHR+AAAA+A+GKFKDEII
Sbjct  179   NPNLNGIPQARDCMLPMGITSENVAQQYGVTREEQDQAAVESHRRAAAASASGKFKDEII  238

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV TKI++PK+G    V +SVDDGIRP+ ++  L KLKP FKK+G TTAGNSSQV+DGA 
Sbjct  239   PVYTKIIDPKSGVAKPVIVSVDDGIRPSTNMEILGKLKPAFKKNGCTTAGNSSQVSDGAA  298

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRSLAIQKGLPILGVFR+F+ VGVDPAVMGIGPAVAIPAAVKSAGL L DIDLFE
Sbjct  299   AVLLMKRSLAIQKGLPILGVFRSFSVVGVDPAVMGIGPAVAIPAAVKSAGLTLQDIDLFE  358

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLG TGARCVATLL EMKRRG+D R+
Sbjct  359   INEAFASQYVYCCKKLNLDTEKVNVNGGAIALGHPLGTTGARCVATLLSEMKRRGRDSRF  418

Query  1364  GVVSMCIGTGMGAAGVFERGDACDELSNAR  1453
             GV+SMCIGTGMGAA V ERGD  DEL NAR
Sbjct  419   GVISMCIGTGMGAAAVIERGDYVDELRNAR  448



>emb|CDY33940.1| BnaA02g30470D [Brassica napus]
Length=456

 Score =   630 bits (1626),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/452 (71%), Positives = 387/452 (86%), Gaps = 7/452 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A ERQ++LL+HL P ++ S      + +SA  CAA  S+     + +GDD+VIVAAYRT 
Sbjct  4     ATERQKILLRHLNPLSS-SPPPYKPTLLSAVNCAAELSSM----AAFGDDVVIVAAYRTA  58

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AAF
Sbjct  59    ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAF  118

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--SV  643
             +AGFP++VP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ + +   G  + 
Sbjct  119   FAGFPDSVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDHIPGGGFNTT  178

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NPRA     A++CLLPMGITSENVA R+GVTR+EQD AAVESH++AAAA A+GK KDEI+
Sbjct  179   NPRAQEFPGARDCLLPMGITSENVAERYGVTREEQDMAAVESHKRAAAANASGKLKDEIV  238

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV TKIV+P T  E  + +SVDDG+RPN+++ DLAKLK VFK +G+TTAGN+SQ++DGAG
Sbjct  239   PVATKIVDPVTKAEKPIVVSVDDGVRPNSNMADLAKLKTVFKPNGSTTAGNASQISDGAG  298

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRSLA++KGLPILGVFR+FA  GVDPAVMGIGPA AIPAA   AGL++ DIDLFE
Sbjct  299   AVLLMKRSLAMKKGLPILGVFRSFAVTGVDPAVMGIGPAYAIPAAANLAGLKVSDIDLFE  358

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+
Sbjct  359   INEAFASQYVYCCKKLELDVEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRF  418

Query  1364  GVVSMCIGTGMGAAGVFERGDACDELSNARKV  1459
             GV+SMCIGTGMGAA VFERGD+ D+LSNAR V
Sbjct  419   GVISMCIGTGMGAAAVFERGDSVDDLSNARVV  450



>ref|XP_010547052.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X3 
[Tarenaya hassleriana]
Length=426

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 317/425 (75%), Positives = 374/425 (88%), Gaps = 8/425 (2%)
 Frame = +2

Query  242   SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  421
             + +GDDIVIVAA+RT +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2     AAFGDDIVIVAAHRTAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTV  61

Query  422   LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  601
             +APGS RA ECR+AA+YAGFP++VP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGI AG+
Sbjct  62    IAPGSQRAMECRVAAYYAGFPDSVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIAAGV  121

Query  602   ESMTVNTMAWEG--SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHR  775
             ESM+ + +A  G   VNP+     +A++CLLPMGITSENVA R+GVTR+EQD AAVESH+
Sbjct  122   ESMSTDHVAGGGFRVVNPKVEDFPKARDCLLPMGITSENVAERYGVTREEQDMAAVESHK  181

Query  776   KaaaataaGKFKDEIIPVTTK------IVNPKTGDETTVTISVDDGIRPNASIGDLAKLK  937
             +AAAATA+GKFKDEI+PV+TK      IV+P+T  E  VT+SVDDGIRPN+SI DLAKLK
Sbjct  182   RAAAATASGKFKDEIVPVSTKLDGSCKIVDPETKQEKAVTVSVDDGIRPNSSIADLAKLK  241

Query  938   PVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGP  1117
             P FK  G+TTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR+FA  GVDPAVMG+GP
Sbjct  242   PAFKPGGSTTAGNASQVSDGAGAVLLMKRSLAVQKGLPILGVFRSFAVTGVDPAVMGVGP  301

Query  1118  AVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGA  1297
             A AIPAA K AGL + DIDLFEINEAFASQ++Y  KKL LD EK+NVNGGA+A+GHPLGA
Sbjct  302   AFAIPAAAKLAGLRVSDIDLFEINEAFASQFVYSCKKLELDREKVNVNGGAIALGHPLGA  361

Query  1298  TGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYL  1477
             TGARCVATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGDA D+LSNAR V  +G+L
Sbjct  362   TGARCVATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDAVDDLSNARTVNLNGHL  421

Query  1478  SKDAR  1492
             SKDA+
Sbjct  422   SKDAK  426



>ref|XP_010442336.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   628 bits (1620),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/459 (70%), Positives = 386/459 (84%), Gaps = 8/459 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESS--VSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  283
             A ERQ++ L+HL P  ++SS      S  +S   CA+  S      + +GDDIVIVAAYR
Sbjct  4     AAERQKIFLRHLNPIPSSSSSSLNHESSVLSPVNCASEVSPM----AAFGDDIVIVAAYR  59

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             T +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+A
Sbjct  60    TAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVA  119

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--  637
             A++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ ++M   G  
Sbjct  120   AYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDSMPGGGFQ  179

Query  638   SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDE  817
             + NPRA    +A++CLLPMG+TSENVA R+G+TRQEQD AAVESH++A AA A+GK KDE
Sbjct  180   TSNPRALEFPKARDCLLPMGVTSENVAERYGITRQEQDMAAVESHKRAPAAIASGKLKDE  239

Query  818   IIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDG  997
             IIPV TKIV+P+T  E  + +SVDDG+RPN+++ DLAKLK VFKKDG+TTAGN+SQ++DG
Sbjct  240   IIPVATKIVDPETKAEKAIVVSVDDGVRPNSNMADLAKLKTVFKKDGSTTAGNASQISDG  299

Query  998   AGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDL  1177
             AGAVLLMKRSLA++KGLPILGV R+FA  GVDP+VMGIGPAVAIPAA   AGL + DIDL
Sbjct  300   AGAVLLMKRSLAMKKGLPILGVLRSFAVTGVDPSVMGIGPAVAIPAATNLAGLNVSDIDL  359

Query  1178  FEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDC  1357
             FEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDC
Sbjct  360   FEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDC  419

Query  1358  RYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  1474
             R+GV+SMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  420   RFGVISMCIGTGMGAAAVFERGDSVDNLSNARVANGEGH  458



>ref|XP_009129750.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Brassica rapa]
Length=456

 Score =   627 bits (1618),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/452 (71%), Positives = 386/452 (85%), Gaps = 7/452 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A ERQ++LL+HL P ++ S      + +SA  CAA  S      + +GDD+VIVAAYRT 
Sbjct  4     ATERQKILLRHLYPLSS-SPPPYKPTLLSAVNCAAELSPM----ASFGDDVVIVAAYRTA  58

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  59    ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  118

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--SV  643
             +AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ + +   G  + 
Sbjct  119   FAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDHIPGGGFNTT  178

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NPRA     A++CLLPMGITSENVA R+GVTR+EQD AAVESH++AAAA A+GK KDEI+
Sbjct  179   NPRAQEFPGARDCLLPMGITSENVAERYGVTREEQDMAAVESHKRAAAANASGKLKDEIV  238

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV TKIV+P T  E  + +SVDDG+RPN+++ DLAKLK VFK +G+TTAGN+SQ++DGAG
Sbjct  239   PVATKIVDPVTKAEKPIVVSVDDGVRPNSNMADLAKLKTVFKPNGSTTAGNASQISDGAG  298

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRSLA++KGLPILGVFR+FA  GVDPAVMGIGPA AIPAA   AGL++ DIDLFE
Sbjct  299   AVLLMKRSLAMKKGLPILGVFRSFAVTGVDPAVMGIGPAYAIPAAANLAGLKVSDIDLFE  358

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR+
Sbjct  359   INEAFASQYVYCCKKLELDVEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCRF  418

Query  1364  GVVSMCIGTGMGAAGVFERGDACDELSNARKV  1459
             GV+SMCIGTGMGAA VFERGD+ D+LSNAR V
Sbjct  419   GVISMCIGTGMGAAAVFERGDSVDDLSNARVV  450



>gb|ADE77908.1| unknown [Picea sitchensis]
Length=444

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/450 (74%), Positives = 375/450 (83%), Gaps = 10/450 (2%)
 Frame = +2

Query  119   RQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSA---AYQRNSVYGDDIVIVAAYRTP  289
             RQ+VL+ HL   + A  L +    VS SVC  GDS    A    S   DD+VIVAAYRTP
Sbjct  2     RQQVLMGHLTGFSTAP-LVAHNLLVSPSVCMGGDSGIDHARAAESCNDDDVVIVAAYRTP  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
              C++KRGGFKDT P+DLL  VLKA++E+T + P EVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61    QCRAKRGGFKDTRPEDLLDPVLKAVVERTGIRPDEVGDIVVGTVLAPGSRRAMECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPE+VP+RTVNRQCSSGLQAVADVA+AIK G+YDIGIGAGLE M+ +++ W    NP
Sbjct  121   YAGFPESVPIRTVNRQCSSGLQAVADVASAIKCGYYDIGIGAGLEFMSEHSIGWGPVDNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R  T QQ Q+CLLPMGITSENVA R+GV+R+ QD+AAV SH+KAAAATAAG+FKDEIIPV
Sbjct  181   RIQTNQQVQDCLLPMGITSENVAERYGVSRESQDEAAVRSHKKAAAATAAGRFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              T+IV+ KTG    VTISVDDGIRPN S+ DLAKLKP FKK G TTAGNSSQVTDGAGAV
Sbjct  241   HTQIVDAKTGQRKPVTISVDDGIRPNTSMSDLAKLKPAFKKGGGTTAGNSSQVTDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKR +A+QKGLPILGVFR+FAAVG DPAVMGIGPAVAIPAAVK+AGL++ DIDLFEIN
Sbjct  301   LLMKRKMAMQKGLPILGVFRSFAAVGCDPAVMGIGPAVAIPAAVKAAGLQIGDIDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC +KL LDPEK+NVNGGA+A+GHPLGATGARCV TLLHEMKRRGKDCR+GV
Sbjct  361   EAFASQYVYCCQKLELDPEKVNVNGGAIALGHPLGATGARCVGTLLHEMKRRGKDCRFGV  420

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKV  1459
             VSMCIGTGMGAA VFERG      SNAR +
Sbjct  421   VSMCIGTGMGAAAVFERG------SNARPI  444



>ref|XP_007049826.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
 gb|EOX93983.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
Length=472

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/431 (75%), Positives = 374/431 (87%), Gaps = 6/431 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  274
             A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4     ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  275   AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  454
             A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64    ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  455   RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWE  634
             RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA  IKAG YDIGI AGLESMT + +   
Sbjct  124   RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVALCIKAGLYDIGIAAGLESMTTDKVVPG  183

Query  635   GS-VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFK  811
              S VNP+  +  QA++CLLPMGITSENVA R+GVTRQEQDQAAVESHR+AAAATA+GKFK
Sbjct  184   VSKVNPQVESFAQARDCLLPMGITSENVAQRYGVTRQEQDQAAVESHRRAAAATASGKFK  243

Query  812   DEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVT  991
             DEIIPV+TKIV+PKTG+E  VTI VDDGIRPN ++ DLAKLKP F+KDG TTAGN+SQV+
Sbjct  244   DEIIPVSTKIVDPKTGEEKPVTIVVDDGIRPNTNMADLAKLKPAFRKDGATTAGNASQVS  303

Query  992   DGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDI  1171
             DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAG+EL DI
Sbjct  304   DGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGIELADI  363

Query  1172  DLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGK  1351
             DLFEINEAFASQY+YC KKL LD EK+NVNGGA+A+GHPLGATGARCV TLL+EMKRRGK
Sbjct  364   DLFEINEAFASQYVYCCKKLELDSEKVNVNGGAIALGHPLGATGARCVGTLLYEMKRRGK  423

Query  1352  DCRYGVVSMCI  1384
             DCR+GV+SMCI
Sbjct  424   DCRFGVISMCI  434



>ref|XP_010439770.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Camelina sativa]
Length=414

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/413 (75%), Positives = 366/413 (89%), Gaps = 2/413 (0%)
 Frame = +2

Query  242   SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  421
             + +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2     AAFGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  422   LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  601
             LAPGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62    LAPGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  602   ESMTVNTMAWEG--SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHR  775
             ESM+ ++M   G  + NPRA    +A++CLLPMG+TSENVA R+GVTR+EQD AAVESH+
Sbjct  122   ESMSTDSMPGGGFQTSNPRALEFPKARDCLLPMGVTSENVAKRYGVTREEQDMAAVESHK  181

Query  776   KaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKD  955
             +AAAA A+GK KDEIIPV TKIV+P+T  E  + +SVDDG+RPN+++ DLAKLK VFKKD
Sbjct  182   RAAAAIASGKLKDEIIPVATKIVDPETKAEKAIVVSVDDGVRPNSNMADLAKLKTVFKKD  241

Query  956   GTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPA  1135
             G+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDP+VMGIGPAVAIPA
Sbjct  242   GSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPSVMGIGPAVAIPA  301

Query  1136  AVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCV  1315
             A   AGL + DIDLFEINEAFASQY+Y  KKL LD +K+NVNGGA+AIGHPLGATGARCV
Sbjct  302   ATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMKKVNVNGGAIAIGHPLGATGARCV  361

Query  1316  ATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  1474
             ATLLHEMKRRGKDCR+GVVSMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  362   ATLLHEMKRRGKDCRFGVVSMCIGTGMGAAAVFERGDSVDNLSNARVANGEGH  414



>ref|XP_010442338.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/413 (75%), Positives = 364/413 (88%), Gaps = 2/413 (0%)
 Frame = +2

Query  242   SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  421
             + +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2     AAFGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  422   LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  601
             LAPGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62    LAPGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  602   ESMTVNTMAWEG--SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHR  775
             ESM+ ++M   G  + NPRA    +A++CLLPMG+TSENVA R+G+TRQEQD AAVESH+
Sbjct  122   ESMSTDSMPGGGFQTSNPRALEFPKARDCLLPMGVTSENVAERYGITRQEQDMAAVESHK  181

Query  776   KaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKD  955
             +A AA A+GK KDEIIPV TKIV+P+T  E  + +SVDDG+RPN+++ DLAKLK VFKKD
Sbjct  182   RAPAAIASGKLKDEIIPVATKIVDPETKAEKAIVVSVDDGVRPNSNMADLAKLKTVFKKD  241

Query  956   GTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPA  1135
             G+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGV R+FA  GVDP+VMGIGPAVAIPA
Sbjct  242   GSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVLRSFAVTGVDPSVMGIGPAVAIPA  301

Query  1136  AVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCV  1315
             A   AGL + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCV
Sbjct  302   ATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAIGHPLGATGARCV  361

Query  1316  ATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  1474
             ATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR     G+
Sbjct  362   ATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNARVANGEGH  414



>ref|XP_006395130.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32416.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=414

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/413 (74%), Positives = 367/413 (89%), Gaps = 2/413 (0%)
 Frame = +2

Query  242   SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  421
             + +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2     AAFGDDIVIVAAYRTAICKAKRGGFKDTRPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  422   LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  601
             +APGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+Y+IGIGAG+
Sbjct  62    IAPGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYEIGIGAGV  121

Query  602   ESMTVNTMAWEG--SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHR  775
             ESM+++  A  G  S NPRA    +A++CLLPMGITSENVA R+GVTR+EQD AAVESH+
Sbjct  122   ESMSIDHTAGGGFQSTNPRAQDFPKARDCLLPMGITSENVAERYGVTREEQDMAAVESHK  181

Query  776   KaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKD  955
             +AAAA A+GK K+EI+PV TKIV+P T +E  V ISVDDG+RPN+++ DLAKLK VFK D
Sbjct  182   RAAAAIASGKLKEEIVPVATKIVDPSTKEEKAVVISVDDGVRPNSNMADLAKLKTVFKPD  241

Query  956   GTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPA  1135
             G+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILG+FR+FA  GV+PAVMG+GPA AIPA
Sbjct  242   GSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGIFRSFAVTGVEPAVMGVGPAYAIPA  301

Query  1136  AVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCV  1315
             A   AGL++ DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGARCV
Sbjct  302   ATNLAGLKVSDIDLFEINEAFASQYVYCCKKLELDLEKVNVNGGAIAIGHPLGATGARCV  361

Query  1316  ATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  1474
             ATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ DELSNA+     G+
Sbjct  362   ATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDELSNAQVANGDGH  414



>gb|KDO65875.1| hypothetical protein CISIN_1g0125222mg, partial [Citrus sinensis]
Length=397

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/397 (79%), Positives = 354/397 (89%), Gaps = 3/397 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4     ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61    ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN+++  G VNP
Sbjct  121   YAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMGITSENVA RFGVTRQEQD AAVESHR+AAAATA+GKFKDEIIPV
Sbjct  181   KVEIFTQARDCLLPMGITSENVAQRFGVTRQEQDLAAVESHRRAAAATASGKFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG E  VTISVDDGIRPN +I DLAKLKP FKKDGTTTAGN+SQV+DGAGAV
Sbjct  241   NTKIVDPKTGVEKRVTISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA+QKGLPILGVFR+F+AVGVDP+VMGIGPAVAIPAAVKSAGL++DDI+LFEIN
Sbjct  301   LLMKRSLAVQKGLPILGVFRSFSAVGVDPSVMGIGPAVAIPAAVKSAGLQIDDINLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGAT  1300
             EAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGAT
Sbjct  361   EAFASQYVYCIKKLGLDPEKVNVNGGAVALGHPLGAT  397



