BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9213

Length=828
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009611049.1|  PREDICTED: probable protein arginine N-methy...    290   4e-92   Nicotiana tomentosiformis
ref|XP_009804079.1|  PREDICTED: probable protein arginine N-methy...    283   2e-89   Nicotiana sylvestris
ref|XP_006353524.1|  PREDICTED: protein arginine N-methyltransfer...    282   3e-89   Solanum tuberosum [potatoes]
ref|XP_004251660.1|  PREDICTED: protein arginine N-methyltransfer...    280   4e-88   Solanum lycopersicum
ref|XP_006362769.1|  PREDICTED: probable protein arginine N-methy...    276   3e-87   Solanum tuberosum [potatoes]
ref|XP_004243149.1|  PREDICTED: probable protein arginine N-methy...    271   3e-85   Solanum lycopersicum
ref|XP_011093686.1|  PREDICTED: protein arginine N-methyltransfer...    271   3e-85   Sesamum indicum [beniseed]
ref|XP_009802305.1|  PREDICTED: probable protein arginine N-methy...    270   9e-85   Nicotiana sylvestris
ref|XP_009605132.1|  PREDICTED: probable protein arginine N-methy...    270   1e-84   Nicotiana tomentosiformis
emb|CDP03196.1|  unnamed protein product                                259   7e-81   Coffea canephora [robusta coffee]
emb|CDY06802.1|  BnaC01g09010D                                          249   2e-76   
ref|XP_002282760.1|  PREDICTED: probable protein arginine N-methy...    249   3e-76   Vitis vinifera
ref|XP_008242427.1|  PREDICTED: probable protein arginine N-methy...    249   4e-76   Prunus mume [ume]
ref|XP_009128628.1|  PREDICTED: protein arginine N-methyltransfer...    248   5e-76   Brassica rapa
ref|XP_006285816.1|  hypothetical protein CARUB_v10007292mg             247   9e-76   Capsella rubella
ref|XP_009137851.1|  PREDICTED: protein arginine N-methyltransfer...    247   1e-75   Brassica rapa
emb|CBI27942.3|  unnamed protein product                                245   2e-75   Vitis vinifera
ref|XP_006371985.1|  arginine N-methyltransferase family protein        246   2e-75   Populus trichocarpa [western balsam poplar]
ref|XP_007202181.1|  hypothetical protein PRUPE_ppa006645mg             246   3e-75   Prunus persica
gb|KFK29506.1|  hypothetical protein AALP_AA7G143300                    245   5e-75   Arabis alpina [alpine rockcress]
gb|KJB65110.1|  hypothetical protein B456_010G081400                    246   6e-75   Gossypium raimondii
ref|XP_010918460.1|  PREDICTED: probable protein arginine N-methy...    245   7e-75   Elaeis guineensis
ref|XP_010447845.1|  PREDICTED: protein arginine N-methyltransfer...    245   9e-75   Camelina sativa [gold-of-pleasure]
ref|XP_008810397.1|  PREDICTED: probable protein arginine N-methy...    244   1e-74   Phoenix dactylifera
gb|KDO59261.1|  hypothetical protein CISIN_1g015306mg                   244   1e-74   Citrus sinensis [apfelsine]
ref|XP_007152929.1|  hypothetical protein PHAVU_004G172200g             243   2e-74   Phaseolus vulgaris [French bean]
gb|KDO59263.1|  hypothetical protein CISIN_1g015306mg                   244   2e-74   Citrus sinensis [apfelsine]
ref|XP_010433089.1|  PREDICTED: protein arginine N-methyltransfer...    244   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_006451413.1|  hypothetical protein CICLE_v10008497mg             244   3e-74   Citrus clementina [clementine]
gb|EMS62209.1|  putative protein arginine N-methyltransferase 1         243   3e-74   Triticum urartu
ref|XP_010090015.1|  Protein arginine N-methyltransferase 1.1           244   3e-74   Morus notabilis
gb|KHG04416.1|  Protein arginine N-methyltransferase 1.1                244   4e-74   Gossypium arboreum [tree cotton]
ref|XP_009405716.1|  PREDICTED: probable protein arginine N-methy...    243   5e-74   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACE82047.1|  putative protein arginine N-methyltransferase 1         243   5e-74   Musa acuminata AAA Group [Cavendish banana]
gb|ABK24509.1|  unknown                                                 242   6e-74   Picea sitchensis
ref|XP_011659967.1|  PREDICTED: protein arginine N-methyltransfer...    243   8e-74   Cucumis sativus [cucumbers]
ref|XP_011013847.1|  PREDICTED: protein arginine N-methyltransfer...    242   9e-74   Populus euphratica
gb|EYU41603.1|  hypothetical protein MIMGU_mgv1a0128561mg               236   1e-73   Erythranthe guttata [common monkey flower]
gb|EMT02681.1|  hypothetical protein F775_27549                         242   2e-73   
ref|NP_001242055.1|  uncharacterized protein LOC100795951               241   2e-73   Glycine max [soybeans]
ref|XP_008450827.1|  PREDICTED: protein arginine N-methyltransfer...    242   2e-73   Cucumis melo [Oriental melon]
gb|KHN32907.1|  Hypothetical protein glysoja_037078                     241   2e-73   Glycine soja [wild soybean]
ref|XP_003529075.1|  PREDICTED: probable protein arginine N-methy...    240   4e-73   Glycine max [soybeans]
gb|ACU24230.1|  unknown                                                 240   4e-73   Glycine max [soybeans]
ref|XP_011004711.1|  PREDICTED: probable protein arginine N-methy...    241   5e-73   Populus euphratica
ref|XP_010548677.1|  PREDICTED: protein arginine N-methyltransfer...    240   6e-73   Tarenaya hassleriana [spider flower]
ref|XP_004287525.1|  PREDICTED: probable protein arginine N-methy...    240   6e-73   Fragaria vesca subsp. vesca
ref|XP_002514159.1|  protein arginine n-methyltransferase 1, puta...    240   7e-73   Ricinus communis
ref|XP_012076792.1|  PREDICTED: probable protein arginine N-methy...    240   9e-73   Jatropha curcas
ref|NP_194680.1|  arginine methyltransferase 11                         239   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002462268.1|  hypothetical protein SORBIDRAFT_02g022770          239   1e-72   Sorghum bicolor [broomcorn]
gb|AAL36326.1|  putative arginine methyltransferase pam1                239   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006661156.1|  PREDICTED: probable protein arginine N-methy...    239   1e-72   
ref|XP_006854005.2|  PREDICTED: probable protein arginine N-methy...    239   2e-72   Amborella trichopoda
ref|XP_010438290.1|  PREDICTED: protein arginine N-methyltransfer...    239   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_008795468.1|  PREDICTED: probable protein arginine N-methy...    239   2e-72   Phoenix dactylifera
ref|NP_001149819.1|  LOC100283446                                       238   3e-72   Zea mays [maize]
ref|XP_007012896.1|  Arginine methyltransferase 11                      238   4e-72   Theobroma cacao [chocolate]
ref|XP_010416788.1|  PREDICTED: probable protein arginine N-methy...    237   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_002883976.1|  hypothetical protein ARALYDRAFT_343233             237   6e-72   Arabidopsis lyrata subsp. lyrata
ref|XP_008391506.1|  PREDICTED: probable protein arginine N-methy...    238   6e-72   
emb|CAA07570.1|  arginine methyltransferase                             237   6e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001062975.1|  Os09g0359800                                       237   9e-72   
ref|XP_009352612.1|  PREDICTED: probable protein arginine N-methy...    236   9e-72   
ref|XP_010262205.1|  PREDICTED: probable protein arginine N-methy...    237   1e-71   Nelumbo nucifera [Indian lotus]
ref|XP_003578015.1|  PREDICTED: probable protein arginine N-methy...    237   1e-71   Brachypodium distachyon [annual false brome]
ref|XP_010541026.1|  PREDICTED: protein arginine N-methyltransfer...    237   1e-71   Tarenaya hassleriana [spider flower]
gb|KCW82249.1|  hypothetical protein EUGRSUZ_C03665                     235   2e-71   Eucalyptus grandis [rose gum]
ref|XP_010049564.1|  PREDICTED: probable protein arginine N-methy...    236   3e-71   Eucalyptus grandis [rose gum]
emb|CDY30213.1|  BnaA03g49570D                                          235   4e-71   Brassica napus [oilseed rape]
emb|CDY35877.1|  BnaA07g01100D                                          234   5e-71   Brassica napus [oilseed rape]
ref|XP_009102148.1|  PREDICTED: probable protein arginine N-methy...    234   5e-71   Brassica rapa
gb|AFK37387.1|  unknown                                                 229   6e-71   Lotus japonicus
ref|XP_004956642.1|  PREDICTED: probable protein arginine N-methy...    235   6e-71   Setaria italica
ref|XP_010495935.1|  PREDICTED: probable protein arginine N-methy...    234   7e-71   Camelina sativa [gold-of-pleasure]
emb|CDX82711.1|  BnaC07g01550D                                          234   9e-71   
gb|KFK40319.1|  protein arginine n-methyltransferase 1                  233   9e-71   Arabis alpina [alpine rockcress]
gb|KJB54345.1|  hypothetical protein B456_009G030600                    234   1e-70   Gossypium raimondii
ref|XP_010924490.1|  PREDICTED: probable protein arginine N-methy...    234   1e-70   Elaeis guineensis
gb|EPS59604.1|  hypothetical protein M569_15200                         232   2e-70   Genlisea aurea
ref|XP_004513091.1|  PREDICTED: protein arginine N-methyltransfer...    233   2e-70   Cicer arietinum [garbanzo]
gb|KHG04415.1|  Protein arginine N-methyltransferase 1.1                243   3e-70   Gossypium arboreum [tree cotton]
gb|KHG04414.1|  Protein arginine N-methyltransferase 1.1                243   4e-70   Gossypium arboreum [tree cotton]
ref|XP_008362974.1|  PREDICTED: probable protein arginine N-methy...    231   4e-70   
ref|XP_002966400.1|  hypothetical protein SELMODRAFT_86090              230   9e-70   
gb|ACJ83303.1|  unknown                                                 228   1e-69   Medicago truncatula
ref|XP_010666534.1|  PREDICTED: protein arginine N-methyltransfer...    231   2e-69   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA61138.1|  TPA: hypothetical protein ZEAMMB73_148337              231   2e-69   
gb|KJB65111.1|  hypothetical protein B456_010G081400                    231   2e-69   Gossypium raimondii
ref|NP_179557.1|  protein arginine N-methyltransferase 1                230   3e-69   Arabidopsis thaliana [mouse-ear cress]
emb|CDY47762.1|  BnaC07g41980D                                          230   5e-69   Brassica napus [oilseed rape]
ref|XP_006408885.1|  hypothetical protein EUTSA_v10002025mg             228   1e-68   
ref|XP_002869429.1|  hypothetical protein ARALYDRAFT_491807             229   1e-68   
ref|XP_003620880.1|  Arginine methyltransferease                        228   2e-68   
gb|AES77098.2|  arginine N-methyltransferase                            228   2e-68   Medicago truncatula
gb|AFK35108.1|  unknown                                                 228   3e-68   Medicago truncatula
ref|XP_006412834.1|  hypothetical protein EUTSA_v100269450mg            225   3e-68   
ref|XP_002309219.2|  hypothetical protein POPTR_0006s15380g             226   8e-67   
gb|KHG19349.1|  Protein arginine N-methyltransferase 1                  208   1e-60   Gossypium arboreum [tree cotton]
ref|XP_001703304.1|  protein arginine N-methyltransferase               206   4e-60   Chlamydomonas reinhardtii
gb|ETO29521.1|  hypothetical protein RFI_07602                          202   1e-58   Reticulomyxa filosa
ref|XP_008613095.1|  protein arginine N-methyltransferase               201   2e-58   Saprolegnia diclina VS20
ref|XP_002946963.1|  hypothetical protein VOLCADRAFT_56214              200   3e-58   Volvox carteri f. nagariensis
ref|XP_002896996.1|  protein arginine N-methyltransferase 1             200   4e-58   Phytophthora infestans T30-4
gb|ETK85528.1|  hypothetical protein L915_09678                         200   7e-58   Phytophthora parasitica
gb|ETI45576.1|  hypothetical protein F443_09880                         199   8e-58   Phytophthora parasitica P1569
ref|XP_008892913.1|  hypothetical protein PPTG_01388                    199   9e-58   Phytophthora parasitica INRA-310
ref|XP_002177025.1|  predicted protein                                  201   3e-57   Phaeodactylum tricornutum CCAP 1055/1
gb|AAO32621.1|  CR061 protein                                           195   3e-56   Chlamydomonas reinhardtii
gb|KDO24558.1|  hypothetical protein SPRG_20913                         193   4e-56   Saprolegnia parasitica CBS 223.65
ref|XP_011013848.1|  PREDICTED: probable protein arginine N-methy...    195   4e-56   Populus euphratica
gb|KDO24020.1|  protein arginine N-methyltransferase                    194   7e-56   Saprolegnia parasitica CBS 223.65
ref|XP_005646141.1|  protein arginine N-methyltransferase               194   1e-55   Coccomyxa subellipsoidea C-169
ref|XP_009526476.1|  putative arginine N-methyltransferase              193   2e-55   Phytophthora sojae
ref|XP_009840743.1|  hypothetical protein H257_14578                    193   2e-55   Aphanomyces astaci
ref|XP_006451412.1|  hypothetical protein CICLE_v10008497mg             191   8e-55   
gb|KJB54348.1|  hypothetical protein B456_009G030600                    191   9e-55   Gossypium raimondii
ref|NP_001171787.1|  protein arginine N-methyltransferase 1-like        192   1e-54   Saccoglossus kowalevskii
tpg|DAA61136.1|  TPA: hypothetical protein ZEAMMB73_148337              190   2e-54   
dbj|BAD23315.1|  putative protein-arginine N-methyltransferase          190   2e-54   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006298196.1|  hypothetical protein CARUB_v10014243mg             190   2e-54   
ref|XP_001763062.1|  protein arginine N-methyltransferase               189   5e-54   
gb|EJK72738.1|  hypothetical protein THAOC_05697                        189   6e-54   Thalassiosira oceanica
ref|XP_006795829.1|  PREDICTED: protein arginine N-methyltransfer...    187   7e-54   Neolamprologus brichardi [lyretail cichlid]
ref|XP_008434746.1|  PREDICTED: protein arginine N-methyltransfer...    191   7e-54   
ref|XP_001460028.1|  hypothetical protein                               190   7e-54   Paramecium tetraurelia strain d4-2
ref|XP_008434747.1|  PREDICTED: protein arginine N-methyltransfer...    191   8e-54   
ref|XP_007252470.1|  PREDICTED: protein arginine N-methyltransfer...    191   8e-54   Astyanax mexicanus [blind cave fish]
ref|XP_008434748.1|  PREDICTED: protein arginine N-methyltransfer...    191   9e-54   
ref|XP_005230922.1|  PREDICTED: protein arginine N-methyltransfer...    191   1e-53   
ref|XP_007553288.1|  PREDICTED: protein arginine N-methyltransfer...    191   1e-53   Poecilia formosa
ref|XP_007553287.1|  PREDICTED: protein arginine N-methyltransfer...    191   1e-53   Poecilia formosa
ref|XP_001758827.1|  protein arginine N-methyltransferase               187   1e-53   
ref|XP_010741443.1|  PREDICTED: protein arginine N-methyltransfer...    188   1e-53   
ref|XP_008434745.1|  PREDICTED: protein arginine N-methyltransfer...    191   1e-53   
ref|XP_008878837.1|  hypothetical protein H310_13207                    188   2e-53   Aphanomyces invadans
ref|XP_008434744.1|  PREDICTED: protein arginine N-methyltransfer...    190   2e-53   
emb|CDO75360.1|  hypothetical protein BN946_scf184966.g28               188   2e-53   Trametes cinnabarina
gb|ERN15472.1|  hypothetical protein AMTR_s00036p00239020               187   2e-53   Amborella trichopoda
ref|NP_001038507.1|  protein arginine N-methyltransferase 8-B           187   2e-53   Danio rerio [leopard danio]
ref|XP_005795825.1|  PREDICTED: protein arginine N-methyltransfer...    190   2e-53   
emb|CDH55325.1|  protein arginine n-methyltransferase                   187   2e-53   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_003972845.1|  PREDICTED: protein arginine N-methyltransfer...    189   3e-53   
emb|CDS11933.1|  hypothetical protein LRAMOSA04129                      187   3e-53   Lichtheimia ramosa
gb|KDQ55829.1|  hypothetical protein JAAARDRAFT_37247                   187   4e-53   Jaapia argillacea MUCL 33604
emb|CAF98851.1|  unnamed protein product                                191   5e-53   Tetraodon nigroviridis
ref|XP_005734858.1|  PREDICTED: protein arginine N-methyltransfer...    189   6e-53   Pundamilia nyererei
ref|XP_004634066.1|  PREDICTED: protein arginine N-methyltransfer...    185   6e-53   
gb|ABB45733.1|  HMT hnRNP methyltransferase-like 2                      182   6e-53   Ovis aries [domestic sheep]
ref|XP_005734857.1|  PREDICTED: protein arginine N-methyltransfer...    189   6e-53   
ref|XP_005164712.1|  PREDICTED: protein arginine N-methyltransfer...    189   7e-53   Danio rerio [leopard danio]
ref|XP_005164711.1|  PREDICTED: protein arginine N-methyltransfer...    189   7e-53   Danio rerio [leopard danio]
ref|XP_005734859.1|  PREDICTED: protein arginine N-methyltransfer...    188   7e-53   
ref|XP_011519270.1|  PREDICTED: protein arginine N-methyltransfer...    183   8e-53   
ref|XP_005471154.1|  PREDICTED: protein arginine N-methyltransfer...    188   8e-53   Oreochromis niloticus
ref|XP_003447109.1|  PREDICTED: protein arginine N-methyltransfer...    188   8e-53   
ref|XP_004568324.1|  PREDICTED: protein arginine N-methyltransfer...    188   9e-53   Maylandia zebra
ref|XP_011239703.1|  PREDICTED: protein arginine N-methyltransfer...    184   9e-53   
ref|XP_010755120.1|  PREDICTED: protein arginine N-methyltransfer...    188   9e-53   
ref|XP_004568325.1|  PREDICTED: protein arginine N-methyltransfer...    187   1e-52   
ref|XP_010885649.1|  PREDICTED: protein arginine N-methyltransfer...    188   1e-52   Esox lucius
ref|XP_005471155.1|  PREDICTED: protein arginine N-methyltransfer...    187   1e-52   
gb|EWM25412.1|  protein arginine N-methyltransferase                    187   1e-52   Nannochloropsis gaditana
ref|XP_010885648.1|  PREDICTED: protein arginine N-methyltransfer...    188   1e-52   Esox lucius
ref|XP_004548340.1|  PREDICTED: protein arginine N-methyltransfer...    187   1e-52   
ref|XP_004646492.1|  PREDICTED: protein arginine N-methyltransfer...    184   1e-52   
ref|XP_011398282.1|  putative protein arginine N-methyltransferase 1    186   1e-52   Auxenochlorella protothecoides
ref|XP_003445042.1|  PREDICTED: protein arginine N-methyltransfer...    187   1e-52   
ref|XP_003200481.1|  PREDICTED: protein arginine N-methyltransfer...    188   1e-52   Danio rerio [leopard danio]
ref|XP_008313886.1|  PREDICTED: protein arginine N-methyltransfer...    188   1e-52   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004646489.1|  PREDICTED: protein arginine N-methyltransfer...    187   1e-52   Octodon degus
ref|XP_002288454.1|  predicted protein                                  187   2e-52   Thalassiosira pseudonana CCMP1335
ref|XP_010776836.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-52   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_005805954.1|  PREDICTED: protein arginine N-methyltransfer...    187   2e-52   
ref|XP_008291045.1|  PREDICTED: protein arginine N-methyltransfer...    187   2e-52   Stegastes partitus
ref|XP_003967225.2|  PREDICTED: protein arginine N-methyltransfer...    186   2e-52   
ref|XP_007564093.1|  PREDICTED: protein arginine N-methyltransfer...    187   2e-52   Poecilia formosa
ref|XP_008398849.1|  PREDICTED: protein arginine N-methyltransfer...    187   2e-52   Poecilia reticulata
ref|XP_008310071.1|  PREDICTED: protein arginine N-methyltransfer...    187   2e-52   
ref|XP_008291515.1|  PREDICTED: protein arginine N-methyltransfer...    187   2e-52   Stegastes partitus
ref|XP_005805953.1|  PREDICTED: protein arginine N-methyltransfer...    187   2e-52   
ref|XP_008291516.1|  PREDICTED: protein arginine N-methyltransfer...    187   2e-52   Stegastes partitus
ref|XP_008310073.1|  PREDICTED: protein arginine N-methyltransfer...    186   2e-52   
ref|XP_001639674.1|  predicted protein                                  186   2e-52   Nematostella vectensis
ref|XP_008291517.1|  PREDICTED: protein arginine N-methyltransfer...    187   2e-52   Stegastes partitus
ref|XP_005451680.1|  PREDICTED: protein arginine N-methyltransfer...    187   2e-52   
ref|XP_008310072.1|  PREDICTED: protein arginine N-methyltransfer...    187   2e-52   
ref|XP_010785893.1|  PREDICTED: protein arginine N-methyltransfer...    187   2e-52   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008310074.1|  PREDICTED: protein arginine N-methyltransfer...    186   3e-52   
ref|XP_008310069.1|  PREDICTED: protein arginine N-methyltransfer...    187   3e-52   
ref|XP_011489450.1|  PREDICTED: protein arginine N-methyltransfer...    186   3e-52   Oryzias latipes [Japanese rice fish]
ref|XP_005805955.1|  PREDICTED: protein arginine N-methyltransfer...    186   3e-52   
ref|XP_008310070.1|  PREDICTED: protein arginine N-methyltransfer...    187   3e-52   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003384941.1|  PREDICTED: protein arginine N-methyltransfer...    184   4e-52   
ref|XP_006160195.1|  PREDICTED: protein arginine N-methyltransfer...    184   4e-52   
gb|EUC58215.1|  arginine N-methyltransferase                            184   4e-52   Rhizoctonia solani AG-3 Rhs1AP
gb|EJT52753.1|  protein arginine n-methyltransferase                    184   5e-52   Trichosporon asahii var. asahii CBS 2479
ref|XP_004634065.1|  PREDICTED: protein arginine N-methyltransfer...    185   5e-52   
ref|XP_006633810.1|  PREDICTED: protein arginine N-methyltransfer...    186   5e-52   
ref|XP_004083213.1|  PREDICTED: protein arginine N-methyltransfer...    186   5e-52   Oryzias latipes [Japanese rice fish]
ref|XP_010776837.1|  PREDICTED: protein arginine N-methyltransfer...    179   6e-52   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006633811.1|  PREDICTED: protein arginine N-methyltransfer...    186   6e-52   
gb|KDR74976.1|  hypothetical protein GALMADRAFT_248796                  184   6e-52   Galerina marginata CBS 339.88
ref|XP_006633809.1|  PREDICTED: protein arginine N-methyltransfer...    186   7e-52   Lepisosteus oculatus
ref|XP_007531367.1|  PREDICTED: protein arginine N-methyltransfer...    182   7e-52   Erinaceus europaeus [common hedgehog]
ref|XP_007074349.1|  PREDICTED: protein arginine N-methyltransfer...    183   7e-52   
emb|CDJ67059.1|  arginine N-methyltransferase 1, putative               186   7e-52   Eimeria necatrix
ref|XP_007941041.1|  PREDICTED: protein arginine N-methyltransfer...    185   7e-52   Orycteropus afer afer
emb|CEL61324.1|  protein arginine N-methyltransferase 1                 184   8e-52   Rhizoctonia solani AG-1 IB
ref|XP_004071919.1|  PREDICTED: protein arginine N-methyltransfer...    184   8e-52   Oryzias latipes [Japanese rice fish]
emb|CDJ41812.1|  arginine N-methyltransferase 1, putative               185   8e-52   Eimeria tenella
ref|XP_010881612.1|  PREDICTED: protein arginine N-methyltransfer...    186   8e-52   Esox lucius
gb|KFH05099.1|  histone arginine methyltransferase PRMT1                182   8e-52   Toxoplasma gondii VAND
ref|XP_010789868.1|  PREDICTED: protein arginine N-methyltransfer...    189   9e-52   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_004646490.1|  PREDICTED: protein arginine N-methyltransfer...    184   9e-52   Octodon degus
ref|XP_007531365.1|  PREDICTED: protein arginine N-methyltransfer...    184   9e-52   Erinaceus europaeus [common hedgehog]
ref|XP_009503841.1|  PREDICTED: protein arginine N-methyltransfer...    183   1e-51   Phalacrocorax carbo [common cormorant]
ref|XP_010079528.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-51   Pterocles gutturalis
ref|XP_003976090.1|  PREDICTED: protein arginine N-methyltransfer...    184   1e-51   Takifugu rubripes [tiger puffer]
ref|XP_009100912.1|  PREDICTED: protein arginine N-methyltransfer...    185   1e-51   
ref|XP_004646491.1|  PREDICTED: protein arginine N-methyltransfer...    184   1e-51   
ref|XP_005815116.1|  PREDICTED: protein arginine N-methyltransfer...    184   1e-51   Xiphophorus maculatus
ref|XP_003269731.2|  PREDICTED: protein arginine N-methyltransfer...    184   1e-51   
ref|XP_011615232.1|  PREDICTED: protein arginine N-methyltransfer...    184   1e-51   Takifugu rubripes [tiger puffer]
ref|XP_008633092.1|  PREDICTED: protein arginine N-methyltransfer...    184   1e-51   
ref|XP_005433881.1|  PREDICTED: protein arginine N-methyltransfer...    184   1e-51   
ref|XP_001746880.1|  hypothetical protein                               183   1e-51   Monosiga brevicollis MX1
ref|XP_005011706.1|  PREDICTED: protein arginine N-methyltransfer...    183   1e-51   Anas platyrhynchos [duck]
ref|XP_003456914.1|  PREDICTED: protein arginine N-methyltransfer...    184   1e-51   
gb|KFV55408.1|  Protein arginine N-methyltransferase 8                  182   1e-51   Tyto alba [Schleiereule]
ref|XP_004286220.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-51   
gb|KFW91495.1|  Protein arginine N-methyltransferase 8                  184   1e-51   Phalacrocorax carbo [common cormorant]
ref|XP_009968359.1|  PREDICTED: protein arginine N-methyltransfer...    181   1e-51   Tyto alba [Schleiereule]
ref|XP_004628126.1|  PREDICTED: protein arginine N-methyltransfer...    181   1e-51   
gb|ABM83307.1|  protein arginine methyltransferase 8                    183   1e-51   synthetic construct
gb|KFO60019.1|  Protein arginine N-methyltransferase 8                  184   2e-51   Corvus brachyrhynchos
ref|XP_005011705.1|  PREDICTED: protein arginine N-methyltransfer...    183   2e-51   
ref|XP_010176495.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-51   
ref|XP_004381697.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-51   
gb|KFZ52530.1|  Protein arginine N-methyltransferase 8                  182   2e-51   Antrostomus carolinensis
ref|XP_005494607.1|  PREDICTED: protein arginine N-methyltransfer...    184   2e-51   Zonotrichia albicollis
ref|XP_005061526.1|  PREDICTED: protein arginine N-methyltransfer...    184   2e-51   Ficedula albicollis
ref|XP_008633090.1|  PREDICTED: protein arginine N-methyltransfer...    184   2e-51   
ref|XP_002194561.1|  PREDICTED: protein arginine N-methyltransfer...    184   2e-51   Taeniopygia guttata
ref|XP_003273857.2|  PREDICTED: protein arginine N-methyltransfer...    182   2e-51   
ref|XP_005531089.1|  PREDICTED: protein arginine N-methyltransfer...    184   2e-51   Pseudopodoces humilis [Tibetan ground-jay]
gb|KFV00595.1|  Protein arginine N-methyltransferase 8                  182   2e-51   Pterocles gutturalis
ref|XP_006069078.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-51   Bubalus bubalis [domestic water buffalo]
dbj|GAN06098.1|  protein arginine N-methyltransferase                   182   2e-51   Mucor ambiguus
ref|XP_003406851.1|  PREDICTED: protein arginine N-methyltransfer...    184   2e-51   Loxodonta africana [African bush elephant]
gb|EPY52601.1|  type I protein arginine N-methyltransferase Rmt1        182   2e-51   Schizosaccharomyces cryophilus OY26
ref|XP_001366105.1|  PREDICTED: protein arginine N-methyltransfer...    184   2e-51   Monodelphis domestica
ref|XP_004459071.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-51   Dasypus novemcinctus
ref|XP_004710501.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-51   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_010752564.1|  PREDICTED: protein arginine N-methyltransfer...    183   2e-51   Larimichthys crocea [croceine croaker]
ref|XP_010145506.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-51   Eurypyga helias
ref|XP_004672290.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-51   Jaculus jaculus
ref|NP_001193971.1|  protein arginine N-methyltransferase 1 isofo...    181   2e-51   Homo sapiens [man]
gb|ADO32994.1|  arginine N-methyltransferase 1                          183   2e-51   Biston betularia [peppered moth]
ref|XP_011476959.1|  PREDICTED: protein arginine N-methyltransfer...    182   3e-51   Oryzias latipes [Japanese rice fish]
ref|XP_004619902.1|  PREDICTED: protein arginine N-methyltransfer...    181   3e-51   Sorex araneus [Eurasian shrew]
ref|XP_006862745.1|  PREDICTED: protein arginine N-methyltransfer...    182   3e-51   Chrysochloris asiatica
ref|XP_012013205.1|  PREDICTED: protein arginine N-methyltransfer...    183   3e-51   
ref|XP_008573608.1|  PREDICTED: protein arginine N-methyltransfer...    183   3e-51   Galeopterus variegatus [Malayan flying lemur]
gb|EKD00720.1|  protein arginine n-methyltransferase                    182   3e-51   Trichosporon asahii var. asahii CBS 8904
ref|XP_004710499.1|  PREDICTED: protein arginine N-methyltransfer...    183   3e-51   Echinops telfairi [lesser hedgehog tenrec]
ref|NP_001527.3|  protein arginine N-methyltransferase 1 isoform 1      183   3e-51   Homo sapiens [man]
sp|Q99873.2|ANM1_HUMAN  RecName: Full=Protein arginine N-methyltr...    183   3e-51   
ref|NP_062804.1|  protein arginine N-methyltransferase 1 isoform 1      183   3e-51   Mus musculus [mouse]
ref|XP_003801526.1|  PREDICTED: protein arginine N-methyltransfer...    183   3e-51   Otolemur garnettii
ref|XP_004879605.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    183   3e-51   
gb|AAH22458.2|  Protein arginine methyltransferase 8                    184   3e-51   Homo sapiens [man]
ref|XP_004672288.1|  PREDICTED: protein arginine N-methyltransfer...    183   3e-51   Jaculus jaculus
ref|XP_005815117.1|  PREDICTED: protein arginine N-methyltransfer...    182   3e-51   Xiphophorus maculatus
gb|ERZ97782.1|  hypothetical protein GLOINDRAFT_339952                  182   3e-51   
ref|XP_008843306.1|  PREDICTED: protein arginine N-methyltransfer...    183   4e-51   Nannospalax galili
ref|XP_001521175.2|  PREDICTED: protein arginine N-methyltransfer...    183   4e-51   
ref|XP_008297814.1|  PREDICTED: protein arginine N-methyltransfer...    182   4e-51   Stegastes partitus
ref|XP_005412910.1|  PREDICTED: protein arginine N-methyltransfer...    184   4e-51   Chinchilla lanigera
ref|XP_003771354.1|  PREDICTED: protein arginine N-methyltransfer...    184   4e-51   
ref|XP_004286218.1|  PREDICTED: protein arginine N-methyltransfer...    183   4e-51   
ref|XP_006027874.1|  PREDICTED: protein arginine N-methyltransfer...    182   4e-51   
ref|XP_012046099.1|  PREDICTED: protein arginine N-methyltransfer...    183   4e-51   
ref|XP_007941044.1|  PREDICTED: protein arginine N-methyltransfer...    181   4e-51   
ref|XP_010715370.1|  PREDICTED: protein arginine N-methyltransfer...    182   4e-51   
ref|XP_004619900.1|  PREDICTED: protein arginine N-methyltransfer...    183   4e-51   
ref|XP_010142849.1|  PREDICTED: protein arginine N-methyltransfer...    182   4e-51   
ref|XP_007397106.1|  hypothetical protein PHACADRAFT_258242             181   4e-51   
gb|KFQ83031.1|  Protein arginine N-methyltransferase 8                  183   4e-51   
gb|KIM83186.1|  hypothetical protein PILCRDRAFT_819400                  182   4e-51   
ref|XP_004409951.1|  PREDICTED: protein arginine N-methyltransfer...    180   4e-51   
ref|XP_008528836.1|  PREDICTED: protein arginine N-methyltransfer...    182   4e-51   
ref|XP_004573169.1|  PREDICTED: protein arginine N-methyltransfer...    182   4e-51   
ref|XP_010200870.1|  PREDICTED: protein arginine N-methyltransfer...    182   4e-51   
ref|XP_009873065.1|  PREDICTED: protein arginine N-methyltransfer...    182   5e-51   
gb|EDK99863.1|  protein arginine N-methyltransferase 8, isoform C...    182   5e-51   
ref|XP_005366989.1|  PREDICTED: protein arginine N-methyltransfer...    182   5e-51   
ref|XP_008948014.1|  PREDICTED: protein arginine N-methyltransfer...    182   5e-51   
ref|XP_004938137.1|  PREDICTED: protein arginine N-methyltransfer...    182   5e-51   
ref|XP_006986292.1|  PREDICTED: protein arginine N-methyltransfer...    182   5e-51   
ref|XP_007531366.1|  PREDICTED: protein arginine N-methyltransfer...    182   5e-51   
ref|XP_008173943.1|  PREDICTED: protein arginine N-methyltransfer...    181   5e-51   
ref|XP_009901154.1|  PREDICTED: protein arginine N-methyltransfer...    183   5e-51   
gb|KFV69130.1|  Protein arginine N-methyltransferase 8                  182   5e-51   
ref|XP_006862744.1|  PREDICTED: protein arginine N-methyltransfer...    183   5e-51   
ref|XP_003514128.1|  PREDICTED: protein arginine N-methyltransfer...    182   5e-51   
ref|XP_003940417.1|  PREDICTED: protein arginine N-methyltransfer...    182   5e-51   
ref|XP_004344846.1|  arginine nmethyltransferase, putative              182   5e-51   
ref|XP_011909585.1|  PREDICTED: protein arginine N-methyltransfer...    181   5e-51   
ref|XP_006108747.1|  PREDICTED: protein arginine N-methyltransfer...    180   5e-51   
ref|XP_008152569.1|  PREDICTED: protein arginine N-methyltransfer...    180   5e-51   
ref|XP_010945432.1|  PREDICTED: protein arginine N-methyltransfer...    184   6e-51   
ref|XP_005084155.1|  PREDICTED: protein arginine N-methyltransfer...    182   6e-51   
ref|XP_004409948.1|  PREDICTED: protein arginine N-methyltransfer...    182   6e-51   
gb|KIJ39883.1|  hypothetical protein M422DRAFT_49404                    182   6e-51   
gb|KFW01075.1|  Protein arginine N-methyltransferase 8                  182   6e-51   
ref|XP_005879600.1|  PREDICTED: protein arginine N-methyltransfer...    180   6e-51   
ref|XP_005258901.1|  PREDICTED: protein arginine N-methyltransfer...    180   6e-51   
ref|XP_010803915.1|  PREDICTED: protein arginine N-methyltransfer...    181   6e-51   
gb|KFU91713.1|  Protein arginine N-methyltransferase 8                  182   6e-51   
ref|XP_003481946.1|  PREDICTED: protein arginine N-methyltransfer...    180   6e-51   
gb|KFP91466.1|  Protein arginine N-methyltransferase 8                  182   6e-51   
ref|XP_005877065.1|  PREDICTED: protein arginine N-methyltransfer...    181   6e-51   
gb|KFV83367.1|  Protein arginine N-methyltransferase 8                  182   6e-51   
gb|KFP32011.1|  Protein arginine N-methyltransferase 8                  182   6e-51   
ref|XP_008570233.1|  PREDICTED: protein arginine N-methyltransfer...    181   6e-51   
ref|XP_006923913.1|  PREDICTED: protein arginine N-methyltransfer...    181   6e-51   
ref|XP_004472661.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    182   7e-51   
gb|KGL76838.1|  Protein arginine N-methyltransferase 8                  182   7e-51   
gb|AAH60250.1|  Protein arginine N-methyltransferase 8                  182   7e-51   
ref|XP_005664132.1|  PREDICTED: protein arginine N-methyltransfer...    181   7e-51   
gb|KFO85337.1|  Protein arginine N-methyltransferase 8                  182   7e-51   
ref|XP_010212332.1|  PREDICTED: protein arginine N-methyltransfer...    183   7e-51   
ref|XP_004052568.1|  PREDICTED: protein arginine N-methyltransfer...    181   7e-51   
gb|KFM02777.1|  Protein arginine N-methyltransferase 8                  182   7e-51   
ref|XP_009677117.1|  PREDICTED: protein arginine N-methyltransfer...    183   7e-51   
ref|XP_005011704.1|  PREDICTED: protein arginine N-methyltransfer...    183   7e-51   
ref|XP_005957071.1|  PREDICTED: protein arginine N-methyltransfer...    182   7e-51   
gb|EXX60127.1|  Hmt1p                                                   182   7e-51   
ref|XP_006742475.1|  PREDICTED: protein arginine N-methyltransfer...    181   7e-51   
ref|XP_006123095.1|  PREDICTED: protein arginine N-methyltransfer...    183   7e-51   
gb|KFO13519.1|  Protein arginine N-methyltransferase 8                  182   7e-51   
ref|XP_006265456.1|  PREDICTED: protein arginine N-methyltransfer...    183   7e-51   
gb|EPX72821.1|  type I protein arginine N-methyltransferase Rmt1        181   7e-51   
ref|XP_008570234.1|  PREDICTED: protein arginine N-methyltransfer...    181   7e-51   
ref|XP_009998712.1|  PREDICTED: protein arginine N-methyltransfer...    182   7e-51   
ref|XP_011366167.1|  PREDICTED: protein arginine N-methyltransfer...    181   7e-51   
ref|XP_005509828.1|  PREDICTED: protein arginine N-methyltransfer...    182   7e-51   
ref|XP_010752565.1|  PREDICTED: protein arginine N-methyltransfer...    181   7e-51   
ref|XP_005234459.1|  PREDICTED: protein arginine N-methyltransfer...    182   8e-51   
ref|XP_008109548.1|  PREDICTED: protein arginine N-methyltransfer...    182   8e-51   
ref|XP_009941319.1|  PREDICTED: protein arginine N-methyltransfer...    182   8e-51   
ref|XP_006108745.1|  PREDICTED: protein arginine N-methyltransfer...    182   8e-51   
ref|NP_958759.2|  protein arginine N-methyltransferase 8                182   8e-51   
ref|XP_008152565.1|  PREDICTED: protein arginine N-methyltransfer...    182   8e-51   
gb|EXX60129.1|  Hmt1p                                                   182   8e-51   
ref|XP_003356049.1|  PREDICTED: protein arginine N-methyltransfer...    182   8e-51   
ref|XP_005084803.1|  PREDICTED: protein arginine N-methyltransfer...    179   8e-51   
ref|XP_007443654.1|  PREDICTED: protein arginine N-methyltransfer...    181   9e-51   
ref|XP_004869407.1|  PREDICTED: protein arginine N-methyltransfer...    182   9e-51   
gb|EXX60128.1|  Hmt1p                                                   181   9e-51   
ref|XP_009677116.1|  PREDICTED: protein arginine N-methyltransfer...    182   9e-51   
ref|XP_010328338.1|  PREDICTED: protein arginine N-methyltransfer...    182   9e-51   
gb|KFW05686.1|  Protein arginine N-methyltransferase 8                  182   9e-51   
gb|KFP86054.1|  Protein arginine N-methyltransferase 8                  182   9e-51   
ref|XP_012030947.1|  PREDICTED: protein arginine N-methyltransfer...    182   9e-51   
ref|XP_005378774.1|  PREDICTED: protein arginine N-methyltransfer...    182   9e-51   
ref|XP_001493928.3|  PREDICTED: protein arginine N-methyltransfer...    182   9e-51   
emb|CBK23341.2|  unnamed protein product                                181   1e-50   
ref|XP_009078540.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
gb|KFQ17368.1|  Protein arginine N-methyltransferase 8                  182   1e-50   
ref|XP_005150286.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_423669.2|  PREDICTED: protein arginine N-methyltransferase...    182   1e-50   
ref|XP_004938136.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|NP_956944.2|  protein arginine N-methyltransferase 1                181   1e-50   
ref|XP_005957070.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
emb|CCD15421.1|  unnamed protein product                                180   1e-50   
ref|XP_007526315.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_007435592.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_005879597.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_009422917.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_011984744.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_008682778.1|  PREDICTED: protein arginine N-methyltransfer...    180   1e-50   
emb|CEJ02957.1|  Putative Protein arginine N-methyltransferase          181   1e-50   
ref|XP_005207252.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_005664130.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
gb|EHH20395.1|  Protein arginine N-methyltransferase 8                  182   1e-50   
ref|XP_010589111.1|  PREDICTED: protein arginine N-methyltransfer...    181   1e-50   
ref|XP_004440346.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
gb|KFP50297.1|  Protein arginine N-methyltransferase 8                  181   1e-50   
ref|XP_008034323.1|  S-adenosyl-L-methionine-dependent methyltran...    181   1e-50   
ref|XP_004286219.1|  PREDICTED: protein arginine N-methyltransfer...    181   1e-50   
ref|XP_003406850.1|  PREDICTED: protein arginine N-methyltransfer...    181   1e-50   
gb|KFP08082.1|  Protein arginine N-methyltransferase 8                  181   1e-50   
ref|XP_004869406.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_004597034.1|  PREDICTED: protein arginine N-methyltransfer...    179   1e-50   
emb|CEG65709.1|  Putative Protein arginine N-methyltransferase 1        181   1e-50   
ref|XP_008501453.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_007623371.1|  PREDICTED: protein arginine N-methyltransfer...    181   1e-50   
ref|XP_007117105.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    182   1e-50   
gb|EPT05024.1|  hypothetical protein FOMPIDRAFT_1027698                 181   1e-50   
ref|XP_010584794.1|  PREDICTED: protein arginine N-methyltransfer...    181   1e-50   
ref|XP_008141962.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_005877061.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_004692910.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_004438813.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_005907280.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_004412013.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
gb|EHH65996.1|  Protein arginine N-methyltransferase 8                  182   1e-50   
ref|XP_005681046.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_006987931.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_006069077.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_004007002.2|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_005907279.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_004596404.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_008703093.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_001156280.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
gb|KFO71444.1|  Protein arginine N-methyltransferase 8                  181   1e-50   
gb|EMS18785.1|  protein arginine N-methyltransferase 1                  181   1e-50   
ref|XP_011984742.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_006891364.1|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
ref|XP_543867.4|  PREDICTED: protein arginine N-methyltransferase 8     182   1e-50   
ref|XP_003481748.2|  PREDICTED: protein arginine N-methyltransfer...    182   1e-50   
gb|EGV98493.1|  Protein arginine N-methyltransferase 8                  181   2e-50   
ref|NP_062828.3|  protein arginine N-methyltransferase 8 isoform 1      182   2e-50   
ref|XP_011366165.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
ref|XP_002712862.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
ref|XP_004643631.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
ref|XP_006210896.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
dbj|BAC40573.1|  unnamed protein product                                181   2e-50   
ref|XP_003496072.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
ref|XP_008889425.1|  histone arginine methyltransferase PRMT1           182   2e-50   
ref|XP_002370706.1|  arginine N-methyltransferase 1                     182   2e-50   
ref|XP_005681047.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
ref|XP_002752271.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
ref|XP_002914161.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
ref|XP_003905865.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
pdb|1ORI|A  Chain A, Structure Of The Predominant Protein Arginin...    181   2e-50   
ref|NP_001243465.1|  protein arginine N-methyltransferase 8 isofo...    182   2e-50   
ref|XP_006178989.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
gb|AAH44522.1|  Prmt1 protein                                           181   2e-50   
ref|XP_003796479.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
ref|NP_001193802.1|  protein arginine N-methyltransferase 8             182   2e-50   
dbj|BAE37781.1|  unnamed protein product                                181   2e-50   
ref|XP_004597032.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
ref|NP_001005629.2|  protein arginine N-methyltransferase 1             181   2e-50   
gb|AAH74614.1|  protein arginine methyltransferase 1                    181   2e-50   
ref|XP_003410673.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
ref|XP_005664131.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
ref|XP_008251036.1|  PREDICTED: LOW QUALITY PROTEIN: protein argi...    181   2e-50   
gb|ESS28919.1|  histone arginine methyltransferase PRMT1                182   2e-50   
ref|XP_003514127.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
pdb|1OR8|A  Chain A, Structure Of The Predominant Protein Arginin...    180   2e-50   
ref|XP_007935262.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
ref|XP_004778352.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
ref|XP_006923912.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
ref|XP_008823697.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
ref|NP_077339.1|  protein arginine N-methyltransferase 1                181   2e-50   
ref|XP_003885709.1|  hypothetical protein NCLIV_061070                  182   2e-50   
gb|EPY85314.1|  hypothetical protein CB1_000388003                      182   2e-50   
gb|EFB23931.1|  hypothetical protein PANDA_006261                       180   2e-50   
ref|XP_009569575.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
dbj|BAG65435.1|  unnamed protein product                                181   2e-50   
ref|XP_008257898.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
ref|XP_009577010.1|  PREDICTED: protein arginine N-methyltransfer...    182   2e-50   
ref|XP_008965220.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
gb|AAH19268.2|  PRMT1 protein                                           181   2e-50   
ref|NP_001015624.1|  protein arginine N-methyltransferase 1             181   2e-50   
ref|XP_004710500.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
ref|XP_003801525.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
ref|XP_006229208.1|  PREDICTED: protein arginine N-methyltransfer...    180   2e-50   
ref|XP_008823698.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
gb|KDQ27505.1|  hypothetical protein PLEOSDRAFT_1089362                 180   2e-50   
ref|XP_007362018.1|  S-adenosyl-L-methionine-dependent methyltran...    180   2e-50   
ref|XP_010357473.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
gb|KDQ21747.1|  hypothetical protein BOTBODRAFT_26174                   180   2e-50   
ref|XP_003463342.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
gb|EAW52518.1|  protein arginine methyltransferase 1, isoform CRA_a     181   2e-50   
gb|EIE90908.1|  hypothetical protein RO3G_15619                         180   2e-50   
gb|AIC61980.1|  PRMT1                                                   180   2e-50   
gb|AAF62895.1|AF222689_3  protein arginine N-methyltransferase 1-...    180   2e-50   
ref|XP_008573609.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
ref|NP_001082771.1|  protein arginine N-methyltransferase 1-B           181   2e-50   
gb|EDL22778.1|  protein arginine N-methyltransferase 1, isoform C...    181   2e-50   
dbj|GAA94110.1|  hypothetical protein E5Q_00757                         181   2e-50   
ref|XP_005084801.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
gb|EPZ34592.1|  putative protein arginine N-methyltransferase           180   2e-50   
ref|XP_001113609.2|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
ref|XP_007251132.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
gb|AAH51547.1|  Prmt1 protein                                           180   2e-50   
gb|AAH72069.1|  LOC398716 protein                                       180   2e-50   
ref|XP_006744381.1|  PREDICTED: protein arginine N-methyltransfer...    180   2e-50   
ref|XP_001917777.1|  PREDICTED: protein arginine N-methyltransfer...    180   2e-50   
ref|XP_005001817.1|  PREDICTED: protein arginine N-methyltransfer...    180   2e-50   
gb|AAH57480.1|  Protein arginine methyltransferase 1                    180   2e-50   
gb|AAI06276.1|  LOC398716 protein                                       180   2e-50   
ref|XP_002157035.1|  PREDICTED: protein arginine N-methyltransfer...    181   2e-50   
ref|XP_006229207.1|  PREDICTED: protein arginine N-methyltransfer...    180   2e-50   
ref|XP_005692787.1|  PREDICTED: protein arginine N-methyltransfer...    180   2e-50   
ref|XP_011821406.1|  PREDICTED: protein arginine N-methyltransfer...    180   2e-50   