>emb|CDY05657.1| BnaC02g38800D [Brassica napus]
Length=462

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/457 (70%), Positives = 392/457 (86%), Gaps = 4/457 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A ERQ++L++HL P +++ SL SI  +    + A   +A     + +GDD+VIVAAYRT 
Sbjct  4     ATERQKILIRHLNPLSSSPSLPSINDNKPTLLSAVNCAAELSPMAAFGDDVVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  64    ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--SV  643
             +AGFP++VP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+++  A  G  + 
Sbjct  124   FAGFPDSVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSIDHTAGGGFHTT  183

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NPRA   + A++CLLPMGITSENVA R+ VTR++QD AAVESH++AAAA A+GK KDEI+
Sbjct  184   NPRAQEFRGARDCLLPMGITSENVAERYCVTREDQDMAAVESHKRAAAANASGKLKDEIV  243

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTA-GNSSQVTDGA  1000
             PV TKIV+P T  E  + +SVDDG+RPN+++ DLAKLK VFK +G+TTA GN+SQ++DGA
Sbjct  244   PVATKIVDPDTKAEKPIVVSVDDGVRPNSNMADLAKLKTVFKPNGSTTAVGNASQISDGA  303

Query  1001  GAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLF  1180
             GAVLLMKRSLA++KGLPILG+FR+FA  GVDPAVMGIGPA AIPAA   AGL++ DIDLF
Sbjct  304   GAVLLMKRSLAMKKGLPILGIFRSFAVTGVDPAVMGIGPAYAIPAAANLAGLKVSDIDLF  363

Query  1181  EINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR  1360
             EINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR
Sbjct  364   EINEAFASQYVYCCKKLELDVEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCR  423

Query  1361  YGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHG  1471
             +GV+SMCIGTGMGAA VFERGD+ D+LSNAR VET+G
Sbjct  424   FGVISMCIGTGMGAAAVFERGDSVDDLSNAR-VETNG  459



>gb|AAL25590.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
Length=390

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/380 (83%), Positives = 346/380 (91%), Gaps = 2/380 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLL+HLRP++++S   + E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4     AIERQRVLLEHLRPSSSSSH--NYEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62    LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNP
Sbjct  122   YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                   QAQNCLLPMG+TSENVA RFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   AVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+PKTGDE  +T+SVDDGIRP  ++  L KLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   KTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  302   LLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFEIN  361

Query  1190  EAFASQYLYCQKKLGLDPEK  1249
             EAFASQ++YC+ K  L   K
Sbjct  362   EAFASQFVYCRNKWDLTQRK  381



>dbj|BAF02017.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=414

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/407 (76%), Positives = 365/407 (90%), Gaps = 4/407 (1%)
 Frame = +2

Query  242   SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  421
             + +GDDIVIVAAYRT +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2     AAFGDDIVIVAAYRTAICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  422   LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  601
             +APGS RA ECR+AA++AGFP++VPVRTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62    IAPGSQRAMECRVAAYFAGFPDSVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  602   ESMTVNTM---AWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESH  772
             ESM+ + +    + GS NPRA    +A++CLLPMGITSENVA RFGVTR+EQD AAVESH
Sbjct  122   ESMSTDHIPGGGFHGS-NPRAQDFPKARDCLLPMGITSENVAERFGVTREEQDMAAVESH  180

Query  773   RKaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKK  952
             ++AAAA A+GK KDEIIPV TKIV+P+T  E  + +SVDDG+RPN+++ DLAKLK VFK+
Sbjct  181   KRAAAAIASGKLKDEIIPVATKIVDPETKAEKAIVVSVDDGVRPNSNMADLAKLKTVFKQ  240

Query  953   DGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIP  1132
             DG+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GV+P+VMGIGPAVAIP
Sbjct  241   DGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVEPSVMGIGPAVAIP  300

Query  1133  AAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARC  1312
             AA K AGL + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARC
Sbjct  301   AATKLAGLNVSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGARC  360

Query  1313  VATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  1453
             VATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  361   VATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  407



>ref|XP_010482154.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/458 (70%), Positives = 388/458 (85%), Gaps = 6/458 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTN-AASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  286
             A ERQ++LL+HL P   ++SS  + ESSV   V  A + +     + +GDDIVIVAAYRT
Sbjct  4     AAERQKILLRHLNPIPCSSSSSLNHESSVLYPVNCASEVSPM---AAFGDDIVIVAAYRT  60

Query  287   PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  466
              +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA
Sbjct  61    AICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAA  120

Query  467   FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG--S  640
             ++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ ++M   G  +
Sbjct  121   YFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTDSMPGGGFQT  180

Query  641   VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEI  820
              NPRA    +A++CLLPMG+TSENVA R+G+TRQEQD AAVESH++AAAA A+GK KDEI
Sbjct  181   SNPRALEFPKARDCLLPMGVTSENVAERYGITRQEQDMAAVESHKRAAAAIASGKLKDEI  240

Query  821   IPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGA  1000
             IPV TKIV+P+T  E  + +SVDDG+RPN+++ DLAKLK VFKKDG+TTAGN+SQ++DGA
Sbjct  241   IPVATKIVDPETKAEKAIVVSVDDGVRPNSNMADLAKLKTVFKKDGSTTAGNASQISDGA  300

Query  1001  GAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLF  1180
             GAVLLMKRSLA++KGLPILGVFR+FA  GVDP+VMGIGPAVAIPAA   AGL + DIDLF
Sbjct  301   GAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPSVMGIGPAVAIPAATNLAGLNVSDIDLF  360

Query  1181  EINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR  1360
             EINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCVATLLHEMKRRGKDCR
Sbjct  361   EINEAFASQYVYSCKKLDLDMEKVNVNGGAIAIGHPLGATGARCVATLLHEMKRRGKDCR  420

Query  1361  YGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  1474
             +GV+SMCIGTGMGAA VFE GD+    S+A+     G+
Sbjct  421   FGVISMCIGTGMGAAAVFESGDSFKNNSDAQVANGEGH  458



>ref|NP_851157.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC17876.1| 3-keto-acyl-CoA-thiolase 1 [Arabidopsis thaliana]
 gb|AAC19122.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AAM97120.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAO00954.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95736.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=414

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/407 (75%), Positives = 365/407 (90%), Gaps = 4/407 (1%)
 Frame = +2

Query  242   SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  421
             + +GDDIVIVAAYRT +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2     AAFGDDIVIVAAYRTAICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  422   LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  601
             +APGS RA ECR+AA++AGFP++VPVRTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62    IAPGSQRAMECRVAAYFAGFPDSVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  602   ESMTVNTM---AWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESH  772
             ESM+ + +    + GS NPRA    +A++CLLPMGITSENVA RFGVTR+EQD AAVESH
Sbjct  122   ESMSTDHIPGGGFHGS-NPRAQDFPKARDCLLPMGITSENVAERFGVTREEQDMAAVESH  180

Query  773   RKaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKK  952
             ++AAAA A+GK KDEIIPV TKIV+P+T  E  + +SVDDG+RPN+++ DLAKLK VFK+
Sbjct  181   KRAAAAIASGKLKDEIIPVATKIVDPETKAEKAIVVSVDDGVRPNSNMADLAKLKTVFKQ  240

Query  953   DGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIP  1132
             +G+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GV+P+VMGIGPAVAIP
Sbjct  241   NGSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVEPSVMGIGPAVAIP  300

Query  1133  AAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARC  1312
             AA K AGL + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARC
Sbjct  301   AATKLAGLNVSDIDLFEINEAFASQYVYSCKKLELDMEKVNVNGGAIAIGHPLGATGARC  360

Query  1313  VATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNAR  1453
             VATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D LSNAR
Sbjct  361   VATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDNLSNAR  407



>ref|XP_009129751.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Brassica rapa]
Length=415

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/406 (75%), Positives = 362/406 (89%), Gaps = 2/406 (0%)
 Frame = +2

Query  248   YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  427
             +GDD+VIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+A
Sbjct  4     FGDDVVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIA  63

Query  428   PGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLES  607
             PGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ES
Sbjct  64    PGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVES  123

Query  608   MTVNTMAWEG--SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKa  781
             M+ + +   G  + NPRA     A++CLLPMGITSENVA R+GVTR+EQD AAVESH++A
Sbjct  124   MSTDHIPGGGFNTTNPRAQEFPGARDCLLPMGITSENVAERYGVTREEQDMAAVESHKRA  183

Query  782   aaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGT  961
             AAA A+GK KDEI+PV TKIV+P T  E  + +SVDDG+RPN+++ DLAKLK VFK +G+
Sbjct  184   AAANASGKLKDEIVPVATKIVDPVTKAEKPIVVSVDDGVRPNSNMADLAKLKTVFKPNGS  243

Query  962   TTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAV  1141
             TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDPAVMGIGPA AIPAA 
Sbjct  244   TTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPAVMGIGPAYAIPAAA  303

Query  1142  KSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVAT  1321
               AGL++ DIDLFEINEAFASQY+YC KKL LD EK+NVNGGA+AIGHPLGATGARCVAT
Sbjct  304   NLAGLKVSDIDLFEINEAFASQYVYCCKKLELDVEKVNVNGGAIAIGHPLGATGARCVAT  363

Query  1322  LLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKV  1459
             LLHEMKRRGKDCR+GV+SMCIGTGMGAA VFERGD+ D+LSNAR V
Sbjct  364   LLHEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDSVDDLSNARVV  409



>gb|AIB06952.1| 3-ketoacyl-CoA thiolase [Vanda hybrid cultivar]
Length=450

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/448 (73%), Positives = 394/448 (88%), Gaps = 5/448 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQ VL +HL+    +SS D   +S+SASV AAGDS+AYQ+N  + DD+VIVAA RT 
Sbjct  4     AIDRQGVLRRHLQ----SSSYDH-PTSLSASVGAAGDSSAYQKNHGFDDDVVIVAACRTA  58

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             + K+ RGGFKDT+ +DLLA +LKAL+EKT LNP EVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59    IGKANRGGFKDTHAEDLLAPLLKALLEKTKLNPYEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAG+Y IGIGAGLESM+ N + WEG  NP
Sbjct  119   YAGFPETVPLRTVNRQCSSGLQAVADVAAAIKAGYYGIGIGAGLESMSSNKVGWEGPPNP  178

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +A +LQQ Q+C LPMG+TSENVA R+G+T++EQDQAAV SH++AAAA A+GKFK+EI+PV
Sbjct  179   KAKSLQQVQDCYLPMGMTSENVAERYGITKEEQDQAAVISHKRAAAAIASGKFKEEIVPV  238

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKI +PK+G E  +T+SVD+G+RP+ S+  LAKLKP FK+ G+TTAGN+SQV+DGAGAV
Sbjct  239   TTKITDPKSGIEKEITVSVDEGVRPDTSLSGLAKLKPAFKEGGSTTAGNASQVSDGAGAV  298

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +AIQKGLPILG+FR+FAAVGVDPAVMGIGPAVAIPAAVK+AGL++ DIDL+EIN
Sbjct  299   LLMRRDVAIQKGLPILGIFRSFAAVGVDPAVMGIGPAVAIPAAVKAAGLQIKDIDLYEIN  358

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ++YC K+LGLDPEK+NVNGGA+A+GHPLGATGARCV+TLL+EMKRRG DCR+G+
Sbjct  359   EAFASQFVYCIKELGLDPEKVNVNGGAIALGHPLGATGARCVSTLLNEMKRRGNDCRFGI  418

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNAR  1453
             +SMCIG+GMGAA VFERGD  D LSN +
Sbjct  419   ISMCIGSGMGAAAVFERGDVADRLSNVQ  446



>ref|XP_010482155.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/413 (74%), Positives = 363/413 (88%), Gaps = 2/413 (0%)
 Frame = +2

Query  242   SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  421
             + +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2     AAFGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  422   LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  601
             LAPGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62    LAPGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  602   ESMTVNTMAWEG--SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHR  775
             ESM+ ++M   G  + NPRA    +A++CLLPMG+TSENVA R+G+TRQEQD AAVESH+
Sbjct  122   ESMSTDSMPGGGFQTSNPRALEFPKARDCLLPMGVTSENVAERYGITRQEQDMAAVESHK  181

Query  776   KaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKD  955
             +AAAA A+GK KDEIIPV TKIV+P+T  E  + +SVDDG+RPN+++ DLAKLK VFKKD
Sbjct  182   RAAAAIASGKLKDEIIPVATKIVDPETKAEKAIVVSVDDGVRPNSNMADLAKLKTVFKKD  241

Query  956   GTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPA  1135
             G+TTAGN+SQ++DGAGAVLLMKRSLA++KGLPILGVFR+FA  GVDP+VMGIGPAVAIPA
Sbjct  242   GSTTAGNASQISDGAGAVLLMKRSLAMKKGLPILGVFRSFAVTGVDPSVMGIGPAVAIPA  301

Query  1136  AVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCV  1315
             A   AGL + DIDLFEINEAFASQY+Y  KKL LD EK+NVNGGA+AIGHPLGATGARCV
Sbjct  302   ATNLAGLNVSDIDLFEINEAFASQYVYSCKKLDLDMEKVNVNGGAIAIGHPLGATGARCV  361

Query  1316  ATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGY  1474
             ATLLHEMKRRGKDCR+GV+SMCIGTGMGAA VFE GD+    S+A+     G+
Sbjct  362   ATLLHEMKRRGKDCRFGVISMCIGTGMGAAAVFESGDSFKNNSDAQVANGEGH  414



>gb|KDO43603.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=415

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/364 (86%), Positives = 340/364 (93%), Gaps = 2/364 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ+VLL+HLRP+N++S   + ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4     AINRQQVLLEHLRPSNSSSH--NYESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62    LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QAQNCLLPMG+TSENVAHRFGVTR+EQDQAAV+SHRKAAAATAAGKFKDEIIPV
Sbjct  182   KVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQAAVDSHRKAAAATAAGKFKDEIIPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTISVDDGIRPN S+ +LAKLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  242   ATKIVDPKTGDEKPVTISVDDGIRPNTSVSELAKLKPVFKKDGTTTAGNSSQVSDGAGAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+LDDIDLFEIN
Sbjct  302   LLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDLFEIN  361

Query  1190  EAFA  1201
             E  A
Sbjct  362   EVVA  365



>gb|EMS60447.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=435

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/459 (68%), Positives = 367/459 (80%), Gaps = 29/459 (6%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A++RQR+LL+HL P   AS   S  S+   +   AGDSAAY R   + DD+VIVAAYRT 
Sbjct  4     ALDRQRILLRHLEPAAGASPAASAVSASVCA---AGDSAAYHRGPCFADDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRG FKDT P+DLL  V KAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61    ICKAKRGSFKDTLPEDLLVPVFKALVDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP++TVNRQCSSGLQAVADVAAAIKAG YDIGI AG+ESMTVN +     VNP
Sbjct  121   YAGFPDTVPLKTVNRQCSSGLQAVADVAAAIKAGMYDIGIAAGVESMTVNKVNLVEKVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMG+TSENVA RFG+TR EQDQAA                       
Sbjct  181   KVELFAQARDCLLPMGLTSENVAQRFGITRMEQDQAA-----------------------  217

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
                IV+PKTG+E  + +S DDGIR N ++  L+KLKP F KDGTTTAGN+SQV+DGAGAV
Sbjct  218   ---IVDPKTGEEKEIVVSADDGIRSNTTLAVLSKLKPAFSKDGTTTAGNASQVSDGAGAV  274

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A QKGLPILG++R+FAAVGVDPAVMG+GPAVAIPAAVK+AGL+++D+DLFEIN
Sbjct  275   LLMRRDVATQKGLPILGIYRSFAAVGVDPAVMGVGPAVAIPAAVKAAGLQINDVDLFEIN  334

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQY+YC KKL LDP K+NVNGGA+A+GHPLGATGARCV+TLL+EMKRRGKDCR+GV
Sbjct  335   EAFASQYVYCSKKLDLDPAKVNVNGGAIALGHPLGATGARCVSTLLNEMKRRGKDCRFGV  394

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  1486
             +SMCIG+GMGAA VFERGDA DEL+NAR V +  +LSKD
Sbjct  395   ISMCIGSGMGAAAVFERGDAVDELTNARGVPSLNWLSKD  433



>gb|KCW57292.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=380

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/361 (86%), Positives = 341/361 (94%), Gaps = 0/361 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AIERQRVLLQHLRP++++SS+    SS+SAS+CAAGDSAAYQR+  +GDDIVIVAAYRT 
Sbjct  4     AIERQRVLLQHLRPSSSSSSVHGDASSLSASICAAGDSAAYQRSGSFGDDIVIVAAYRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LCKSKRGGFKDTYPDDLLA VL+ALI+KT +NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64    LCKSKRGGFKDTYPDDLLAPVLRALIDKTKINPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEGSVNP
Sbjct  124   YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEGSVNP  183

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +  +  QAQNCLLPMG+TSENVAHRFGVTRQEQDQAAVESHRKAAAATAAG+FKDEIIPV
Sbjct  184   KVKSFAQAQNCLLPMGVTSENVAHRFGVTRQEQDQAAVESHRKAAAATAAGRFKDEIIPV  243

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  VTI+VDDGIRP+A++ DLAKLKPVFKKDG TTAGNSSQV+DGAGAV
Sbjct  244   ATKIVDPKTGDEKPVTIAVDDGIRPSATLSDLAKLKPVFKKDGCTTAGNSSQVSDGAGAV  303

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDLFEIN
Sbjct  304   LLMKRSLAMEKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLFEIN  363

Query  1190  E  1192
             E
Sbjct  364   E  364



>gb|KDO43605.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
 gb|KDO43606.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
 gb|KDO43607.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=345