>ref|XP_009611049.1| PREDICTED: probable protein arginine N-methyltransferase 1.2 
[Nicotiana tomentosiformis]
Length=400

 Score =   290 bits (742),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/200 (75%), Positives = 175/200 (88%), Gaps = 6/200 (3%)
 Frame = +2

Query  239  SKMDSEGLNQTTTGGHDKRPTKIRFeyddeeqqqqrpdqdeTLTESSNLEVEEDTAMC--  412
            S+ ++E  N  +T  HD +P+KI+F+Y+D+EQ  ++ D+  T+TESSNLE++ED +MC  
Sbjct  3    SRTNNENQNSASTSTHDLKPSKIKFQYEDDEQVVEQGDE--TVTESSNLEIDEDVSMCGR  60

Query  413  --DPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKV  586
                SA++DS+V  DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKN+FLFKDKV
Sbjct  61   PASASANDDSIVDVDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNSFLFKDKV  120

Query  587  VLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIEL  766
            VLDVGAGTGILSLFCAKVGAKHVYA+ECS+MA MAQEIVK NGFSDVITVIKGK+EEI+L
Sbjct  121  VLDVGAGTGILSLFCAKVGAKHVYAIECSSMADMAQEIVKLNGFSDVITVIKGKVEEIDL  180

Query  767  PVAQVDIIISEWMGYFLLYE  826
            P+ QVDIIISEWMGYFLLYE
Sbjct  181  PIPQVDIIISEWMGYFLLYE  200



>ref|XP_009804079.1| PREDICTED: probable protein arginine N-methyltransferase 1.2 
[Nicotiana sylvestris]
Length=404

 Score =   283 bits (724),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 146/203 (72%), Positives = 172/203 (85%), Gaps = 8/203 (4%)
 Frame = +2

Query  239  SKMDSEGLNQTTTGGHDKRPTKIRFeyddeeqqqqrpdqdeTLTESSNLEVEEDTAMCDP  418
            S+ ++E  N  +T  HD +P+KI+F+Y+++++Q      + T+TESSNLE++EDT+MCD 
Sbjct  3    SQSNNENQNSASTSTHDLKPSKIKFQYEEDDEQVVEQGDE-TVTESSNLEIDEDTSMCDR  61

Query  419  SADED-------SMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFK  577
            +A          S+V  DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKN+FLFK
Sbjct  62   AAAAAAAAADDDSIVDGDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNSFLFK  121

Query  578  DKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEE  757
            DKVVLDVGAGTGILSLFCAKVGAKHVYA+ECS+MA MAQEIVK NG+SDVITVIKGK+EE
Sbjct  122  DKVVLDVGAGTGILSLFCAKVGAKHVYAIECSSMADMAQEIVKLNGYSDVITVIKGKVEE  181

Query  758  IELPVAQVDIIISEWMGYFLLYE  826
            I+LPV QVDIIISEWMGYFLLYE
Sbjct  182  IDLPVPQVDIIISEWMGYFLLYE  204



>ref|XP_006353524.1| PREDICTED: protein arginine N-methyltransferase 1.1-like [Solanum 
tuberosum]
Length=396

 Score =   282 bits (722),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 150/199 (75%), Positives = 172/199 (86%), Gaps = 8/199 (4%)
 Frame = +2

Query  245  MDSEGLNQT-TTGGHDKRPTKIRFeyddeeqqqqrpdqdeTLTESSN-LEVEEDTAMCDP  418
            MDS   N+   +  + K P+KI+F+Y+D+++Q  + +   T+TESSN LEV+ED +MCDP
Sbjct  1    MDSVSNNEIENSASYGKNPSKIKFQYEDDDEQVVQDE---TVTESSNNLEVDEDISMCDP  57

Query  419  S---ADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVV  589
            +   A +DS VG DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKN+FLFKDKVV
Sbjct  58   TTAAAVDDSTVGGDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNSFLFKDKVV  117

Query  590  LDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELP  769
            LDVGAGTGILSLFCAKVGAKHVYA+ECS+MA MAQEIVK NGFSDVITVIKGK+EEI+LP
Sbjct  118  LDVGAGTGILSLFCAKVGAKHVYAIECSSMADMAQEIVKLNGFSDVITVIKGKVEEIDLP  177

Query  770  VAQVDIIISEWMGYFLLYE  826
            V QVDIIISEWMGYFLLYE
Sbjct  178  VPQVDIIISEWMGYFLLYE  196



>ref|XP_004251660.1| PREDICTED: protein arginine N-methyltransferase 1.1 [Solanum 
lycopersicum]
Length=396

 Score =   280 bits (715),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 147/199 (74%), Positives = 170/199 (85%), Gaps = 8/199 (4%)
 Frame = +2

Query  245  MDSEGLNQT-TTGGHDKRPTKIRFeyddeeqqqqrpdqdeTLTESSNLEVEEDTAMCDPS  421
            MDS   N+   +  + K  +KI+F+Y+D+++Q  + +    +TESSNLEV+ED +MCDP+
Sbjct  1    MDSVSNNEIENSASYGKNQSKIKFQYEDDDEQVVQDE---AVTESSNLEVDEDISMCDPT  57

Query  422  ----ADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVV  589
                A ++SMVG DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKN+FLFKDKVV
Sbjct  58   TTAAAVDESMVGGDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNSFLFKDKVV  117

Query  590  LDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELP  769
            LDVGAGTGILSLFCAKVGAKHVYA+ECS+MA  AQEIVK NGFSDVITVIKGK+EEI+LP
Sbjct  118  LDVGAGTGILSLFCAKVGAKHVYAIECSSMADTAQEIVKLNGFSDVITVIKGKVEEIDLP  177

Query  770  VAQVDIIISEWMGYFLLYE  826
            V QVDIIISEWMGYFLLYE
Sbjct  178  VPQVDIIISEWMGYFLLYE  196



>ref|XP_006362769.1| PREDICTED: probable protein arginine N-methyltransferase 1-like 
[Solanum tuberosum]
Length=375

 Score =   276 bits (707),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 2/152 (1%)
 Frame = +2

Query  371  ESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  550
            ESSN+EVEEDT+MCDP   +DS+VG DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV
Sbjct  26   ESSNIEVEEDTSMCDPI--DDSIVGSDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  83

Query  551  IYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVI  730
            IYKN+FL KDKVVLDVGAGTGILSLFCAKVGAKHVYA+ECS+MA MAQEIVK NGFSDVI
Sbjct  84   IYKNSFLIKDKVVLDVGAGTGILSLFCAKVGAKHVYAIECSSMADMAQEIVKLNGFSDVI  143

Query  731  TVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            TVIKGK+EEI+LPV +VDIIISEWMGYFLLYE
Sbjct  144  TVIKGKVEEIDLPVPKVDIIISEWMGYFLLYE  175



>ref|XP_004243149.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Solanum 
lycopersicum]
Length=375

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 143/152 (94%), Gaps = 2/152 (1%)
 Frame = +2

Query  371  ESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  550
            ESSN+EVEEDT+MCDP   ++S+VG +KTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV
Sbjct  26   ESSNIEVEEDTSMCDPI--DESIVGSNKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  83

Query  551  IYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVI  730
            IYKN+FL KDKVVLDVGAGTGILSLFCAKVGAKHVYA+ECS+MA MAQEIVK NGFSDVI
Sbjct  84   IYKNSFLIKDKVVLDVGAGTGILSLFCAKVGAKHVYAIECSSMADMAQEIVKLNGFSDVI  143

Query  731  TVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            TVIKGK+EEI+ PV +VDIIISEWMGYFLLYE
Sbjct  144  TVIKGKVEEIDFPVRKVDIIISEWMGYFLLYE  175



>ref|XP_011093686.1| PREDICTED: protein arginine N-methyltransferase 1.1 [Sesamum 
indicum]
Length=382

 Score =   271 bits (694),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 145/179 (81%), Positives = 158/179 (88%), Gaps = 9/179 (5%)
 Frame = +2

Query  293  RPTKIRFeyddeeqqqqrpdqdeTLTESSNLEVEEDTAMCDPSADEDSMV-GDDKTSADY  469
            +PTKIRFEYDD+E+     +     TESSNLE  EDTAMC+P   EDS   GDDKTSADY
Sbjct  12   QPTKIRFEYDDDEEAGTLEEVA---TESSNLE--EDTAMCEP---EDSFAAGDDKTSADY  63

Query  470  YFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAK  649
            YFDSYSHFGIHEEMLKDVVRTKTYQNVIYKN+FLFKDK+VLDVGAGTGILSLFCAKVGAK
Sbjct  64   YFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNSFLFKDKIVLDVGAGTGILSLFCAKVGAK  123

Query  650  HVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            HVYAVECS+MA MAQEIVK NG+S+VI V+KGKIEEIELPVAQVD+IISEWMGYFL+YE
Sbjct  124  HVYAVECSSMADMAQEIVKLNGYSNVIAVLKGKIEEIELPVAQVDVIISEWMGYFLVYE  182