 Score =   597 bits (1539),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/343 (87%), Positives = 325/343 (95%), Gaps = 0/343 (0%)
 Frame = +2

Query  458   MAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG  637
             MAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN MAWEG
Sbjct  1     MAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVNPMAWEG  60

Query  638   SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDE  817
             SVNP+    +QAQNCLLPMG+TSENVAHRFGVTR+EQDQAAV+SHRKAAAATAAGKFKDE
Sbjct  61    SVNPKVKAFEQAQNCLLPMGVTSENVAHRFGVTRKEQDQAAVDSHRKAAAATAAGKFKDE  120

Query  818   IIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDG  997
             IIPV TKIV+PKTGDE  VTISVDDGIRPN S+ +LAKLKPVFKKDGTTTAGNSSQV+DG
Sbjct  121   IIPVATKIVDPKTGDEKPVTISVDDGIRPNTSVSELAKLKPVFKKDGTTTAGNSSQVSDG  180

Query  998   AGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDL  1177
             AGAVLLMKRS+A++KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVKSAGL+LDDIDL
Sbjct  181   AGAVLLMKRSVAMRKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKSAGLQLDDIDL  240

Query  1178  FEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDC  1357
             FEINEAFASQ++YC+ KLGLDPEKINVNGGA+AIGHPLG TGARCVATLLHEMKRRG+DC
Sbjct  241   FEINEAFASQFVYCRNKLGLDPEKINVNGGALAIGHPLGTTGARCVATLLHEMKRRGRDC  300

Query  1358  RYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKD  1486
             R+GV+SMCIGTGMGAA VFERGD  DEL N RKVE++ +LSKD
Sbjct  301   RFGVISMCIGTGMGAAAVFERGDCADELCNVRKVESNNFLSKD  343



>gb|KCW50170.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=406

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/400 (78%), Positives = 352/400 (88%), Gaps = 2/400 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAA--GDSAAYQRNSVYGDDIVIVAAYR  283
             A++RQRVLL+HL+P+ ++ S      S   S  A   GD AAYQR + +GDD+VIVAAYR
Sbjct  4     ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64    TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  643
             AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+ +     V
Sbjct  124   AFYAGFPETVPLRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVDQVRAVPKV  183

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NPR  +  QA++CLLPMGITSENVA RFGVTRQEQDQAAVESHR+A AAT +GKFKDEII
Sbjct  184   NPRVHSFAQARDCLLPMGITSENVAQRFGVTRQEQDQAAVESHRRAYAATQSGKFKDEII  243

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV+TK V+PKTG+E  VTISVDDGIRPN +I DLAKLKP F+KDG TTAGN+SQV+DGAG
Sbjct  244   PVSTKFVDPKTGEEKPVTISVDDGIRPNTNINDLAKLKPAFRKDGATTAGNASQVSDGAG  303

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL LDDIDL E
Sbjct  304   AVLLMKRSVAVQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLTLDDIDLLE  363

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATG  1303
             INEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATG
Sbjct  364   INEAFASQYVYCCKKLGLDPEKVNVNGGALALGHPLGATG  403



>gb|KCW50169.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=406

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/402 (77%), Positives = 353/402 (88%), Gaps = 2/402 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAA--GDSAAYQRNSVYGDDIVIVAAYR  283
             A++RQRVLL+HL+P+ ++ S      S   S  A   GD AAYQR + +GDD+VIVAAYR
Sbjct  4     ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64    TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  643
             AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+ +     V
Sbjct  124   AFYAGFPETVPLRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVDQVRAVPKV  183

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NPR  +  QA++CLLPMGITSENVA RFGVTRQEQDQAAVESHR+A AAT +GKFKDEII
Sbjct  184   NPRVHSFAQARDCLLPMGITSENVAQRFGVTRQEQDQAAVESHRRAYAATQSGKFKDEII  243

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV+TK V+PKTG+E  VTISVDDGIRPN +I DLAKLKP F+KDG TTAGN+SQV+DGAG
Sbjct  244   PVSTKFVDPKTGEEKPVTISVDDGIRPNTNINDLAKLKPAFRKDGATTAGNASQVSDGAG  303

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRS+A+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAGL LDDIDL E
Sbjct  304   AVLLMKRSVAVQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGLTLDDIDLLE  363

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGAR  1309
             INEAFASQY+YC KKLGLDPEK+NVNGGA+A+GHPLGATG +
Sbjct  364   INEAFASQYVYCCKKLGLDPEKVNVNGGALALGHPLGATGWK  405



>gb|KJB42403.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=372

 Score =   593 bits (1529),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/371 (81%), Positives = 339/371 (91%), Gaps = 1/371 (0%)
 Frame = +2

Query  353   LKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGL  532
             ++A+I++T LNPSEVGDI+VGTVLAPGS RA ECRMAAFYAGFP+TVP+RTVNRQCSSGL
Sbjct  1     MQAVIDRTKLNPSEVGDIVVGTVLAPGSQRAMECRMAAFYAGFPDTVPIRTVNRQCSSGL  60

Query  533   QavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGS-VNPRASTLQQAQNCLLPMGITSE  709
             QAVADVAA IKAGFYDIGIGAGLESMT N  A + S VNP+  +  QA++CLLPMGITSE
Sbjct  61    QAVADVAACIKAGFYDIGIGAGLESMTTNGSAPDQSKVNPKVKSFAQARDCLLPMGITSE  120

Query  710   NVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVD  889
             NVA R+GVTRQEQDQAAVESHR+AAAATA+GKFK+EI+PV+TKIV+PKTG+E  VTISVD
Sbjct  121   NVAQRYGVTRQEQDQAAVESHRRAAAATASGKFKEEIVPVSTKIVDPKTGEEKAVTISVD  180

Query  890   DGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFR  1069
             DGIRP+ +   LAKLKP FKKDGTTTAGN+SQV+DGAGAVLLMKRSLA+QKGLPILGVFR
Sbjct  181   DGIRPDTNTAGLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLALQKGLPILGVFR  240

Query  1070  TFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEK  1249
             +FAAVGVDPAVMGIGPAVAIPAAVKSAGLE+DDIDLFEINEAFASQ++Y  KKLGLD EK
Sbjct  241   SFAAVGVDPAVMGIGPAVAIPAAVKSAGLEIDDIDLFEINEAFASQFVYSCKKLGLDREK  300

Query  1250  INVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDA  1429
             +NVNGGA+A+GHPLG TGARCV TLL+EMKRRGKDCR+GV+SMCIGTGMGAA VFERGD 
Sbjct  301   VNVNGGAIALGHPLGVTGARCVGTLLYEMKRRGKDCRFGVISMCIGTGMGAAAVFERGDC  360

Query  1430  CDELSNARKVE  1462
              DEL NAR V+
Sbjct  361   VDELCNARAVK  371



>dbj|BAD95031.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
Length=343

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/343 (87%), Positives = 317/343 (92%), Gaps = 0/343 (0%)
 Frame = +2

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  643
             AFYAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSV
Sbjct  1     AFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSV  60

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             NP      QAQNCLLPMG+TSENVA RFGV+RQEQDQAAV+SHRKAAAATAAGKFKDEII
Sbjct  61    NPAVKKFAQAQNCLLPMGVTSENVAQRFGVSRQEQDQAAVDSHRKAAAATAAGKFKDEII  120

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PV TK+V+PKTGDE  +T+SVDDGIRP  ++  L KLKPVFKKDGTTTAGNSSQV+DGAG
Sbjct  121   PVKTKLVDPKTGDEKPITVSVDDGIRPTTTLASLGKLKPVFKKDGTTTAGNSSQVSDGAG  180

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLLMKRS+A+QKGLP+LGVFRTFAAVGVDPA+MGIGPAVAIPAAVK+AGLELDDIDLFE
Sbjct  181   AVLLMKRSVAMQKGLPVLGVFRTFAAVGVDPAIMGIGPAVAIPAAVKAAGLELDDIDLFE  240

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQ++YC+ KLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCR+
Sbjct  241   INEAFASQFVYCRNKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRF  300

Query  1364  GVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             GVVSMCIGTGMGAA VFERGD  DEL NARKVE  G LSKDAR
Sbjct  301   GVVSMCIGTGMGAAAVFERGDGVDELRNARKVEAQGLLSKDAR  343



>ref|XP_007034450.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
 gb|EOY05376.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
Length=355

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/338 (88%), Positives = 319/338 (94%), Gaps = 0/338 (0%)
 Frame = +2

Query  476   GFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRA  655
             G  ETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEGSVNPR 
Sbjct  17    GDTETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEGSVNPRV  76

Query  656   STLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTT  835
               ++QAQNCLLPMG+TSENVAHRFGVTRQEQDQAAVESHRKAAAATA+GKFKDEIIPVTT
Sbjct  77    KQMEQAQNCLLPMGVTSENVAHRFGVTRQEQDQAAVESHRKAAAATASGKFKDEIIPVTT  136

Query  836   KIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLL  1015
             KIV+PKTGDE  VTISVDDGIRPN S+ DLAKL+PVFKKDG+TTAGNSSQV+DGAGAVLL
Sbjct  137   KIVDPKTGDEKPVTISVDDGIRPNTSLSDLAKLRPVFKKDGSTTAGNSSQVSDGAGAVLL  196

Query  1016  MKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEA  1195
             MKRS+A+ KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDL+EINEA
Sbjct  197   MKRSVAMLKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDLYEINEA  256

Query  1196  FASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVS  1375
             FASQ++YC+KKL LDP+KINVNG AMAIGHPLGATGARCVATLLHEMKRRGKDCR+GV+S
Sbjct  257   FASQFVYCRKKLELDPKKINVNGAAMAIGHPLGATGARCVATLLHEMKRRGKDCRFGVIS  316

Query  1376  MCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             MCIGTGMGAA VFERGD  DEL NARKVET+ +LSKDA
Sbjct  317   MCIGTGMGAAAVFERGDHTDELCNARKVETNSFLSKDA  354



>ref|XP_005646163.1| thiolase [Coccomyxa subellipsoidea C-169]
 gb|EIE21619.1| thiolase [Coccomyxa subellipsoidea C-169]
Length=470

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/458 (63%), Positives = 366/458 (80%), Gaps = 3/458 (1%)
 Frame = +2

Query  119   RQRVLLQHLRPT-NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLC  295
             RQ+VLL HLRP  N  ++ + ++  + AS CAAGDSAAY+R +   DD+VIV+A RTP+ 
Sbjct  13    RQQVLLNHLRPAGNTEAAFERMQ--LQASACAAGDSAAYERRASGPDDVVIVSALRTPIT  70

Query  296   KSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYA  475
             K+KRGGFKDT PDDL+A+V +A +++T +NP+++GDI++G+VL   S RA + R+A F A
Sbjct  71    KAKRGGFKDTLPDDLMAAVFQATLDRTGINPADIGDIVIGSVLGDSSQRAIQVRIAGFLA  130

Query  476   GFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRA  655
             G PE V V TVNRQCSSGLQA+A VAAAI+AG+Y+IG+  G+E+M+ N MAW+G VNP+ 
Sbjct  131   GIPENVAVHTVNRQCSSGLQAIASVAAAIQAGYYEIGLAGGVETMSTNPMAWDGGVNPKI  190

Query  656   STLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTT  835
             +  Q+AQ+CLLPMG+TSENVA ++G+TR++QD+ A  SH++AAAA  +G+FKDEI+PV T
Sbjct  191   ADNQKAQDCLLPMGVTSENVAEKYGITRKDQDELAARSHKRAAAARGSGRFKDEIVPVKT  250

Query  836   KIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLL  1015
                +PKTG+E  + +S DDGIRP  +   L  L+ VFKK+GTTTAGNSSQ++DGA AVLL
Sbjct  251   VWKDPKTGEEKEIVVSEDDGIRPGVTAAALGGLRAVFKKNGTTTAGNSSQISDGAAAVLL  310

Query  1016  MKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEA  1195
             MKR  A ++GLP+LG+FR+FAAVGVDPAVMGIGPAVAIPAAV+ AGL +DDID+FE+NEA
Sbjct  311   MKRREAAKRGLPVLGIFRSFAAVGVDPAVMGIGPAVAIPAAVQKAGLSIDDIDVFELNEA  370

Query  1196  FASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVS  1375
             FASQ  YC KKLGLDPE++N NGGA+A+GHPLG TGARC ATLLHEM +RGK  R+GVVS
Sbjct  371   FASQATYCVKKLGLDPERVNPNGGAVALGHPLGCTGARCTATLLHEMNKRGKASRFGVVS  430

Query  1376  MCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             MCIG+GMGAA VFERG   D L NA      G+LS DA
Sbjct  431   MCIGSGMGAAAVFERGGEVDALRNAAPTHAQGFLSHDA  468



>gb|AFW74041.1| hypothetical protein ZEAMMB73_080325 [Zea mays]
Length=407

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/378 (78%), Positives = 343/378 (91%), Gaps = 3/378 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4     AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61    ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             +AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAG+YDIGIGAGLESM++N++AWEG VNP
Sbjct  121   FAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGYYDIGIGAGLESMSINSIAWEGQVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             + S  Q+AQ+CLLPMGITSENVAHR+GVTRQEQDQAA ESHR+AAAATA+GKFKDEI+PV
Sbjct  181   KISAFQKAQDCLLPMGITSENVAHRYGVTRQEQDQAAAESHRRAAAATASGKFKDEIVPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E  V ISVDDGIRP  +   LAKLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  241   PTKIVDPKTGEEKEVVISVDDGIRPGTTASGLAKLKPVFKKDGTTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE+ DIDLFE+N
Sbjct  301   LLMKRSVALKKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLEIGDIDLFELN  360

Query  1190  EAFASQYLYCQKKLGLDP  1243
             EAFASQ++YC  KLGLDP
Sbjct  361   EAFASQFVYCCNKLGLDP  378



>dbj|BAJ85217.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87964.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   583 bits (1502),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/398 (74%), Positives = 343/398 (86%), Gaps = 3/398 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A++RQR+LL+HL P   A+  +   S+VSASVCAAGDSAAY R   + DDIVIVAAYRT 
Sbjct  4     ALDRQRILLRHLEP---AAGANPTASAVSASVCAAGDSAAYHRGPCFADDIVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRG FKDT P+DLL  V KAL+EKT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61    ICKAKRGSFKDTLPEDLLVPVFKALVEKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP+TVP++TVNRQCSSGLQAVADVAAAIKAG YDIGI AG+ESMTVN +   G VNP
Sbjct  121   YAGFPDTVPLKTVNRQCSSGLQAVADVAAAIKAGMYDIGIAAGVESMTVNKVDLVGKVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMG+TSENVA RFG+TR EQDQAAVESHRKAAAA AAGKFK+EI+PV
Sbjct  181   KVELFAQARDCLLPMGLTSENVAQRFGITRMEQDQAAVESHRKAAAAVAAGKFKEEIVPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E  + +S DDGIR N ++  L+KLKP F KDGTTTAGN+SQV+DGAGAV
Sbjct  241   HTKIVDPKTGEEKEIVVSADDGIRSNTTLAVLSKLKPAFSKDGTTTAGNASQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLM+R +A QKGLPILG++R+FAAVGVDPAVMG+GPAVAIPAAVK+AGL+++D+DLFEIN
Sbjct  301   LLMRRDVATQKGLPILGIYRSFAAVGVDPAVMGVGPAVAIPAAVKAAGLQINDVDLFEIN  360

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATG  1303
             EAFASQY+YC KKL LDP K+NVNGGA+A+GHPLGATG
Sbjct  361   EAFASQYVYCSKKLDLDPAKVNVNGGAIALGHPLGATG  398



>gb|ABK94786.1| unknown [Populus trichocarpa]
Length=346

 Score =   580 bits (1494),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 288/346 (83%), Positives = 322/346 (93%), Gaps = 1/346 (0%)
 Frame = +2

Query  458   MAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG  637
             MAAFYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFY+IGIGAGLESMT+N M+W+G
Sbjct  1     MAAFYAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYEIGIGAGLESMTINQMSWDG  60

Query  638   SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDE  817
              VNP+    Q+AQ+CLLPMGITSENVAHRFGVTRQEQDQAAV+SHRKAAAATA+G+FKDE
Sbjct  61    DVNPKLKNFQKAQDCLLPMGITSENVAHRFGVTRQEQDQAAVDSHRKAAAATASGRFKDE  120

Query  818   IIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDG  997
             IIPV TKIV+PKTGDE  + +SVDDGIRP  S+  L KLK VFKKDGTTTAGNSSQ++DG
Sbjct  121   IIPVATKIVDPKTGDEKPIVVSVDDGIRPETSVAGLGKLKTVFKKDGTTTAGNSSQISDG  180

Query  998   AGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDL  1177
             AGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLEL+DIDL
Sbjct  181   AGAVLLMKRSVAVQKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELEDIDL  240

Query  1178  FEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDC  1357
             FEINEAFASQ++YC+KKL LDP+KINVNGGAMAIGHPLGATGARCVATLLHEMKRRG+DC
Sbjct  241   FEINEAFASQFVYCRKKLELDPQKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGRDC  300

Query  1358  RYGVVSMCIGTGMGAAGVFERGDACDELSN-ARKVETHGYLSKDAR  1492
             R+GVVSMCIGTGMGAA VFERGD CDEL N  RKVE++  LS+D+R
Sbjct  301   RFGVVSMCIGTGMGAAAVFERGDGCDELCNGGRKVESNNLLSRDSR  346



>ref|XP_007034451.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
 gb|EOY05377.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
Length=326

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/344 (83%), Positives = 309/344 (90%), Gaps = 19/344 (6%)
 Frame = +2

Query  458   MAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG  637
             MAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N MAWEG
Sbjct  1     MAAFYAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPMAWEG  60

Query  638   SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDE  817
             SVNPR   ++QAQNCLLPMG+TSENVAHRFGVTRQEQDQAAVESHRKAAAATA+GKFKDE
Sbjct  61    SVNPRVKQMEQAQNCLLPMGVTSENVAHRFGVTRQEQDQAAVESHRKAAAATASGKFKDE  120