>ref|XP_009802305.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Nicotiana 
sylvestris]
Length=372

 Score =   270 bits (690),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 142/155 (92%), Gaps = 8/155 (5%)
 Frame = +2

Query  362  TLTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  541
            T+TESSN+EVEEDTAMC+        VG DKTSADYYFDSYSHFGIHEEMLKDVVRTKTY
Sbjct  26   TITESSNVEVEEDTAMCE--------VGGDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  77

Query  542  QNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFS  721
            QNVIYKN+FL KDKVVLDVGAGTGILSLFCAKVGAKHVYA+ECS+MA MA+EIVK NGFS
Sbjct  78   QNVIYKNSFLIKDKVVLDVGAGTGILSLFCAKVGAKHVYAIECSSMADMAKEIVKLNGFS  137

Query  722  DVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            DVITVIKGK+EEI+LPV QVDIIISEWMGYFLLYE
Sbjct  138  DVITVIKGKVEEIDLPVPQVDIIISEWMGYFLLYE  172



>ref|XP_009605132.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Nicotiana 
tomentosiformis]
Length=372

 Score =   270 bits (690),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 142/155 (92%), Gaps = 8/155 (5%)
 Frame = +2

Query  362  TLTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  541
            T+TESSN+EVEEDTAMC+        VG DKTSADYYFDSYSHFGIHEEMLKDVVRTKTY
Sbjct  26   TITESSNVEVEEDTAMCE--------VGGDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  77

Query  542  QNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFS  721
            QNVIYKN+FL KDKVVLDVGAGTGILSLFCAKVGAKHVYA+ECS+MA MA+EIVK NGFS
Sbjct  78   QNVIYKNSFLIKDKVVLDVGAGTGILSLFCAKVGAKHVYAIECSSMADMAKEIVKLNGFS  137

Query  722  DVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            DVITVIKGK+EEI+LPV QVDIIISEWMGYFLLYE
Sbjct  138  DVITVIKGKVEEIDLPVPQVDIIISEWMGYFLLYE  172



>emb|CDP03196.1| unnamed protein product [Coffea canephora]
Length=340

 Score =   259 bits (662),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/140 (87%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = +2

Query  407  MCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKV  586
            M +P  D+ +++G DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKN+FLF+DKV
Sbjct  1    MFEPDPDDGNVIGADKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNSFLFRDKV  60

Query  587  VLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIEL  766
            VLDVGAGTGILSLFCAKVGAKHVYA+ECS+MA MAQEIVK NGFSDVITVIKGK+EEIEL
Sbjct  61   VLDVGAGTGILSLFCAKVGAKHVYAIECSSMADMAQEIVKLNGFSDVITVIKGKVEEIEL  120

Query  767  PVAQVDIIISEWMGYFLLYE  826
            PVAQVD+IISEWMGYFLLYE
Sbjct  121  PVAQVDVIISEWMGYFLLYE  140



>emb|CDY06802.1| BnaC01g09010D [Brassica napus]
Length=389

 Score =   249 bits (636),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 133/155 (86%), Gaps = 1/155 (1%)
 Frame = +2

Query  365  LTESSNLEVEEDTAMCDPSADEDSM-VGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  541
            + E S LE  +D +MC+     D+  V DD TSADYYFDSYSHFGIHEEMLKDVVRTKTY
Sbjct  35   VAEGSGLEAAQDESMCEAGESTDAAEVTDDTTSADYYFDSYSHFGIHEEMLKDVVRTKTY  94

Query  542  QNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFS  721
            QNVIY+N FL KDK+VLDVGAGTGILSLFCAK GAKHVYAVECS MA MA+EIVK+NGFS
Sbjct  95   QNVIYQNKFLIKDKIVLDVGAGTGILSLFCAKAGAKHVYAVECSQMADMAKEIVKANGFS  154

Query  722  DVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            DVITV+KGKIEEIELP  +VD+IISEWMGYFLL+E
Sbjct  155  DVITVLKGKIEEIELPTPKVDVIISEWMGYFLLFE  189



>ref|XP_002282760.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Vitis 
vinifera]
Length=406

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/177 (73%), Positives = 141/177 (80%), Gaps = 24/177 (14%)
 Frame = +2

Query  368  TESSNLE----------VEEDTA----MCDPSADE----------DSMVGDDKTSADYYF  475
            TESSNLE          + +D A    MC+P   +          DS++G DKTSADYYF
Sbjct  30   TESSNLEDPMCDADESTIGQDKAIDDTMCEPGESDKDIARSFELDDSVIGSDKTSADYYF  89

Query  476  DSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHV  655
            DSYSHFGIHEEMLKDVVRTKTYQNVIYKN FLFK+KVVLDVGAGTGILSLFCAK GAKHV
Sbjct  90   DSYSHFGIHEEMLKDVVRTKTYQNVIYKNKFLFKNKVVLDVGAGTGILSLFCAKAGAKHV  149

Query  656  YAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            YAVECS MA MA+EIV+ NGFSDVITV+KGK+EEI LPVAQVDIIISEWMGYFLL+E
Sbjct  150  YAVECSHMADMAKEIVEVNGFSDVITVMKGKVEEIVLPVAQVDIIISEWMGYFLLFE  206



>ref|XP_008242427.1| PREDICTED: probable protein arginine N-methyltransferase 1.2 
[Prunus mume]
Length=400

 Score =   249 bits (635),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/200 (66%), Positives = 153/200 (77%), Gaps = 21/200 (11%)
 Frame = +2

Query  263  NQTTTG-GHDKRPTKIRFeyddeeqqqqrpdqdeTLTESSNLEVEEDTAMCDPSAD---E  430
            NQ++ G  H  + +KIRF   ++E +         L ++S      D +MCDP  D   +
Sbjct  10   NQSSAGFSHLPQGSKIRFADKEDEDE--------ALKDASG-SANHDESMCDPELDKAVD  60

Query  431  DSM--------VGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKV  586
            DSM          DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N FLFKDK+
Sbjct  61   DSMGEPEVSFIAADDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNQFLFKDKI  120

Query  587  VLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIEL  766
            VLDVGAGTGILSLFCAK GA+HVYAVECS MA MA+EIV++NGFS+VITV+KGKIEE+EL
Sbjct  121  VLDVGAGTGILSLFCAKAGAQHVYAVECSDMADMAKEIVEANGFSNVITVLKGKIEELEL  180

Query  767  PVAQVDIIISEWMGYFLLYE  826
            PV +VDIIISEWMGYFLL+E
Sbjct  181  PVPKVDIIISEWMGYFLLFE  200



>ref|XP_009128628.1| PREDICTED: protein arginine N-methyltransferase 1.1 [Brassica 
rapa]
 emb|CDY43510.1| BnaA01g07340D [Brassica napus]
Length=390

 Score =   248 bits (634),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +2

Query  365  LTESSNLEVEEDTAMCDPSADEDS-MVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  541
            + E S  E  +D +MC+     D+  V DD TSADYYFDSYSHFGIHEEMLKDVVRTKTY
Sbjct  36   VAEGSGFEAAQDESMCEAGESTDAAQVTDDTTSADYYFDSYSHFGIHEEMLKDVVRTKTY  95

Query  542  QNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFS  721
            QNVIY+N FL KDK+VLDVGAGTGILSLFCAK GAKHVYAVECS MA MA+EIVK+NGFS
Sbjct  96   QNVIYQNKFLIKDKIVLDVGAGTGILSLFCAKAGAKHVYAVECSQMADMAKEIVKANGFS  155

Query  722  DVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            DVITV+KGKIEEIELP  +VD+IISEWMGYFLL+E
Sbjct  156  DVITVLKGKIEEIELPTPKVDVIISEWMGYFLLFE  190



>ref|XP_006285816.1| hypothetical protein CARUB_v10007292mg [Capsella rubella]
 gb|EOA18714.1| hypothetical protein CARUB_v10007292mg [Capsella rubella]
Length=386

 Score =   247 bits (631),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 129/147 (88%), Gaps = 3/147 (2%)
 Frame = +2

Query  386  EVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNA  565
            E  +D +MCD  A E   V DD TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N 
Sbjct  43   EAAQDESMCDADASE---VTDDTTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNK  99

Query  566  FLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKG  745
            FL KDK+VLDVGAGTGILSLFCAK GA HVYAVECS MA MA+EIVK+NGFSDVITV+KG
Sbjct  100  FLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADMAKEIVKANGFSDVITVLKG  159

Query  746  KIEEIELPVAQVDIIISEWMGYFLLYE  826
            KIEEIELPV +VD+IISEWMGYFLL+E
Sbjct  160  KIEEIELPVPKVDVIISEWMGYFLLFE  186



>ref|XP_009137851.1| PREDICTED: protein arginine N-methyltransferase 1.1-like [Brassica 
rapa]
Length=389

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +2

Query  362  TLTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  541
            T   S+     +D +MCD +AD  +   DD TSADYYFDSYSHFGIHEEMLKDVVRTKTY
Sbjct  36   TAQGSAEAATAQDESMCD-AADSTTDAADDTTSADYYFDSYSHFGIHEEMLKDVVRTKTY  94

Query  542  QNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFS  721
            QNVIY+N FL KDKVVLDVGAGTGILSLFCAK GAKHVYAVECS MA MA+EIVK+NGFS
Sbjct  95   QNVIYQNKFLIKDKVVLDVGAGTGILSLFCAKAGAKHVYAVECSQMADMAKEIVKANGFS  154

Query  722  DVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            DVITV+KGKIEEIELP  +VD+IISEWMGYFLL+E
Sbjct  155  DVITVLKGKIEEIELPTPKVDVIISEWMGYFLLFE  189



>emb|CBI27942.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 130/150 (87%), Gaps = 10/150 (7%)
 Frame = +2

Query  407  MCDPSADE----------DSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY  556
            MC+P   +          DS++G DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY
Sbjct  1    MCEPGESDKDIARSFELDDSVIGSDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY  60

Query  557  KNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITV  736
            KN FLFK+KVVLDVGAGTGILSLFCAK GAKHVYAVECS MA MA+EIV+ NGFSDVITV
Sbjct  61   KNKFLFKNKVVLDVGAGTGILSLFCAKAGAKHVYAVECSHMADMAKEIVEVNGFSDVITV  120

Query  737  IKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            +KGK+EEI LPVAQVDIIISEWMGYFLL+E
Sbjct  121  MKGKVEEIVLPVAQVDIIISEWMGYFLLFE  150



>ref|XP_006371985.1| arginine N-methyltransferase family protein [Populus trichocarpa]
 gb|ABK95671.1| unknown [Populus trichocarpa]
 gb|ERP49782.1| arginine N-methyltransferase family protein [Populus trichocarpa]
Length=384

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 144/178 (81%), Gaps = 2/178 (1%)
 Frame = +2

Query  293  RPTKIRFeyddeeqqqqrpdqdeTLTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYY  472
            + TKIRF  ++EE++    D     TE S     +D AM DP         DDKTSADYY
Sbjct  9    QATKIRFNDEEEEEESSNLDDSIVATEKS--IAIDDVAMQDPDVSFVDGCDDDKTSADYY  66

Query  473  FDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKH  652
            FDSYSHFGIHEEMLKDVVRTKTYQNVIY+N FLFKDKVVLDVGAGTGILSLFCAK GA H
Sbjct  67   FDSYSHFGIHEEMLKDVVRTKTYQNVIYQNKFLFKDKVVLDVGAGTGILSLFCAKAGAAH  126

Query  653  VYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            VYAVECS MA MA+EIV+SNG+S+VITV+KGKIEEIELPVA+VDIIISEWMGYFLL+E
Sbjct  127  VYAVECSHMANMAKEIVESNGYSNVITVLKGKIEEIELPVAKVDIIISEWMGYFLLFE  184



>ref|XP_007202181.1| hypothetical protein PRUPE_ppa006645mg [Prunus persica]
 gb|EMJ03380.1| hypothetical protein PRUPE_ppa006645mg [Prunus persica]
Length=401

 Score =   246 bits (629),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 133/154 (86%), Gaps = 11/154 (7%)
 Frame = +2

Query  398  DTAMCDPSAD---EDSM--------VGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  544
            D +MCDP  D   +DSM          DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ
Sbjct  48   DESMCDPELDKAVDDSMGEPDVSFIAADDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  107

Query  545  NVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSD  724
            NVIY+N FLFKDK+VLDVGAGTGILSLFCAK GA+HVYAVECS MA MA+EIV++NGFS+
Sbjct  108  NVIYQNQFLFKDKIVLDVGAGTGILSLFCAKAGAQHVYAVECSDMADMAKEIVEANGFSN  167

Query  725  VITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            VITV+KGKIEE+ELPV +VDIIISEWMGYFLL+E
Sbjct  168  VITVLKGKIEELELPVPKVDIIISEWMGYFLLFE  201



>gb|KFK29506.1| hypothetical protein AALP_AA7G143300 [Arabis alpina]
Length=388

 Score =   245 bits (626),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 119/147 (81%), Positives = 129/147 (88%), Gaps = 2/147 (1%)
 Frame = +2

Query  386  EVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNA  565
            E  +D  MCD  A + S V DD TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N 
Sbjct  44   EAAQDEPMCD--AADASEVTDDTTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNK  101

Query  566  FLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKG  745
            FL KDK+VLDVGAGTGILSLFCAK GAKHVYAVECS MA MA+EIVK+NGFSDVITV+KG
Sbjct  102  FLIKDKIVLDVGAGTGILSLFCAKAGAKHVYAVECSQMADMAKEIVKANGFSDVITVLKG  161

Query  746  KIEEIELPVAQVDIIISEWMGYFLLYE  826
            KIEEIELP  +VD+IISEWMGYFLL+E
Sbjct  162  KIEEIELPTPKVDVIISEWMGYFLLFE  188



>gb|KJB65110.1| hypothetical protein B456_010G081400 [Gossypium raimondii]
Length=398

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 153/197 (78%), Gaps = 19/197 (10%)
 Frame = +2

Query  266  QTTTGGHDK-RPTKIRFeyddeeqqqqrpdqdeTLTESSNLE--------VEEDTAMCDP  418
            QT+T   ++   TKIRF+  D++            T+SSNL+          ED +M +P
Sbjct  11   QTSTNSSNQFEGTKIRFQDADDDGVA---------TDSSNLDESILAVDKAAEDVSMGEP  61

Query  419  SAD-EDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLD  595
            +    DS  GDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N FLF++KVVLD
Sbjct  62   NVSFVDSDAGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNKFLFQNKVVLD  121

Query  596  VGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVA  775
            VGAGTGILSLFCA+ GA HVYAVECS MA MA++IV++NG SDV+TV+KGKIEEIELPVA
Sbjct  122  VGAGTGILSLFCARAGAAHVYAVECSHMADMAKQIVETNGLSDVVTVLKGKIEEIELPVA  181

Query  776  QVDIIISEWMGYFLLYE  826
            +VDIIISEWMGYFLL+E
Sbjct  182  KVDIIISEWMGYFLLFE  198



>ref|XP_010918460.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Elaeis 
guineensis]
Length=391

 Score =   245 bits (626),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 135/153 (88%), Gaps = 9/153 (6%)
 Frame = +2

Query  368  TESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQN  547
            TESSNL+        DP A+  +++G DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQN
Sbjct  48   TESSNLD--------DP-AESLALIGSDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQN  98

Query  548  VIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDV  727
            VIY+N FLFK+KVVLDVGAGTGILSLFCAK GAKHVYA+ECS MA MA+EIV++NGFS+V
Sbjct  99   VIYQNTFLFKNKVVLDVGAGTGILSLFCAKAGAKHVYAIECSLMADMAKEIVQANGFSNV  158

Query  728  ITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            +TV+KGK+EEIELPV  VD+IISEWMGYFLL+E
Sbjct  159  VTVLKGKVEEIELPVTHVDVIISEWMGYFLLFE  191



>ref|XP_010447845.1| PREDICTED: protein arginine N-methyltransferase 1.1-like [Camelina 
sativa]
Length=387

 Score =   245 bits (625),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 117/147 (80%), Positives = 128/147 (87%), Gaps = 3/147 (2%)
 Frame = +2

Query  386  EVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNA  565
            E  +D +MCD  A +   V DD TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N 
Sbjct  44   EAAQDESMCDAEASD---VADDTTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNK  100

Query  566  FLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKG  745
            FL KDK+VLDVGAGTGILSLFCAK GA HVYAVECS MA MA+EIVK+NGFSDVITV+KG
Sbjct  101  FLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADMAKEIVKANGFSDVITVLKG  160

Query  746  KIEEIELPVAQVDIIISEWMGYFLLYE  826
            KIEEIELP  +VD+IISEWMGYFLL+E
Sbjct  161  KIEEIELPTPKVDVIISEWMGYFLLFE  187



>ref|XP_008810397.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Phoenix 
dactylifera]
Length=391

 Score =   244 bits (624),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 134/153 (88%), Gaps = 9/153 (6%)
 Frame = +2

Query  368  TESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQN  547
            TESSNLE        +P A   +++G DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQN
Sbjct  48   TESSNLE--------NPPASL-ALIGSDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQN  98

Query  548  VIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDV  727
            VIY+N FLFK+KVVLDVGAGTGILSLFCAK GAKHVYA+ECS MA MA+EIV++NGFS+V
Sbjct  99   VIYQNTFLFKNKVVLDVGAGTGILSLFCAKAGAKHVYAIECSLMADMAKEIVQANGFSNV  158

Query  728  ITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            IT++KGK+EEIELPV  VD+IISEWMGYFLL+E
Sbjct  159  ITILKGKVEEIELPVTHVDVIISEWMGYFLLFE  191



>gb|KDO59261.1| hypothetical protein CISIN_1g015306mg [Citrus sinensis]
Length=379

 Score =   244 bits (623),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 131/145 (90%), Gaps = 3/145 (2%)
 Frame = +2

Query  395  EDTAMCDPSADEDSMVG-DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFL  571
            ED AMCD  AD   + G DDKTSADYYFDSYSHFGIHEEMLKDVVRTK+YQNVIY+N FL
Sbjct  63   EDEAMCD--ADVSMIDGEDDKTSADYYFDSYSHFGIHEEMLKDVVRTKSYQNVIYQNKFL  120

Query  572  FKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKI  751
            FKDKVVLDVGAGTGILSLFCAK GA HVYAVECS MA MA++IV++NGFS+VITV+KGKI
Sbjct  121  FKDKVVLDVGAGTGILSLFCAKAGAAHVYAVECSQMANMAKQIVEANGFSNVITVLKGKI  180

Query  752  EEIELPVAQVDIIISEWMGYFLLYE  826
            EEIELPV +VDIIISEWMGYFLL+E
Sbjct  181  EEIELPVTKVDIIISEWMGYFLLFE  205



>ref|XP_007152929.1| hypothetical protein PHAVU_004G172200g [Phaseolus vulgaris]
 gb|ESW24923.1| hypothetical protein PHAVU_004G172200g [Phaseolus vulgaris]
Length=376

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 133/152 (88%), Gaps = 10/152 (7%)
 Frame = +2

Query  371  ESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  550
            ESSNL    D +MCD +        DDKTSADYYFDSYSHFGIHEEMLKD VRTKTYQNV
Sbjct  35   ESSNL----DQSMCDIAE------SDDKTSADYYFDSYSHFGIHEEMLKDTVRTKTYQNV  84

Query  551  IYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVI  730
            IY+N FLFK+KVVLDVGAGTGILSLFCAK GA+HVYAVECS MA MA+EIV++NGFS+V+
Sbjct  85   IYQNKFLFKNKVVLDVGAGTGILSLFCAKAGAEHVYAVECSHMADMAKEIVETNGFSNVV  144

Query  731  TVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            TV+KGKIEEIELPVA+VDIIISEWMGYFLL+E
Sbjct  145  TVLKGKIEEIELPVAKVDIIISEWMGYFLLFE  176



>gb|KDO59263.1| hypothetical protein CISIN_1g015306mg [Citrus sinensis]
Length=409

 Score =   244 bits (624),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 131/145 (90%), Gaps = 3/145 (2%)
 Frame = +2

Query  395  EDTAMCDPSADEDSMVG-DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFL  571
            ED AMCD  AD   + G DDKTSADYYFDSYSHFGIHEEMLKDVVRTK+YQNVIY+N FL
Sbjct  63   EDEAMCD--ADVSMIDGEDDKTSADYYFDSYSHFGIHEEMLKDVVRTKSYQNVIYQNKFL  120

Query  572  FKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKI  751
            FKDKVVLDVGAGTGILSLFCAK GA HVYAVECS MA MA++IV++NGFS+VITV+KGKI
Sbjct  121  FKDKVVLDVGAGTGILSLFCAKAGAAHVYAVECSQMANMAKQIVEANGFSNVITVLKGKI  180

Query  752  EEIELPVAQVDIIISEWMGYFLLYE  826
            EEIELPV +VDIIISEWMGYFLL+E
Sbjct  181  EEIELPVTKVDIIISEWMGYFLLFE  205



>ref|XP_010433089.1| PREDICTED: protein arginine N-methyltransferase 1.1 [Camelina 
sativa]
Length=386

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 127/144 (88%), Gaps = 3/144 (2%)
 Frame = +2

Query  395  EDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLF  574
            +D +MCD  A   S V DD TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N FL 
Sbjct  46   QDESMCDAEA---SDVADDTTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNKFLI  102

Query  575  KDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIE  754
            KDK+VLDVGAGTGILSLFCAK GA HVYAVECS MA MA+EIVK+NGFSDVITV+KGKIE
Sbjct  103  KDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADMAKEIVKANGFSDVITVLKGKIE  162

Query  755  EIELPVAQVDIIISEWMGYFLLYE  826
            EIELP  +VD+IISEWMGYFLL+E
Sbjct  163  EIELPTPKVDVIISEWMGYFLLFE  186



>ref|XP_006451413.1| hypothetical protein CICLE_v10008497mg [Citrus clementina]
 ref|XP_006475399.1| PREDICTED: protein arginine N-methyltransferase 1.1-like [Citrus 
sinensis]
 gb|ESR64653.1| hypothetical protein CICLE_v10008497mg [Citrus clementina]
 gb|KDO59262.1| hypothetical protein CISIN_1g015306mg [Citrus sinensis]
Length=405

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 131/145 (90%), Gaps = 3/145 (2%)
 Frame = +2

Query  395  EDTAMCDPSADEDSMVG-DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFL  571
            ED AMCD  AD   + G DDKTSADYYFDSYSHFGIHEEMLKDVVRTK+YQNVIY+N FL
Sbjct  63   EDEAMCD--ADVSMIDGEDDKTSADYYFDSYSHFGIHEEMLKDVVRTKSYQNVIYQNKFL  120

Query  572  FKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKI  751
            FKDKVVLDVGAGTGILSLFCAK GA HVYAVECS MA MA++IV++NGFS+VITV+KGKI
Sbjct  121  FKDKVVLDVGAGTGILSLFCAKAGAAHVYAVECSQMANMAKQIVEANGFSNVITVLKGKI  180

Query  752  EEIELPVAQVDIIISEWMGYFLLYE  826
            EEIELPV +VDIIISEWMGYFLL+E
Sbjct  181  EEIELPVTKVDIIISEWMGYFLLFE  205



>gb|EMS62209.1| putative protein arginine N-methyltransferase 1 [Triticum urartu]
Length=357

 Score =   243 bits (619),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 133/148 (90%), Gaps = 5/148 (3%)
 Frame = +2

Query  383  LEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKN  562
            +EVEE      P+A  + ++G+DKTSADYYFDSYSHFGIHEEMLKDVVRT++YQNVI +N
Sbjct  1    MEVEEG-----PAAPGEEVIGNDKTSADYYFDSYSHFGIHEEMLKDVVRTRSYQNVITQN  55

Query  563  AFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIK  742
             FLFKDK+VLDVGAGTGILSLFCAK GAKHVYA+ECS MA MA+EIVK+NGFS+VITVIK
Sbjct  56   NFLFKDKIVLDVGAGTGILSLFCAKAGAKHVYAIECSQMADMAKEIVKTNGFSEVITVIK  115

Query  743  GKIEEIELPVAQVDIIISEWMGYFLLYE  826
            GK+EEIELPV +VD+IISEWMGYFLL+E
Sbjct  116  GKVEEIELPVPKVDVIISEWMGYFLLFE  143



>ref|XP_010090015.1| Protein arginine N-methyltransferase 1.1 [Morus notabilis]
 gb|EXB38812.1| Protein arginine N-methyltransferase 1.1 [Morus notabilis]
Length=404

 Score =   244 bits (622),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 138/166 (83%), Gaps = 18/166 (11%)
 Frame = +2

Query  368  TESSNLEVEEDTAMCD----PSADEDSMVGD---------DKTSADYYFDSYSHFGIHEE  508
            TESSNL    D +MCD    P A  D  VGD         DKTSADYYFDSYSHFGIHEE
Sbjct  44   TESSNL----DESMCDLDVSPVAG-DKAVGDQDVPFIDSDDKTSADYYFDSYSHFGIHEE  98

Query  509  MLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGM  688
            MLKDVVRTKTYQNVIY+N FLFK+KVVLDVGAGTGILSLFCAK GAKHVYAVECS MA M
Sbjct  99   MLKDVVRTKTYQNVIYQNGFLFKNKVVLDVGAGTGILSLFCAKAGAKHVYAVECSQMADM  158

Query  689  AQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            A++IV++NGFSDVITV+KGK+EE+ELPV +VDII+SEWMGYFLL+E
Sbjct  159  AKQIVEANGFSDVITVLKGKMEELELPVPKVDIIVSEWMGYFLLFE  204



>gb|KHG04416.1| Protein arginine N-methyltransferase 1.1 [Gossypium arboreum]
Length=425

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 152/197 (77%), Gaps = 19/197 (10%)
 Frame = +2

Query  266  QTTTGGHDK-RPTKIRFeyddeeqqqqrpdqdeTLTESSNLE--------VEEDTAMCDP  418
            QT+T   ++   TKIRF+  D++            T++SNL+          ED +M +P
Sbjct  11   QTSTNSSNQFEGTKIRFQDADDDGVA---------TDNSNLDESILAVDKATEDVSMGEP  61

Query  419  SAD-EDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLD  595
                 DS  GDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N FLF++KVVLD
Sbjct  62   DVSFVDSDAGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNKFLFQNKVVLD  121

Query  596  VGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVA  775
            VGAGTGILSLFCAK GA HVYAVECS MA MA++IV++NG SDVITV+KGKIEEIELPVA
Sbjct  122  VGAGTGILSLFCAKAGAAHVYAVECSHMADMAKQIVETNGLSDVITVLKGKIEEIELPVA  181

Query  776  QVDIIISEWMGYFLLYE  826
            +VDIIISEWMGYFLL+E
Sbjct  182  KVDIIISEWMGYFLLFE  198



>ref|XP_009405716.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Musa 
acuminata subsp. malaccensis]
Length=385

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 132/152 (87%), Gaps = 13/152 (9%)
 Frame = +2

Query  371  ESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  550
            ESSNLE             +  ++G DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV
Sbjct  47   ESSNLE-------------DSPLIGSDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  93

Query  551  IYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVI  730
            IY+N+FLFK+KVVLDVGAGTGILSLFCAK GAKHVYAVECS MA MA+EIV++NG+S+VI
Sbjct  94   IYQNSFLFKNKVVLDVGAGTGILSLFCAKAGAKHVYAVECSLMADMAKEIVQTNGYSNVI  153

Query  731  TVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            TV+KGK+EEIELPVA VD+IISEWMGYFLL+E
Sbjct  154  TVLKGKVEEIELPVAHVDVIISEWMGYFLLFE  185



>gb|ACE82047.1| putative protein arginine N-methyltransferase 1 [Musa acuminata 
AAA Group]
Length=385

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 132/152 (87%), Gaps = 13/152 (9%)
 Frame = +2

Query  371  ESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  550
            ESSNLE             +  ++G DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV
Sbjct  47   ESSNLE-------------DSPLIGSDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  93

Query  551  IYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVI  730
            IY+N+FLFK+KVVLDVGAGTGILSLFCAK GAKHVYAVECS MA MA+EIV++NG+S+VI
Sbjct  94   IYQNSFLFKNKVVLDVGAGTGILSLFCAKAGAKHVYAVECSLMADMAKEIVQTNGYSNVI  153

Query  731  TVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            TV+KGK+EEIELPVA VD+IISEWMGYFLL+E
Sbjct  154  TVLKGKVEEIELPVAHVDVIISEWMGYFLLFE  185



>gb|ABK24509.1| unknown [Picea sitchensis]
Length=379

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/137 (86%), Positives = 126/137 (92%), Gaps = 4/137 (3%)
 Frame = +2

Query  428  EDSMV----GDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLD  595
            E+SMV    G D+TSADYYFDSYSHFGIHEEMLKD VRTKTYQNVIY+N+FLFKDKVVLD
Sbjct  43   EESMVDVFTGSDQTSADYYFDSYSHFGIHEEMLKDTVRTKTYQNVIYQNSFLFKDKVVLD  102

Query  596  VGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVA  775
            VGAGTGILSLFCAK GAKHVYAVECS MA MAQEIVK+NG+SDVITV+KGKIEEIELPV 
Sbjct  103  VGAGTGILSLFCAKGGAKHVYAVECSHMADMAQEIVKANGYSDVITVLKGKIEEIELPVQ  162

Query  776  QVDIIISEWMGYFLLYE  826
             VDIIISEWMGYFLL+E
Sbjct  163  NVDIIISEWMGYFLLFE  179



>ref|XP_011659967.1| PREDICTED: protein arginine N-methyltransferase 1.1 [Cucumis 
sativus]
 gb|KGN66214.1| hypothetical protein Csa_1G586760 [Cucumis sativus]
Length=401

 Score =   243 bits (620),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/166 (73%), Positives = 136/166 (82%), Gaps = 17/166 (10%)
 Frame = +2

Query  368  TESSNLEVEEDTAMCDPSADEDSMV-------------GDDKTSADYYFDSYSHFGIHEE  508
            TESSN     D +MCD + D + ++              DDKTSADYYFDSYSHFGIHEE
Sbjct  40   TESSNF----DESMCDAADDSNRVIEDTACEPGQSFNDKDDKTSADYYFDSYSHFGIHEE  95

Query  509  MLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGM  688
            MLKD VRTKTYQNVIY+N FLFK+KVVLDVGAGTGILSLFCAK GA HVYAVECS MA M
Sbjct  96   MLKDTVRTKTYQNVIYQNKFLFKNKVVLDVGAGTGILSLFCAKAGAAHVYAVECSHMADM  155

Query  689  AQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            A+EIV++NGFS+VITV+KGK+EEIELPVA+VDIIISEWMGYFLL+E
Sbjct  156  AKEIVETNGFSNVITVLKGKVEEIELPVAKVDIIISEWMGYFLLFE  201



>ref|XP_011013847.1| PREDICTED: protein arginine N-methyltransferase 1.1-like isoform 
X1 [Populus euphratica]
Length=384

 Score =   242 bits (618),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = +2

Query  395  EDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLF  574
            +D +M DP         DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N FLF
Sbjct  41   DDVSMQDPDVSFVDGCDDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNKFLF  100

Query  575  KDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIE  754
            KDKVVLDVGAGTGILSLFCAK GA HVYAVECS MA MA+EIV+SNG+S+VITV+KGKIE
Sbjct  101  KDKVVLDVGAGTGILSLFCAKAGAAHVYAVECSHMANMAKEIVESNGYSNVITVLKGKIE  160

Query  755  EIELPVAQVDIIISEWMGYFLLYE  826
            E ELPVA+VDIIISEWMGYFLL+E
Sbjct  161  ETELPVAKVDIIISEWMGYFLLFE  184



>gb|EYU41603.1| hypothetical protein MIMGU_mgv1a0128561mg, partial [Erythranthe 
guttata]
Length=225

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 136/162 (84%), Gaps = 16/162 (10%)
 Frame = +2

Query  374  SSNLEVEEDTAMCDPSADEDSMV-GDDKTSADYYFDSYSHFGIH----------EEMLKD  520
            SSNLE  ED+ M +P   EDS++ GD+KTSADYYFDSYSHF +            EMLKD
Sbjct  26   SSNLE--EDSTMFEP---EDSLLTGDEKTSADYYFDSYSHFDVFGNLIYMTLLMPEMLKD  80

Query  521  VVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEI  700
             VRTKTYQNVIYKNAFL KDKVVLDVGAGTGILSLFCAKVGAKHVYAVECS+MA MA+EI
Sbjct  81   SVRTKTYQNVIYKNAFLIKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSSMADMAKEI  140

Query  701  VKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            V  NGFSDVITV++GKIEEIELPVA+VD+IISEWMGYFL+YE
Sbjct  141  VDKNGFSDVITVLRGKIEEIELPVAKVDVIISEWMGYFLVYE  182



>gb|EMT02681.1| hypothetical protein F775_27549 [Aegilops tauschii]
Length=394

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 133/148 (90%), Gaps = 5/148 (3%)
 Frame = +2

Query  383  LEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKN  562
            +EVEE      P+A  + ++G+DKTSADYYFDSYSHFGIHEEMLKDVVRT++YQNVI +N
Sbjct  38   MEVEES-----PAAPGEEVIGNDKTSADYYFDSYSHFGIHEEMLKDVVRTRSYQNVITQN  92

Query  563  AFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIK  742
             FLFKDK+VLDVGAGTGILSLFCAK GAKHVYA+ECS MA MA+EIVK+NGFS+VITVIK
Sbjct  93   NFLFKDKIVLDVGAGTGILSLFCAKAGAKHVYAIECSQMADMAKEIVKTNGFSEVITVIK  152

Query  743  GKIEEIELPVAQVDIIISEWMGYFLLYE  826
            GK+EEI+LPV +VD+IISEWMGYFLL+E
Sbjct  153  GKVEEIDLPVPKVDVIISEWMGYFLLFE  180



>ref|NP_001242055.1| uncharacterized protein LOC100795951 [Glycine max]
 gb|ACU19903.1| unknown [Glycine max]
Length=376

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 10/152 (7%)
 Frame = +2

Query  371  ESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  550
            ESSNL    D +MCD    E+S   DDKTSADYYFDSYSHFGIHEEMLKD VRTKTYQNV
Sbjct  35   ESSNL----DQSMCDI---EES---DDKTSADYYFDSYSHFGIHEEMLKDTVRTKTYQNV  84

Query  551  IYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVI  730
            IY+N FLFK+KVVLDVGAGTGILSLFCAK GA+HVYAVECS MA MA+EIV++NG+S+V+
Sbjct  85   IYQNRFLFKNKVVLDVGAGTGILSLFCAKAGAEHVYAVECSHMADMAKEIVEANGYSNVV  144

Query  731  TVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            TV+KGKIEEIELPVA+VDIIISEWMGYFLL+E
Sbjct  145  TVLKGKIEEIELPVAKVDIIISEWMGYFLLFE  176



>ref|XP_008450827.1| PREDICTED: protein arginine N-methyltransferase 1.1 [Cucumis 
melo]
Length=401

 Score =   242 bits (617),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/166 (72%), Positives = 136/166 (82%), Gaps = 17/166 (10%)
 Frame = +2

Query  368  TESSNLEVEEDTAMCDPSADEDSMV-------------GDDKTSADYYFDSYSHFGIHEE  508
            TESSN     D +MCD + D + ++              DDKTSADYYFDSYSHFGIHEE
Sbjct  40   TESSNF----DESMCDAADDSNRVIEDTACEPGQSFNDKDDKTSADYYFDSYSHFGIHEE  95

Query  509  MLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGM  688
            MLKD VRTKTYQNVIY+N FLFK+KVVLDVGAGTGILSLFCAK GA HVYAVECS MA M
Sbjct  96   MLKDTVRTKTYQNVIYQNKFLFKNKVVLDVGAGTGILSLFCAKAGAAHVYAVECSHMADM  155

Query  689  AQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            A+EIV++NGFS+VITV+KGK+EEIELPV++VDIIISEWMGYFLL+E
Sbjct  156  AKEIVETNGFSNVITVLKGKVEEIELPVSKVDIIISEWMGYFLLFE  201



>gb|KHN32907.1| Hypothetical protein glysoja_037078 [Glycine soja]
Length=376

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 10/152 (7%)
 Frame = +2

Query  371  ESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  550
            ESSNL    D +MCD    E+S   DDKTSADYYFDSYSHFGIHEEMLKD VRTKTYQNV
Sbjct  35   ESSNL----DQSMCDI---EES---DDKTSADYYFDSYSHFGIHEEMLKDTVRTKTYQNV  84

Query  551  IYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVI  730
            IY+N FLFK+KVVLDVGAGTGILSLFCAK GA+HVYAVECS MA MA+EIV++NG+S+V+
Sbjct  85   IYQNKFLFKNKVVLDVGAGTGILSLFCAKAGAEHVYAVECSHMADMAKEIVEANGYSNVV  144

Query  731  TVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            TV+KGKIEEIELPVA+VDIIISEWMGYFLL+E
Sbjct  145  TVLKGKIEEIELPVAKVDIIISEWMGYFLLFE  176



>ref|XP_003529075.1| PREDICTED: probable protein arginine N-methyltransferase 1-like 
[Glycine max]
 gb|KHN40342.1| Hypothetical protein glysoja_000840 [Glycine soja]
Length=379

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 10/152 (7%)
 Frame = +2

Query  371  ESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  550
            ESSNL    D +MCD    E+S   DDKTSADYYFDSYSHFGIHEEMLKD VRTKTYQNV
Sbjct  38   ESSNL----DQSMCDI---EES---DDKTSADYYFDSYSHFGIHEEMLKDSVRTKTYQNV  87

Query  551  IYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVI  730
            IY+N FLFK+KVVLDVGAGTGILSLFCAK GA+HVYAVECS MA MA+EIV++NG+S+V+
Sbjct  88   IYQNKFLFKNKVVLDVGAGTGILSLFCAKAGAEHVYAVECSHMADMAKEIVEANGYSNVV  147

Query  731  TVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            TV+KGKIEEIELPVA+VDIIISEWMGYFLL+E
Sbjct  148  TVLKGKIEEIELPVAKVDIIISEWMGYFLLFE  179



>gb|ACU24230.1| unknown [Glycine max]
Length=379

 Score =   240 bits (613),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 135/152 (89%), Gaps = 10/152 (7%)
 Frame = +2

Query  371  ESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  550
            ESSNL    D +MCD    E+S   DDKTSADYYFDSYSHFGIHEEMLKD VRTKTYQNV
Sbjct  38   ESSNL----DQSMCDI---EES---DDKTSADYYFDSYSHFGIHEEMLKDSVRTKTYQNV  87

Query  551  IYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVI  730
            IY+N FLFK+KVVLDVGAGTGILSLFCAK GA+HVYAVECS MA MA+EIV++NG+S+V+
Sbjct  88   IYQNKFLFKNKVVLDVGAGTGILSLFCAKAGAEHVYAVECSHMADMAKEIVEANGYSNVV  147

Query  731  TVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            TV+KGKIEEIELPVA+VDIIISEWMGYFLL+E
Sbjct  148  TVLKGKIEEIELPVAKVDIIISEWMGYFLLFE  179



>ref|XP_011004711.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Populus 
euphratica]
Length=393

 Score =   241 bits (614),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = +2

Query  395  EDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLF  574
            +D  M DP+A       DDKTSADYYFDSYSHFGIHEEMLKD VRTKTYQNVI++N FLF
Sbjct  50   DDVTMSDPNAPFVDGGDDDKTSADYYFDSYSHFGIHEEMLKDAVRTKTYQNVIFQNKFLF  109

Query  575  KDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIE  754
            KDKVVLDVGAGTGILSLFCAK GA HVYAVECS +A MA+EIV+SNGFS+VITV+KGKIE
Sbjct  110  KDKVVLDVGAGTGILSLFCAKAGAAHVYAVECSHIANMAKEIVESNGFSNVITVMKGKIE  169

Query  755  EIELPVAQVDIIISEWMGYFLLYE  826
            +IELPVA+VDIIISEWMGYFLL+E
Sbjct  170  DIELPVAKVDIIISEWMGYFLLFE  193



>ref|XP_010548677.1| PREDICTED: protein arginine N-methyltransferase 1.1-like [Tarenaya 
hassleriana]
Length=378

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 130/149 (87%), Gaps = 3/149 (2%)
 Frame = +2

Query  386  EVEEDTAMCDPS--ADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYK  559
            E   D +MCD    AD D  V DD TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+
Sbjct  31   EAIRDESMCDAGNGADADD-VTDDITSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQ  89

Query  560  NAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVI  739
            N FLFKDK+VLDVGAGTGILSLFCAK GA+HVYAVECS MA MA+EIV++NGFSDVITV+
Sbjct  90   NKFLFKDKIVLDVGAGTGILSLFCAKAGARHVYAVECSHMADMAKEIVETNGFSDVITVL  149

Query  740  KGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            KGK+EEIELP  +VD+IISEWMGYFL++E
Sbjct  150  KGKVEEIELPTPKVDVIISEWMGYFLVFE  178



>ref|XP_004287525.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Fragaria 
vesca subsp. vesca]
Length=380

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 134/159 (84%), Gaps = 12/159 (8%)
 Frame = +2

Query  386  EVEEDTAMCDP------------SADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVR  529
            + + D +MCD             + DE + V +DKTSADYYFDSYSHFGIHEEMLKD+VR
Sbjct  22   DADHDESMCDHPDLDKAVLDVSMADDEPAEVSNDKTSADYYFDSYSHFGIHEEMLKDLVR  81

Query  530  TKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKS  709
            TKTYQNVIY+N FLFKDK+VLDVGAGTGILSLFCAK GAKHVYAVECS MA  A+EIV++
Sbjct  82   TKTYQNVIYQNKFLFKDKIVLDVGAGTGILSLFCAKAGAKHVYAVECSDMAERAKEIVET  141

Query  710  NGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            NGFS+V+TV+KGKIEE+ELPVA+VDIIISEWMGYFLL+E
Sbjct  142  NGFSNVVTVLKGKIEELELPVAKVDIIISEWMGYFLLFE  180



>ref|XP_002514159.1| protein arginine n-methyltransferase 1, putative [Ricinus communis]
 gb|EEF48113.1| protein arginine n-methyltransferase 1, putative [Ricinus communis]
Length=387

 Score =   240 bits (612),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N FLFK+KVVLDVGAGTGILSL
Sbjct  61   DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNKFLFKNKVVLDVGAGTGILSL  120

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            FCAK GA HVYAVECS MA MA+EIV+SNGFS+V+TV+KGK+EE+ELPVA+VDIIISEWM
Sbjct  121  FCAKAGAAHVYAVECSAMADMAKEIVESNGFSNVVTVLKGKVEELELPVAKVDIIISEWM  180

Query  806  GYFLLYE  826
            GYFLLYE
Sbjct  181  GYFLLYE  187



>ref|XP_012076792.1| PREDICTED: probable protein arginine N-methyltransferase 1.2 
[Jatropha curcas]
 gb|KDP33742.1| hypothetical protein JCGZ_07313 [Jatropha curcas]
Length=399

 Score =   240 bits (612),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 124/165 (75%), Positives = 136/165 (82%), Gaps = 15/165 (9%)
 Frame = +2

Query  368  TESSNLE---VEEDTAMCDPSADEDSMV---------GDDKTSADYYFDSYSHFGIHEEM  511
            T SSNL+   +  D A+   + D+DSM           DDKTSADYYFDSYSHFGIHEEM
Sbjct  38   TVSSNLDQSIIASDKAI---AMDDDSMGETDVSFIDGDDDKTSADYYFDSYSHFGIHEEM  94

Query  512  LKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMA  691
            LKDVVRTKTYQNVIY+N FLFK+KVVLDVGAGTGILSLFCAK GA HVYAVECS MA MA
Sbjct  95   LKDVVRTKTYQNVIYQNKFLFKNKVVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADMA  154

Query  692  QEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            +EI +SNG SDV+TV+KGKIEEIELPVA+VDIIISEWMGYFLLYE
Sbjct  155  KEIAESNGLSDVVTVLKGKIEEIELPVAKVDIIISEWMGYFLLYE  199



>ref|NP_194680.1| arginine methyltransferase 11 [Arabidopsis thaliana]
 sp|Q9SU94.1|ANM11_ARATH RecName: Full=Protein arginine N-methyltransferase 1.1; Short=AtPRMT11; 
AltName: Full=Arginine methyltransferase pam1; AltName: 
Full=Histone-arginine N-methyltransferase PRMT11 [Arabidopsis 
thaliana]
 emb|CAB45311.1| arginine methyltransferase (pam1) [Arabidopsis thaliana]
 emb|CAB79709.1| arginine methyltransferase (pam1) [Arabidopsis thaliana]
 gb|AAM65371.1| arginine methyltransferase pam1 [Arabidopsis thaliana]
 gb|AAN12952.1| arginine methyltransferase pam1 [Arabidopsis thaliana]
 gb|AEE85638.1| arginine methyltransferase 11 [Arabidopsis thaliana]
Length=390

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 127/148 (86%), Gaps = 1/148 (1%)
 Frame = +2

Query  386  EVEEDTAMCDPSADEDSM-VGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKN  562
            E  +D +M D     D+  V DD TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N
Sbjct  43   ETPQDESMFDAGESADTAEVTDDTTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQN  102

Query  563  AFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIK  742
             FL KDK+VLDVGAGTGILSLFCAK GA HVYAVECS MA MA+EIVK+NGFSDVITV+K
Sbjct  103  KFLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADMAKEIVKANGFSDVITVLK  162

Query  743  GKIEEIELPVAQVDIIISEWMGYFLLYE  826
            GKIEEIELP  +VD+IISEWMGYFLL+E
Sbjct  163  GKIEEIELPTPKVDVIISEWMGYFLLFE  190



>ref|XP_002462268.1| hypothetical protein SORBIDRAFT_02g022770 [Sorghum bicolor]
 gb|EER98789.1| hypothetical protein SORBIDRAFT_02g022770 [Sorghum bicolor]
Length=384

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  437  MVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGI  616
            ++G +KTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVI++N+FL KDKVVLDVGAGTGI
Sbjct  55   VIGSEKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIFQNSFLIKDKVVLDVGAGTGI  114

Query  617  LSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIIS  796
            LSLFCAK GAKHVYA+ECS MA MA+EIVKSNG+SDVITVIKGK+EEIELPV +VD+IIS
Sbjct  115  LSLFCAKAGAKHVYAIECSQMADMAKEIVKSNGYSDVITVIKGKVEEIELPVPKVDVIIS  174

Query  797  EWMGYFLLYE  826
            EWMGYFLL+E
Sbjct  175  EWMGYFLLFE  184



>gb|AAL36326.1| putative arginine methyltransferase pam1 [Arabidopsis thaliana]
Length=390

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 127/148 (86%), Gaps = 1/148 (1%)
 Frame = +2

Query  386  EVEEDTAMCDPSADEDSM-VGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKN  562
            E  +D +M D     D+  V DD TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N
Sbjct  43   ETPQDESMFDAGESADTAEVTDDTTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQN  102

Query  563  AFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIK  742
             FL KDK+VLDVGAGTGILSLFCAK GA HVYAVECS MA MA+EIVK+NGFSDVITV+K
Sbjct  103  KFLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADMAKEIVKANGFSDVITVLK  162

Query  743  GKIEEIELPVAQVDIIISEWMGYFLLYE  826
            GKIEEIELP  +VD+IISEWMGYFLL+E
Sbjct  163  GKIEEIELPTPKVDVIISEWMGYFLLFE  190



>ref|XP_006661156.1| PREDICTED: probable protein arginine N-methyltransferase 1-like 
[Oryza brachyantha]
Length=393

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 125/130 (96%), Gaps = 0/130 (0%)
 Frame = +2

Query  437  MVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGI  616
            ++G+DKTSADYYFDSYSHFGIHEEMLKDVVRTK+YQNVI +N+FLFKDKVVLDVGAGTGI
Sbjct  64   VIGNDKTSADYYFDSYSHFGIHEEMLKDVVRTKSYQNVITQNSFLFKDKVVLDVGAGTGI  123

Query  617  LSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIIS  796
            LSLFCAK GAKHVYA+ECS MA MA+EIVK+NG+SDVITVIKGK+EEIELPV +VD+IIS
Sbjct  124  LSLFCAKAGAKHVYAIECSQMADMAKEIVKANGYSDVITVIKGKVEEIELPVPKVDVIIS  183

Query  797  EWMGYFLLYE  826
            EWMGYFLL+E
Sbjct  184  EWMGYFLLFE  193



>ref|XP_006854005.2| PREDICTED: probable protein arginine N-methyltransferase 1 [Amborella 
trichopoda]
Length=388

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 131/147 (89%), Gaps = 0/147 (0%)
 Frame = +2

Query  386  EVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNA  565
            E++E++A+   +   ++++G+D TSADYYFDSYSHFGIHEEMLKD VRTKTYQNVIY+N 
Sbjct  42   EMDENSALDSCAEPPETIIGNDHTSADYYFDSYSHFGIHEEMLKDTVRTKTYQNVIYQNK  101

Query  566  FLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKG  745
            FLFKDKVVLDVGAGTGILSLFCAK GAKHVYAVECS MA MA+EIV+ NG++DVITV+KG
Sbjct  102  FLFKDKVVLDVGAGTGILSLFCAKAGAKHVYAVECSLMADMAKEIVQVNGYADVITVLKG  161

Query  746  KIEEIELPVAQVDIIISEWMGYFLLYE  826
            K+EEI LPV  VDIIISEWMGYFLL+E
Sbjct  162  KVEEIVLPVPHVDIIISEWMGYFLLFE  188



>ref|XP_010438290.1| PREDICTED: protein arginine N-methyltransferase 1.1-like [Camelina 
sativa]
Length=387

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 116/147 (79%), Positives = 127/147 (86%), Gaps = 3/147 (2%)
 Frame = +2

Query  386  EVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNA  565
            E  +D +M D  A   S V D+ TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N 
Sbjct  44   EAAQDESMRDAEA---SDVADNTTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNK  100

Query  566  FLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKG  745
            FL KDK+VLDVGAGTGILSLFCAK GA HVYAVECS MA MA+EIVK+NGFSDVITV+KG
Sbjct  101  FLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADMAKEIVKANGFSDVITVLKG  160

Query  746  KIEEIELPVAQVDIIISEWMGYFLLYE  826
            KIEEIELP  +VD+IISEWMGYFLL+E
Sbjct  161  KIEEIELPTPKVDVIISEWMGYFLLFE  187



>ref|XP_008795468.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Phoenix 
dactylifera]
Length=391

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 130/153 (85%), Gaps = 9/153 (6%)
 Frame = +2

Query  368  TESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQN  547
            TESSNLE   ++          ++   DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQN
Sbjct  48   TESSNLENPPESL---------ALSSSDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQN  98

Query  548  VIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDV  727
            VIY+N FLFK+KVVLDVGAGTGILSLFCAK GAKHVYA+ECS MA MA+EIV++NGFS+ 
Sbjct  99   VIYQNTFLFKNKVVLDVGAGTGILSLFCAKAGAKHVYAIECSHMADMAKEIVQANGFSNA  158

Query  728  ITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            ITV+KGK+EEIELPV  VD+IISEWMGYFLL+E
Sbjct  159  ITVLKGKVEEIELPVTHVDVIISEWMGYFLLFE  191



>ref|NP_001149819.1| LOC100283446 [Zea mays]
 gb|ACG36901.1| protein arginine N-methyltransferase 1 [Zea mays]
 gb|ACL53648.1| unknown [Zea mays]
 tpg|DAA61139.1| TPA: protein arginine N-methyltransferase 1 [Zea mays]
Length=384

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 134/154 (87%), Gaps = 3/154 (2%)
 Frame = +2

Query  371  ESSNLEVEE--DTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  544
            E   +EVEE  D  + D  A  + ++G +KTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ
Sbjct  32   EEVGMEVEESFDAGVEDEQAAAE-VIGSEKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  90

Query  545  NVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSD  724
            NVI +++FL K+KVVLDVGAGTGILSLFCAK GAKHVYA+ECS MA MAQEIVKSNG+SD
Sbjct  91   NVITQSSFLIKNKVVLDVGAGTGILSLFCAKAGAKHVYAIECSQMADMAQEIVKSNGYSD  150

Query  725  VITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            VITVIKGK+EEIELPV +VD+IISEWMGYFLL+E
Sbjct  151  VITVIKGKVEEIELPVPKVDVIISEWMGYFLLFE  184



>ref|XP_007012896.1| Arginine methyltransferase 11 [Theobroma cacao]
 gb|EOY30515.1| Arginine methyltransferase 11 [Theobroma cacao]
Length=398

 Score =   238 bits (608),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 150/204 (74%), Gaps = 18/204 (9%)
 Frame = +2

Query  242  KMDSEGLNQTTTGGHDKRPTKIRFeyddeeqqqqrpdqdeTLTESSNLE--------VEE  397
            + +S     +T   +    TKIRF+  D+E+           T+SSNL+          E
Sbjct  4    RKNSNAAQTSTNSSNGFEGTKIRFQDADDEEAA---------TDSSNLDESIVAIDKATE  54

Query  398  DTAMCDPSAD-EDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLF  574
            D +M +P     D    DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N FLF
Sbjct  55   DVSMGEPDVSFVDCEGDDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNKFLF  114

Query  575  KDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIE  754
            ++KVVLDVGAGTGILSLFCAK GA HVYAVECS MA MA++IV+ NG SDV+TV+KGKIE
Sbjct  115  QNKVVLDVGAGTGILSLFCAKAGAAHVYAVECSHMADMAKQIVEKNGVSDVVTVLKGKIE  174

Query  755  EIELPVAQVDIIISEWMGYFLLYE  826
            EIELPVA+VDIIISEWMGYFLL+E
Sbjct  175  EIELPVAKVDIIISEWMGYFLLFE  198



>ref|XP_010416788.1| PREDICTED: probable protein arginine N-methyltransferase 1.2 
[Camelina sativa]
Length=364

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/154 (77%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +2

Query  368  TESSNLEVEE-DTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  544
            T+ +    E+ D +M D   D D+ V DD TSADYYFDSYSHFGIHEEMLKDVVRTK+YQ
Sbjct  12   TQETKFHFEDADVSMSD-GGDNDADVTDDVTSADYYFDSYSHFGIHEEMLKDVVRTKSYQ  70

Query  545  NVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSD  724
            +VIYKN FL KDK+VLDVGAGTGILSLFCAK GA HVYAVECS MA  A+EIVKSNG SD
Sbjct  71   DVIYKNKFLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADTAKEIVKSNGLSD  130

Query  725  VITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            VITV+KGKIEEIELPV +VD+IISEWMGYFLLYE
Sbjct  131  VITVLKGKIEEIELPVPKVDVIISEWMGYFLLYE  164



>ref|XP_002883976.1| hypothetical protein ARALYDRAFT_343233 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60235.1| hypothetical protein ARALYDRAFT_343233 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 131/154 (85%), Gaps = 2/154 (1%)
 Frame = +2

Query  368  TESSNLEVEE-DTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  544
            T+ + L  E+ D +M D   D ++ V DD TSADYYFDSYSHFGIHEEMLKDVVRTK YQ
Sbjct  14   TQKTKLHFEDADESMYD-GGDNNADVADDITSADYYFDSYSHFGIHEEMLKDVVRTKCYQ  72

Query  545  NVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSD  724
            +VIYKN FL KDK+VLDVGAGTGILSLFCAK GA H+YAVECS MA  A+EIVKSNGFSD
Sbjct  73   DVIYKNKFLIKDKIVLDVGAGTGILSLFCAKAGAAHIYAVECSQMADTAREIVKSNGFSD  132

Query  725  VITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            VITV+KGKIEEIELP+ +VD+IISEWMGYFLLYE
Sbjct  133  VITVLKGKIEEIELPIPKVDVIISEWMGYFLLYE  166



>ref|XP_008391506.1| PREDICTED: probable protein arginine N-methyltransferase 1.2 
[Malus domestica]
Length=391

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 135/165 (82%), Gaps = 15/165 (9%)
 Frame = +2

Query  365  LTESSNLEVEEDTAMCDPSAD---EDSM--------VGDDKTSADYYFDSYSHFGIHEEM  511
            + ESSN     D +MCDP  D   +DSM          D KTSADYYFDSYSHFGIHEEM
Sbjct  31   VPESSN----PDESMCDPELDKAVDDSMGEPEVSFVEADGKTSADYYFDSYSHFGIHEEM  86

Query  512  LKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMA  691
            LKD+VRTKTYQNVIY+N FL  DK+VLDVGAGTGILSLFCAK GAKHVYAVECS MA MA
Sbjct  87   LKDLVRTKTYQNVIYQNKFLIXDKIVLDVGAGTGILSLFCAKAGAKHVYAVECSDMADMA  146

Query  692  QEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            +EIV++NG+S++ITV+KGKIEEIELPV +VDIIISEWMGYFLL+E
Sbjct  147  KEIVETNGYSNLITVLKGKIEEIELPVPKVDIIISEWMGYFLLFE  191



>emb|CAA07570.1| arginine methyltransferase [Arabidopsis thaliana]
Length=376

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 126/148 (85%), Gaps = 1/148 (1%)
 Frame = +2

Query  386  EVEEDTAMCDPSADEDSM-VGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKN  562
            E  +D +M D     D+  V DD TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N
Sbjct  43   ETPQDESMFDAGESADTAEVTDDTTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQN  102