Query  818   IIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDG  997
             IIPVTTKIV+PKTGDE  VTISVDDGIRPN S+ DLAKL+PVFKKDG+TTAGNSSQV+DG
Sbjct  121   IIPVTTKIVDPKTGDEKPVTISVDDGIRPNTSLSDLAKLRPVFKKDGSTTAGNSSQVSDG  180

Query  998   AGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDL  1177
             AGAVLLMKRS+A+ KGLPILGVFRTFAAVGVDPA+MG+GPAVAIPAAVK+AGLELDDIDL
Sbjct  181   AGAVLLMKRSVAMLKGLPILGVFRTFAAVGVDPAIMGVGPAVAIPAAVKAAGLELDDIDL  240

Query  1178  FEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDC  1357
             +EINEAFASQ++YC+KKL LDP                   GARCVATLLHEMKRRGKDC
Sbjct  241   YEINEAFASQFVYCRKKLELDP-------------------GARCVATLLHEMKRRGKDC  281

Query  1358  RYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             R+GV+SMCIGTGMGAA VFERGD  DEL NARKVET+ +LSKDA
Sbjct  282   RFGVISMCIGTGMGAAAVFERGDHTDELCNARKVETNSFLSKDA  325



>gb|AFW74040.1| hypothetical protein ZEAMMB73_080325 [Zea mays]
Length=378

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/361 (78%), Positives = 328/361 (91%), Gaps = 3/361 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4     AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61    ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             +AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAG+YDIGIGAGLESM++N++AWEG VNP
Sbjct  121   FAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGYYDIGIGAGLESMSINSIAWEGQVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             + S  Q+AQ+CLLPMGITSENVAHR+GVTRQEQDQAA ESHR+AAAATA+GKFKDEI+PV
Sbjct  181   KISAFQKAQDCLLPMGITSENVAHRYGVTRQEQDQAAAESHRRAAAATASGKFKDEIVPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG+E  V ISVDDGIRP  +   LAKLKPVFKKDGTTTAGNSSQV+DGAGAV
Sbjct  241   PTKIVDPKTGEEKEVVISVDDGIRPGTTASGLAKLKPVFKKDGTTTAGNSSQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRS+A++KGLPILGVFR+FAAVGVDPAVMG+GPAVAIPAAVKSAGLE+ DIDLFE+N
Sbjct  301   LLMKRSVALKKGLPILGVFRSFAAVGVDPAVMGVGPAVAIPAAVKSAGLEIGDIDLFELN  360

Query  1190  E  1192
             E
Sbjct  361   E  361



>ref|XP_002989683.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
 gb|EFJ09160.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
Length=408

 Score =   557 bits (1436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/392 (72%), Positives = 333/392 (85%), Gaps = 1/392 (0%)
 Frame = +2

Query  254   DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  433
             DD+VIVAA+RTP+CK+KRGGFKD++P+DLL  VLKA++  T + P+EVGDI+VGTV+APG
Sbjct  16    DDVVIVAAFRTPICKAKRGGFKDSFPEDLLVPVLKAVVAHTGVIPAEVGDIVVGTVIAPG  75

Query  434   SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  613
             S RA+ECR+AA  AGFP+TVPVRTVNRQCSSGLQAV DVAAAIK+GFY+IGIGAG+E M+
Sbjct  76    SHRAAECRIAALLAGFPDTVPVRTVNRQCSSGLQAVGDVAAAIKSGFYEIGIGAGVECMS  135

Query  614   VNT-MAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaa  790
             ++  +  +  VNP+      A++CLLPMGITSENVA R+G+TR+EQD+AAV SHR AAAA
Sbjct  136   IDFGVQQQPRVNPQVELNSMAKDCLLPMGITSENVAERYGITREEQDEAAVVSHRNAAAA  195

Query  791   taaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTA  970
              A+G+FKDEI PV TK V+  T + T   ISVDDG+RP+ ++G LA+LKP FK  GT+TA
Sbjct  196   IASGRFKDEITPVKTKRVDATTEEVTESVISVDDGVRPDTTLGVLARLKPAFKSGGTSTA  255

Query  971   GNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSA  1150
             GNSSQV+DGAGAVLLMKRS A Q+GLP+LG FR+FA VGV+P VMGIGPAVAIP A+K A
Sbjct  256   GNSSQVSDGAGAVLLMKRSCASQRGLPVLGAFRSFAVVGVEPGVMGIGPAVAIPKAIKDA  315

Query  1151  GLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLH  1330
             GLE+ DI LFEINEAFASQY YC KKL LDP K+NVNGGA+A+GHPLGATGARCVATLLH
Sbjct  316   GLEISDIHLFEINEAFASQYTYCCKKLQLDPAKVNVNGGAIALGHPLGATGARCVATLLH  375

Query  1331  EMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  1426
             EM +RG  CRYGVVSMCIGTGMGAA VFERGD
Sbjct  376   EMAKRGSACRYGVVSMCIGTGMGAAAVFERGD  407



>gb|KDO65876.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
 gb|KDO65877.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
Length=374

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/363 (78%), Positives = 319/363 (88%), Gaps = 3/363 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4     ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61    ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN+++  G VNP
Sbjct  121   YAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMGITSENVA RFGVTRQEQD AAVESHR+AAAATA+GKFKDEIIPV
Sbjct  181   KVEIFTQARDCLLPMGITSENVAQRFGVTRQEQDLAAVESHRRAAAATASGKFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG E  VTISVDDGIRPN +I DLAKLKP FKKDGTTTAGN+SQV+DGAGAV
Sbjct  241   NTKIVDPKTGVEKRVTISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             LLMKRSLA+QKGLPILGVFR+F+AVGVDP+VMGIGPAVAIPAAVKSAGL++DDI+LFEIN
Sbjct  301   LLMKRSLAVQKGLPILGVFRSFSAVGVDPSVMGIGPAVAIPAAVKSAGLQIDDINLFEIN  360

Query  1190  EAF  1198
             E  
Sbjct  361   EVL  363



>ref|XP_002991797.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
 gb|EFJ07201.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
Length=395

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/395 (70%), Positives = 330/395 (84%), Gaps = 4/395 (1%)
 Frame = +2

Query  245   VYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVL  424
             +  DD+VIVAA+RTP+CK+KRGGFKD++P+DLL  VLKA++  T + P++VGDI+VGTV+
Sbjct  3     ISSDDVVIVAAFRTPICKAKRGGFKDSFPEDLLVPVLKAVVAHTGVIPADVGDIVVGTVI  62

Query  425   APGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLE  604
             APGS RA+ECR+AA  AGFP+TVPVRTVNRQCSSGLQAV DVAAAIK+GFY+IGIGAG+E
Sbjct  63    APGSHRAAECRIAALLAGFPDTVPVRTVNRQCSSGLQAVGDVAAAIKSGFYEIGIGAGVE  122

Query  605   SMTVNT-MAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKa  781
              M+++  +  +  VNP+      A++CLLPMGITSENVA R+G+TR+EQD+AAV SH+ A
Sbjct  123   CMSIDFGVQQQPRVNPQVELNSMAKDCLLPMGITSENVAERYGITREEQDEAAVVSHQNA  182

Query  782   aaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGT  961
             AAA A+G+FKDEI PV TK V+  T + T   ISVDDG+RP+ ++  LA+LKP FK  GT
Sbjct  183   AAAIASGRFKDEITPVKTKRVDATTEEVTESVISVDDGVRPDTTLSVLARLKPAFKSGGT  242

Query  962   TTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAV  1141
             +TAGNSSQV+DGAGAVLLMKRS A Q+GLP+LG FR+FA VGV+P VMGIGPAVAIP AV
Sbjct  243   STAGNSSQVSDGAGAVLLMKRSCATQRGLPVLGAFRSFAVVGVEPGVMGIGPAVAIPKAV  302

Query  1142  KSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVAT  1321
             K AGLE+ DI LFEINEAFASQY YC KKL LDP K+NVNGGA+A+GHPL   GARCVAT
Sbjct  303   KDAGLEISDIHLFEINEAFASQYTYCCKKLQLDPAKVNVNGGAIALGHPL---GARCVAT  359

Query  1322  LLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  1426
             LLHEM +RG  CRYGVVSMCIGTGMGAA VFERGD
Sbjct  360   LLHEMAKRGSACRYGVVSMCIGTGMGAAAVFERGD  394



>gb|ACU21519.1| unknown [Glycine max]
Length=349

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/347 (79%), Positives = 310/347 (89%), Gaps = 2/347 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             AI RQ++LL HL P+++    +S  SS+ AS C AGDSAAYQR S +GDD+VIVAAYRT 
Sbjct  4     AINRQKILLHHLNPSSSTHPNES--SSLHASACVAGDSAAYQRTSTFGDDVVIVAAYRTA  61

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
              CK+KRGGFKDT PDDLLA VLKA+IEKTN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62    HCKAKRGGFKDTLPDDLLAPVLKAVIEKTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N M W+GSVNP
Sbjct  122   YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTNPMGWDGSVNP  181

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +Q QNCLLPMGITSENVA RFGV+R+EQDQAAVESHR+AAAATAAGKFKDEI+PV
Sbjct  182   KVKMFEQVQNCLLPMGITSENVAQRFGVSRKEQDQAAVESHRRAAAATAAGKFKDEIVPV  241

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             TTKIV+PKTG+E +VTISVDDG RP  ++ DL +LKPVFKKDG+TTAGNSSQVTDGA AV
Sbjct  242   TTKIVDPKTGEEKSVTISVDDGSRPGTTVSDLGRLKPVFKKDGSTTAGNSSQVTDGASAV  301

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSA  1150
             LLMKRS+A+QKGLPILGVFRTFAAVGVDPA+MG+GPA AIP AVK+A
Sbjct  302   LLMKRSVALQKGLPILGVFRTFAAVGVDPAIMGVGPAAAIPVAVKAA  348



>gb|AFW68657.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=345

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/344 (78%), Positives = 308/344 (90%), Gaps = 0/344 (0%)
 Frame = +2

Query  458   MAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEG  637
             MAA YAGFP+TVP++TVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN ++ +G
Sbjct  1     MAALYAGFPDTVPLKTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNKVSLDG  60

Query  638   SVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDE  817
               NP+     QA++CLLPMG+TSENVAHRFG+TR EQDQAAVESHRKAAAA AAGKFK+E
Sbjct  61    QANPKVELFSQARDCLLPMGLTSENVAHRFGITRLEQDQAAVESHRKAAAAAAAGKFKEE  120

Query  818   IIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDG  997
             I+PV TKIV+PKTG+E  + IS DDGIR + S+  L+KLKP F KDG+TTAGN+SQV+DG
Sbjct  121   IVPVHTKIVDPKTGEEKKIVISADDGIRVDTSLAVLSKLKPAFSKDGSTTAGNASQVSDG  180

Query  998   AGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDL  1177
             AGAVLLM+R +A++KGLP+LGVFRTFAAVGVDPAVMGIGPAVAIPAAVK+AGL++DDIDL
Sbjct  181   AGAVLLMRRDVAMKKGLPVLGVFRTFAAVGVDPAVMGIGPAVAIPAAVKAAGLQMDDIDL  240

Query  1178  FEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDC  1357
             FEINEAFASQY+YC KKL LDP K+NVNGGAMA+GHPLGATGARCV+TLL+EMKRRGKDC
Sbjct  241   FEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALGHPLGATGARCVSTLLNEMKRRGKDC  300

Query  1358  RYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             R+GV+SMCIG+GMGAA VFERGD  DEL+NAR + TH +LSKDA
Sbjct  301   RFGVISMCIGSGMGAAAVFERGDGVDELTNARGISTHNWLSKDA  344



>ref|XP_002946078.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
 gb|EFJ53073.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
Length=462

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/458 (63%), Positives = 359/458 (78%), Gaps = 8/458 (2%)
 Frame = +2

Query  119   RQRVLLQHLRPT-NAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLC  295
             R  VL +H+ P  N    L       S   C+AGDSAAY+R++   DD+VIVAA RTPL 
Sbjct  10    RLSVLAKHICPVPNGVQGL-------SLQGCSAGDSAAYERHNTADDDVVIVAALRTPLT  62

Query  296   KSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYA  475
             K++RGG KDT   DLLA+V KA++++T + P  +GDI++G+VL P S RA+ECR+A+F+A
Sbjct  63    KARRGGLKDTDAVDLLATVFKAVLDRTGVEPQAIGDIVIGSVLGPSSQRANECRIASFFA  122

Query  476   GFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRA  655
             G PETVPVRTVNRQCSSGLQA+ADVAAAI+AGFY +G+  G+E+M++N MAWEG +NPR 
Sbjct  123   GIPETVPVRTVNRQCSSGLQAIADVAAAIRAGFYTVGLAGGVETMSLNPMAWEGGINPRI  182

Query  656   STLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTT  835
                  AQ C++PMG+TSENVA +FG+ R+ QD+ AV SHRKAAAA AAGKFKDEI+PV+T
Sbjct  183   ENFPGAQGCMMPMGVTSENVAAKFGIDRKSQDEFAVRSHRKAAAAKAAGKFKDEIVPVST  242

Query  836   KIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLL  1015
             K+ +PK G ET V +S DDG+R + ++  L+ LKP F+K+GTTTAGNSSQVTDGA AVL+
Sbjct  243   KVKDPKMGAETPVVVSEDDGVRGSTTVESLSGLKPAFRKNGTTTAGNSSQVTDGAAAVLM  302

Query  1016  MKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEA  1195
             M R+ A ++GLPILG+FR+FAAVGVDP++MGIGPAVAIP AV  AGL LDDID++EINEA
Sbjct  303   MTRAEAHRRGLPILGIFRSFAAVGVDPSIMGIGPAVAIPEAVARAGLSLDDIDVYEINEA  362

Query  1196  FASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVS  1375
             FASQ  YC  KLG+D  K+N NGGA+A+GHPLGATGARC ATLLHE++RRG+  R+GVVS
Sbjct  363   FASQASYCVAKLGIDENKVNPNGGAIAMGHPLGATGARCTATLLHELRRRGRGSRFGVVS  422

Query  1376  MCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             MCIG+GMGAA VFE G   D+   AR V+    LSKDA
Sbjct  423   MCIGSGMGAAAVFETGGEVDKFMTARAVKGQVLLSKDA  460



>gb|KJB10129.1| hypothetical protein B456_001G185200 [Gossypium raimondii]
Length=371

 Score =   528 bits (1360),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/362 (76%), Positives = 315/362 (87%), Gaps = 1/362 (0%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ RQRVLL HLRP++++SS     +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4     ALNRQRVLLHHLRPSSSSSSSHESAATLFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  63

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  64    ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  123

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMA-WEGSVN  646
             YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT + +      VN
Sbjct  124   YAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTTDKVVPGVPKVN  183

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
             P+  +  QA++CLLPMGITSENVA  +GVTRQEQDQAAVESHR+AAAATA+GKFKDEI+P
Sbjct  184   PKVESFAQARDCLLPMGITSENVAEHYGVTRQEQDQAAVESHRRAAAATASGKFKDEIVP  243

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             V TKIV+PKTG+E   TI VDDGIRPN ++ DLAKLKP FKKDGTTTAGN+SQV+DGAGA
Sbjct  244   VLTKIVDPKTGEEKAATIMVDDGIRPNTNMADLAKLKPAFKKDGTTTAGNASQVSDGAGA  303

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
              LLMKRSLA+QKG PILGVFR+FAAVGVDPAVMGIGPAVAIPAA+KSAGLELDDIDLFEI
Sbjct  304   ALLMKRSLAMQKGFPILGVFRSFAAVGVDPAVMGIGPAVAIPAAIKSAGLELDDIDLFEI  363

Query  1187  NE  1192
             NE
Sbjct  364   NE  365



>gb|AEQ94132.1| putative 3-ketoacyl CoA thiolase [Elaeis guineensis]
Length=324

 Score =   521 bits (1342),  Expect = 5e-179, Method: Compositional matrix adjust.
 Identities = 260/324 (80%), Positives = 298/324 (92%), Gaps = 0/324 (0%)
 Frame = +2

Query  218   DSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEV  397
             DSAAYQR+S +GDD+V+VAAYRTP+CKSKRGGFKDT+P+DLLA+VLK L++KT LNP+EV
Sbjct  1     DSAAYQRSSSFGDDVVVVAAYRTPICKSKRGGFKDTHPEDLLATVLKGLLDKTKLNPNEV  60

Query  398   GDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFY  577
              DI+VGTVLAPGS RA+ECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAA+IKAGFY
Sbjct  61    SDIVVGTVLAPGSQRATECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAASIKAGFY  120

Query  578   DIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQA  757
             DIGIGAGLESMT N ++WEGS+NP+  TLQQAQ+CLLPMGITSENVA R+GVTRQEQD A
Sbjct  121   DIGIGAGLESMTANVVSWEGSINPKVKTLQQAQDCLLPMGITSENVARRYGVTRQEQDWA  180

Query  758   AVESHRKaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLK  937
             AVESHR+AAAATA+GKF+DEI+PV TKIV+PKTG+E  VTIS+DDGIRP  S+  LAKL 
Sbjct  181   AVESHRRAAAATASGKFRDEIVPVVTKIVDPKTGEEKQVTISMDDGIRPETSLSGLAKLT  240

Query  938   PVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGP  1117
             PVF+KDG+TTAGNSSQV+DGA AVLLM+R +AI+KG  I GVFR+FAAVGVDPAVMGIGP
Sbjct  241   PVFQKDGSTTAGNSSQVSDGAAAVLLMRRDVAIKKGFSIFGVFRSFAAVGVDPAVMGIGP  300

Query  1118  AVAIPAAVKSAGLELDDIDLFEIN  1189
             AVAIPAAVKSAGL+++DIDLFE  
Sbjct  301   AVAIPAAVKSAGLQIEDIDLFEFK  324



>gb|KDO65879.1| hypothetical protein CISIN_1g0125222mg, partial [Citrus sinensis]
Length=335

 Score =   516 bits (1328),  Expect = 1e-176, Method: Compositional matrix adjust.
 Identities = 268/321 (83%), Positives = 295/321 (92%), Gaps = 1/321 (0%)
 Frame = +2

Query  338   LLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQ  517
             LL SV +A+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAFYAGFPETVP+RTVNRQ
Sbjct  16    LLFSV-QAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAFYAGFPETVPLRTVNRQ  74

Query  518   CSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMG  697
             CSSGLQAVADVA AIKAG YDIGI AGLESMTVN+++  G VNP+     QA++CLLPMG
Sbjct  75    CSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQVNPKVEIFTQARDCLLPMG  134

Query  698   ITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTTKIVNPKTGDETTVT  877
             ITSENVA RFGVTRQEQD AAVESHR+AAAATA+GKFKDEIIPV TKIV+PKTG E  VT
Sbjct  135   ITSENVAQRFGVTRQEQDLAAVESHRRAAAATASGKFKDEIIPVNTKIVDPKTGVEKRVT  194

Query  878   ISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPIL  1057
             ISVDDGIRPN +I DLAKLKP FKKDGTTTAGN+SQV+DGAGAVLLMKRSLA+QKGLPIL
Sbjct  195   ISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAVLLMKRSLAVQKGLPIL  254

Query  1058  GVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGL  1237
             GVFR+F+AVGVDP+VMGIGPAVAIPAAVKSAGL++DDI+LFEINEAFASQY+YC KKLGL
Sbjct  255   GVFRSFSAVGVDPSVMGIGPAVAIPAAVKSAGLQIDDINLFEINEAFASQYVYCIKKLGL  314

Query  1238  DPEKINVNGGAMAIGHPLGAT  1300
             DPEK+NVNGGA+A+GHPLGAT
Sbjct  315   DPEKVNVNGGAVALGHPLGAT  335



>gb|AFK34605.1| unknown [Lotus japonicus]
Length=296

 Score =   510 bits (1314),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 251/294 (85%), Positives = 274/294 (93%), Gaps = 1/294 (0%)
 Frame = +2

Query  608   MTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaa  787
             MT N M WEGSVNP+    +QAQNCLLPMGITSENVAHRFGV+R+EQDQAAVESHR+AAA
Sbjct  1     MTSNPMGWEGSVNPKVKEFEQAQNCLLPMGITSENVAHRFGVSRKEQDQAAVESHRRAAA  60

Query  788   ataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTT  967
             ATAAGKFKDEIIPVTTKIV+PKTG+E +VTISVDDGIRPNA++ DLAKLKPVFKKDGTTT
Sbjct  61    ATAAGKFKDEIIPVTTKIVDPKTGEEKSVTISVDDGIRPNATVSDLAKLKPVFKKDGTTT  120

Query  968   AGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKS  1147
             AGNSSQV+DGAGAVLLMKRS+A+QKGLPILGVFRTFAAVGVDPAVMG+GPA AIP AVK+
Sbjct  121   AGNSSQVSDGAGAVLLMKRSVAMQKGLPILGVFRTFAAVGVDPAVMGVGPAAAIPVAVKA  180

Query  1148  AGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLL  1327
             AGLELDDIDLFEINEAFASQ++YC+ KLGLD EKINVNGGAMAIGHPLGATGARCVATLL
Sbjct  181   AGLELDDIDLFEINEAFASQFVYCRNKLGLDLEKINVNGGAMAIGHPLGATGARCVATLL  240

Query  1328  HEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             HEMKRRG+DCR+GV+SMCIGTGMGAA VFERGD  DEL NARKV+   +LSKDA
Sbjct  241   HEMKRRGRDCRFGVISMCIGTGMGAAAVFERGDGVDELRNARKVDNL-HLSKDA  293



>ref|XP_007049827.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
 gb|EOX93984.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
Length=376

 Score =   509 bits (1312),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 271/367 (74%), Positives = 314/367 (86%), Gaps = 6/367 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  274
             A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4     ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  275   AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  454
             A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64    ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  455   RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWE  634
             RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA  IKAG YDIGI AGLESMT + +   
Sbjct  124   RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVALCIKAGLYDIGIAAGLESMTTDKVVPG  183

Query  635   GS-VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFK  811
              S VNP+  +  QA++CLLPMGITSENVA R+GVTRQEQDQAAVESHR+AAAATA+GKFK
Sbjct  184   VSKVNPQVESFAQARDCLLPMGITSENVAQRYGVTRQEQDQAAVESHRRAAAATASGKFK  243

Query  812   DEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVT  991
             DEIIPV+TKIV+PKTG+E  VTI VDDGIRPN ++ DLAKLKP F+KDG TTAGN+SQV+
Sbjct  244   DEIIPVSTKIVDPKTGEEKPVTIVVDDGIRPNTNMADLAKLKPAFRKDGATTAGNASQVS  303

Query  992   DGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDI  1171
             DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAG+EL DI
Sbjct  304   DGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGIELADI  363

Query  1172  DLFEINE  1192
             DLFEINE
Sbjct  364   DLFEINE  370



>ref|XP_001697225.1| acetyl-CoA acyltransferase [Chlamydomonas reinhardtii]
 gb|EDP00480.1| acetyl-CoA acyltransferase [Chlamydomonas reinhardtii]
Length=461

 Score =   508 bits (1308),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 285/435 (66%), Positives = 347/435 (80%), Gaps = 1/435 (0%)
 Frame = +2

Query  188   SVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALI  367
             S+S   C+AGDSAAY+R +   DD+VIVA+ RTPL K+KRGG +DT   DLL+++ KA++
Sbjct  25    SLSLQTCSAGDSAAYERRNTADDDVVIVASLRTPLTKAKRGGLRDTDAADLLSTLFKAVL  84

Query  368   EKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavad  547
             E+T + P  +GDI++G+VL P S RA+ECR+A+F+AG P+ VPVRTVNRQCSSGLQA+AD
Sbjct  85    ERTGVEPQAIGDIVIGSVLGPSSQRANECRIASFFAGIPDVVPVRTVNRQCSSGLQAIAD  144

Query  548   vaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRF  727
             VAAAIKAGFY +G+  G+E+M+ N MAWEG +NPR      A +C+LPMG+TSENVA ++
Sbjct  145   VAAAIKAGFYTVGLAGGVETMSSNPMAWEGGINPRVGDFPGAASCMLPMGVTSENVAAKY  204

Query  728   GVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPN  907
             GV R+ QD+ AV SH+KAAAA AAGKFKDEI+PV TK+V+PKTG ET +TIS DDGIR +
Sbjct  205   GVDRKTQDEFAVRSHKKAAAARAAGKFKDEIVPVATKLVDPKTGAETKITISEDDGIRGS  264

Query  908   ASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVG  1087
              ++  L  LK VFKK+GTTTAGNSSQVTDGA   L+M R+ A ++GLPILGVFR FAAVG
Sbjct  265   TTMETLGALKAVFKKNGTTTAGNSSQVTDGAAVALMMTRAEATRRGLPILGVFRAFAAVG  324

Query  1088  VDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGG  1267
             VDPA+MG+GPAVAIPAAV  AGL LDDID+FEINEAFASQ  Y   KLGLD  K+N NGG
Sbjct  325   VDPAIMGVGPAVAIPAAVARAGLSLDDIDVFEINEAFASQAFYSITKLGLDEAKVNPNGG  384

Query  1268  AMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSN  1447
             A+A+GHPLGATGARC ATLLHEM+RRG+  R+GVVSMCIG+GMGAA VFE G   D L+ 
Sbjct  385   AIALGHPLGATGARCTATLLHEMRRRGRAARFGVVSMCIGSGMGAAAVFEAGGETDALAT  444

Query  1448  ARKVE-THGYLSKDA  1489
             AR V      LSKDA
Sbjct  445   ARAVAGPQQLLSKDA  459



>ref|XP_011400620.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
 gb|KFM27633.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
Length=455

 Score =   503 bits (1294),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 267/459 (58%), Positives = 335/459 (73%), Gaps = 12/459 (3%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A +RQ+VLL HL   +    +    +S  +    AGD           DD+VIV+  RT 
Sbjct  4     AAQRQKVLLSHLASAHGTPEVAPQPTSAESHDRRAGDL----------DDVVIVSTCRTA  53

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             LC+++RGGFKDT  DDL+A+VLK  + +T + P  VGDI+ G+V+ P S RA+E RMA  
Sbjct  54    LCRARRGGFKDTPVDDLIAAVLKDTLRRTGIEPEAVGDIVFGSVMGPSSQRANELRMAML  113

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             +AGFP TVPV T+NRQCSSGLQA+A VAA+IKAG+Y + I  G+E MT N M WEG+VNP
Sbjct  114   FAGFPHTVPVHTLNRQCSSGLQAMASVAASIKAGYYTMAIAGGVEHMTSNPMNWEGTVNP  173

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             R +T Q+A +CL+PMGITSENV+ +FG+TR EQD  A+ SHR AAAA AAGKFK+EI+PV
Sbjct  174   RVATCQEAADCLIPMGITSENVSAQFGMTRAEQDAFALRSHRLAAAARAAGKFKNEIVPV  233

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              T ++    G+E  VTIS DDGIRP  ++  LA LKP FKK G+TTAG+SSQ TDGA AV
Sbjct  234   ET-VLKDANGEERRVTISEDDGIRPEVTLATLAALKPAFKKGGSTTAGSSSQTTDGAAAV  292

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             L+M R  A ++GLP+L +FR+FAAVGV PA+MGIGP  AIP AV+ AGL LDD+D+FEIN
Sbjct  293   LMMTRREARRRGLPVLAIFRSFAAVGVPPAIMGIGPVAAIPEAVRRAGLGLDDVDVFEIN  352

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ LY  KKLGLD E++N NGGA+A+GHPLG TGAR  ATL++EM+RRGK  R+GV
Sbjct  353   EAFASQALYTVKKLGLDLERVNPNGGAIALGHPLGCTGARQAATLINEMQRRGKAARFGV  412

Query  1370  VSMCIGTGMGAAGVFERGDACDELSNARKVE-THGYLSK  1483
             +SMCIG+GMGAA V ER  + D   +AR     H  LS+
Sbjct  413   ISMCIGSGMGAAAVLERDFSDDAERSARPATGVHAGLSR  451



>ref|XP_007049828.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4 [Theobroma cacao]
 gb|EOX93985.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4 [Theobroma cacao]
Length=374

 Score =   496 bits (1276),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 265/361 (73%), Positives = 308/361 (85%), Gaps = 6/361 (2%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  274
             A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4     ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  275   AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  454
             A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64    ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  455   RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWE  634
             RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA  IKAG YDIGI AGLESMT + +   
Sbjct  124   RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVALCIKAGLYDIGIAAGLESMTTDKVVPG  183

Query  635   GS-VNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFK  811
              S VNP+  +  QA++CLLPMGITSENVA R+GVTRQEQDQAAVESHR+AAAATA+GKFK
Sbjct  184   VSKVNPQVESFAQARDCLLPMGITSENVAQRYGVTRQEQDQAAVESHRRAAAATASGKFK  243

Query  812   DEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVT  991
             DEIIPV+TKIV+PKTG+E  VTI VDDGIRPN ++ DLAKLKP F+KDG TTAGN+SQV+
Sbjct  244   DEIIPVSTKIVDPKTGEEKPVTIVVDDGIRPNTNMADLAKLKPAFRKDGATTAGNASQVS  303

Query  992   DGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDI  1171
             DGAGAVLLMKRSLA+QKGLPILGVFR+FAAVGVDPAVMGIGPAVAIPAAVKSAG+EL DI
Sbjct  304   DGAGAVLLMKRSLAMQKGLPILGVFRSFAAVGVDPAVMGIGPAVAIPAAVKSAGIELADI  363

Query  1172  D  1174
             D
Sbjct  364   D  364



>gb|KDO65878.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
Length=320

 Score =   478 bits (1231),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 248/320 (78%), Positives = 278/320 (87%), Gaps = 3/320 (1%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4     ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61    ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFPETVP+RTVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN+++  G VNP
Sbjct  121   YAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVNSISVVGQVNP  180

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +     QA++CLLPMGITSENVA RFGVTRQEQD AAVESHR+AAAATA+GKFKDEIIPV
Sbjct  181   KVEIFTQARDCLLPMGITSENVAQRFGVTRQEQDLAAVESHRRAAAATASGKFKDEIIPV  240

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTG E  VTISVDDGIRPN +I DLAKLKP FKKDGTTTAGN+SQV+DGAGAV
Sbjct  241   NTKIVDPKTGVEKRVTISVDDGIRPNTTIADLAKLKPAFKKDGTTTAGNASQVSDGAGAV  300

Query  1010  LLMKRSLAIQKGLPILGVFR  1069
             LLMKRSLA+QKGLPILGVFR
Sbjct  301   LLMKRSLAVQKGLPILGVFR  320



>gb|AFW68656.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=295

 Score =   469 bits (1207),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 224/294 (76%), Positives = 262/294 (89%), Gaps = 0/294 (0%)
 Frame = +2

Query  608   MTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaa  787
             MTVN ++ +G  NP+     QA++CLLPMG+TSENVAHRFG+TR EQDQAAVESHRKAAA
Sbjct  1     MTVNKVSLDGQANPKVELFSQARDCLLPMGLTSENVAHRFGITRLEQDQAAVESHRKAAA  60

Query  788   ataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTT  967
             A AAGKFK+EI+PV TKIV+PKTG+E  + IS DDGIR + S+  L+KLKP F KDG+TT
Sbjct  61    AAAAGKFKEEIVPVHTKIVDPKTGEEKKIVISADDGIRVDTSLAVLSKLKPAFSKDGSTT  120

Query  968   AGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKS  1147
             AGN+SQV+DGAGAVLLM+R +A++KGLP+LGVFRTFAAVGVDPAVMGIGPAVAIPAAVK+
Sbjct  121   AGNASQVSDGAGAVLLMRRDVAMKKGLPVLGVFRTFAAVGVDPAVMGIGPAVAIPAAVKA  180

Query  1148  AGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLL  1327
             AGL++DDIDLFEINEAFASQY+YC KKL LDP K+NVNGGAMA+GHPLGATGARCV+TLL
Sbjct  181   AGLQMDDIDLFEINEAFASQYVYCCKKLKLDPAKVNVNGGAMALGHPLGATGARCVSTLL  240

Query  1328  HEMKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDA  1489
             +EMKRRGKDCR+GV+SMCIG+GMGAA VFERGD  DEL+NAR + TH +LSKDA
Sbjct  241   NEMKRRGKDCRFGVISMCIGSGMGAAAVFERGDGVDELTNARGISTHNWLSKDA  294



>ref|XP_007513169.1| unknown [Bathycoccus prasinos]
 emb|CCO16727.1| unknown [Bathycoccus prasinos]
Length=448

 Score =   474 bits (1221),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 232/392 (59%), Positives = 307/392 (78%), Gaps = 1/392 (0%)
 Frame = +2

Query  248   YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT-NLNPSEVGDIIVGTVL  424
             + DD+VIV A RTP+ ++++GG KDT  DDL+A+VL A + +T N+N +++GD++VG+VL
Sbjct  56    HPDDVVIVCALRTPITRARKGGLKDTTADDLVATVLAAALRETENINANDIGDVVVGSVL  115

Query  425   APGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLE  604
                S RA+ECR+  F AGFP  VPVRTVNRQCSSGLQA ADVA+AIKAG+Y++GI AG+E
Sbjct  116   GDSSQRANECRIGMFLAGFPVKVPVRTVNRQCSSGLQACADVASAIKAGYYEVGIAAGVE  175

Query  605   SMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaa  784
             +M+ N M W+G  NP+A+++  AQNCL+PMG+TSENVA ++ ++R+ QD  A ESHR+AA
Sbjct  176   TMSKNPMKWDGGFNPKAASVTNAQNCLIPMGVTSENVAAKWHISRETQDAFAAESHRRAA  235

Query  785   aataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTT  964
              A   GKFK +I+PV TKI++ +T +E  + +S DDGIR   ++ +LAKLKPVFKK G+T
Sbjct  236   EARRNGKFKSQIVPVVTKIIDKETKEEKEIVVSEDDGIREGVTVENLAKLKPVFKKGGST  295

Query  965   TAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVK  1144
             TAGN+SQV+DGAG V+L KRS A + GL I+  +++F+AVG  P +MGIGPAVAIP A +
Sbjct  296   TAGNASQVSDGAGVVILCKRSYATKNGLKIMAKWKSFSAVGCPPEIMGIGPAVAIPDACE  355

Query  1145  SAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATL  1324
              AG+++ DI+LFE+NEAFASQ  YC   L L  + +NVNGGA+A+GHPLGATGARC+ATL
Sbjct  356   RAGVKVSDINLFELNEAFASQASYCVNHLKLSKDIVNVNGGAIALGHPLGATGARCMATL  415

Query  1325  LHEMKRRGKDCRYGVVSMCIGTGMGAAGVFER  1420
             LHEM  R   C+ GVVSMCIG+GMGAA V ER
Sbjct  416   LHEMHSRDASCKLGVVSMCIGSGMGAAAVVER  447



>ref|XP_001418570.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96863.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=417

 Score =   467 bits (1202),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 237/387 (61%), Positives = 303/387 (78%), Gaps = 5/387 (1%)
 Frame = +2

Query  254   DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  433
             DD+VIV+A RTP+ ++KRGG   T  DDL+A+VL+A + +  ++ ++VGDI+VG+VL   
Sbjct  27    DDVVIVSACRTPITRAKRGGLAATPADDLIAAVLQASVARGKIDVNDVGDIVVGSVLGAS  86

Query  434   SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  613
             S RA+ECR+  F AGFP+ VPVRT NRQCSSGLQA AD+AA IKAG+YD+GIGAG+E+MT
Sbjct  87    SQRANECRIGMFLAGFPKEVPVRTTNRQCSSGLQACADIAAGIKAGYYDMGIGAGVETMT  146