Query  563  AFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIK  742
             FL KDK+VLDVGAGTGILSLFCA  GA HVYAVECS MA MA+EIVK+NGFSDVITV+K
Sbjct  103  KFLIKDKIVLDVGAGTGILSLFCAXAGAAHVYAVECSQMADMAKEIVKANGFSDVITVLK  162

Query  743  GKIEEIELPVAQVDIIISEWMGYFLLYE  826
            GKIEEIELP  +VD+IISEWMGYFLL+E
Sbjct  163  GKIEEIELPTPKVDVIISEWMGYFLLFE  190



>ref|NP_001062975.1| Os09g0359800 [Oryza sativa Japonica Group]
 sp|Q0J2C6.1|ANM1_ORYSJ RecName: Full=Probable protein arginine N-methyltransferase 1 
[Oryza sativa Japonica Group]
 sp|A2Z0C0.1|ANM1_ORYSI RecName: Full=Probable protein arginine N-methyltransferase 1 
[Oryza sativa Indica Group]
 dbj|BAF24889.1| Os09g0359800 [Oryza sativa Japonica Group]
 gb|EAZ08781.1| hypothetical protein OsI_31042 [Oryza sativa Indica Group]
 dbj|BAG94311.1| unnamed protein product [Oryza sativa Japonica Group]
Length=387

 Score =   237 bits (605),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 124/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  437  MVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGI  616
            ++G DKTSADYYFDSYSHFGIHEEMLKDVVRTK+YQNVI +N+FLFKDK+VLDVGAGTGI
Sbjct  58   VIGSDKTSADYYFDSYSHFGIHEEMLKDVVRTKSYQNVITQNSFLFKDKIVLDVGAGTGI  117

Query  617  LSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIIS  796
            LSLFCAK GAKHVYA+ECS MA MA+EIVK+NG+S+VITVIKGK+EEIELPV +VD+IIS
Sbjct  118  LSLFCAKAGAKHVYAIECSQMADMAKEIVKTNGYSNVITVIKGKVEEIELPVPKVDVIIS  177

Query  797  EWMGYFLLYE  826
            EWMGYFLL+E
Sbjct  178  EWMGYFLLFE  187



>ref|XP_009352612.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Pyrus 
x bretschneideri]
Length=351

 Score =   236 bits (602),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 129/151 (85%), Gaps = 11/151 (7%)
 Frame = +2

Query  407  MCDPSAD---EDSM--------VGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVI  553
            MCDP  D   +DSM          D KTSADYYFDSYSHFGIHEEMLKD+VRTKTYQNVI
Sbjct  1    MCDPELDKAVDDSMGEPEVSFVEADGKTSADYYFDSYSHFGIHEEMLKDLVRTKTYQNVI  60

Query  554  YKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVIT  733
            Y+N FL KDK+VLDVGAGTGILSLFCAK GAKHVYAVECS MA MA+EIV++NG+S++IT
Sbjct  61   YQNKFLIKDKIVLDVGAGTGILSLFCAKAGAKHVYAVECSDMADMAKEIVETNGYSNLIT  120

Query  734  VIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            V+KGKIEEIELPV +VDIIISEWMGYFLL+E
Sbjct  121  VLKGKIEEIELPVPKVDIIISEWMGYFLLFE  151



>ref|XP_010262205.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Nelumbo 
nucifera]
Length=385

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 127/136 (93%), Gaps = 0/136 (0%)
 Frame = +2

Query  419  SADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDV  598
            S  +++++G D+TSADYYFDSYSHFGIHEEMLKD VRTKTYQNVIY+N FLF++KVVLDV
Sbjct  50   SEPDETLLGSDQTSADYYFDSYSHFGIHEEMLKDTVRTKTYQNVIYQNTFLFRNKVVLDV  109

Query  599  GAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQ  778
            GAGTGILSLFCAK GAKHVYA+ECS MA MA+EIVK+NGFS+VITV+KGK+EEI LP+A+
Sbjct  110  GAGTGILSLFCAKAGAKHVYAIECSHMADMAKEIVKANGFSNVITVLKGKVEEIVLPIAK  169

Query  779  VDIIISEWMGYFLLYE  826
            VD+IISEWMGYFLL+E
Sbjct  170  VDVIISEWMGYFLLFE  185



>ref|XP_003578015.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Brachypodium 
distachyon]
Length=384

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  437  MVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGI  616
            ++G +KTSADYYFDSYSHFGIHEEMLKDVVRT++YQNVI +N+FLFKDK+VLDVGAGTGI
Sbjct  55   VIGSEKTSADYYFDSYSHFGIHEEMLKDVVRTRSYQNVITQNSFLFKDKIVLDVGAGTGI  114

Query  617  LSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIIS  796
            LSLFCAK GAKHVYA+ECS MA MA+EIVK NGFSDVITVIKGK+EEIELPV +VD+IIS
Sbjct  115  LSLFCAKAGAKHVYAIECSQMADMAKEIVKKNGFSDVITVIKGKVEEIELPVPKVDVIIS  174

Query  797  EWMGYFLLYE  826
            EWMGYFLL+E
Sbjct  175  EWMGYFLLFE  184



>ref|XP_010541026.1| PREDICTED: protein arginine N-methyltransferase 1.1 [Tarenaya 
hassleriana]
Length=391

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 151/190 (79%), Gaps = 7/190 (4%)
 Frame = +2

Query  263  NQTTTGGHDK-RPTKIRFeyddeeqqqqrpdqdeTLTESSNLEVEEDTAMCDPS-ADEDS  436
            NQ    G D+ + +K+RFE  DE+Q  +       +T S+  E  +D +MCD     +  
Sbjct  7    NQNDQLGSDQNQNSKLRFEDADEDQVAEE-----VMTCSNVDEAVQDESMCDAGEDADTD  61

Query  437  MVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGI  616
             V DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N FLFKDK+VLDVGAGTGI
Sbjct  62   DVSDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNKFLFKDKIVLDVGAGTGI  121

Query  617  LSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIIS  796
            LSLFCAK GA+HVYAVECS MA MA+EIV++NGFSDVITV+KGKIEEIELP  +VD+IIS
Sbjct  122  LSLFCAKAGARHVYAVECSQMADMAKEIVRTNGFSDVITVLKGKIEEIELPTPKVDVIIS  181

Query  797  EWMGYFLLYE  826
            EWMGYFL++E
Sbjct  182  EWMGYFLVFE  191



>gb|KCW82249.1| hypothetical protein EUGRSUZ_C03665 [Eucalyptus grandis]
Length=368

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 151/211 (72%), Gaps = 40/211 (19%)
 Frame = +2

Query  281  GHDKRP---TKIRFeyddeeqqqqrpdqdeTLTESSNLEVEEDTAMCDPSADEDSMV---  442
            G D+ P   TKIRF  DD   Q+       T T SSNL    D  MCDP  DE + V   
Sbjct  17   GSDQPPQQATKIRFTDDDGGGQEDG-----TATGSSNL----DEVMCDP--DESTTVADM  65

Query  443  ----------------------GDD-KTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVI  553
                                  GDD +TSADYYFDSYSHFGIHEEMLKD+VRTKTYQNVI
Sbjct  66   TVDASASASASACEANDSFPDDGDDHQTSADYYFDSYSHFGIHEEMLKDIVRTKTYQNVI  125

Query  554  YKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVIT  733
            Y+N FLFK+KVVLDVGAGTGILSLFCAK GA+HVYA+ECS MA  A+EIV+SNGFS+VIT
Sbjct  126  YQNKFLFKNKVVLDVGAGTGILSLFCAKAGAQHVYAIECSQMAETAKEIVESNGFSNVIT  185

Query  734  VIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            V+KGK+EEI+LPVA+VDIIISEWMGYFLL+E
Sbjct  186  VLKGKVEEIDLPVAKVDIIISEWMGYFLLFE  216



>ref|XP_010049564.1| PREDICTED: probable protein arginine N-methyltransferase 1.2 
[Eucalyptus grandis]
 gb|KCW82248.1| hypothetical protein EUGRSUZ_C03665 [Eucalyptus grandis]
Length=416

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 151/211 (72%), Gaps = 40/211 (19%)
 Frame = +2

Query  281  GHDKRP---TKIRFeyddeeqqqqrpdqdeTLTESSNLEVEEDTAMCDPSADEDSMV---  442
            G D+ P   TKIRF  DD   Q+       T T SSNL    D  MCDP  DE + V   
Sbjct  17   GSDQPPQQATKIRFTDDDGGGQEDG-----TATGSSNL----DEVMCDP--DESTTVADM  65

Query  443  ----------------------GDD-KTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVI  553
                                  GDD +TSADYYFDSYSHFGIHEEMLKD+VRTKTYQNVI
Sbjct  66   TVDASASASASACEANDSFPDDGDDHQTSADYYFDSYSHFGIHEEMLKDIVRTKTYQNVI  125

Query  554  YKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVIT  733
            Y+N FLFK+KVVLDVGAGTGILSLFCAK GA+HVYA+ECS MA  A+EIV+SNGFS+VIT
Sbjct  126  YQNKFLFKNKVVLDVGAGTGILSLFCAKAGAQHVYAIECSQMAETAKEIVESNGFSNVIT  185

Query  734  VIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            V+KGK+EEI+LPVA+VDIIISEWMGYFLL+E
Sbjct  186  VLKGKVEEIDLPVAKVDIIISEWMGYFLLFE  216



>emb|CDY30213.1| BnaA03g49570D [Brassica napus]
Length=391

 Score =   235 bits (600),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 131/157 (83%), Gaps = 3/157 (2%)
 Frame = +2

Query  362  TLTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIH--EEMLKDVVRTK  535
            T   S+     +D  MCD +AD  +   DD TSADYYFDSYSHFG++  +EMLKDVVRTK
Sbjct  36   TAQGSAEAATAQDEPMCD-AADITTDAADDTTSADYYFDSYSHFGLYLLQEMLKDVVRTK  94

Query  536  TYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNG  715
            TYQNVIY+N FL KDKVVLDVGAGTGILSLFCAK GAKHVYAVECS MA MA+EIVK+NG
Sbjct  95   TYQNVIYQNKFLIKDKVVLDVGAGTGILSLFCAKAGAKHVYAVECSQMADMAKEIVKANG  154

Query  716  FSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            FSDVITV+KGKIEEIELP  +VD+IISEWMGYFLL+E
Sbjct  155  FSDVITVLKGKIEEIELPTPKVDVIISEWMGYFLLFE  191



>emb|CDY35877.1| BnaA07g01100D [Brassica napus]
Length=363

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 129/154 (84%), Gaps = 7/154 (5%)
 Frame = +2

Query  368  TESSNLEVEE-DTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  544
             +++ L  E+ D  MCD        V DD TSADYYFDSYSHFGIHEEMLKDVVRTK+Y+
Sbjct  16   NQNTKLPFEDADETMCDAD------VADDITSADYYFDSYSHFGIHEEMLKDVVRTKSYR  69

Query  545  NVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSD  724
            +VIYKN FL KDK+VLDVGAGTGILSLFCAK GA HVYAVECS MA  A+EIVKSNGFSD
Sbjct  70   DVIYKNKFLVKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADTAKEIVKSNGFSD  129

Query  725  VITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            VITV+KGKIEEIELPV +VD+IISEWMGYFL+YE
Sbjct  130  VITVLKGKIEEIELPVPKVDVIISEWMGYFLVYE  163



>ref|XP_009102148.1| PREDICTED: probable protein arginine N-methyltransferase 1.2 
[Brassica rapa]
Length=363

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 129/154 (84%), Gaps = 7/154 (5%)
 Frame = +2

Query  368  TESSNLEVEE-DTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  544
             +++ L  E+ D  MCD        V DD TSADYYFDSYSHFGIHEEMLKDVVRTK+Y+
Sbjct  16   NQNTKLPFEDADETMCDAD------VADDITSADYYFDSYSHFGIHEEMLKDVVRTKSYR  69

Query  545  NVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSD  724
            +VIYKN FL KDK+VLDVGAGTGILSLFCAK GA HVYAVECS MA  A+EIVKSNGFSD
Sbjct  70   DVIYKNKFLVKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADTAKEIVKSNGFSD  129

Query  725  VITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            VITV+KGKIEEIELPV +VD+IISEWMGYFL+YE
Sbjct  130  VITVLKGKIEEIELPVPKVDVIISEWMGYFLVYE  163



>gb|AFK37387.1| unknown [Lotus japonicus]
Length=213

 Score =   229 bits (584),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 131/154 (85%), Gaps = 9/154 (6%)
 Frame = +2

Query  365  LTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  544
            + E+SNL    D +MCD   D D      KTSADYYFDSYSHFGIHEEMLKD VRTKTYQ
Sbjct  17   VAETSNL----DQSMCDDPDDSDD-----KTSADYYFDSYSHFGIHEEMLKDTVRTKTYQ  67

Query  545  NVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSD  724
            +VIY+N FLFKDK+VLDVGAGTGILSLFCAK GAKHVYAVECS MA MA+EIV++NG+S+
Sbjct  68   SVIYQNKFLFKDKIVLDVGAGTGILSLFCAKAGAKHVYAVECSQMANMAKEIVETNGYSN  127

Query  725  VITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            VITV+KGKIEE+ELPV +VDIIISEWMGY LL+E
Sbjct  128  VITVLKGKIEELELPVPKVDIIISEWMGYLLLFE  161



>ref|XP_004956642.1| PREDICTED: probable protein arginine N-methyltransferase 1-like 
[Setaria italica]
Length=385

 Score =   235 bits (599),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 123/130 (95%), Gaps = 0/130 (0%)
 Frame = +2

Query  437  MVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGI  616
            ++G DKTSADYYFDSYSHFGIHEEMLKD+VRTKTYQNVI +++FL KDK+VLDVGAGTGI
Sbjct  56   VIGSDKTSADYYFDSYSHFGIHEEMLKDIVRTKTYQNVITQSSFLIKDKIVLDVGAGTGI  115

Query  617  LSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIIS  796
            LSLFCAK GAKHVYA+ECS MA MA+EIVK+NG+SDVITVIKGK+EEIELPV +VD+IIS
Sbjct  116  LSLFCAKAGAKHVYAIECSQMADMAKEIVKTNGYSDVITVIKGKVEEIELPVPKVDVIIS  175

Query  797  EWMGYFLLYE  826
            EWMGYFLL+E
Sbjct  176  EWMGYFLLFE  185



>ref|XP_010495935.1| PREDICTED: probable protein arginine N-methyltransferase 1.2 
[Camelina sativa]
Length=364

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/154 (75%), Positives = 130/154 (84%), Gaps = 2/154 (1%)
 Frame = +2

Query  368  TESSNLEVEE-DTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  544
            T+ +    E+ D +M D   D ++ V DD TSADYYFDSYSHFGIHEEMLKDVVRTK+YQ
Sbjct  12   TQETKFHFEDADVSMSD-GGDNNADVTDDVTSADYYFDSYSHFGIHEEMLKDVVRTKSYQ  70

Query  545  NVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSD  724
            +VIYKN FL KDK+VLDVGAGTGILSLFCAK GA HVYAVECS MA  A+EIVK+NG SD
Sbjct  71   DVIYKNKFLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADTAKEIVKANGLSD  130

Query  725  VITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            VITV+KGKIEEIELPV +VD+IISEWMGYFLLYE
Sbjct  131  VITVLKGKIEEIELPVLKVDVIISEWMGYFLLYE  164



>emb|CDX82711.1| BnaC07g01550D [Brassica napus]
Length=361

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 123/143 (86%), Gaps = 6/143 (4%)
 Frame = +2

Query  398  DTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFK  577
            D  MCD        V DD TSADYYFDSYSHFGIHEEMLKDVVRTK+Y++VIYKN FL K
Sbjct  25   DETMCDAD------VADDITSADYYFDSYSHFGIHEEMLKDVVRTKSYRDVIYKNKFLVK  78

Query  578  DKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEE  757
            DK+VLDVGAGTGILSLFCAK GA HVYAVECS MA  A+EIVKSNGFSDVITV+KGKIEE
Sbjct  79   DKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADTAKEIVKSNGFSDVITVLKGKIEE  138

Query  758  IELPVAQVDIIISEWMGYFLLYE  826
            IELPV +VD+IISEWMGYFL+YE
Sbjct  139  IELPVPKVDVIISEWMGYFLVYE  161



>gb|KFK40319.1| protein arginine n-methyltransferase 1 [Arabis alpina]
Length=332

 Score =   233 bits (593),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 122/140 (87%), Gaps = 8/140 (6%)
 Frame = +2

Query  407  MCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKV  586
            MCD        V DD TSADYYFDSYSHFGIHEEMLKDVVRTK+Y++VIYKN FL KDK+
Sbjct  1    MCD--------VADDITSADYYFDSYSHFGIHEEMLKDVVRTKSYRDVIYKNKFLIKDKI  52

Query  587  VLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIEL  766
            VLDVGAGTGILSLFCAK GA HVYAVECS MA  A+EIVKSNGFSDVITV+KGKIEEIEL
Sbjct  53   VLDVGAGTGILSLFCAKAGAAHVYAVECSQMADTAKEIVKSNGFSDVITVLKGKIEEIEL  112

Query  767  PVAQVDIIISEWMGYFLLYE  826
            PV +VD+IISEWMGYFLLYE
Sbjct  113  PVPKVDVIISEWMGYFLLYE  132



>gb|KJB54345.1| hypothetical protein B456_009G030600 [Gossypium raimondii]
Length=398

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 134/165 (81%), Gaps = 15/165 (9%)
 Frame = +2

Query  368  TESSNLE--------VEEDTAMCDPSADEDSMVG----DDKTSADYYFDSYSHFGIHEEM  511
            + SSNL+          ED +M +P     S  G    DDKTSADYYFDSYSHFGIHEEM
Sbjct  37   SNSSNLDDSIVAVDKASEDVSMGEPDV---SFFGCDGEDDKTSADYYFDSYSHFGIHEEM  93

Query  512  LKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMA  691
            LKD VRTKTYQNVIY+N FLF++K+VLDVGAGTGILSLFCAK GA HVYAVECS MA MA
Sbjct  94   LKDAVRTKTYQNVIYRNKFLFQNKIVLDVGAGTGILSLFCAKAGAAHVYAVECSHMADMA  153

Query  692  QEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            ++IV++NG SDV+TV+KGKIEEIELPVA+VDIIISEWMGYFLL+E
Sbjct  154  KQIVETNGLSDVVTVLKGKIEEIELPVAKVDIIISEWMGYFLLFE  198



>ref|XP_010924490.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Elaeis 
guineensis]
Length=391

 Score =   234 bits (597),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 129/153 (84%), Gaps = 9/153 (6%)
 Frame = +2

Query  368  TESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQN  547
            TESSNLE    +          ++   D+TSADYYFDSYSHFGIHEEMLKDVVRTKTYQN
Sbjct  48   TESSNLENPPQSL---------ALSSSDQTSADYYFDSYSHFGIHEEMLKDVVRTKTYQN  98

Query  548  VIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDV  727
            VIY+N FLFK+KVVLDVGAGTGILS FCAK GAKHVYA+ECS MA MA+EIV++NGFS+V
Sbjct  99   VIYQNTFLFKNKVVLDVGAGTGILSFFCAKAGAKHVYAIECSHMADMAKEIVQANGFSNV  158

Query  728  ITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            ITV+KGK+EEIELPV  +D+IISEWMGYFLL+E
Sbjct  159  ITVLKGKVEEIELPVTCIDVIISEWMGYFLLFE  191



>gb|EPS59604.1| hypothetical protein M569_15200, partial [Genlisea aurea]
Length=330

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 123/130 (95%), Gaps = 2/130 (2%)
 Frame = +2

Query  443  GDDKTSADYYFDSYSHFG--IHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGI  616
            GDDKTSADYYFDSYSHF   + +EMLKDVVRTKTYQNVIYKN+FLFKDKVVLDVGAGTGI
Sbjct  1    GDDKTSADYYFDSYSHFDFLLIQEMLKDVVRTKTYQNVIYKNSFLFKDKVVLDVGAGTGI  60

Query  617  LSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIIS  796
            LSLFCAKVGAKHVYAVECS+MA MAQ+IV  NGFS+VI+V+KGKIEEIELPV++VDIIIS
Sbjct  61   LSLFCAKVGAKHVYAVECSSMADMAQQIVMQNGFSNVISVLKGKIEEIELPVSEVDIIIS  120

Query  797  EWMGYFLLYE  826
            EWMGYFLLYE
Sbjct  121  EWMGYFLLYE  130



>ref|XP_004513091.1| PREDICTED: protein arginine N-methyltransferase 1.1-like [Cicer 
arietinum]
Length=386

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 130/152 (86%), Gaps = 8/152 (5%)
 Frame = +2

Query  371  ESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  550
            E+SNL    D +MC    D+     D KTSADYYFDSYSHFGIHEEMLKD VRTKTYQNV
Sbjct  43   ETSNL----DQSMCGCDLDD----SDGKTSADYYFDSYSHFGIHEEMLKDSVRTKTYQNV  94

Query  551  IYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVI  730
            IY+N FLFK+KVVLDVGAGTGILSLFCAK GA+HVYAVECS MA MA+EIV++NG+S VI
Sbjct  95   IYQNRFLFKNKVVLDVGAGTGILSLFCAKAGAEHVYAVECSDMADMAKEIVETNGYSKVI  154

Query  731  TVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            TV+KGKIEE+ELPV +VDIIISEWMGYFLL+E
Sbjct  155  TVLKGKIEELELPVPKVDIIISEWMGYFLLFE  186



>gb|KHG04415.1| Protein arginine N-methyltransferase 1.1 [Gossypium arboreum]
Length=894

 Score =   243 bits (621),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 137/162 (85%), Gaps = 9/162 (6%)
 Frame = +2

Query  368  TESSNLE--------VEEDTAMCDPSAD-EDSMVGDDKTSADYYFDSYSHFGIHEEMLKD  520
            T++SNL+          ED +M +P     DS  GDDKTSADYYFDSYSHFGIHEEMLKD
Sbjct  506  TDNSNLDESILAVDKATEDVSMGEPDVSFVDSDAGDDKTSADYYFDSYSHFGIHEEMLKD  565

Query  521  VVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEI  700
            VVRTKTYQNVIY+N FLF++KVVLDVGAGTGILSLFCAK GA HVYAVECS MA MA++I
Sbjct  566  VVRTKTYQNVIYQNKFLFQNKVVLDVGAGTGILSLFCAKAGAAHVYAVECSHMADMAKQI  625

Query  701  VKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            V++NG SDVITV+KGKIEEIELPVA+VDIIISEWMGYFLL+E
Sbjct  626  VETNGLSDVITVLKGKIEEIELPVAKVDIIISEWMGYFLLFE  667



>gb|KHG04414.1| Protein arginine N-methyltransferase 1.1 [Gossypium arboreum]
Length=923

 Score =   243 bits (621),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 137/162 (85%), Gaps = 9/162 (6%)
 Frame = +2

Query  368  TESSNLE--------VEEDTAMCDPSAD-EDSMVGDDKTSADYYFDSYSHFGIHEEMLKD  520
            T++SNL+          ED +M +P     DS  GDDKTSADYYFDSYSHFGIHEEMLKD
Sbjct  535  TDNSNLDESILAVDKATEDVSMGEPDVSFVDSDAGDDKTSADYYFDSYSHFGIHEEMLKD  594

Query  521  VVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEI  700
            VVRTKTYQNVIY+N FLF++KVVLDVGAGTGILSLFCAK GA HVYAVECS MA MA++I
Sbjct  595  VVRTKTYQNVIYQNKFLFQNKVVLDVGAGTGILSLFCAKAGAAHVYAVECSHMADMAKQI  654

Query  701  VKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            V++NG SDVITV+KGKIEEIELPVA+VDIIISEWMGYFLL+E
Sbjct  655  VETNGLSDVITVLKGKIEEIELPVAKVDIIISEWMGYFLLFE  696



>ref|XP_008362974.1| PREDICTED: probable protein arginine N-methyltransferase 1 [Malus 
domestica]
Length=338

 Score =   231 bits (590),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +2

Query  443  GDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILS  622
             D KTSADYYFDSYSHFGIHEEMLKD+VRTKTYQNVIY+N FL KDK+VLDVGAGTGILS
Sbjct  11   ADGKTSADYYFDSYSHFGIHEEMLKDLVRTKTYQNVIYQNKFLIKDKIVLDVGAGTGILS  70

Query  623  LFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEW  802
            LFCAK GAKHVYAVECS MA MA+EIV++NG+S+VITV+KGKIEE+ELPV +VDIIISEW
Sbjct  71   LFCAKAGAKHVYAVECSDMADMAKEIVETNGYSNVITVLKGKIEELELPVPKVDIIISEW  130

Query  803  MGYFLLYE  826
            MGYFLL+E
Sbjct  131  MGYFLLFE  138



>ref|XP_002966400.1| hypothetical protein SELMODRAFT_86090 [Selaginella moellendorffii]
 ref|XP_002978163.1| hypothetical protein SELMODRAFT_108460 [Selaginella moellendorffii]
 gb|EFJ20820.1| hypothetical protein SELMODRAFT_108460 [Selaginella moellendorffii]
 gb|EFJ32427.1| hypothetical protein SELMODRAFT_86090 [Selaginella moellendorffii]
Length=337

 Score =   230 bits (587),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = +2

Query  449  DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLF  628
            D TSADYYFDSY+HFGIHEEMLKD VRTKTYQNVIY+N FLFKDKVVLDVGAGTGILSLF
Sbjct  12   DPTSADYYFDSYAHFGIHEEMLKDTVRTKTYQNVIYENGFLFKDKVVLDVGAGTGILSLF  71

Query  629  CAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMG  808
            CAK GAKHVYAVECS MA  A+EI++ NG+SDVITV+KGK+EEIELPV QVD+IISEWMG
Sbjct  72   CAKGGAKHVYAVECSLMANTAKEIIQKNGYSDVITVLKGKVEEIELPVQQVDVIISEWMG  131

Query  809  YFLLYE  826
            YFLL+E
Sbjct  132  YFLLFE  137



>gb|ACJ83303.1| unknown [Medicago truncatula]
Length=281

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 131/154 (85%), Gaps = 8/154 (5%)
 Frame = +2

Query  365  LTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  544
            + E+SNL+  +    CD    +DS   +DKTSADYYFDSYSHFGIHEEMLKD VRTKTYQ
Sbjct  37   VAETSNLD--QSMGGCDL---DDS---NDKTSADYYFDSYSHFGIHEEMLKDTVRTKTYQ  88

Query  545  NVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSD  724
            NVIY+N FLFK+KVVLDVGAGTGILSLFCAK GA HVYAVECS MA  A+EIV++NG+S 
Sbjct  89   NVIYQNRFLFKNKVVLDVGAGTGILSLFCAKAGAAHVYAVECSHMADRAKEIVETNGYSK  148

Query  725  VITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            VITV+KGKIEE+ELPV +VDIIISEWMGYFLL+E
Sbjct  149  VITVLKGKIEELELPVPKVDIIISEWMGYFLLFE  182



>ref|XP_010666534.1| PREDICTED: protein arginine N-methyltransferase 1.1 [Beta vulgaris 
subsp. vulgaris]
Length=368

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/131 (85%), Positives = 122/131 (93%), Gaps = 1/131 (1%)
 Frame = +2

Query  434  SMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTG  613
            S + DD+TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKN FL K KVVLDVGAGTG
Sbjct  39   SNLTDDRTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNDFLVKGKVVLDVGAGTG  98

Query  614  ILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIII  793
            ILSLFCAK GAKHVYAVECS MA MA+EIV++NG+SDVITV+KGKIEEI+LPV +VDII+
Sbjct  99   ILSLFCAKAGAKHVYAVECSHMADMAKEIVETNGYSDVITVLKGKIEEIDLPV-KVDIIV  157

Query  794  SEWMGYFLLYE  826
            SEWMGYFLLYE
Sbjct  158  SEWMGYFLLYE  168



>tpg|DAA61138.1| TPA: hypothetical protein ZEAMMB73_148337 [Zea mays]
Length=384

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 132/154 (86%), Gaps = 3/154 (2%)
 Frame = +2

Query  371  ESSNLEVEE--DTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  544
            E   +EVEE  D  + D  A  + ++G +KTSADYYFDSYSHFG  +EMLKDVVRTKTYQ
Sbjct  32   EEVGMEVEESFDAGVEDEQAAAE-VIGSEKTSADYYFDSYSHFGTLQEMLKDVVRTKTYQ  90

Query  545  NVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSD  724
            NVI +++FL K+KVVLDVGAGTGILSLFCAK GAKHVYA+ECS MA MAQEIVKSNG+SD
Sbjct  91   NVITQSSFLIKNKVVLDVGAGTGILSLFCAKAGAKHVYAIECSQMADMAQEIVKSNGYSD  150

Query  725  VITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            VITVIKGK+EEIELPV +VD+IISEWMGYFLL+E
Sbjct  151  VITVIKGKVEEIELPVPKVDVIISEWMGYFLLFE  184



>gb|KJB65111.1| hypothetical protein B456_010G081400 [Gossypium raimondii]
Length=399

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 150/198 (76%), Gaps = 20/198 (10%)
 Frame = +2

Query  266  QTTTGGHDK-RPTKIRFeyddeeqqqqrpdqdeTLTESSNLE--------VEEDTAMCDP  418
            QT+T   ++   TKIRF+  D++            T+SSNL+          ED +M +P
Sbjct  11   QTSTNSSNQFEGTKIRFQDADDDGVA---------TDSSNLDESILAVDKAAEDVSMGEP  61

Query  419  SAD-EDSMVGDDKTSADYYFDSYSHF-GIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVL  592
            +    DS  GDDKTSADYYFDSYSHF    +EMLKDVVRTKTYQNVIY+N FLF++KVVL
Sbjct  62   NVSFVDSDAGDDKTSADYYFDSYSHFVTAFQEMLKDVVRTKTYQNVIYQNKFLFQNKVVL  121

Query  593  DVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPV  772
            DVGAGTGILSLFCA+ GA HVYAVECS MA MA++IV++NG SDV+TV+KGKIEEIELPV
Sbjct  122  DVGAGTGILSLFCARAGAAHVYAVECSHMADMAKQIVETNGLSDVVTVLKGKIEEIELPV  181

Query  773  AQVDIIISEWMGYFLLYE  826
            A+VDIIISEWMGYFLL+E
Sbjct  182  AKVDIIISEWMGYFLLFE  199



>ref|NP_179557.1| protein arginine N-methyltransferase 1 [Arabidopsis thaliana]
 sp|O82210.1|ANM12_ARATH RecName: Full=Probable protein arginine N-methyltransferase 1.2; 
Short=AtPRMT12 [Arabidopsis thaliana]
 gb|AAC62148.1| putative arginine N-methyltransferase [Arabidopsis thaliana]
 gb|AAP21299.1| At2g19670 [Arabidopsis thaliana]
 dbj|BAE99452.1| putative arginine N-methyltransferase [Arabidopsis thaliana]
 gb|AEC06910.1| protein arginine N-methyltransferase 1 [Arabidopsis thaliana]
Length=366

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCA  634
            TSADYYFDSYSHFGIHEEMLKDVVRTK+YQ+VIYKN FL KDK+VLDVGAGTGILSLFCA
Sbjct  43   TSADYYFDSYSHFGIHEEMLKDVVRTKSYQDVIYKNKFLIKDKIVLDVGAGTGILSLFCA  102

Query  635  KVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYF  814
            K GA HVYAVECS MA  A+EIVKSNGFSDVITV+KGKIEEIELPV +VD+IISEWMGYF
Sbjct  103  KAGAAHVYAVECSQMADTAKEIVKSNGFSDVITVLKGKIEEIELPVPKVDVIISEWMGYF  162

Query  815  LLYE  826
            LLYE
Sbjct  163  LLYE  166



>emb|CDY47762.1| BnaC07g41980D [Brassica napus]
Length=388

 Score =   230 bits (586),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/146 (78%), Positives = 129/146 (88%), Gaps = 6/146 (4%)
 Frame = +2

Query  395  EDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIH--EEMLKDVVRTKTYQNVIYKNAF  568
            +D +MCD +AD  +   DD TSADYYFDSYSHFG++  +EMLKDVVRTKTYQNVIY+N F
Sbjct  47   QDESMCD-AADGTT---DDTTSADYYFDSYSHFGLYLLQEMLKDVVRTKTYQNVIYQNKF  102

Query  569  LFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGK  748
            L KDKVVLDVGAGTGILSLFCAK GAKHVYAVECS MA MA+EIVK+NGFSDVITV+KGK
Sbjct  103  LIKDKVVLDVGAGTGILSLFCAKAGAKHVYAVECSQMADMAKEIVKANGFSDVITVLKGK  162

Query  749  IEEIELPVAQVDIIISEWMGYFLLYE  826
            IEEIELP  +V++IISEWMGYFLL+E
Sbjct  163  IEEIELPTPKVEVIISEWMGYFLLFE  188



>ref|XP_006408885.1| hypothetical protein EUTSA_v10002025mg [Eutrema salsugineum]
 gb|ESQ50338.1| hypothetical protein EUTSA_v10002025mg [Eutrema salsugineum]
Length=360

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 112/154 (73%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = +2

Query  368  TESSNLEVEE-DTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  544
             +++ L  E+ D  MCD   + D  V DD TSADYYFDSYSHFGIHEEMLKDVVRTK Y+
Sbjct  20   NQNTKLRFEDADELMCDAGDNAD--VADDITSADYYFDSYSHFGIHEEMLKDVVRTKCYR  77

Query  545  NVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSD  724
            +VIYKN F  KDK+VLDVGAGTGILSLFCAK GA HVYAVECS MA  A+EIVKSNGFSD
Sbjct  78   DVIYKNKFHIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADTAKEIVKSNGFSD  137

Query  725  VITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
             I V+KGKIEEIE P+ +VD+IISEWMGYFL+YE
Sbjct  138  FIKVLKGKIEEIEFPIPKVDVIISEWMGYFLVYE  171



>ref|XP_002869429.1| hypothetical protein ARALYDRAFT_491807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45688.1| hypothetical protein ARALYDRAFT_491807 [Arabidopsis lyrata subsp. 
lyrata]
Length=390

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +2

Query  458  SADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAK  637
            SADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIY+N FL KDK+VLDVGAGTGILSLFCAK
Sbjct  68   SADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYQNKFLIKDKIVLDVGAGTGILSLFCAK  127

Query  638  VGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFL  817
             GA HVYAVECS MA MA+EIVK+NGFSDVITV+KGKIEEIELP  +VD+IISEWMGYFL
Sbjct  128  AGAAHVYAVECSQMADMAKEIVKANGFSDVITVLKGKIEEIELPTPKVDVIISEWMGYFL  187

Query  818  LYE  826
            L+E
Sbjct  188  LFE  190



>ref|XP_003620880.1| Arginine methyltransferease [Medicago truncatula]
Length=369

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 131/154 (85%), Gaps = 8/154 (5%)
 Frame = +2

Query  365  LTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  544
            + E+SNL+  +    CD    +DS   +DKTSADYYFDSYSHFGIHEEMLKD VRTKTYQ
Sbjct  24   VAETSNLD--QSMGGCDL---DDS---NDKTSADYYFDSYSHFGIHEEMLKDTVRTKTYQ  75

Query  545  NVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSD  724
            NVIY+N FLFK+KVVLDVGAGTGILSLFCAK GA HVYAVECS MA  A+EIV++NG+S 
Sbjct  76   NVIYQNRFLFKNKVVLDVGAGTGILSLFCAKAGAAHVYAVECSHMADRAKEIVETNGYSK  135

Query  725  VITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            VITV+KGKIEE+ELPV +VDIIISEWMGYFLL+E
Sbjct  136  VITVLKGKIEELELPVPKVDIIISEWMGYFLLFE  169



>gb|AES77098.2| arginine N-methyltransferase [Medicago truncatula]
Length=383

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 131/154 (85%), Gaps = 8/154 (5%)
 Frame = +2

Query  365  LTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  544
            + E+SNL+  +    CD    +DS   +DKTSADYYFDSYSHFGIHEEMLKD VRTKTYQ
Sbjct  38   VAETSNLD--QSMGGCDL---DDS---NDKTSADYYFDSYSHFGIHEEMLKDTVRTKTYQ  89

Query  545  NVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSD  724
            NVIY+N FLFK+KVVLDVGAGTGILSLFCAK GA HVYAVECS MA  A+EIV++NG+S 
Sbjct  90   NVIYQNRFLFKNKVVLDVGAGTGILSLFCAKAGAAHVYAVECSHMADRAKEIVETNGYSK  149

Query  725  VITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            VITV+KGKIEE+ELPV +VDIIISEWMGYFLL+E
Sbjct  150  VITVLKGKIEELELPVPKVDIIISEWMGYFLLFE  183



>gb|AFK35108.1| unknown [Medicago truncatula]
Length=383

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 131/154 (85%), Gaps = 8/154 (5%)
 Frame = +2

Query  365  LTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQ  544
            + E+SNL+  +    CD    +DS   +DKTSADYYFDSYSHFGIHEEMLKD VRTKTYQ
Sbjct  38   VAETSNLD--QSMGGCDL---DDS---NDKTSADYYFDSYSHFGIHEEMLKDTVRTKTYQ  89

Query  545  NVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSD  724
            NVIY+N FLFK+KVVLDVGAGTGILSLFCAK GA HVYAVECS MA  A+EIV++NG+S 
Sbjct  90   NVIYQNRFLFKNKVVLDVGAGTGILSLFCAKAGAAHVYAVECSHMADRAKEIVETNGYSK  149

Query  725  VITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            VITV+KGKIEE+ELPV +VDIIISEWMGYFLL+E
Sbjct  150  VITVLKGKIEELELPVPKVDIIISEWMGYFLLFE  183



>ref|XP_006412834.1| hypothetical protein EUTSA_v100269450mg, partial [Eutrema salsugineum]
 gb|ESQ54287.1| hypothetical protein EUTSA_v100269450mg, partial [Eutrema salsugineum]
Length=290

 Score =   225 bits (573),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 127/160 (79%), Gaps = 16/160 (10%)
 Frame = +2

Query  386  EVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIH-------------EEMLKDVV  526
            E  +D +MCD  A E + V DD TSADYYFDSYSHF +H              EMLKDVV
Sbjct  43   EAAQDESMCD--AGESAGVNDDTTSADYYFDSYSHF-VHFFCLIRLEYTLSSLEMLKDVV  99

Query  527  RTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVK  706
            RTKTYQNVIY+N FL KDK+VLDVGAGTGILSLFCAK GA HVYAVECS MA MA+EIVK
Sbjct  100  RTKTYQNVIYQNKFLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADMAKEIVK  159

Query  707  SNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            +NGFSDVITV+KGKIEEIELP  +VD+IISEWMGYFLL+E
Sbjct  160  ANGFSDVITVLKGKIEEIELPTPKVDVIISEWMGYFLLFE  199



>ref|XP_002309219.2| hypothetical protein POPTR_0006s15380g, partial [Populus trichocarpa]
 gb|EEE92742.2| hypothetical protein POPTR_0006s15380g, partial [Populus trichocarpa]
Length=449

 Score =   226 bits (576),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 126/153 (82%), Gaps = 9/153 (6%)
 Frame = +2

Query  395  EDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGI---------HEEMLKDVVRTKTYQN  547
            +D  M DP+A       DDKTSADYYFDSYSHFG           +EMLKD VRTKTYQN
Sbjct  97   DDVTMSDPNAPFVDGGDDDKTSADYYFDSYSHFGTVDVSLLILTLQEMLKDGVRTKTYQN  156

Query  548  VIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDV  727
            VI++N FLFKDKVVLDVGAGTGILSLFCAK GA HVYAVECS +A MA+EIV+SNGFS+V
Sbjct  157  VIFQNKFLFKDKVVLDVGAGTGILSLFCAKAGAAHVYAVECSHIANMAKEIVESNGFSNV  216

Query  728  ITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            ITV+KGKIE+IELPVA+VDIIISEWMGYFLL+E
Sbjct  217  ITVLKGKIEDIELPVAKVDIIISEWMGYFLLFE  249



>gb|KHG19349.1| Protein arginine N-methyltransferase 1 [Gossypium arboreum]
Length=388

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 124/162 (77%), Gaps = 19/162 (12%)
 Frame = +2

Query  368  TESSNLE--------VEEDTAMCDPSADEDSMVG-DDKTSADYYFDSYSHFGIHEEMLKD  520
            + SSNL+          ED +M +P        G DDKTSADYYFDSYSHF         
Sbjct  37   SNSSNLDDSIVAVDKASEDVSMGEPDVSFFGCDGEDDKTSADYYFDSYSHF---------  87

Query  521  VVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEI  700
             VRTKTYQNVIY+N FLF++KVVLDVGAGTGILSLFCAK GA HVYAVECS MA MA++I
Sbjct  88   -VRTKTYQNVIYRNKFLFQNKVVLDVGAGTGILSLFCAKAGAAHVYAVECSHMADMAKQI  146

Query  701  VKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            V++NG SDV+TV+KGKIEEIELPVA+VDIIISEWMGYFLL+E
Sbjct  147  VETNGLSDVVTVLKGKIEEIELPVAKVDIIISEWMGYFLLFE  188



>ref|XP_001703304.1| protein arginine N-methyltransferase [Chlamydomonas reinhardtii]
 sp|A8IEF3.1|ANM1_CHLRE RecName: Full=Protein arginine N-methyltransferase 1 [Chlamydomonas 
reinhardtii]
 gb|EDP05986.1| protein arginine N-methyltransferase [Chlamydomonas reinhardtii]
Length=345

 Score =   206 bits (523),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  449  DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLF  628
            D+TSADYYFDSYSHFGIHEEMLKD VRT+TY N I  NA+LFKDK+VLD+G GTGILSLF
Sbjct  20   DRTSADYYFDSYSHFGIHEEMLKDSVRTRTYMNAILNNAYLFKDKIVLDIGCGTGILSLF  79

Query  629  CAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMG  808
             AK GAKHVY +ECST+A  A +IVK N F D +T+IKGK+EE+ LPV +VDIIISEWMG
Sbjct  80   SAKAGAKHVYGIECSTIAEQATQIVKDNKFDDRVTIIKGKVEEVTLPVDKVDIIISEWMG  139

Query  809  YFLLYE  826
            YFL YE
Sbjct  140  YFLFYE  145



>gb|ETO29521.1| hypothetical protein RFI_07602 [Reticulomyxa filosa]
Length=354

 Score =   202 bits (513),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 121/153 (79%), Gaps = 2/153 (1%)
 Frame = +2

Query  368  TESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQN  547
            TE+++     D    + ++ ++S  G+ KTSADYYFDSYSHFGIHEEMLKD VRTKTYQ 
Sbjct  3    TETNSKTTNMDEKDANSTSKKES--GEHKTSADYYFDSYSHFGIHEEMLKDTVRTKTYQR  60

Query  548  VIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDV  727
             I +N  LFKDK+VLDVGAGTGIL LF A+ GAK V+ +EC+ +A  A++IVK NGF  V
Sbjct  61   AILQNKHLFKDKIVLDVGAGTGILCLFAAQAGAKQVFGIECAGIAVHAKKIVKENGFEKV  120

Query  728  ITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            +T+I+GK+EE+ELPV +VDIIISEWMGYFLLYE
Sbjct  121  VTIIQGKLEEVELPVPKVDIIISEWMGYFLLYE  153



>ref|XP_008613095.1| protein arginine N-methyltransferase [Saprolegnia diclina VS20]
 gb|EQC33455.1| protein arginine N-methyltransferase [Saprolegnia diclina VS20]
Length=333

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 109/140 (78%), Gaps = 6/140 (4%)
 Frame = +2

Query  407  MCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKV  586
            M  P AD        +TS DYYFDSYSHFGIHEEMLKD VRTKTY N I +N  LFKDK+
Sbjct  1    MSAPPADSS------QTSKDYYFDSYSHFGIHEEMLKDTVRTKTYMNAILQNGHLFKDKI  54

Query  587  VLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIEL  766
            VLDVG GTGILS+F AK GA HVY ++CS +   A++IV  NGFSD IT+IKGK+EE+EL
Sbjct  55   VLDVGCGTGILSMFAAKAGAAHVYGIDCSGIITQAKQIVHDNGFSDRITLIKGKVEEVEL  114

Query  767  PVAQVDIIISEWMGYFLLYE  826
            PVA VDIIISEWMGYFLLYE
Sbjct  115  PVAHVDIIISEWMGYFLLYE  134



>ref|XP_002946963.1| hypothetical protein VOLCADRAFT_56214 [Volvox carteri f. nagariensis]
 gb|EFJ52189.1| hypothetical protein VOLCADRAFT_56214 [Volvox carteri f. nagariensis]
Length=331

 Score =   200 bits (509),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/126 (72%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +2

Query  449  DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLF  628
            D TSA+YYFDSYSHFGIHEEMLKD VRT+TY + I  NAFLFKDK+VLD+G GTGILSLF
Sbjct  6    DLTSANYYFDSYSHFGIHEEMLKDSVRTRTYMSAIMNNAFLFKDKIVLDIGCGTGILSLF  65

Query  629  CAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMG  808
             AK GAKHVY +ECST+A  A++IVK N + D +T+IKGK+EE+ LPV +VDII+SEWMG
Sbjct  66   SAKAGAKHVYGIECSTIAEQAKQIVKDNNYEDRVTIIKGKVEEVTLPVEKVDIIVSEWMG  125

Query  809  YFLLYE  826
            YFL YE
Sbjct  126  YFLFYE  131



>ref|XP_002896996.1| protein arginine N-methyltransferase 1 [Phytophthora infestans 
T30-4]
 gb|EEY66477.1| protein arginine N-methyltransferase 1 [Phytophthora infestans 
T30-4]
Length=343

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +2

Query  401  TAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKD  580
            +A   P A  +  V  + TS DYYFDSYSHFGIHEEMLKD VRTK Y N I ++  LFKD
Sbjct  2    SAATPPPAPTNGAVSKEMTSKDYYFDSYSHFGIHEEMLKDTVRTKAYMNAILQSKHLFKD  61

Query  581  KVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEI  760
            KVVLDVG GTGILS+F AK GAKHVY V+CS +   A+EIVK+NGF+D IT+I+GK+EE+
Sbjct  62   KVVLDVGCGTGILSMFAAKAGAKHVYGVDCSGILTQAREIVKANGFADKITLIQGKMEEL  121

Query  761  ELPVAQVDIIISEWMGYFLLYE  826
             LPV +VDIIISEWMGYFLLYE
Sbjct  122  TLPVDKVDIIISEWMGYFLLYE  143



>gb|ETK85528.1| hypothetical protein L915_09678 [Phytophthora parasitica]
 gb|ETL38967.1| hypothetical protein L916_09582 [Phytophthora parasitica]
 gb|ETO74220.1| hypothetical protein F444_09974 [Phytophthora parasitica P1976]
 gb|ETP43471.1| hypothetical protein F442_09785 [Phytophthora parasitica P10297]
Length=343

 Score =   200 bits (508),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  416  PSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLD  595
            P A  +     + TS DYYFDSYSHFGIHEEMLKD VRTK Y N I ++  LFKDKVVLD
Sbjct  7    PPAPVNGATSKEMTSKDYYFDSYSHFGIHEEMLKDTVRTKAYMNAILQSKHLFKDKVVLD  66

Query  596  VGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVA  775
            VG GTGILS+F AK GAKHVY V+CS+M   A+EIVK+NGF+D IT+I+GK+EE+ LPV 
Sbjct  67   VGCGTGILSMFAAKAGAKHVYGVDCSSMLTHAREIVKANGFADKITLIQGKMEELTLPVD  126

Query  776  QVDIIISEWMGYFLLYE  826
            +VDIIISEWMGYFLLYE
Sbjct  127  KVDIIISEWMGYFLLYE  143



>gb|ETI45576.1| hypothetical protein F443_09880 [Phytophthora parasitica P1569]
 gb|ETL92088.1| hypothetical protein L917_09507 [Phytophthora parasitica]
 gb|ETM45387.1| hypothetical protein L914_09546 [Phytophthora parasitica]
 gb|ETP15384.1| hypothetical protein F441_09830 [Phytophthora parasitica CJ01A1]
Length=343

 Score =   199 bits (507),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  416  PSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLD  595
            P A  +     + TS DYYFDSYSHFGIHEEMLKD VRTK Y N I ++  LFKDKVVLD
Sbjct  7    PPAPVNGAASKEMTSKDYYFDSYSHFGIHEEMLKDTVRTKAYMNAILQSKHLFKDKVVLD  66

Query  596  VGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVA  775
            VG GTGILS+F AK GAKHVY V+CS+M   A+EIVK+NGF+D IT+I+GK+EE+ LPV 
Sbjct  67   VGCGTGILSMFAAKAGAKHVYGVDCSSMLTHAREIVKANGFADKITLIQGKMEELTLPVD  126

Query  776  QVDIIISEWMGYFLLYE  826
            +VDIIISEWMGYFLLYE
Sbjct  127  KVDIIISEWMGYFLLYE  143



>ref|XP_008892913.1| hypothetical protein PPTG_01388 [Phytophthora parasitica INRA-310]
 gb|ETN21082.1| hypothetical protein PPTG_01388 [Phytophthora parasitica INRA-310]
Length=343

 Score =   199 bits (507),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 110/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  416  PSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLD  595
            P A  +     + TS DYYFDSYSHFGIHEEMLKD VRTK Y N I ++  LFKDKVVLD
Sbjct  7    PPAPVNGAASREMTSKDYYFDSYSHFGIHEEMLKDTVRTKAYMNAILQSKHLFKDKVVLD  66

Query  596  VGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVA  775
            VG GTGILS+F AK GAKHVY V+CS+M   A+EIVK+NGF+D IT+I+GK+EE+ LPV 
Sbjct  67   VGCGTGILSMFAAKAGAKHVYGVDCSSMLTHAREIVKANGFADKITLIQGKMEELTLPVD  126

Query  776  QVDIIISEWMGYFLLYE  826
            +VDIIISEWMGYFLLYE
Sbjct  127  KVDIIISEWMGYFLLYE  143



>ref|XP_002177025.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC51488.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=445

 Score =   201 bits (510),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +2

Query  428  EDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAG  607
            E +   +D+TS DYYFDSY+H GIHEEMLKD VRT+TY+  I +N  LF+DK+VLDVG G
Sbjct  113  ESTHAPEDRTSKDYYFDSYAHHGIHEEMLKDEVRTRTYEMAILQNRHLFQDKIVLDVGCG  172

Query  608  TGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDI  787
            TGILS+F ++ GAKHVYAV+CST+A  A+ IV  NGF D ITVI+GKIEEI+LPVAQVDI
Sbjct  173  TGILSMFASQAGAKHVYAVDCSTIAHQARLIVAKNGFGDKITVIQGKIEEIDLPVAQVDI  232

Query  788  IISEWMGYFLLYE  826
            I+SEWMGYFLLYE
Sbjct  233  IVSEWMGYFLLYE  245



>gb|AAO32621.1| CR061 protein [Chlamydomonas reinhardtii]
Length=342

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 104/126 (83%), Gaps = 3/126 (2%)
 Frame = +2

Query  449  DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLF  628
            D+TSADYYFDSYSHFGIHEEMLKD VRT+TY N I  NA+LFKDK+VLD+G GTGILSLF
Sbjct  20   DRTSADYYFDSYSHFGIHEEMLKDSVRTRTYMNAILNNAYLFKDKIVLDIGCGTGILSLF  79

Query  629  CAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMG  808
             AK GAKHVY +ECST+A  A +IVK N F D +T+IKGK   + LPV +VDIIISEWMG
Sbjct  80   SAKAGAKHVYGIECSTIAEQATQIVKDNKFDDRVTIIKGK---VTLPVDKVDIIISEWMG  136

Query  809  YFLLYE  826
            YFL YE
Sbjct  137  YFLFYE  142



>gb|KDO24558.1| hypothetical protein SPRG_20913 [Saprolegnia parasitica CBS 223.65]
Length=282

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  464  DYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVG  643
            DYYFDSYSHFGIHEEMLKD VRTKTY N I +N  LFKDKVVLDVG GTGILS+F AK G
Sbjct  17   DYYFDSYSHFGIHEEMLKDAVRTKTYMNAILQNGHLFKDKVVLDVGCGTGILSMFAAKAG  76

Query  644  AKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLY  823
            A HVY ++CS +   A++IV  NGFSD IT+IKGK+EE+ELPV  VDIIISEWMGYFLLY
Sbjct  77   AAHVYGIDCSGIITQAKQIVHDNGFSDRITLIKGKVEEVELPVQHVDIIISEWMGYFLLY  136

Query  824  E  826
            +
Sbjct  137  D  137



>ref|XP_011013848.1| PREDICTED: probable protein arginine N-methyltransferase 1 isoform 
X2 [Populus euphratica]
Length=340

 Score =   195 bits (495),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 93/107 (87%), Positives = 101/107 (94%), Gaps = 0/107 (0%)
 Frame = +2

Query  506  EMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAG  685
            EMLKDVVRTKTYQNVIY+N FLFKDKVVLDVGAGTGILSLFCAK GA HVYAVECS MA 
Sbjct  34   EMLKDVVRTKTYQNVIYQNKFLFKDKVVLDVGAGTGILSLFCAKAGAAHVYAVECSHMAN  93

Query  686  MAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            MA+EIV+SNG+S+VITV+KGKIEE ELPVA+VDIIISEWMGYFLL+E
Sbjct  94   MAKEIVESNGYSNVITVLKGKIEETELPVAKVDIIISEWMGYFLLFE  140



>gb|KDO24020.1| protein arginine N-methyltransferase [Saprolegnia parasitica 
CBS 223.65]
Length=335

 Score =   194 bits (493),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 101/121 (83%), Gaps = 0/121 (0%)
 Frame = +2

Query  464  DYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVG  643
            DYYFDSYSHFGIHEEMLKD VRTKTY N I +N  LFKDKVVLDVG GTGILS+F AK G
Sbjct  16   DYYFDSYSHFGIHEEMLKDAVRTKTYMNAILQNGHLFKDKVVLDVGCGTGILSMFAAKAG  75

Query  644  AKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLY  823
            A HVY ++CS +   A++IV  NGFSD IT+IKGK+EE+ELPV  VDIIISEWMGYFLLY
Sbjct  76   AAHVYGIDCSGIITQAKQIVHDNGFSDRITLIKGKVEEVELPVQHVDIIISEWMGYFLLY  135

Query  824  E  826
            E
Sbjct  136  E  136



>ref|XP_005646141.1| protein arginine N-methyltransferase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21597.1| protein arginine N-methyltransferase [Coccomyxa subellipsoidea 
C-169]
Length=350

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +2

Query  434  SMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTG  613
            S+   + T+ADYYFDSY+HFGIHEEMLKD VRT++YQ  I  NA L+KDK+VLDVG GTG
Sbjct  20   SLSQAEHTAADYYFDSYAHFGIHEEMLKDTVRTRSYQQSILGNAHLYKDKIVLDVGCGTG  79

Query  614  ILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIII  793
            ILSLF AK GAKHVY +E S +A  AQ+IVK NG+   +T+I+GK+EE+ELPV +VDIII
Sbjct  80   ILSLFAAKAGAKHVYGIERSAIAEQAQQIVKDNGYQSKVTIIQGKVEEVELPVEKVDIII  139

Query  794  SEWMGYFLLYE  826
            SEWMGYFL+YE
Sbjct  140  SEWMGYFLMYE  150



>ref|XP_009526476.1| putative arginine N-methyltransferase [Phytophthora sojae]
 gb|EGZ17418.1| putative arginine N-methyltransferase [Phytophthora sojae]
Length=344

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCA  634
            TS DYYFDSYSHFGIHEEMLKD VRTK Y N I ++  LFKDKVVLDVG GTGILS+F A
Sbjct  21   TSKDYYFDSYSHFGIHEEMLKDTVRTKAYMNAILQSKHLFKDKVVLDVGCGTGILSMFAA  80

Query  635  KVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYF  814
            K GAKHVY V+CS +   A+EIV++NGF+D IT+I+GK+EE+ LPV +VDIIISEWMGYF
Sbjct  81   KAGAKHVYGVDCSGILTQAREIVRANGFADKITLIQGKMEELTLPVDKVDIIISEWMGYF  140

Query  815  LLYE  826
            LLYE
Sbjct  141  LLYE  144



>ref|XP_009840743.1| hypothetical protein H257_14578 [Aphanomyces astaci]
 gb|ETV69729.1| hypothetical protein H257_14578 [Aphanomyces astaci]
Length=346

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCA  634
            TS DYYFDSYSHFGIHEEMLKD VRTKTY N I +NA LFK K+VLDVG GTGILS+F A
Sbjct  24   TSKDYYFDSYSHFGIHEEMLKDSVRTKTYMNAIMQNAHLFKGKIVLDVGCGTGILSMFAA  83

Query  635  KVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYF  814
            K GA HVY V+CS +   A++I+  NGFSD IT+IK K+EE+ELPV  VDIIISEWMGYF
Sbjct  84   KAGAAHVYGVDCSGIITQAKQIIADNGFSDRITLIKAKVEEMELPVPHVDIIISEWMGYF  143