Query  614   VNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaat  793
              N M WEG +NPR ++   AQNCL+PMGITSENVA ++G+TR+ QD  A  SH +AA A 
Sbjct  147   ANPMKWEGGINPRIASSSDAQNCLIPMGITSENVAEKWGITREAQDTMAARSHARAANAR  206

Query  794   aaGKFKDEIIPVTTKIV-NPKTG--DETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTT  964
             A+G+FK EI+P+ TK   +PKTG      V +S DDGIR   ++  LAKL  VFKK G+T
Sbjct  207   ASGRFKAEIVPIHTKTAPDPKTGAGGGANVIVSEDDGIREGTTVQSLAKLPAVFKKGGST  266

Query  965   TAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVK  1144
             T GN+SQV+DGA AV+L +RS A  +GLPIL  +R++AAVG DPA+MGIGPA+AIPA + 
Sbjct  267   TPGNASQVSDGAAAVVLARRSYAEARGLPILATWRSWAAVGCDPALMGIGPAIAIPATLS  326

Query  1145  SAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATL  1324
             +A + +DD+DL+EINEAFASQ  YC +KLGLD EK+NVNGGA+A+GHPLGATGARC+ATL
Sbjct  327   AANMTVDDVDLYEINEAFASQATYCVEKLGLDSEKVNVNGGAIALGHPLGATGARCLATL  386

Query  1325  LHEMKRRGKDCRYGVVSMCIGTGMGAA  1405
             +HEM RRG   + GVVSMCIG+GMG A
Sbjct  387   IHEMHRRG--AKTGVVSMCIGSGMGMA  411



>gb|KDD73648.1| beta-ketoacyl-ACP synthase, partial [Helicosporidium sp. ATCC 
50920]
Length=427

 Score =   466 bits (1198),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 241/413 (58%), Positives = 308/413 (75%), Gaps = 1/413 (0%)
 Frame = +2

Query  254   DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  433
             DD+ IV+A RTPL KS RGG KDT   DL+A+VL   + +T ++P +VGD+++G+V+   
Sbjct  16    DDVCIVSACRTPLTKSNRGGLKDTPAHDLVAAVLAETVRRTGVDPKDVGDVVLGSVMGHS  75

Query  434   SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  613
             S RA+ECR+  F AGFP+TVPV TVNRQCSSGLQA+A VAAAIK+G+Y +GI  G+E+M+
Sbjct  76    SQRANECRIGMFLAGFPDTVPVHTVNRQCSSGLQAIASVAAAIKSGYYSVGIAGGVETMS  135

Query  614   VNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaat  793
              + M WEG +    +   QA++C +PMG+TSENVA ++ ++R+ QD+ A ESHRKAAAA 
Sbjct  136   ADPMRWEGEIAENVAEHPQARDCFIPMGVTSENVAAQYHLSREVQDRFAAESHRKAAAAR  195

Query  794   aaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAG  973
              +GKF+DEI+PV+TK V  + G   +V +S DDGIR   S+  L KL+PVFKK G+TTAG
Sbjct  196   KSGKFRDEIVPVSTK-VKLQDGTVKSVVVSEDDGIREGVSLEALGKLRPVFKKGGSTTAG  254

Query  974   NSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAG  1153
             NSSQ TDGA AV+LM R  A ++GL ++GVFR+FAAVGV P +MGIGPA AIPAAVK AG
Sbjct  255   NSSQTTDGAAAVMLMTRREAQRRGLAVMGVFRSFAAVGVPPRIMGIGPAFAIPAAVKLAG  314

Query  1154  LELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHE  1333
             L + D+D++EINEAFASQ  Y    L +DP K+N NGGA+A+GHPLG TGAR  ATLL+E
Sbjct  315   LGVQDVDVYEINEAFASQASYSVDTLKIDPAKVNPNGGAIALGHPLGCTGARQTATLLYE  374

Query  1334  MKRRGKDCRYGVVSMCIGTGMGAAGVFERGDACDELSNARKVETHGYLSKDAR  1492
             M RRGK  R+GVVSMCIG+GMGAA VFER  + D  S A        LS DA+
Sbjct  375   MARRGKTARFGVVSMCIGSGMGAAAVFEREGSEDRTSFAAPATARTGLSADAQ  427



>ref|XP_002500295.1| acetyl-coa acyltransferase [Micromonas sp. RCC299]
 gb|ACO61553.1| acetyl-coa acyltransferase [Micromonas sp. RCC299]
Length=425

 Score =   462 bits (1189),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 249/389 (64%), Positives = 313/389 (80%), Gaps = 3/389 (1%)
 Frame = +2

Query  254   DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  433
             DDIV+V+A RTP+ ++K+GG KDT  DDL+A++LKA +++T L+ ++VGD++VG+VL   
Sbjct  36    DDIVVVSALRTPITRAKKGGLKDTPADDLVATLLKATVDRTGLDVNDVGDVVVGSVLGNS  95

Query  434   SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  613
             S RA+ECR+A F AGFP+ VPVRTVNRQCSSGLQA ADVAAAIKAG+YD+GI AG+E+MT
Sbjct  96    SQRANECRIAMFLAGFPQEVPVRTVNRQCSSGLQACADVAAAIKAGYYDVGIAAGVETMT  155

Query  614   VNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaat  793
              N M WEG +NPR ++   AQ+CL+PMG+TSENVA R+ +TR++QD  A  SH +AAAA 
Sbjct  156   SNPMKWEGGMNPRVASSSDAQSCLIPMGVTSENVAERWEITREQQDTLAARSHARAAAAQ  215

Query  794   aaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAG  973
               G+F  +I+PV T+  +PKTG+ + + +  DDGIR   +   LAKL  VFKK G+TT G
Sbjct  216   RDGRFDSQIVPVRTQWRDPKTGEVSRIVVDKDDGIREGTTTTTLAKLPAVFKKGGSTTPG  275

Query  974   NSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAG  1153
             N+SQV+DGAG V+L KRS A+ KGLPI+G F +FAAVGVDP VMGIGPAVAIP A++ AG
Sbjct  276   NASQVSDGAGCVVLAKRSYALAKGLPIMGRFVSFAAVGVDPKVMGIGPAVAIPVAIEKAG  335

Query  1154  LE-LDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLH  1330
             L  + D+DLFE+NEAFASQ  YC  KLGLD EK+NVNGGA+A+GHPLGATGARCVATL+H
Sbjct  336   LRSVADVDLFELNEAFASQATYCATKLGLDVEKVNVNGGAIALGHPLGATGARCVATLMH  395

Query  1331  EMKRRGKDCRYGVVSMCIGTGMGAAGVFE  1417
             EM+RRG   R GVVSMCIG+GMGAAGVFE
Sbjct  396   EMQRRG--ARNGVVSMCIGSGMGAAGVFE  422



>emb|CEF98532.1| Thiolase-like, subgroup [Ostreococcus tauri]
Length=424

 Score =   461 bits (1185),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 235/391 (60%), Positives = 308/391 (79%), Gaps = 7/391 (2%)
 Frame = +2

Query  254   DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  433
             DD+V+VAA RTP+ ++K+GG   T  DDL+A+VL+A   + N++PSEVGD++VG+VL   
Sbjct  41    DDVVVVAACRTPITRAKKGGLAKTPADDLVAAVLQAATRRANIDPSEVGDVVVGSVLGSS  100

Query  434   SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  613
             S RA+ECR+A F AGFP+ VPVRT NRQCSSG+QA AD+AA IKAG+YD+GIGAG+E+MT
Sbjct  101   SQRANECRIAMFLAGFPKEVPVRTTNRQCSSGIQACADIAAGIKAGYYDVGIGAGVETMT  160

Query  614   VNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaat  793
              N M WEG  NPR ++   AQNCL+PMG+TSENVA ++G++R+ QD  A  SH +AAAA 
Sbjct  161   SNPMKWEGGFNPRVASSSDAQNCLIPMGVTSENVAEKYGISRETQDTMAARSHARAAAAR  220

Query  794   aaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAG  973
             A+G+FK+EI+P+ TK  N +  D   + +S DDGIRP  ++  LA+L  VFKK G+TT G
Sbjct  221   ASGRFKNEIVPIHTK--NAEGAD---IIVSEDDGIRPETTLATLARLPAVFKKGGSTTPG  275

Query  974   NSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAG  1153
             N+SQV+DGA AV+L +RS A  +GLPIL  +R+F+AVG DPA+MGIGPAVAIPAA+K+A 
Sbjct  276   NASQVSDGAAAVVLARRSYAEARGLPILATWRSFSAVGCDPALMGIGPAVAIPAALKAAN  335

Query  1154  LELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHE  1333
             L +DDIDL+E+NEAFASQ  YC +KLGLDPE++NVNGGA+A+GHPLGATGARC+ATL++E
Sbjct  336   LTVDDIDLYELNEAFASQATYCIEKLGLDPERVNVNGGAIALGHPLGATGARCLATLVYE  395

Query  1334  MKRRGKDCRYGVVSMCIGTGMGAAGVFERGD  1426
             M RRG   + G+ S C+G+GMG A +    D
Sbjct  396   MHRRG--AKTGMFSCCVGSGMGVAALVSVED  424



>ref|XP_006307516.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
 gb|EOA40414.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
Length=315

 Score =   456 bits (1172),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 237/320 (74%), Positives = 278/320 (87%), Gaps = 10/320 (3%)
 Frame = +2

Query  110   AIERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  289
             A+ERQRVLLQHL+P++++ S  S  + +          AAYQ  S YGDD+VIVAA RT 
Sbjct  4     AMERQRVLLQHLQPSSSSDSALSPSACL----------AAYQNTSKYGDDVVIVAAQRTA  53

Query  290   LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  469
             +CK+KRG FKDTYPD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMA+F
Sbjct  54    ICKAKRGSFKDTYPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMASF  113

Query  470   YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNP  649
             YAGFP TVP+RTVNRQC+SGLQAVADVAAAIKAGFYDIGIGAGLESMT N   W+GSVNP
Sbjct  114   YAGFPLTVPIRTVNRQCASGLQAVADVAAAIKAGFYDIGIGAGLESMTTNPRGWKGSVNP  173

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
             +    +QA +CLLPMGITSENV+HRF ++R+EQDQAAV+SHRKAA+ATA+GKF+DEIIPV
Sbjct  174   KVKNFEQAHSCLLPMGITSENVSHRFNISREEQDQAAVDSHRKAASATASGKFEDEIIPV  233

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TKIV+PKTGDE  +T+SVDDGIRPN ++  L KLKPVFKKDGTTTAGNSSQ++DGAGAV
Sbjct  234   KTKIVDPKTGDEKPITVSVDDGIRPNTTLSGLMKLKPVFKKDGTTTAGNSSQLSDGAGAV  293

Query  1010  LLMKRSLAIQKGLPILGVFR  1069
             LLM+RS+A++KGLPILGVFR
Sbjct  294   LLMRRSVAMEKGLPILGVFR  313



>ref|XP_004339798.1| acetylCoA acyltransferase, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR17785.1| acetylCoA acyltransferase, putative [Acanthamoeba castellanii 
str. Neff]
Length=430

 Score =   454 bits (1168),  Expect = 3e-151, Method: Compositional matrix adjust.
 Identities = 245/437 (56%), Positives = 322/437 (74%), Gaps = 17/437 (4%)
 Frame = +2

Query  116   ERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLC  295
              R  VL  H++P    S ++ + ++ +++V                DDIVIV A RT + 
Sbjct  7     HRLSVLEAHIQPQQN-SEMEGLSAAFTSAVGVKSP-----------DDIVIVKAVRTAVG  54

Query  296   KSKRGGFKDTYPDDLLASVLKALIEKT-NLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  472
             K+KRG FK+T PD+LLA VLK L++ T  + P   GD+++GTVL PG+  A+E R+A+  
Sbjct  55    KAKRGSFKNTGPDNLLAPVLKHLVQTTPQIKPELYGDVVIGTVLPPGAQGATEVRVASLL  114

Query  473   AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTM-AWEGSVNP  649
             AG P+ VP  TVNRQCSSGLQA+A+VA+AIKAG+YDIGI  G+ESM+ N+M  W+G +N 
Sbjct  115   AGLPDIVPCTTVNRQCSSGLQAIANVASAIKAGYYDIGIAGGVESMSSNSMDRWDGGINQ  174

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
              A     A+ C L MG TSENVA R+GV+R+ QDQ A  SH+KAA A  AGKF+DEI+PV
Sbjct  175   EALQHPSAKGCYLNMGQTSENVAERYGVSRETQDQFAALSHKKAAEAIKAGKFRDEIVPV  234

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
             T  + + K G+  T+T+S D+G+R + +   L KL+PVFK+ G+TTAGNSSQV+DGA A 
Sbjct  235   TVTVEDDK-GNSKTITVSQDEGVRADTTAEKLGKLRPVFKEGGSTTAGNSSQVSDGAAAC  293

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             ++ KRS+A + GLPI GVFR+FAAVGV+PAVMGIGPAVAIPAAV+ AG+ L D+D++EIN
Sbjct  294   IVTKRSVAQKLGLPIFGVFRSFAAVGVEPAVMGIGPAVAIPAAVQKAGISLQDVDVYEIN  353

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ +YC +KLG+  EK+N NGGA+A+GHPLG TGAR  ATLL+E+KRR  + R+GV
Sbjct  354   EAFASQAVYCVQKLGIPVEKVNPNGGAIALGHPLGCTGARQTATLLNELKRR--NARFGV  411

Query  1370  VSMCIGTGMGAAGVFER  1420
             VSMCIG+GMGAA V+ER
Sbjct  412   VSMCIGSGMGAAAVYER  428



>ref|XP_008844714.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal [Nannospalax 
galili]
 ref|XP_008844715.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal [Nannospalax 
galili]
Length=424

 Score =   450 bits (1157),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 244/435 (56%), Positives = 322/435 (74%), Gaps = 19/435 (4%)
 Frame = +2

Query  119   RQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  292
             R +V+L HL  RP ++        S++ A+ C+AG   A        DD+V+V   RTP+
Sbjct  3     RLQVVLGHLAGRPGSS--------SALQAAPCSAGFPQAS------ADDVVVVHGRRTPI  48

Query  293   CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  472
              + +RGGFKDT PD+LL++VL A+++   L P ++GDI VG VL PG+  A   R+A F 
Sbjct  49    GRGRRGGFKDTTPDELLSAVLTAVLQDVKLKPEQLGDISVGNVLQPGA-GALMARIAQFL  107

Query  473   AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  652
             +G PETVP+ TVNRQCSSGLQAVA++A  I+ G YDIG+  G+ESM+++     G++  R
Sbjct  108   SGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSDRGNPGNITSR  167

Query  653   ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVT  832
                 ++A++CL+PMGITSENVA RFG++RQ+QD  A+ S +KAA A + G F++EI+PVT
Sbjct  168   LLENEKAKDCLIPMGITSENVAERFGISRQKQDAFALTSQQKAARAQSRGCFREEIVPVT  227

Query  833   TKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVL  1012
             T +++ + G++ T+T+S D+GIRP+ ++  LAKLKP FK  G+TTAGNSSQV+DGA AVL
Sbjct  228   TTVLDDE-GNKRTITVSQDEGIRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVL  286

Query  1013  LMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINE  1192
             L +RS A + GLPILGV R+FA VGV P +MGIGPA AIP A++ AGL + DID+FEINE
Sbjct  287   LARRSKAKELGLPILGVLRSFAVVGVPPDIMGIGPAYAIPEALQKAGLTVSDIDIFEINE  346

Query  1193  AFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVV  1372
             AFASQ LYC +KLG+ PEK+N  GGA+A+GHPLG TGAR V TLL+E+KRRGK   YGVV
Sbjct  347   AFASQALYCVEKLGIPPEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGKRA-YGVV  405

Query  1373  SMCIGTGMGAAGVFE  1417
             SMCIGTGMGAA VFE
Sbjct  406   SMCIGTGMGAAAVFE  420



>ref|XP_003283381.1| acetyl-CoA C-acyltransferase [Dictyostelium purpureum]
 gb|EGC40032.1| acetyl-CoA C-acyltransferase [Dictyostelium purpureum]
Length=418

 Score =   448 bits (1152),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 234/389 (60%), Positives = 293/389 (75%), Gaps = 7/389 (2%)
 Frame = +2

Query  254   DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  433
             DD+VIVA +RT + K+KRG FK+T PD+LLA V+K +++ TN++P  +GD+++G VL   
Sbjct  35    DDVVIVAPFRTAIGKAKRGSFKETAPDELLAPVIKHILKVTNIDPKLIGDVVMGAVLPRS  94

Query  434   SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  613
             S  A+E R+A   AG P+ VP  TVNRQCSSGLQA+A+ A+A+K G Y++G+  G+ESM+
Sbjct  95    SQGATEVRVATLLAGLPKEVPCYTVNRQCSSGLQAIANCASAVKMGLYEVGLAGGVESMS  154

Query  614   VNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaat  793
             +N MAW+G  N  AS       C + MG TSENVA RFGVTR+EQD+ +V+SH+KA AA 
Sbjct  155   LNPMAWDGGFNETASNDPIMSGCYMTMGQTSENVAERFGVTRKEQDEFSVQSHKKAGAAQ  214

Query  794   aaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAG  973
              AGKFKDEI+PVT K     T D   V +  D+GIR   ++ DLAKLKP FK DGTTTAG
Sbjct  215   RAGKFKDEIVPVTIK-----TEDGKEVVVDKDEGIREQTTLADLAKLKPAFKSDGTTTAG  269

Query  974   NSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAG  1153
             NSSQ++DGA A L+MKRS A + GL I  VFR+FAAVGV+P+VMGIGPA AIP AVK AG
Sbjct  270   NSSQMSDGAAACLVMKRSTAERLGLQIALVFRSFAAVGVEPSVMGIGPAAAIPVAVKQAG  329

Query  1154  LELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHE  1333
             L ++DID+FEINEAFASQ  Y  KKLGLD  K+N NG  +++GHPLGATGAR  AT+ +E
Sbjct  330   LSINDIDVFEINEAFASQAYYSCKKLGLDMSKVNPNGSGISLGHPLGATGARLTATISNE  389