Query  815  LLYE  826
            LLYE
Sbjct  144  LLYE  147



>ref|XP_006451412.1| hypothetical protein CICLE_v10008497mg [Citrus clementina]
 gb|ESR64652.1| hypothetical protein CICLE_v10008497mg [Citrus clementina]
 gb|KDO59264.1| hypothetical protein CISIN_1g015306mg [Citrus sinensis]
Length=306

 Score =   191 bits (484),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +2

Query  509  MLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGM  688
            MLKDVVRTK+YQNVIY+N FLFKDKVVLDVGAGTGILSLFCAK GA HVYAVECS MA M
Sbjct  1    MLKDVVRTKSYQNVIYQNKFLFKDKVVLDVGAGTGILSLFCAKAGAAHVYAVECSQMANM  60

Query  689  AQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            A++IV++NGFS+VITV+KGKIEEIELPV +VDIIISEWMGYFLL+E
Sbjct  61   AKQIVEANGFSNVITVLKGKIEEIELPVTKVDIIISEWMGYFLLFE  106



>gb|KJB54348.1| hypothetical protein B456_009G030600 [Gossypium raimondii]
Length=321

 Score =   191 bits (485),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 103/112 (92%), Gaps = 0/112 (0%)
 Frame = +2

Query  491  FGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVEC  670
            F + +EMLKD VRTKTYQNVIY+N FLF++K+VLDVGAGTGILSLFCAK GA HVYAVEC
Sbjct  10   FLVFQEMLKDAVRTKTYQNVIYRNKFLFQNKIVLDVGAGTGILSLFCAKAGAAHVYAVEC  69

Query  671  STMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            S MA MA++IV++NG SDV+TV+KGKIEEIELPVA+VDIIISEWMGYFLL+E
Sbjct  70   SHMADMAKQIVETNGLSDVVTVLKGKIEEIELPVAKVDIIISEWMGYFLLFE  121



>ref|NP_001171787.1| protein arginine N-methyltransferase 1-like [Saccoglossus kowalevskii]
Length=357

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = +2

Query  416  PSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLD  595
            PS D   +  +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  LFKDKVVLD
Sbjct  21   PSEDAKHIKPEDMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNRHLFKDKVVLD  80

Query  596  VGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVA  775
            VG GTGI+S+F AK GA  V  +ECS++  +A++I+K NG SD IT+++GK+EE+ELPV 
Sbjct  81   VGCGTGIMSMFAAKAGASKVIGIECSSIVDLAEQIIKDNGLSDTITIVRGKVEEVELPVE  140

Query  776  QVDIIISEWMGYFLLYE  826
            +VDII+SEWMGY L YE
Sbjct  141  KVDIIVSEWMGYCLFYE  157



>tpg|DAA61136.1| TPA: hypothetical protein ZEAMMB73_148337 [Zea mays]
 tpg|DAA61137.1| TPA: hypothetical protein ZEAMMB73_148337 [Zea mays]
Length=306

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/106 (85%), Positives = 100/106 (94%), Gaps = 0/106 (0%)
 Frame = +2

Query  509  MLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGM  688
            MLKDVVRTKTYQNVI +++FL K+KVVLDVGAGTGILSLFCAK GAKHVYA+ECS MA M
Sbjct  1    MLKDVVRTKTYQNVITQSSFLIKNKVVLDVGAGTGILSLFCAKAGAKHVYAIECSQMADM  60

Query  689  AQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            AQEIVKSNG+SDVITVIKGK+EEIELPV +VD+IISEWMGYFLL+E
Sbjct  61   AQEIVKSNGYSDVITVIKGKVEEIELPVPKVDVIISEWMGYFLLFE  106



>dbj|BAD23315.1| putative protein-arginine N-methyltransferase [Oryza sativa Japonica 
Group]
Length=306

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 101/106 (95%), Gaps = 0/106 (0%)
 Frame = +2

Query  509  MLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGM  688
            MLKDVVRTK+YQNVI +N+FLFKDK+VLDVGAGTGILSLFCAK GAKHVYA+ECS MA M
Sbjct  1    MLKDVVRTKSYQNVITQNSFLFKDKIVLDVGAGTGILSLFCAKAGAKHVYAIECSQMADM  60

Query  689  AQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            A+EIVK+NG+S+VITVIKGK+EEIELPV +VD+IISEWMGYFLL+E
Sbjct  61   AKEIVKTNGYSNVITVIKGKVEEIELPVPKVDVIISEWMGYFLLFE  106



>ref|XP_006298196.1| hypothetical protein CARUB_v10014243mg [Capsella rubella]
 gb|EOA31094.1| hypothetical protein CARUB_v10014243mg [Capsella rubella]
Length=306

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/106 (86%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  509  MLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGM  688
            MLKDVVRTK+YQ+VIYKN FL KDK+VLDVGAGTGILSLFCAK GA HVYAVECS MA  
Sbjct  1    MLKDVVRTKSYQDVIYKNKFLIKDKIVLDVGAGTGILSLFCAKAGAAHVYAVECSQMADT  60

Query  689  AQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            A+EIVKSNGFSDVITV+KGKIEEIELPV +VD+IISEWMGYFLLYE
Sbjct  61   AKEIVKSNGFSDVITVLKGKIEEIELPVPKVDVIISEWMGYFLLYE  106



>ref|XP_001763062.1| protein arginine N-methyltransferase [Physcomitrella patens]
 gb|EDQ72267.1| protein arginine N-methyltransferase [Physcomitrella patens]
Length=306

 Score =   189 bits (479),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  509  MLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGM  688
            MLKD VRTKTYQN IY+N FLFKDKVVLDVGAGTG+LSLFCAK GAKHVYAVECSTMA  
Sbjct  1    MLKDTVRTKTYQNAIYQNGFLFKDKVVLDVGAGTGVLSLFCAKGGAKHVYAVECSTMADT  60

Query  689  AQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            A+EIVK+NG+SDV+TVIKGK+EEI LPV +VDIIISEWMGYFLL+E
Sbjct  61   AREIVKANGYSDVVTVIKGKLEEITLPVDKVDIIISEWMGYFLLFE  106



>gb|EJK72738.1| hypothetical protein THAOC_05697, partial [Thalassiosira oceanica]
Length=317

 Score =   189 bits (479),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            DD+TS DYYFDSY H GIHEEMLKD VRT TYQ  I  N  LF+ KVVLDVGAGT ILS+
Sbjct  162  DDRTSRDYYFDSYGHHGIHEEMLKDDVRTNTYQMAILNNRELFEGKVVLDVGAGTAILSM  221

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F  K GAKHVYAV+CS++   A++IV+ NG +D IT+I+GK+EEI+LPV +VDII+SEWM
Sbjct  222  FAVKAGAKHVYAVDCSSIIDQARQIVEDNGMADKITLIRGKMEEIDLPVPKVDIIVSEWM  281

Query  806  GYFLLYE  826
            GYFLLYE
Sbjct  282  GYFLLYE  288



>ref|XP_006795829.1| PREDICTED: protein arginine N-methyltransferase 8-B-like [Neolamprologus 
brichardi]
Length=266

 Score =   187 bits (475),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  8    EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSM  67

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  68   FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  127

Query  806  GYFLLYE  826
            GY L YE
Sbjct  128  GYCLFYE  134



>ref|XP_008434746.1| PREDICTED: protein arginine N-methyltransferase 8-B isoform X3 
[Poecilia reticulata]
Length=412

 Score =   191 bits (485),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +2

Query  443  GDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILS  622
             D+ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDKVVLDVG+GTGILS
Sbjct  85   ADEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKVVLDVGSGTGILS  144

Query  623  LFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEW  802
            +F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEW
Sbjct  145  MFAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEW  204

Query  803  MGYFLLYE  826
            MGY L YE
Sbjct  205  MGYSLFYE  212



>ref|XP_001460028.1| hypothetical protein [Paramecium tetraurelia strain d4-2]
 emb|CAK92631.1| unnamed protein product [Paramecium tetraurelia]
Length=359

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = +2

Query  461  ADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKV  640
            ADYYFDSYSHF IHEEMLKD +RTK YQN I KN  LF++K+VLDVGAGTGILS+F A+ 
Sbjct  38   ADYYFDSYSHFSIHEEMLKDRIRTKAYQNAILKNKQLFQNKIVLDVGAGTGILSIFAAQA  97

Query  641  GAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLL  820
            GAKHVYAVE + +A  A++I+  NG S+ ITV+KGKIEEIELPV +VDIIISEWMGYFLL
Sbjct  98   GAKHVYAVENANIAIHAKKIISDNGLSEQITVVKGKIEEIELPVEKVDIIISEWMGYFLL  157

Query  821  YE  826
            YE
Sbjct  158  YE  159



>ref|XP_008434747.1| PREDICTED: protein arginine N-methyltransferase 8-B isoform X4 
[Poecilia reticulata]
Length=411

 Score =   191 bits (485),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +2

Query  443  GDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILS  622
             D+ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDKVVLDVG+GTGILS
Sbjct  84   ADEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKVVLDVGSGTGILS  143

Query  623  LFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEW  802
            +F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEW
Sbjct  144  MFAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEW  203

Query  803  MGYFLLYE  826
            MGY L YE
Sbjct  204  MGYSLFYE  211



>ref|XP_007252470.1| PREDICTED: protein arginine N-methyltransferase 8-B-like [Astyanax 
mexicanus]
Length=413

 Score =   191 bits (485),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  LFKDK+VLDVG+GTGILS+
Sbjct  87   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHLFKDKIVLDVGSGTGILSM  146

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  +++I+KSN   DVIT+ KGK+EE ELPV QVDII+SEWM
Sbjct  147  FAAKAGAKHVYGIECSSISEYSEKIIKSNHLDDVITIFKGKVEETELPVDQVDIIVSEWM  206

Query  806  GYFLLYE  826
            GY L YE
Sbjct  207  GYCLFYE  213



>ref|XP_008434748.1| PREDICTED: protein arginine N-methyltransferase 8-B isoform X5 
[Poecilia reticulata]
Length=408

 Score =   191 bits (484),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +2

Query  443  GDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILS  622
             D+ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDKVVLDVG+GTGILS
Sbjct  81   ADEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKVVLDVGSGTGILS  140

Query  623  LFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEW  802
            +F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEW
Sbjct  141  MFAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEW  200

Query  803  MGYFLLYE  826
            MGY L YE
Sbjct  201  MGYSLFYE  208



>ref|XP_005230922.1| PREDICTED: protein arginine N-methyltransferase 1-like [Falco 
peregrinus]
Length=416

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 101/215 (47%), Positives = 130/215 (60%), Gaps = 23/215 (11%)
 Frame = +2

Query  182  SQP*TLNHSLHHLLKP*THSKMDSEGLNQTTTGGHDKRPTKIRFeyddeeqqqqrpdqde  361
            SQP      L H L    H+   +EG  +T   G   RP ++ F                
Sbjct  17   SQP-----RLPHFL----HAVEGAEGPGRTGATGGPLRPPQLTFVA--------------  53

Query  362  TLTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  541
            TL    +L+   +   C P         ++ TS DYYFDSY+HFGIHEEMLKD VRT TY
Sbjct  54   TLANGMSLQTPLEDVSCPPGESSTKPSAEEMTSKDYYFDSYAHFGIHEEMLKDEVRTLTY  113

Query  542  QNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFS  721
            +N ++ N  LFKDKVVLDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N   
Sbjct  114  RNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARRVIGIECSSISDYAVKIVKANKLD  173

Query  722  DVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
             V+++IKGK+EE+ELPV +VDIIISEWMGY L YE
Sbjct  174  HVVSIIKGKVEEVELPVEKVDIIISEWMGYCLFYE  208



>ref|XP_007553288.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X2 [Poecilia formosa]
Length=411

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            D+ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDKVVLDVG+GTGILS+
Sbjct  85   DEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKVVLDVGSGTGILSM  144

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  145  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  204

Query  806  GYFLLYE  826
            GY L YE
Sbjct  205  GYSLFYE  211



>ref|XP_007553287.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X1 [Poecilia formosa]
Length=412

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            D+ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDKVVLDVG+GTGILS+
Sbjct  86   DEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKVVLDVGSGTGILSM  145

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  146  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  205

Query  806  GYFLLYE  826
            GY L YE
Sbjct  206  GYSLFYE  212



>ref|XP_001758827.1| protein arginine N-methyltransferase [Physcomitrella patens]
 gb|EDQ76333.1| protein arginine N-methyltransferase [Physcomitrella patens]
Length=306

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  509  MLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGM  688
            MLKD VRTKTYQN IY+N FLFKDKVVLDVGAGTG+LSLFCAK GAKHVYAVECSTMA  
Sbjct  1    MLKDAVRTKTYQNAIYQNRFLFKDKVVLDVGAGTGVLSLFCAKGGAKHVYAVECSTMAET  60

Query  689  AQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            A+EIVK+NGFSDV+TVIKGK+E+I LPV +VDIIISEWMGYFLL+E
Sbjct  61   AREIVKTNGFSDVVTVIKGKLEDITLPVDKVDIIISEWMGYFLLFE  106



>ref|XP_010741443.1| PREDICTED: protein arginine N-methyltransferase 8-B [Larimichthys 
crocea]
Length=337

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  79   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSM  138

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  139  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVEKVDIIISEWM  198

Query  806  GYFLLYE  826
            GY L YE
Sbjct  199  GYCLFYE  205



>ref|XP_008434745.1| PREDICTED: protein arginine N-methyltransferase 8-B isoform X2 
[Poecilia reticulata]
Length=417

 Score =   191 bits (484),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +2

Query  443  GDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILS  622
             D+ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDKVVLDVG+GTGILS
Sbjct  90   ADEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKVVLDVGSGTGILS  149

Query  623  LFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEW  802
            +F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEW
Sbjct  150  MFAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEW  209

Query  803  MGYFLLYE  826
            MGY L YE
Sbjct  210  MGYSLFYE  217



>ref|XP_008878837.1| hypothetical protein H310_13207 [Aphanomyces invadans]
 gb|ETV92530.1| hypothetical protein H310_13207 [Aphanomyces invadans]
Length=343

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  416  PSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLD  595
            P+A   +   +  TS DYYFDSYSHFGIHEEMLKD VRTKTY N I +N  LFK KVVLD
Sbjct  8    PAAAATTPSVEGMTSKDYYFDSYSHFGIHEEMLKDSVRTKTYMNAILQNVHLFKGKVVLD  67

Query  596  VGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVA  775
            VG GTGILS+F AK GA HVY V+CS +   A++I+  N FSD IT+IK K+E++ELPV 
Sbjct  68   VGCGTGILSMFAAKAGAAHVYGVDCSGIITQAKQIIADNDFSDRITLIKAKVEDMELPVP  127

Query  776  QVDIIISEWMGYFLLYE  826
             VDIIISEWMGYFLLYE
Sbjct  128  HVDIIISEWMGYFLLYE  144



>ref|XP_008434744.1| PREDICTED: protein arginine N-methyltransferase 8-B isoform X1 
[Poecilia reticulata]
Length=418

 Score =   190 bits (483),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +2

Query  443  GDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILS  622
             D+ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDKVVLDVG+GTGILS
Sbjct  91   ADEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKVVLDVGSGTGILS  150

Query  623  LFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEW  802
            +F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEW
Sbjct  151  MFAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEW  210

Query  803  MGYFLLYE  826
            MGY L YE
Sbjct  211  MGYSLFYE  218



>emb|CDO75360.1| hypothetical protein BN946_scf184966.g28 [Trametes cinnabarina]
Length=345

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 107/133 (80%), Gaps = 0/133 (0%)
 Frame = +2

Query  428  EDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAG  607
            +D++  D+ TS DYY DSY+HFGIHEEMLKD VRT +Y+N I  NA LFKDK+VLDVG G
Sbjct  16   QDNITPDNMTSKDYYADSYAHFGIHEEMLKDSVRTGSYRNAIVNNAHLFKDKLVLDVGCG  75

Query  608  TGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDI  787
            TGILS+F AK GAKHV  V+ S +   AQ+IV++NGF D IT++KGK+EE++LP  Q DI
Sbjct  76   TGILSMFAAKAGAKHVVGVDMSNIIDQAQKIVEANGFKDKITLVKGKLEEVQLPFDQFDI  135

Query  788  IISEWMGYFLLYE  826
            IISEWMGYFLLYE
Sbjct  136  IISEWMGYFLLYE  148



>gb|ERN15472.1| hypothetical protein AMTR_s00036p00239020 [Amborella trichopoda]
Length=306

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +2

Query  509  MLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGM  688
            MLKD VRTKTYQNVIY+N FLFKDKVVLDVGAGTGILSLFCAK GAKHVYAVECS MA M
Sbjct  1    MLKDTVRTKTYQNVIYQNKFLFKDKVVLDVGAGTGILSLFCAKAGAKHVYAVECSLMADM  60

Query  689  AQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            A+EIV+ NG++DVITV+KGK+EEI LPV  VDIIISEWMGYFLL+E
Sbjct  61   AKEIVQVNGYADVITVLKGKVEEIVLPVPHVDIIISEWMGYFLLFE  106



>ref|NP_001038507.1| protein arginine N-methyltransferase 8-B [Danio rerio]
 gb|AAI62920.1| Protein arginine methyltransferase 8 [Danio rerio]
 gb|AAI62940.1| Protein arginine methyltransferase 8 [Danio rerio]
Length=334

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  8    EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSM  67

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  +++I+KSN    VIT++KGK+EE ELPV QVDIIISEWM
Sbjct  68   FAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITILKGKVEETELPVDQVDIIISEWM  127

Query  806  GYFLLYE  826
            GY L YE
Sbjct  128  GYCLFYE  134



>ref|XP_005795825.1| PREDICTED: protein arginine N-methyltransferase 8-B-like [Xiphophorus 
maculatus]
Length=421

 Score =   190 bits (482),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            D+ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDKVVLDVG+GTGILS+
Sbjct  95   DEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKVVLDVGSGTGILSM  154

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  155  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDTVITIFKGKVEEVELPVEKVDIIISEWM  214

Query  806  GYFLLYE  826
            GY L YE
Sbjct  215  GYSLFYE  221



>emb|CDH55325.1| protein arginine n-methyltransferase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=335

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 108/140 (77%), Gaps = 5/140 (4%)
 Frame = +2

Query  407  MCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKV  586
            M + + DE  M     TS DYYFDSY+HFGIHEEMLKD VRT +Y++ IY N  LFKDK+
Sbjct  1    MANKTGDEAGM-----TSKDYYFDSYAHFGIHEEMLKDEVRTLSYRSAIYNNKHLFKDKI  55

Query  587  VLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIEL  766
            VLDVG GTGILS+F AK GAKHVY ++ S +   A+EIVK N  SD +T+I+GK+EE+EL
Sbjct  56   VLDVGCGTGILSMFAAKAGAKHVYGIDMSNIIIQAREIVKDNHLSDKVTLIQGKMEEVEL  115

Query  767  PVAQVDIIISEWMGYFLLYE  826
            PV  VDIIISEWMGYFLLYE
Sbjct  116  PVKHVDIIISEWMGYFLLYE  135



>ref|XP_003972845.1| PREDICTED: protein arginine N-methyltransferase 8-B-like [Takifugu 
rubripes]
Length=398

 Score =   189 bits (480),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  72   EDMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHMFKDKIVLDVGSGTGILSM  131

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  132  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVEKVDIIISEWM  191

Query  806  GYFLLYE  826
            GY L YE
Sbjct  192  GYCLFYE  198



>emb|CDS11933.1| hypothetical protein LRAMOSA04129 [Absidia idahoensis var. thermophila]
Length=334

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 108/140 (77%), Gaps = 5/140 (4%)
 Frame = +2

Query  407  MCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKV  586
            M + + DE  M     TS DYYFDSY+HFGIHEEMLKD VRT +Y++ IY N  LF+DK+
Sbjct  1    MANKTGDEAGM-----TSKDYYFDSYAHFGIHEEMLKDEVRTLSYRSAIYNNKHLFQDKI  55

Query  587  VLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIEL  766
            VLDVG GTGILS+F AK GAKHVY ++ S +   A+EIVK N  SD +T+I+GK+EE+EL
Sbjct  56   VLDVGCGTGILSMFAAKAGAKHVYGIDMSNIIHQAREIVKDNHLSDKVTLIQGKMEEVEL  115

Query  767  PVAQVDIIISEWMGYFLLYE  826
            PV  VDIIISEWMGYFLLYE
Sbjct  116  PVKHVDIIISEWMGYFLLYE  135



>gb|KDQ55829.1| hypothetical protein JAAARDRAFT_37247 [Jaapia argillacea MUCL 
33604]
Length=342

 Score =   187 bits (475),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +2

Query  401  TAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKD  580
            T   +P A ED    ++ TS DYY DSY+HFGIHEEMLKD VRT +Y+N IY N+ LFKD
Sbjct  3    TQAAEPMAVEDGAQVENMTSRDYYADSYAHFGIHEEMLKDTVRTASYRNAIYNNSHLFKD  62

Query  581  KVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEI  760
            K VLDVG GTGILS+F AK GAKHV  ++ S +   AQ I+++NGF D IT++KGK+EE 
Sbjct  63   KTVLDVGCGTGILSMFAAKAGAKHVVGIDMSNIIDQAQRIIEANGFKDTITLVKGKLEEA  122

Query  761  ELPVAQVDIIISEWMGYFLLYE  826
             LP+   DII+SEWMGYFLLYE
Sbjct  123  TLPIESFDIIVSEWMGYFLLYE  144



>emb|CAF98851.1| unnamed protein product [Tetraodon nigroviridis]
Length=482

 Score =   191 bits (484),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 86/130 (66%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +2

Query  437  MVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGI  616
            +  D+ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGI
Sbjct  68   LSPDEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGI  127

Query  617  LSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIIS  796
            LS+F AK GA+HVY +ECS++A  ++ I+KSN    VIT+ KGK+EE ELPV +VDIIIS
Sbjct  128  LSMFAAKAGARHVYGIECSSIAEYSERIIKSNHLDSVITIFKGKVEEAELPVDKVDIIIS  187

Query  797  EWMGYFLLYE  826
            EWMGY L YE
Sbjct  188  EWMGYCLFYE  197



>ref|XP_005734858.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X2 [Pundamilia nyererei]
Length=412

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  86   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSM  145

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VITV KGK+EE+ELPV +VDIIISEWM
Sbjct  146  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITVFKGKVEEVELPVEKVDIIISEWM  205

Query  806  GYFLLYE  826
            GY L YE
Sbjct  206  GYCLFYE  212



>ref|XP_004634066.1| PREDICTED: protein arginine N-methyltransferase 1-like isoform 
X2 [Octodon degus]
Length=285

 Score =   185 bits (470),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  410  CDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVV  589
            C P+   +    +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N ++ N  LFKDKVV
Sbjct  15   CGPAETSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVV  74

Query  590  LDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELP  769
            LDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N    V+T+IKGK+EE+ELP
Sbjct  75   LDVGSGTGILCMFAAKAGARKVIGIECSSISDYAMKIVKANKLDHVVTIIKGKVEEVELP  134

Query  770  VAQVDIIISEWMGYFLLYE  826
            V +VDIIISEWMGY L YE
Sbjct  135  VEKVDIIISEWMGYCLFYE  153



>gb|ABB45733.1| HMT hnRNP methyltransferase-like 2 [Ovis aries]
Length=180

 Score =   182 bits (461),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  410  CDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVV  589
            C  + + +    +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N ++ N  LFKDKVV
Sbjct  15   CGQAENSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVV  74

Query  590  LDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELP  769
            LDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N    V+T+IKGK+EE+ELP
Sbjct  75   LDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP  134

Query  770  VAQVDIIISEWMGYFLLYE  826
            V +VDIIISEWMGY L YE
Sbjct  135  VEKVDIIISEWMGYCLFYE  153



>ref|XP_005734857.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X1 [Pundamilia nyererei]
Length=428

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  102  EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSM  161

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VITV KGK+EE+ELPV +VDIIISEWM
Sbjct  162  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITVFKGKVEEVELPVEKVDIIISEWM  221

Query  806  GYFLLYE  826
            GY L YE
Sbjct  222  GYCLFYE  228



>ref|XP_005164712.1| PREDICTED: protein arginine N-methyltransferase 8-B isoform X2 
[Danio rerio]
 sp|Q5RGQ2.2|ANM8B_DANRE RecName: Full=Protein arginine N-methyltransferase 8-B; AltName: 
Full=Heterogeneous nuclear ribonucleoprotein methyltransferase-like 
protein 4; AltName: Full=zfL3 [Danio rerio]
Length=419

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  93   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSM  152

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  +++I+KSN    VIT++KGK+EE ELPV QVDIIISEWM
Sbjct  153  FAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITILKGKVEETELPVDQVDIIISEWM  212

Query  806  GYFLLYE  826
            GY L YE
Sbjct  213  GYCLFYE  219



>ref|XP_005164711.1| PREDICTED: protein arginine N-methyltransferase 8-B isoform X1 
[Danio rerio]
Length=420

 Score =   189 bits (479),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  94   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSM  153

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  +++I+KSN    VIT++KGK+EE ELPV QVDIIISEWM
Sbjct  154  FAAKAGAKHVYGIECSSISEYSEKIIKSNHLDSVITILKGKVEETELPVDQVDIIISEWM  213

Query  806  GYFLLYE  826
            GY L YE
Sbjct  214  GYCLFYE  220



>ref|XP_005734859.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X3 [Pundamilia nyererei]
Length=384

 Score =   188 bits (477),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  58   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSM  117

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VITV KGK+EE+ELPV +VDIIISEWM
Sbjct  118  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITVFKGKVEEVELPVEKVDIIISEWM  177

Query  806  GYFLLYE  826
            GY L YE
Sbjct  178  GYCLFYE  184



>ref|XP_011519270.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X1 
[Homo sapiens]
Length=240

 Score =   183 bits (465),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDKVVLDVG+GTGILS+
Sbjct  68   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSM  127

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK V+ +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  128  FAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWM  187

Query  806  GYFLLYE  826
            GY L YE
Sbjct  188  GYCLFYE  194



>ref|XP_005471154.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X2 [Oreochromis niloticus]
Length=412

 Score =   188 bits (478),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  86   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSM  145

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  146  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  205

Query  806  GYFLLYE  826
            GY L YE
Sbjct  206  GYCLFYE  212



>ref|XP_003447109.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X1 [Oreochromis niloticus]
Length=419

 Score =   188 bits (478),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  93   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSM  152

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  153  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  212

Query  806  GYFLLYE  826
            GY L YE
Sbjct  213  GYCLFYE  219



>ref|XP_004568324.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X1 [Maylandia zebra]
 ref|XP_005930414.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X1 [Haplochromis burtoni]
Length=412

 Score =   188 bits (478),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  86   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSM  145

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  146  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  205

Query  806  GYFLLYE  826
            GY L YE
Sbjct  206  GYCLFYE  212



>ref|XP_011239703.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X2 
[Mus musculus]
Length=259

 Score =   184 bits (467),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDKVVLDVG+GTGILS+
Sbjct  68   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSM  127

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK V+ +ECS+++  +++I+K+N   +VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  128  FAAKAGAKKVFGIECSSISDYSEKIIKANHLDNVITIFKGKVEEVELPVEKVDIIISEWM  187

Query  806  GYFLLYE  826
            GY L YE
Sbjct  188  GYCLFYE  194



>ref|XP_010755120.1| PREDICTED: protein arginine N-methyltransferase 8 [Larimichthys 
crocea]
Length=412

 Score =   188 bits (478),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  86   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  145

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  146  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  205

Query  806  GYFLLYE  826
            GY L YE
Sbjct  206  GYCLFYE  212



>ref|XP_004568325.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X2 [Maylandia zebra]
 ref|XP_005930415.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X2 [Haplochromis burtoni]
Length=384

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  58   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSM  117

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  118  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  177

Query  806  GYFLLYE  826
            GY L YE
Sbjct  178  GYCLFYE  184



>ref|XP_010885649.1| PREDICTED: protein arginine N-methyltransferase 8-B isoform X2 
[Esox lucius]
Length=402

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  76   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHMFKDKIVLDVGSGTGILSM  135

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  136  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVEKVDIIISEWM  195

Query  806  GYFLLYE  826
            GY L YE
Sbjct  196  GYCLFYE  202



>ref|XP_005471155.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X3 [Oreochromis niloticus]
Length=384

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  58   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSM  117

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  118  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  177

Query  806  GYFLLYE  826
            GY L YE
Sbjct  178  GYCLFYE  184



>gb|EWM25412.1| protein arginine N-methyltransferase [Nannochloropsis gaditana]
Length=376

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 113/153 (74%), Gaps = 3/153 (2%)
 Frame = +2