Query  1334  MKRRGKDCRYGVVSMCIGTGMGAAGVFER  1420
             MKRRG   R+GVVSMCIGTGMGAA V+ER
Sbjct  390   MKRRG--ARFGVVSMCIGTGMGAACVYER  416



>ref|XP_005348140.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like isoform 
X1 [Microtus ochrogaster]
Length=424

 Score =   447 bits (1150),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 243/437 (56%), Positives = 323/437 (74%), Gaps = 19/437 (4%)
 Frame = +2

Query  113   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  286
             + R +V+L HL  RP ++        S++ A+ C+AG   A         D+V+V   RT
Sbjct  1     MHRLQVVLGHLAGRPESS--------SALQAAPCSAGFPQAS------ASDVVVVHGRRT  46

Query  287   PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  466
             P+ +S RGGFKDT PD+LL++VL A+++  NL P ++GDI VG VL PG+  A   R+  
Sbjct  47    PIGRSGRGGFKDTTPDELLSAVLTAVLQDLNLRPEQLGDISVGNVLQPGA-GAVMARIGQ  105

Query  467   FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  646
             F +G PETVP+ TVNRQCSSGLQAVA++A  I+ G YDIG+  G+ESM+++     G+++
Sbjct  106   FLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSERGNPGNIS  165

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
              R    ++A++CL+PMGITSENVA RFG++RQ+QD  A+ S +KAA A + G F+ EI+P
Sbjct  166   SRLLENEKARDCLIPMGITSENVAERFGISRQKQDAFALASQQKAARAQSRGCFRAEIVP  225

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             VTT +++ K G++ T+T+S D+G+RP+ ++  LAKLKP FK  G+TTAGNSSQV+DGA A
Sbjct  226   VTTTVLDDK-GNKKTITVSQDEGVRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAAA  284

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
             VLL +RS A + GLPILGV R++A VGV P +MGIGPA AIPAA++ AGL ++DID+FEI
Sbjct  285   VLLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFEI  344

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQ LYC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+KRRGK   YG
Sbjct  345   NEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVITLLNELKRRGKRA-YG  403

Query  1367  VVSMCIGTGMGAAGVFE  1417
             VVSMCIGTGMGAA VFE
Sbjct  404   VVSMCIGTGMGAAAVFE  420



>ref|NP_666342.1| 3-ketoacyl-CoA thiolase B, peroxisomal precursor [Mus musculus]
 sp|Q8VCH0.1|THIKB_MOUSE RecName: Full=3-ketoacyl-CoA thiolase B, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase B; AltName: Full=Beta-ketothiolase 
B; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
B; Flags: Precursor [Mus musculus]
 gb|AAH19882.1| Acetyl-Coenzyme A acyltransferase 1B [Mus musculus]
 gb|AAP31669.1| 3-ketoacyl-CoA thiolase B [Mus musculus]
 dbj|BAE26781.1| unnamed protein product [Mus musculus]
 gb|EDL09240.1| mCG21883, isoform CRA_e [Mus musculus]
Length=424

 Score =   446 bits (1148),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 244/437 (56%), Positives = 322/437 (74%), Gaps = 19/437 (4%)
 Frame = +2

Query  113   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  286
             + R +V+L HL  RP ++        S++ A+ C+AG   A         D+V+V   RT
Sbjct  1     MHRLQVVLGHLAGRPESS--------SALQAAPCSAGFLQAS------ASDVVVVHGRRT  46

Query  287   PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  466
             P+ ++ RG FKDT PD+LL++VL A+++   L P ++GDI VG VL PG+  A   R+A 
Sbjct  47    PIGRASRGCFKDTTPDELLSAVLTAVLQDVKLKPEQLGDISVGNVLQPGA-GAIMARIAQ  105

Query  467   FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  646
             F +G PETVP+ TVNRQCSSGLQAVA++A  I+ G YDIG+  G+ESMT++     G+++
Sbjct  106   FLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSQRGNHGNIS  165

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
              R    ++A++CL+PMGITSENVA RFGV+RQ+QD  A+ S +KAA+A + G F  EI+P
Sbjct  166   SRLLENEKARDCLIPMGITSENVAERFGVSRQKQDAFALASQQKAASAQSRGCFHAEIVP  225

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             VTT ++N K GD+ T+T+S D+G+RP+ ++  LAKLKP FK  G+TTAGNSSQV+DGA A
Sbjct  226   VTTTVLNDK-GDKKTITVSQDEGVRPSTTMQGLAKLKPAFKDGGSTTAGNSSQVSDGAAA  284

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
             VLL +RS A + GLPILGV R++A VGV P VMGIGPA AIPAA++ AGL ++DID+FEI
Sbjct  285   VLLARRSKAEELGLPILGVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLTVNDIDIFEI  344

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+KRRG+   YG
Sbjct  345   NEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YG  403

Query  1367  VVSMCIGTGMGAAGVFE  1417
             VVSMCIGTGMGAA VFE
Sbjct  404   VVSMCIGTGMGAAAVFE  420



>ref|XP_009066824.1| hypothetical protein LOTGIDRAFT_134529 [Lottia gigantea]
 gb|ESO82471.1| hypothetical protein LOTGIDRAFT_134529 [Lottia gigantea]
Length=432

 Score =   446 bits (1147),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 229/389 (59%), Positives = 300/389 (77%), Gaps = 5/389 (1%)
 Frame = +2

Query  254   DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVG-TVLAP  430
             +DIVIV+A RTP+ K+KRG FKDTYPDDLLA+V +A+I    L P+++GDI +G +   P
Sbjct  37    EDIVIVSALRTPIGKAKRGSFKDTYPDDLLATVFQAVINDVKLAPADIGDICIGRSYKIP  96

Query  431   GSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESM  610
             G   A+  R A FY+  PETVP+ T NRQCSSGLQAV +VA  I+ G  +IG+  G ESM
Sbjct  97    GIQAAATARFAQFYSNIPETVPIFTTNRQCSSGLQAVLNVAGFIRNGVCNIGLAGGFESM  156

Query  611   TVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaa  790
             T +  + +G VNP+   +++A++CL+PMGITSENVA++FG++RQ+QD+ A+ES ++A+ A
Sbjct  157   TQSKNSADG-VNPKVFEVEKARDCLIPMGITSENVANKFGISRQKQDEFALESQKRASEA  215

Query  791   taaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTA  970
                G F+DEI+PVTT I N K G E T+ ++ DDGIRP    G L+KL+P F+++GTTTA
Sbjct  216   QRLGYFQDEIVPVTTTITN-KEGQEQTIRVTKDDGIRPTTLQG-LSKLRPAFQENGTTTA  273

Query  971   GNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSA  1150
             GNSSQV+DGA AVL+ KRS A ++G P+LGV R+FA  G  P +MGIGPAVAIP A+K A
Sbjct  274   GNSSQVSDGAAAVLVAKRSEAERRGWPVLGVLRSFAVAGCPPDIMGIGPAVAIPLALKKA  333

Query  1151  GLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLH  1330
             GL +DDI+++EINEAFASQ +YC +KLG++P K+N  GGA+A+GHPLG TG+R +ATLLH
Sbjct  334   GLRIDDIEIYEINEAFASQAVYCVEKLGINPIKVNPKGGAIALGHPLGCTGSRQIATLLH  393

Query  1331  EMKRRGKDCRYGVVSMCIGTGMGAAGVFE  1417
             E+KRRGK    GVVSMCIGTGMGAA VFE
Sbjct  394   ELKRRGKRS-LGVVSMCIGTGMGAAAVFE  421



>sp|P07871.2|THIKB_RAT RecName: Full=3-ketoacyl-CoA thiolase B, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase B; AltName: Full=Beta-ketothiolase 
B; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
B; Flags: Precursor [Rattus norvegicus]
 gb|AAH98757.1| Similar to 3-ketoacyl-CoA thiolase B, peroxisomal precursor (Beta-ketothiolase 
B) [Rattus norvegicus]
 gb|EDL76923.1| rCG25918, isoform CRA_b [Rattus norvegicus]
Length=424

 Score =   445 bits (1144),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 241/435 (55%), Positives = 321/435 (74%), Gaps = 15/435 (3%)
 Frame = +2

Query  113   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  292
             + R +V+L HL   + +SS      ++ A+ C+AG   A         D+V+V   RTP+
Sbjct  1     MHRLQVVLGHLAGRSESSS------ALQAAPCSAGFPQAS------ASDVVVVHGRRTPI  48

Query  293   CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  472
              ++ RGGFKDT PD+LL++VL A+++   L P  +GDI VG VL PG+  A+  R+A F 
Sbjct  49    GRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLQPGA-GAAMARIAQFL  107

Query  473   AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  652
             +G PETVP+  VNRQCSSGLQAVA++A  I+ G YDIG+  G+ESMT++     G+++ R
Sbjct  108   SGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSERGNPGNISSR  167

Query  653   ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVT  832
                 ++A++CL+PMGITSENVA RFG++RQ+QD  A+ S +KAA+A + G F+ EI+PVT
Sbjct  168   LLENEKARDCLIPMGITSENVAERFGISRQKQDAFALASQQKAASAQSKGCFRAEIVPVT  227

Query  833   TKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVL  1012
             T +++ K GD  T+T+S D+G+RP+ ++  LAKLKP FK  G+TTAGNSSQV+DGA AVL
Sbjct  228   TTVLDDK-GDRKTITVSQDEGVRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVL  286

Query  1013  LMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINE  1192
             L +RS A + GLPILGV R++A VGV P +MGIGPA AIPAA++ AGL ++DID+FEINE
Sbjct  287   LARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFEINE  346

Query  1193  AFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVV  1372
             AFASQ LYC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+KRRG+   YGVV
Sbjct  347   AFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YGVV  405

Query  1373  SMCIGTGMGAAGVFE  1417
             SMCIGTGMGAA VFE
Sbjct  406   SMCIGTGMGAAAVFE  420



>ref|XP_005348137.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like isoform 
X2 [Microtus ochrogaster]
Length=424

 Score =   444 bits (1143),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 243/437 (56%), Positives = 322/437 (74%), Gaps = 19/437 (4%)
 Frame = +2

Query  113   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  286
             + R +V+L HL  RP ++        S++ A+ C+AG   A         D+V+V   RT
Sbjct  1     MHRLQVVLGHLAGRPESS--------SALQAAPCSAGFLQAS------ASDVVVVHGRRT  46

Query  287   PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  466
             P+ +S RGGFKDT PD+LL++VL A+++  NL P ++GDI VG VL PG+  A   R+A 
Sbjct  47    PIGRSGRGGFKDTTPDELLSAVLTAVLQDVNLRPEQLGDISVGNVLLPGA-GAVTARIAQ  105

Query  467   FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  646
             F +G PETVP  TVNRQCSSGLQAVA++A  I+ G YDIG+  G+ESMT++      +++
Sbjct  106   FLSGIPETVPSSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTMSERGNFRNIS  165

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
              R    ++A++CL+PMGITSENVA RFG++RQ+QD  A+ S +KAA A + G F+ EI+P
Sbjct  166   SRLLENEKARDCLIPMGITSENVAERFGISRQKQDAFALASQQKAARAQSRGCFRAEIVP  225

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             VTT +++ K G++ T+T+S D+G+RP+ ++  LAKLKP FK  G+TTAGNSSQV+DGA A
Sbjct  226   VTTTVLDDK-GNKKTITVSQDEGVRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAAA  284

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
             +LL +RS A + GLPILGV R++A VGV P +MGIGPA AIPAA++ AGL ++DID+FEI
Sbjct  285   ILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFEI  344

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQ LYC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+KRRGK   YG
Sbjct  345   NEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVITLLNELKRRGKRA-YG  403

Query  1367  VVSMCIGTGMGAAGVFE  1417
             VVSMCIGTGMGAA VFE
Sbjct  404   VVSMCIGTGMGAAAVFE  420



>dbj|BAE35878.1| unnamed protein product [Mus musculus]
Length=406

 Score =   443 bits (1139),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 237/411 (58%), Positives = 310/411 (75%), Gaps = 9/411 (2%)
 Frame = +2

Query  185   SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKAL  364
             S++ A+ C+AG   A         D+V+V   RTP+ ++ RG FKDT PD+LL++VL A+
Sbjct  1     SALQAAPCSAGFLQAS------ASDVVVVHGRRTPIGRASRGCFKDTTPDELLSAVLTAV  54

Query  365   IEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQava  544
             ++   L P ++GDI VG VL PG+  A   R+A F +G PETVP+ TVNRQCSSGLQAVA
Sbjct  55    LQDVKLKPEQLGDISVGNVLQPGA-GAIMARIAQFLSGIPETVPLSTVNRQCSSGLQAVA  113

Query  545   dvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPRASTLQQAQNCLLPMGITSENVAHR  724
             ++A  I+ G YDIG+  G+ESMT++     G+++ R    ++A++CL+PMGITSENVA R
Sbjct  114   NIAGGIRNGSYDIGMACGVESMTLSQRGNHGNISSRLLENEKARDCLIPMGITSENVAER  173

Query  725   FGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVTTKIVNPKTGDETTVTISVDDGIRP  904
             FGV+RQ+QD  A+ S +KAA+A + G F  EI+PVTT ++N K GD+ T+T+S D+G+RP
Sbjct  174   FGVSRQKQDAFALASQQKAASAQSRGCFHAEIVPVTTTVLNDK-GDKKTITVSQDEGVRP  232

Query  905   NASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVLLMKRSLAIQKGLPILGVFRTFAAV  1084
             + ++  LAKLKP FK  G+TTAGNSSQV+DGA AVLL +RS A + GLPILGV R++A V
Sbjct  233   STTMQGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVLLARRSKAEELGLPILGVLRSYAVV  292

Query  1085  GVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINEAFASQYLYCQKKLGLDPEKINVNG  1264
             GV P VMGIGPA AIPAA++ AGL ++DID+FEINEAFASQ +YC +KLG+  EK+N  G
Sbjct  293   GVPPDVMGIGPAYAIPAALQKAGLTVNDIDIFEINEAFASQAVYCVEKLGIPAEKVNPLG  352

Query  1265  GAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVVSMCIGTGMGAAGVFE  1417
             GA+A+GHPLG TGAR V TLL+E+KRRG+   YGVVSMCIGTGMGAA VFE
Sbjct  353   GAIALGHPLGCTGARQVVTLLNELKRRGRRA-YGVVSMCIGTGMGAAAVFE  402



>ref|NP_570934.1| 3-ketoacyl-CoA thiolase A, peroxisomal precursor [Mus musculus]
 ref|XP_006511986.1| PREDICTED: 3-ketoacyl-CoA thiolase A, peroxisomal isoform X1 
[Mus musculus]
 sp|Q921H8.1|THIKA_MOUSE RecName: Full=3-ketoacyl-CoA thiolase A, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase A; AltName: Full=Beta-ketothiolase 
A; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
A; Flags: Precursor [Mus musculus]
 gb|AAH12400.1| Acetyl-Coenzyme A acyltransferase 1A [Mus musculus]
 gb|AAP31668.1| 3-ketoacyl-CoA thiolase A [Mus musculus]
 gb|AAP72964.1| peroxisomal 3-ketoacyl-CoA thiolase A [Mus musculus]
 gb|EDL09221.1| mCG20972, isoform CRA_a [Mus musculus]
Length=424

 Score =   443 bits (1140),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 241/437 (55%), Positives = 325/437 (74%), Gaps = 19/437 (4%)
 Frame = +2

Query  113   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  286
             + R +V+L HL  RP ++        S++ A+ C    SA + + S    D+V+V   RT
Sbjct  1     MHRLQVVLGHLAGRPESS--------SALQAAPC----SARFPQASA--SDVVVVHGRRT  46

Query  287   PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  466
             P+ ++ RGGFK+T PD+LL++VL A+++   L P ++GDI VG VL PG+  A   R+A 
Sbjct  47    PIGRASRGGFKNTTPDELLSAVLTAVLQDVRLKPEQLGDISVGNVLEPGA-GAVMARIAQ  105

Query  467   FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  646
             F +G PETVP+ TVNRQCSSGLQAVA++A  I+ G YDIG+  G+ESM+++ M   G+++
Sbjct  106   FLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSGMGNPGNIS  165

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
              R    ++A++CL PMG+TSENVA RFG++RQ+QD  A+ S +KAA+A + G F+ EI+P
Sbjct  166   SRLLESEKARDCLTPMGMTSENVAERFGISRQKQDDFALASQQKAASAQSRGCFRAEIVP  225

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             VTT +++ K GD+ T+T+S D+G+RP+ ++  LAKLKP FK  G+TTAGNSSQV+DGA A
Sbjct  226   VTTTVLDDK-GDKKTITVSQDEGVRPSTTMQGLAKLKPAFKDGGSTTAGNSSQVSDGAAA  284

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
             VLL +RS A + GLPILGV R++A VGV P VMGIGPA AIPAA++ AGL ++DID+FEI
Sbjct  285   VLLARRSKAEELGLPILGVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLTVNDIDIFEI  344

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+KRRG+   YG
Sbjct  345   NEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YG  403

Query  1367  VVSMCIGTGMGAAGVFE  1417
             VVSMCIGTGMGAA VFE
Sbjct  404   VVSMCIGTGMGAAAVFE  420



>dbj|BAA14107.1| peroxisomal 3-ketoacyl-CoA thiolase B [Rattus norvegicus]
Length=424

 Score =   443 bits (1140),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 240/435 (55%), Positives = 321/435 (74%), Gaps = 15/435 (3%)
 Frame = +2

Query  113   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  292
             + R +V+L HL   + +SS      ++ A+ C+AG   A         D+V+V   RTP+
Sbjct  1     MHRLQVVLGHLAGRSESSS------ALQAAPCSAGFPQAS------ASDVVVVHGRRTPI  48

Query  293   CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  472
              ++ RGGFKDT PD+LL++VL A+++   L P  +GDI VG VL PG+  A+  R+A F 
Sbjct  49    GRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLQPGA-GAAMARIAQFL  107

Query  473   AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  652
             +G PETVP+  VNRQCSSGLQAVA++A  I+ G YDIG+  G+ESMT++     G+++ R
Sbjct  108   SGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSERGNPGNISSR  167

Query  653   ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVT  832
                 ++A++CL+PMGITSENVA RFG++RQ+QD  A+ S +KAA+A + G F+ EI+PVT
Sbjct  168   LLENEKARDCLIPMGITSENVAERFGISRQKQDAFALASQQKAASAQSKGCFRAEIVPVT  227

Query  833   TKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVL  1012
             T +++ K GD  T+T+S D+G+RP+ ++  LAKLKP FK  G+TTAGNSSQV+DGA AVL
Sbjct  228   TTVLDDK-GDRKTITVSQDEGVRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVL  286

Query  1013  LMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINE  1192
             L +RS A + GLPILGV R++A VGV P +MGIGPA AIPAA++ AGL ++DID+FEINE
Sbjct  287   LARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFEINE  346

Query  1193  AFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVV  1372
             AFASQ LYC +K+G+  EK+N  GGA+A+GHPLG TGAR V TLL+E+KRRG+   YGVV
Sbjct  347   AFASQALYCVEKVGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YGVV  405

Query  1373  SMCIGTGMGAAGVFE  1417
             SMCIGTGMGAA VFE
Sbjct  406   SMCIGTGMGAAAVFE  420



>ref|XP_003221941.1| PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal [Anolis carolinensis]
Length=422

 Score =   443 bits (1139),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 245/435 (56%), Positives = 312/435 (72%), Gaps = 17/435 (4%)
 Frame = +2

Query  113   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  292
             + R +V+L HL          S  S V A  C    S    R +   DD+V+V   RTP+
Sbjct  1     MHRVKVVLGHL----------SASSQVKAGPCLGFSS----RPASAPDDVVVVHGRRTPI  46

Query  293   CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  472
              K+KRGGFK+T PD+LLA+V+ A+++  NL+P ++ DI VG VL PG+  A   R+  F 
Sbjct  47    AKAKRGGFKETTPDELLAAVMTAVLKDLNLSPDKLEDICVGNVLQPGA-GALTARVGQFL  105

Query  473   AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  652
             +G PETVP+  VNRQCSSGLQAV ++A  I+ G YDIG+  G+ESM++ + +  G V+ R
Sbjct  106   SGIPETVPLSCVNRQCSSGLQAVINIAGGIRNGSYDIGLACGVESMSLRSASEPGDVSSR  165

Query  653   ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVT  832
                   A++CL+PMGITSENVA RFGVTR++QD  A+ S +KAA A   G FK+EI+PVT
Sbjct  166   MMDNANARDCLIPMGITSENVAERFGVTREKQDAFALVSQQKAARAQQLGLFKNEIVPVT  225

Query  833   TKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVL  1012
             TK  + + G+E T+T+  D+GIR   ++  LAKLKP FK+DGTTTAGN+SQV+DGA AVL
Sbjct  226   TKFTDDQ-GNEKTITVLKDEGIRAGTTLEGLAKLKPAFKQDGTTTAGNASQVSDGAAAVL  284

Query  1013  LMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINE  1192
             L KRS A Q GLP+LGV R++A VGV P VMGIGPA AIPAA++ AGL + DID+FEINE
Sbjct  285   LAKRSKASQLGLPVLGVLRSYAVVGVPPDVMGIGPAYAIPAALEKAGLTVKDIDVFEINE  344

Query  1193  AFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVV  1372
             AFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+KRRGK   YGVV
Sbjct  345   AFASQAVYCVEKLGIPLEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGKR-GYGVV  403

Query  1373  SMCIGTGMGAAGVFE  1417
             SMCIGTGMGAA VFE
Sbjct  404   SMCIGTGMGAAAVFE  418



>gb|EDL76915.1| rCG25819, isoform CRA_a [Rattus norvegicus]
 gb|EDL76916.1| rCG25819, isoform CRA_a [Rattus norvegicus]
Length=434

 Score =   443 bits (1139),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 242/438 (55%), Positives = 323/438 (74%), Gaps = 19/438 (4%)
 Frame = +2

Query  110   AIERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  283
             A+ R +V+L HL  RP ++        S++ A+ C    SA++ + S    D+V+V   R
Sbjct  10    AMHRLQVVLGHLAGRPESS--------SALQAAPC----SASFPQASA--SDVVVVHGRR  55

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             TP+ ++ RGGFKDT PD+LL++VL A+++   L P  +GDI VG VL PG+  A   R+A
Sbjct  56    TPIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLEPGA-GAVMARIA  114

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  643
              F +G PETVP+  VNRQCSSGLQAVA++A  I+ G YDIG+  G+ESM+++     G++
Sbjct  115   QFLSGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSNRGNPGNI  174

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             + R     +A++CL+PMGITSENVA RFG++RQ+QD  A+ S +KAA+A + G F+ EI+
Sbjct  175   SSRLLESDKARDCLIPMGITSENVAERFGISRQKQDAFALASQQKAASAQSKGCFRAEIV  234

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PVTT +++ K GD  T+T+S D+G+RP+ ++  LAKLKP FK  G+TTAGNSSQV+DGA 
Sbjct  235   PVTTTVLDDK-GDRKTITVSQDEGVRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAA  293

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLL +RS A + GLPILGV R++A VGV P +MGIGPA AIPAA++ AGL ++DID+FE
Sbjct  294   AVLLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFE  353

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQ LYC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+KRRG+   Y
Sbjct  354   INEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-Y  412

Query  1364  GVVSMCIGTGMGAAGVFE  1417
             GVVSMCIGTGMGAA VFE
Sbjct  413   GVVSMCIGTGMGAAAVFE  430



>ref|XP_002591918.1| hypothetical protein BRAFLDRAFT_284464 [Branchiostoma floridae]
 gb|EEN47929.1| hypothetical protein BRAFLDRAFT_284464 [Branchiostoma floridae]
Length=430

 Score =   442 bits (1138),  Expect = 1e-146, Method: Compositional matrix adjust.
 Identities = 245/436 (56%), Positives = 309/436 (71%), Gaps = 13/436 (3%)
 Frame = +2

Query  113   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  292
             +ER + +  H+   N A +          S  +   +    R +   DD+VI++A RTP+
Sbjct  1     MERMQTIFGHISVPNRAQN---------QSFSSLAQNEVKGRFAESEDDVVIISALRTPI  51

Query  293   CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  472
              K+ RG FKDT PDDLL SVLKA +E+TN+NPSE+GDI VG VL PG+  A   R+A F 
Sbjct  52    GKAARGSFKDTTPDDLLVSVLKATLERTNVNPSEIGDICVGNVLQPGAGPAV-FRIAQFA  110

Query  473   AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWE-GSVNP  649
             AG PETVP+   NRQCSSGLQAV  VA +IKAG  D+ IGAG+ESM+      E G +NP
Sbjct  111   AGIPETVPLSACNRQCSSGLQAVMHVANSIKAGVCDMAIGAGVESMSKRKQGGEPGDLNP  170

Query  650   RASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPV  829
                  ++A++C++PMGITSENVA RFGVTR+ QD  A  S ++A AAT  G F+DEI+PV
Sbjct  171   DNFKFEKARDCIIPMGITSENVAERFGVTRETQDMFAAISQQRACAATEKGLFQDEIVPV  230

Query  830   TTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAV  1009
              TK+V+ K G E  +T++ DDG+RP  +   LA+L   FKK G+TTAGNSSQV+DGA AV
Sbjct  231   KTKVVD-KDGQEREITVTKDDGVRPGTTKEKLARLPAAFKKGGSTTAGNSSQVSDGAAAV  289

Query  1010  LLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEIN  1189
             L+ +RS A Q GLP+ GV R++A VGV P VMGIGPA AIP A+K AGL +DDID+FE+N
Sbjct  290   LVARRSKARQLGLPVFGVIRSYAVVGVPPDVMGIGPAYAIPEALKKAGLSVDDIDVFEVN  349

Query  1190  EAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGV  1369
             EAFASQ +Y   KLG+  EK+N NGGA+A+GHPLG TG+R +ATLL+E+KRRGK   YGV
Sbjct  350   EAFASQAVYSVDKLGIPWEKVNPNGGAIALGHPLGCTGSRQIATLLNELKRRGKRA-YGV  408

Query  1370  VSMCIGTGMGAAGVFE  1417
             VSMCIGTGMGAA V E
Sbjct  409   VSMCIGTGMGAAAVIE  424



>dbj|BAA14106.1| peroxisomal 3-ketoacyl-CoA thiolase A [Rattus norvegicus]
Length=434

 Score =   442 bits (1137),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 242/438 (55%), Positives = 322/438 (74%), Gaps = 19/438 (4%)
 Frame = +2

Query  110   AIERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  283
             A+ R +V+L HL  RP ++        S++ A+ C    SA + + S    D+V+V   R
Sbjct  10    AMHRLQVVLGHLAGRPESS--------SALQAAPC----SATFPQASA--SDVVVVHGRR  55

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             TP+ ++ RGGFKDT PD+LL++VL A+++   L P  +GDI VG VL PG+  A   R+A
Sbjct  56    TPIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLEPGA-GAVMARIA  114

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  643
              F +G PETVP+  VNRQCSSGLQAVA++A  I+ G YDIG+  G+ESM+++     G++
Sbjct  115   QFLSGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSNRGNPGNI  174

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             + R     +A++CL+PMGITSENVA RFG++RQ+QD  A+ S +KAA+A + G F+ EI+
Sbjct  175   SSRLLESDKARDCLIPMGITSENVAERFGISRQKQDAFALASQQKAASAQSKGCFRAEIV  234

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PVTT +++ K GD  T+T+S D+G+RP+ ++  LAKLKP FK  G+TTAGNSSQV+DGA 
Sbjct  235   PVTTTVLDDK-GDRKTITVSQDEGVRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAA  293

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLL +RS A + GLPILGV R++A VGV P +MGIGPA AIPAA++ AGL ++DID+FE
Sbjct  294   AVLLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFE  353

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQ LYC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+KRRG+   Y
Sbjct  354   INEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-Y  412

Query  1364  GVVSMCIGTGMGAAGVFE  1417
             GVVSMCIGTGMGAA VFE
Sbjct  413   GVVSMCIGTGMGAAAVFE  430



>ref|NP_001035108.1| 3-ketoacyl-CoA thiolase B, peroxisomal precursor [Rattus norvegicus]
 gb|AAA41497.1| peroxisomal 3-ketoacyl-CoA thiolase precursor (E.C 2.3.1.16) 
[Rattus norvegicus]
Length=424

 Score =   442 bits (1136),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 240/435 (55%), Positives = 320/435 (74%), Gaps = 15/435 (3%)
 Frame = +2

Query  113   IERQRVLLQHLRPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  292
             + R +V+L HL   + +SS      ++ A+ C+AG   A         D+V+V   RTP+
Sbjct  1     MHRLQVVLGHLAGRSESSS------ALQAAPCSAGFPQAS------ASDVVVVHGQRTPI  48

Query  293   CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  472
              ++ RGGFKDT PD+LL++VL A+++     P  +GDI VG VL PG+  A+  R+A F 
Sbjct  49    GRAGRGGFKDTTPDELLSAVLTAVLQDVKPKPECLGDISVGNVLQPGA-GAAMARIAQFL  107

Query  473   AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVNPR  652
             +G PETVP+  VNRQCSSGLQAVA++A  I+ G YDIG+  G+ESMT++     G+++ R
Sbjct  108   SGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMTLSERGNPGNISSR  167

Query  653   ASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIPVT  832
                 ++A++CL+PMGITSENVA RFG++RQ+QD  A+ S +KAA+A + G F+ EI+PVT
Sbjct  168   LLENEKARDCLIPMGITSENVAERFGISRQKQDAFALASQQKAASAQSKGCFRAEIVPVT  227

Query  833   TKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGAVL  1012
             T +++ K GD  T+T+S D+G+RP+ ++  LAKLKP FK  G+TTAGNSSQV+DGA AVL
Sbjct  228   TTVLDDK-GDRKTITVSQDEGVRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAAAVL  286

Query  1013  LMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEINE  1192
             L +RS A + GLPILGV R++A VGV P +MGIGPA AIPAA++ AGL ++DID+FEINE
Sbjct  287   LARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFEINE  346

Query  1193  AFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYGVV  1372
             AFASQ LYC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+KRRG+   YGVV
Sbjct  347   AFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YGVV  405

Query  1373  SMCIGTGMGAAGVFE  1417
             SMCIGTGMGAA VFE
Sbjct  406   SMCIGTGMGAAAVFE  420



>dbj|BAE25296.1| unnamed protein product [Mus musculus]
Length=424

 Score =   441 bits (1134),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 240/437 (55%), Positives = 324/437 (74%), Gaps = 19/437 (4%)
 Frame = +2

Query  113   IERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  286
             + R +V+L HL  RP ++        S++ A+ C    SA + + S    D+V+V   RT
Sbjct  1     MHRLQVVLGHLAGRPESS--------SALQAAPC----SARFPQASA--SDVVVVHGRRT  46

Query  287   PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  466
             P+ ++ RGGFK+T PD+LL++VL A+++   L P ++GDI VG VL PG+  A   R+A 
Sbjct  47    PIGRASRGGFKNTTPDELLSAVLTAVLQDVRLKPEQLGDISVGNVLEPGA-GAVMARIAQ  105

Query  467   FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSVN  646
             F +G PETVP+ TVNRQCSSGLQAVA++A  I+ G YDIG+  G+ESM+++ M   G+++
Sbjct  106   FLSGIPETVPLSTVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSGMGNPGNIS  165

Query  647   PRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEIIP  826
              R    ++A++CL PMG+TSENVA RFG++RQ+QD  A+ S +KAA+A + G F+ EI+P
Sbjct  166   SRLLESEKARDCLTPMGMTSENVAERFGISRQKQDDFALASQQKAASAQSRGCFRAEIVP  225

Query  827   VTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAGA  1006
             VTT +++ K GD+ T+T+S D+G+RP+ ++  LAKLKP FK  G+TTAGNSSQV+DGA A
Sbjct  226   VTTTVLDDK-GDKKTITVSQDEGVRPSTTMQGLAKLKPAFKDGGSTTAGNSSQVSDGAAA  284

Query  1007  VLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFEI  1186
             VLL +RS   + GLPILGV R++A VGV P VMGIGPA AIPAA++ AGL ++DID+FEI
Sbjct  285   VLLARRSKDEELGLPILGVLRSYAVVGVPPDVMGIGPAYAIPAALQKAGLTVNDIDIFEI  344

Query  1187  NEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRYG  1366
             NEAFASQ +YC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+KRRG+   YG
Sbjct  345   NEAFASQAVYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGRRA-YG  403

Query  1367  VVSMCIGTGMGAAGVFE  1417
             VVSMCIGTGMGAA VFE
Sbjct  404   VVSMCIGTGMGAAAVFE  420



>ref|NP_036621.1| 3-ketoacyl-CoA thiolase A, peroxisomal [Rattus norvegicus]
 gb|AAA41471.1| 3-ketoacyl-CoA thiolase 2 (EC 2.3.1.16) [Rattus norvegicus]
Length=434

 Score =   441 bits (1134),  Expect = 5e-146, Method: Compositional matrix adjust.
 Identities = 242/438 (55%), Positives = 321/438 (73%), Gaps = 19/438 (4%)
 Frame = +2

Query  110   AIERQRVLLQHL--RPTNAASSLDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  283
             A+ R +V+L HL  RP ++        S++ A+ C    SA + + S    D+V+V   R
Sbjct  10    AMHRLQVVLGHLAGRPESS--------SALQAAPC----SATFPQASA--SDVVVVHGRR  55

Query  284   TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  463
             TP+ ++ RGGFKDT PD+LL++VL A+++   L P  +GDI VG VL PG+  A   R+A
Sbjct  56    TPIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPECLGDISVGNVLEPGA-GAVMARIA  114

Query  464   AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVNTMAWEGSV  643
              F +G PETVP+  VNRQCSSGLQAVA++A  I+ G YDIG+  G+ESM+++     G++
Sbjct  115   QFLSGIPETVPLSAVNRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLSNRGNPGNI  174

Query  644   NPRASTLQQAQNCLLPMGITSENVAHRFGVTRQEQDQAAVESHRKaaaataaGKFKDEII  823
             + R     +A++CL+PMGITSENVA RFG++RQ+QD  A+ S +KAA+A + G F+ EI+
Sbjct  175   SSRLLESDKARDCLIPMGITSENVAERFGISRQKQDAFALASQQKAASAQSKGCFRAEIV  234

Query  824   PVTTKIVNPKTGDETTVTISVDDGIRPNASIGDLAKLKPVFKKDGTTTAGNSSQVTDGAG  1003
             PVTT +++ K GD  T+T+S D+G+RP+ ++  LAKLKP FK  G+TTAGNSSQV+DGA 
Sbjct  235   PVTTTVLDDK-GDRKTITVSQDEGVRPSTTMEGLAKLKPAFKDGGSTTAGNSSQVSDGAA  293

Query  1004  AVLLMKRSLAIQKGLPILGVFRTFAAVGVDPAVMGIGPAVAIPAAVKSAGLELDDIDLFE  1183
             AVLL +RS A + GLPILGV R++A VGV P +MGIGPA AIPAA++ AGL ++DID+FE
Sbjct  294   AVLLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPAALQKAGLTVNDIDIFE  353

Query  1184  INEAFASQYLYCQKKLGLDPEKINVNGGAMAIGHPLGATGARCVATLLHEMKRRGKDCRY  1363
             INEAFASQ LYC +KLG+  EK+N  GGA+A+GHPLG TGAR V TLL+E+KRRG    Y
Sbjct  354   INEAFASQALYCVEKLGIPAEKVNPLGGAIALGHPLGCTGARQVVTLLNELKRRGTRA-Y  412

Query  1364  GVVSMCIGTGMGAAGVFE  1417
             GVVSMCIGTGMGAA VFE
Sbjct  413   GVVSMCIGTGMGAAAVFE  430



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5693136954415