Query  377  SNLEVEEDTAMCDPS---ADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQN  547
            +N EV    +   PS   +++  M     TSADYYFDSYSHFGIHEEMLKD VRT++Y N
Sbjct  24   ANGEVPTKESTTPPSTSHSEDGKMSAVSMTSADYYFDSYSHFGIHEEMLKDEVRTRSYMN  83

Query  548  VIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDV  727
             I +N  LF+ KVVLDVG GTGILS+F AK GA  V  V+CST+   A++IV +NG  D 
Sbjct  84   AIMRNRHLFEGKVVLDVGCGTGILSMFAAKAGAAKVIGVDCSTILEQAKQIVVANGLEDR  143

Query  728  ITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            IT+I+GKIEEI+LPV +VDIIISEWMGYFLLYE
Sbjct  144  ITLIRGKIEEIDLPVEKVDIIISEWMGYFLLYE  176



>ref|XP_010885648.1| PREDICTED: protein arginine N-methyltransferase 8-B isoform X1 
[Esox lucius]
Length=420

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  94   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHMFKDKIVLDVGSGTGILSM  153

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  154  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVEKVDIIISEWM  213

Query  806  GYFLLYE  826
            GY L YE
Sbjct  214  GYCLFYE  220



>ref|XP_004548340.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X2 [Maylandia zebra]
 ref|XP_005930333.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X3 [Haplochromis burtoni]
Length=398

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  72   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSM  131

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  132  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVEKVDIIISEWM  191

Query  806  GYFLLYE  826
            GY L YE
Sbjct  192  GYCLFYE  198



>ref|XP_004646492.1| PREDICTED: protein arginine N-methyltransferase 1 isoform X4 
[Octodon degus]
Length=285

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  410  CDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVV  589
            C P+   +    +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N ++ N  LFKDKVV
Sbjct  15   CGPAETSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVV  74

Query  590  LDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELP  769
            LDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N    V+T+IKGK+EE+ELP
Sbjct  75   LDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP  134

Query  770  VAQVDIIISEWMGYFLLYE  826
            V +VDIIISEWMGY L YE
Sbjct  135  VEKVDIIISEWMGYCLFYE  153



>ref|XP_011398282.1| putative protein arginine N-methyltransferase 1, partial [Auxenochlorella 
protothecoides]
 gb|KFM25389.1| putative protein arginine N-methyltransferase 1, partial [Auxenochlorella 
protothecoides]
Length=334

 Score =   186 bits (471),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCA  634
            T+ADYY DSY HFGIHEEMLKD VRTKTY N I +N  LFKDKVVLDVG GTGILSLF A
Sbjct  11   TAADYYADSYGHFGIHEEMLKDEVRTKTYMNSILRNGHLFKDKVVLDVGCGTGILSLFAA  70

Query  635  KVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYF  814
            K GAKHVY ++ S +A  A+ IV+ NG +D IT+++GK+EE+ELPV  VDIIISEWMGYF
Sbjct  71   KAGAKHVYGIDMSAIAEQAKIIVRDNGHADRITILRGKVEEVELPVDTVDIIISEWMGYF  130

Query  815  LLYE  826
            L+YE
Sbjct  131  LVYE  134



>ref|XP_003445042.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X1 [Oreochromis niloticus]
 ref|XP_004548339.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X1 [Maylandia zebra]
 ref|XP_005451678.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X2 [Oreochromis niloticus]
 ref|XP_005451679.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X3 [Oreochromis niloticus]
 ref|XP_005733521.1| PREDICTED: protein arginine N-methyltransferase 8-B-like [Pundamilia 
nyererei]
 ref|XP_005930331.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X1 [Haplochromis burtoni]
 ref|XP_005930332.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X2 [Haplochromis burtoni]
 ref|XP_006780803.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X1 [Neolamprologus brichardi]
 ref|XP_006780804.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X2 [Neolamprologus brichardi]
 ref|XP_006780805.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X3 [Neolamprologus brichardi]
 ref|XP_006780806.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X4 [Neolamprologus brichardi]
Length=405

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  79   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSM  138

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  139  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVEKVDIIISEWM  198

Query  806  GYFLLYE  826
            GY L YE
Sbjct  199  GYCLFYE  205



>ref|XP_003200481.1| PREDICTED: protein arginine N-methyltransferase 8-B-like [Danio 
rerio]
Length=410

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  84   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHIFKDKIVLDVGSGTGILSM  143

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  +++I+K+N    VIT+ KGK+EE ELPV QVDIIISEWM
Sbjct  144  FAAKAGAKHVYGIECSSISEYSEKIIKANHLDSVITIFKGKVEETELPVDQVDIIISEWM  203

Query  806  GYFLLYE  826
            GY L YE
Sbjct  204  GYCLFYE  210



>ref|XP_008313886.1| PREDICTED: protein arginine N-methyltransferase 8-B-like [Cynoglossus 
semilaevis]
Length=411

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  85   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSM  144

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  145  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVEKVDIIISEWM  204

Query  806  GYFLLYE  826
            GY L YE
Sbjct  205  GYCLFYE  211



>ref|XP_004646489.1| PREDICTED: protein arginine N-methyltransferase 1 isoform X1 
[Octodon degus]
Length=371

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 113/155 (73%), Gaps = 0/155 (0%)
 Frame = +2

Query  362  TLTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  541
            TL    +L+   +   C P+   +    +D TS DYYFDSY+HFGIHEEMLKD VRT TY
Sbjct  17   TLANGMSLQPPLEEVSCGPAETSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTY  76

Query  542  QNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFS  721
            +N ++ N  LFKDKVVLDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N   
Sbjct  77   RNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLD  136

Query  722  DVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
             V+T+IKGK+EE+ELPV +VDIIISEWMGY L YE
Sbjct  137  HVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYE  171



>ref|XP_002288454.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED93890.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=395

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = +2

Query  416  PSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLD  595
            P     S   DD TS DYYFDSYSH GIHEEMLKD VRTKTY+  I  N  LF+ K+VLD
Sbjct  59   PQTANSSEKNDDHTSKDYYFDSYSHHGIHEEMLKDEVRTKTYEMAIKNNRHLFEGKIVLD  118

Query  596  VGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVA  775
            VG GTGIL +F A+ GA HVY V+CS++   AQ+I+ +NGFSD IT+IK K+E++ELPV 
Sbjct  119  VGCGTGILCMFAAQAGAAHVYGVDCSSIIEQAQKIIYANGFSDEITLIKAKMEDVELPVP  178

Query  776  QVDIIISEWMGYFLLYE  826
             VDIIISEWMGYFLLYE
Sbjct  179  SVDIIISEWMGYFLLYE  195



>ref|XP_010776836.1| PREDICTED: protein arginine N-methyltransferase 1-like isoform 
X1 [Notothenia coriiceps]
Length=193

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/151 (58%), Positives = 111/151 (74%), Gaps = 7/151 (5%)
 Frame = +2

Query  374  SSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVI  553
            +  +E+ +  +   P+A+       D TS DYYFDSY+HFGIHEEMLKD VRT TY+N +
Sbjct  5    AERMEISQGESSAKPAAE-------DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSM  57

Query  554  YKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVIT  733
            + N  LFKDKVVLDVG+GTGIL +F AK GAK V  +ECS+++  A +IVK+N   DV+T
Sbjct  58   FHNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANKMDDVVT  117

Query  734  VIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            +IKGK+EE+ELP   VDIIISEWMGY L YE
Sbjct  118  IIKGKVEEVELPTDGVDIIISEWMGYCLFYE  148



>ref|XP_005805954.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X2 [Xiphophorus maculatus]
Length=390

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  64   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSM  123

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDII+SEWM
Sbjct  124  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVEKVDIIVSEWM  183

Query  806  GYFLLYE  826
            GY L YE
Sbjct  184  GYCLFYE  190



>ref|XP_008291045.1| PREDICTED: protein arginine N-methyltransferase 8-B-like [Stegastes 
partitus]
Length=405

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  79   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSM  138

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  139  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVDKVDIIISEWM  198

Query  806  GYFLLYE  826
            GY L YE
Sbjct  199  GYCLFYE  205



>ref|XP_003967225.2| PREDICTED: protein arginine N-methyltransferase 8 [Takifugu rubripes]
Length=362

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            D+ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  36   DEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSM  95

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS++A  ++ I+KSN    VIT+ KGK+EE ELPV +VDIIISEWM
Sbjct  96   FAAKAGAKQVYGIECSSIAEYSERIIKSNHLDSVITIFKGKVEETELPVEKVDIIISEWM  155

Query  806  GYFLLYE  826
            GY L YE
Sbjct  156  GYCLFYE  162



>ref|XP_007564093.1| PREDICTED: protein arginine N-methyltransferase 8-B [Poecilia 
formosa]
Length=405

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  79   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSM  138

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDII+SEWM
Sbjct  139  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVEKVDIIVSEWM  198

Query  806  GYFLLYE  826
            GY L YE
Sbjct  199  GYCLFYE  205



>ref|XP_008398849.1| PREDICTED: protein arginine N-methyltransferase 8-B-like [Poecilia 
reticulata]
Length=405

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  79   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSM  138

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDII+SEWM
Sbjct  139  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVEKVDIIVSEWM  198

Query  806  GYFLLYE  826
            GY L YE
Sbjct  199  GYCLFYE  205



>ref|XP_008310071.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X3 
[Cynoglossus semilaevis]
Length=409

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLD+G+GTGILS+
Sbjct  83   EEMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDIGSGTGILSM  142

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  143  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  202

Query  806  GYFLLYE  826
            GY L YE
Sbjct  203  GYCLFYE  209



>ref|XP_008291515.1| PREDICTED: protein arginine N-methyltransferase 8-B isoform X1 
[Stegastes partitus]
Length=412

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  86   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  145

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ +GK+EE+ELPV +VDIIISEWM
Sbjct  146  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFRGKVEEVELPVEKVDIIISEWM  205

Query  806  GYFLLYE  826
            GY L YE
Sbjct  206  GYCLFYE  212



>ref|XP_005805953.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X1 [Xiphophorus maculatus]
Length=419

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  93   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSM  152

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDII+SEWM
Sbjct  153  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVEKVDIIVSEWM  212

Query  806  GYFLLYE  826
            GY L YE
Sbjct  213  GYCLFYE  219



>ref|XP_008291516.1| PREDICTED: protein arginine N-methyltransferase 8-B isoform X2 
[Stegastes partitus]
Length=409

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  83   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  142

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ +GK+EE+ELPV +VDIIISEWM
Sbjct  143  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFRGKVEEVELPVEKVDIIISEWM  202

Query  806  GYFLLYE  826
            GY L YE
Sbjct  203  GYCLFYE  209



>ref|XP_008310073.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X5 
[Cynoglossus semilaevis]
Length=390

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLD+G+GTGILS+
Sbjct  64   EEMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDIGSGTGILSM  123

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  124  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  183

Query  806  GYFLLYE  826
            GY L YE
Sbjct  184  GYCLFYE  190



>ref|XP_001639674.1| predicted protein [Nematostella vectensis]
 gb|EDO47611.1| predicted protein [Nematostella vectensis]
Length=380

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 103/124 (83%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCA  634
            TSADYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  LF+DK+VLDVG GTGILS+F A
Sbjct  57   TSADYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHLFRDKIVLDVGCGTGILSMFAA  116

Query  635  KVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYF  814
            K GAKHVYA+E S++   ++ I+K N F  VIT+IKGK+E++ELPV +VDIIISEWMGY 
Sbjct  117  KAGAKHVYAIEMSSIVDYSKTIIKDNNFDSVITLIKGKVEDVELPVEKVDIIISEWMGYC  176

Query  815  LLYE  826
            L YE
Sbjct  177  LFYE  180



>ref|XP_008291517.1| PREDICTED: protein arginine N-methyltransferase 8-B isoform X3 
[Stegastes partitus]
Length=397

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  71   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  130

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ +GK+EE+ELPV +VDIIISEWM
Sbjct  131  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFRGKVEEVELPVEKVDIIISEWM  190

Query  806  GYFLLYE  826
            GY L YE
Sbjct  191  GYCLFYE  197



>ref|XP_005451680.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X4 [Oreochromis niloticus]
Length=398

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  72   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSM  131

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  132  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVEKVDIIISEWM  191

Query  806  GYFLLYE  826
            GY L YE
Sbjct  192  GYCLFYE  198



>ref|XP_008310072.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X4 
[Cynoglossus semilaevis]
Length=407

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLD+G+GTGILS+
Sbjct  81   EEMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDIGSGTGILSM  140

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  141  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  200

Query  806  GYFLLYE  826
            GY L YE
Sbjct  201  GYCLFYE  207



>ref|XP_010785893.1| PREDICTED: protein arginine N-methyltransferase 8-B-like [Notothenia 
coriiceps]
Length=412

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N   FKDK+VLDVG+GTGILS+
Sbjct  86   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHAFKDKIVLDVGSGTGILSM  145

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE ELPV +VDIIISEWM
Sbjct  146  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEAELPVEKVDIIISEWM  205

Query  806  GYFLLYE  826
            GY L YE
Sbjct  206  GYSLFYE  212



>ref|XP_008310074.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X6 
[Cynoglossus semilaevis]
Length=387

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLD+G+GTGILS+
Sbjct  61   EEMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDIGSGTGILSM  120

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  121  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  180

Query  806  GYFLLYE  826
            GY L YE
Sbjct  181  GYCLFYE  187



>ref|XP_008310069.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X1 
[Cynoglossus semilaevis]
Length=415

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLD+G+GTGILS+
Sbjct  89   EEMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDIGSGTGILSM  148

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  149  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  208

Query  806  GYFLLYE  826
            GY L YE
Sbjct  209  GYCLFYE  215



>ref|XP_011489450.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X2 
[Oryzias latipes]
Length=384

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  79   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSM  138

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   + IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  139  FAANAGAKHVYGIECSSISEYSEKIIKSNHMHNAITIFKGKVEEVELPVEKVDIIISEWM  198

Query  806  GYFLLYE  826
            GY L YE
Sbjct  199  GYCLFYE  205



>ref|XP_005805955.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X3 [Xiphophorus maculatus]
Length=395

 Score =   186 bits (473),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  69   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSM  128

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDII+SEWM
Sbjct  129  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVEKVDIIVSEWM  188

Query  806  GYFLLYE  826
            GY L YE
Sbjct  189  GYCLFYE  195



>ref|XP_008310070.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X2 
[Cynoglossus semilaevis]
Length=413

 Score =   187 bits (474),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLD+G+GTGILS+
Sbjct  87   EEMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDIGSGTGILSM  146

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  ++ I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  147  FAAKAGAKHVYGIECSSISEYSERIIKSNHLDSVITIFKGKVEEVELPVEKVDIIISEWM  206

Query  806  GYFLLYE  826
            GY L YE
Sbjct  207  GYCLFYE  213



>ref|XP_003384941.1| PREDICTED: protein arginine N-methyltransferase 1-like [Amphimedon 
queenslandica]
Length=341

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/126 (65%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +2

Query  449  DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLF  628
            D TS DYYFDSYSHFGIHEEMLKD +RT TY+N +Y N  LFK KV+LDVG GTGILS+F
Sbjct  16   DLTSKDYYFDSYSHFGIHEEMLKDEIRTLTYRNAMYHNRHLFKGKVILDVGCGTGILSMF  75

Query  629  CAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMG  808
              + GAKHVY V+CS +   A++I++ NG +D +T+IKGK+EEIELP+  VD+I+SEWMG
Sbjct  76   AVRAGAKHVYGVDCSNIINQARDIIRDNGMTDRVTLIKGKMEEIELPIKHVDVIVSEWMG  135

Query  809  YFLLYE  826
            Y L YE
Sbjct  136  YCLFYE  141



>ref|XP_006160195.1| PREDICTED: protein arginine N-methyltransferase 1 [Tupaia chinensis]
Length=303

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = +2

Query  362  TLTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  541
            TL    +L+   +   C  +   +    +D TS DYYFDSY+HFGIHEEMLKD VRT TY
Sbjct  17   TLANGMSLQPPLEEVSCGQAESNEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTY  76

Query  542  QNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFS  721
            +N ++ N  LFKDKVVLDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N   
Sbjct  77   RNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLD  136

Query  722  DVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
             V+T+IKGK+EE+ELPV +VDIIISEWMGY L YE
Sbjct  137  HVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYE  171



>gb|EUC58215.1| arginine N-methyltransferase, partial [Rhizoctonia solani AG-3 
Rhs1AP]
 gb|KEP51269.1| hnrnp arginine N-methyltransferase [Rhizoctonia solani 123E]
Length=344

 Score =   184 bits (468),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +2

Query  425  DEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGA  604
            +ED +  ++ TS DYY DSY+HFGIHEEMLKD VRT +Y+N +Y N+ LFK K VLDVG 
Sbjct  12   EEDQVTPENMTSKDYYADSYAHFGIHEEMLKDTVRTTSYRNAMYNNSHLFKGKTVLDVGC  71

Query  605  GTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVD  784
            GTGILS+F AK GAKHV  ++ S +   AQ+I+++NGF D IT++KGK+EE ELP  Q D
Sbjct  72   GTGILSMFAAKAGAKHVVGIDMSNIIDQAQKIIEANGFKDTITLVKGKLEESELPYKQFD  131

Query  785  IIISEWMGYFLLYE  826
            II+SEWMGYFLLYE
Sbjct  132  IIVSEWMGYFLLYE  145



>gb|EJT52753.1| protein arginine n-methyltransferase [Trichosporon asahii var. 
asahii CBS 2479]
Length=340

 Score =   184 bits (468),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = +2

Query  419  SADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDV  598
             A+ D     + TSADYY DSY+HFGIHEEMLKD VRT +Y+N I +N  LFKDKVVLDV
Sbjct  7    PANGDKPSAGNMTSADYYADSYAHFGIHEEMLKDQVRTLSYRNAIIQNKHLFKDKVVLDV  66

Query  599  GAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQ  778
            G GTGILS+F AK GAK V  ++ S +   AQ+I+ +NGF+D IT++KGK+E++ELPV Q
Sbjct  67   GCGTGILSMFAAKAGAKQVIGIDMSNILDTAQKIIDANGFTDKITLLKGKLEDVELPVKQ  126

Query  779  VDIIISEWMGYFLLYE  826
            VDIIISEWMGYFLLYE
Sbjct  127  VDIIISEWMGYFLLYE  142



>ref|XP_004634065.1| PREDICTED: protein arginine N-methyltransferase 1-like isoform 
X1 [Octodon degus]
Length=353

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  410  CDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVV  589
            C P+   +    +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N ++ N  LFKDKVV
Sbjct  15   CGPAETSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVV  74

Query  590  LDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELP  769
            LDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N    V+T+IKGK+EE+ELP
Sbjct  75   LDVGSGTGILCMFAAKAGARKVIGIECSSISDYAMKIVKANKLDHVVTIIKGKVEEVELP  134

Query  770  VAQVDIIISEWMGYFLLYE  826
            V +VDIIISEWMGY L YE
Sbjct  135  VEKVDIIISEWMGYCLFYE  153



>ref|XP_006633810.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X2 [Lepisosteus oculatus]
Length=403

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  77   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  136

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GA+HVY +ECS+++  +++I+K+N    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  137  FAAKAGARHVYGIECSSISDYSEKIIKANHLDSVITIFKGKVEEVELPVDEVDIIISEWM  196

Query  806  GYFLLYE  826
            GY L YE
Sbjct  197  GYCLFYE  203



>ref|XP_004083213.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X1 
[Oryzias latipes]
Length=405

 Score =   186 bits (472),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  79   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILSM  138

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   + IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  139  FAANAGAKHVYGIECSSISEYSEKIIKSNHMHNAITIFKGKVEEVELPVEKVDIIISEWM  198

Query  806  GYFLLYE  826
            GY L YE
Sbjct  199  GYCLFYE  205



>ref|XP_010776837.1| PREDICTED: protein arginine N-methyltransferase 1-like isoform 
X2 [Notothenia coriiceps]
Length=190

 Score =   179 bits (455),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +2

Query  443  GDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILS  622
             +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N ++ N  LFKDKVVLDVG+GTGIL 
Sbjct  18   AEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNKHLFKDKVVLDVGSGTGILC  77

Query  623  LFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEW  802
            +F AK GAK V  +ECS+++  A +IVK+N   DV+T+IKGK+EE+ELP   VDIIISEW
Sbjct  78   MFAAKAGAKKVIGIECSSISDYAVKIVKANKMDDVVTIIKGKVEEVELPTDGVDIIISEW  137

Query  803  MGYFLLYE  826
            MGY L YE
Sbjct  138  MGYCLFYE  145



>ref|XP_006633811.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X3 [Lepisosteus oculatus]
Length=395

 Score =   186 bits (471),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  69   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  128

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GA+HVY +ECS+++  +++I+K+N    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  129  FAAKAGARHVYGIECSSISDYSEKIIKANHLDSVITIFKGKVEEVELPVDEVDIIISEWM  188

Query  806  GYFLLYE  826
            GY L YE
Sbjct  189  GYCLFYE  195



>gb|KDR74976.1| hypothetical protein GALMADRAFT_248796 [Galerina marginata CBS 
339.88]
Length=343

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 107/139 (77%), Gaps = 2/139 (1%)
 Frame = +2

Query  416  PSADEDSMVGD--DKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVV  589
            PS   D+ V D  D TS DYY DSY+HFGIHEEMLKD VRT +Y+  I  NA LFK K V
Sbjct  6    PSTKSDTGVPDPLDMTSRDYYADSYAHFGIHEEMLKDTVRTGSYRTAIVNNAHLFKGKTV  65

Query  590  LDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELP  769
            LDVG GTGILS+F AK GAKHV  ++ S +   AQ+I+++NGF DVIT++KGK+E++ELP
Sbjct  66   LDVGCGTGILSMFAAKAGAKHVVGIDMSNILDQAQKIIEANGFKDVITLVKGKLEDVELP  125

Query  770  VAQVDIIISEWMGYFLLYE  826
            + + DIIISEWMGYFLLYE
Sbjct  126  IKEFDIIISEWMGYFLLYE  144



>ref|XP_006633809.1| PREDICTED: protein arginine N-methyltransferase 8-B-like isoform 
X1 [Lepisosteus oculatus]
Length=397

 Score =   186 bits (471),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  71   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  130

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GA+HVY +ECS+++  +++I+K+N    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  131  FAAKAGARHVYGIECSSISDYSEKIIKANHLDSVITIFKGKVEEVELPVDEVDIIISEWM  190

Query  806  GYFLLYE  826
            GY L YE
Sbjct  191  GYCLFYE  197



>ref|XP_007531367.1| PREDICTED: protein arginine N-methyltransferase 1 isoform X3 
[Erinaceus europaeus]
Length=285

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  410  CDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVV  589
            C  +   D    +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N ++ N  LFKDKVV
Sbjct  15   CGQAESTDKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVV  74

Query  590  LDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELP  769
            LDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N    V+T+IKGK+EE+ELP
Sbjct  75   LDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP  134

Query  770  VAQVDIIISEWMGYFLLYE  826
            V +VDIIISEWMGY L YE
Sbjct  135  VEKVDIIISEWMGYCLFYE  153



>ref|XP_007074349.1| PREDICTED: protein arginine N-methyltransferase 1 [Panthera tigris 
altaica]
Length=324

 Score =   183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = +2

Query  362  TLTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  541
            TL    +L+   +   C  +   +    +D TS DYYFDSY+HFGIHEEMLKD VRT TY
Sbjct  17   TLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTY  76

Query  542  QNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFS  721
            +N ++ N  LFKDKVVLDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N   
Sbjct  77   RNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLD  136

Query  722  DVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
             V+T+IKGK+EE+ELPV +VDIIISEWMGY L YE
Sbjct  137  HVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYE  171



>emb|CDJ67059.1| arginine N-methyltransferase 1, putative [Eimeria necatrix]
Length=400

 Score =   186 bits (471),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 111/152 (73%), Gaps = 3/152 (2%)
 Frame = +2

Query  371  ESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  550
            +   L  EE  A    SAD   +  DD +SADYYF+SY+HF IHEEM+KD VRT +YQ  
Sbjct  50   QCQKLSPEEKAAF---SADWKQLQQDDISSADYYFNSYAHFSIHEEMIKDSVRTCSYQRA  106

Query  551  IYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVI  730
            I  N  LF+ KVVLDVG+GTGILSLF A+ GAKHVY +ECS +  +A+++  +NG  D +
Sbjct  107  IMDNQHLFRGKVVLDVGSGTGILSLFAARAGAKHVYGIECSEIVRIARKVAAANGLEDRV  166

Query  731  TVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            T ++GK EEIELPV +VDII+SEWMGYFLLYE
Sbjct  167  TFVEGKAEEIELPVEKVDIIVSEWMGYFLLYE  198



>ref|XP_007941041.1| PREDICTED: protein arginine N-methyltransferase 1 isoform X1 
[Orycteropus afer afer]
Length=371

 Score =   185 bits (469),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = +2

Query  362  TLTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  541
            TL    NL+   +   C  +   +    +D TS DYYFDSY+HFGIHEEMLKD VRT TY
Sbjct  17   TLANGMNLQPSLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTY  76

Query  542  QNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFS  721
            +N ++ N  LFKDKVVLDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N   
Sbjct  77   RNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLD  136

Query  722  DVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
             V+T+IKGK+EE+ELPV +VDI+ISEWMGY L YE
Sbjct  137  HVVTIIKGKVEEVELPVEKVDIVISEWMGYCLFYE  171



>emb|CEL61324.1| protein arginine N-methyltransferase 1 [Rhizoctonia solani AG-1 
IB]
Length=344

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 104/133 (78%), Gaps = 0/133 (0%)
 Frame = +2

Query  428  EDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAG  607
            ED +  ++ TS DYY DSY+HFGIHEEMLKD VRT +Y+N +Y N+ LFK K VLDVG G
Sbjct  13   EDQVNTENMTSKDYYADSYAHFGIHEEMLKDTVRTTSYRNAMYNNSHLFKGKTVLDVGCG  72

Query  608  TGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDI  787
            TGILS+F AK GAKHV  ++ S +   AQ+I+++NGF D IT++KGK+EE ELP  Q DI
Sbjct  73   TGILSMFAAKAGAKHVVGIDMSNIIDQAQKIIEANGFKDTITLVKGKLEEAELPFQQFDI  132

Query  788  IISEWMGYFLLYE  826
            I+SEWMGYFLLYE
Sbjct  133  IVSEWMGYFLLYE  145



>ref|XP_004071919.1| PREDICTED: protein arginine N-methyltransferase 1 isoform X1 
[Oryzias latipes]
Length=348

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 113/151 (75%), Gaps = 7/151 (5%)
 Frame = +2

Query  374  SSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVI  553
            +  +EV +  +   P+A+       D TS DYYFDSY+HFGIHEEMLKD VRT TY+N +
Sbjct  5    AERMEVSQGESSAKPAAE-------DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSM  57

Query  554  YKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVIT  733
            + N  LFKDKVVLDVG+GTGIL +F AK GAK V  +ECS+++  A +IVK+N   DV+T
Sbjct  58   FYNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANNMDDVVT  117

Query  734  VIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            +IKGK+EE+ELPV +VDIIISEWMGY L YE
Sbjct  118  IIKGKVEEVELPVDKVDIIISEWMGYCLFYE  148



>emb|CDJ41812.1| arginine N-methyltransferase 1, putative [Eimeria tenella]
Length=400

 Score =   185 bits (470),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 111/152 (73%), Gaps = 3/152 (2%)
 Frame = +2

Query  371  ESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  550
            +   L  EE  A    SAD   +  DD +SADYYF+SY+HF IHEEM+KD VRT +YQ  
Sbjct  50   QCQKLSPEEKAAF---SADWKQLQQDDISSADYYFNSYAHFSIHEEMIKDSVRTCSYQRA  106

Query  551  IYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVI  730
            I  N  LF+ KVVLDVG+GTGILSLF A+ GAKHVY +ECS +  +A+++  +NG  D +
Sbjct  107  IMDNQHLFRGKVVLDVGSGTGILSLFAARAGAKHVYGIECSEIVRIARKVAAANGLEDRV  166

Query  731  TVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            T ++GK EEIELPV +VDII+SEWMGYFLLYE
Sbjct  167  TFVEGKAEEIELPVEKVDIIVSEWMGYFLLYE  198



>ref|XP_010881612.1| PREDICTED: protein arginine N-methyltransferase 8-B-like [Esox 
lucius]
Length=408

 Score =   186 bits (471),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY HFGIHEEMLKD VRT TY+N +Y N   FKDK VLDVG+GTGILS+
Sbjct  82   EEMTSKDYYFDSYGHFGIHEEMLKDEVRTLTYRNSMYHNKHAFKDKTVLDVGSGTGILSM  141

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS+++  +++I+KSN    VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  142  FAAKAGAKHVYGIECSSISEYSEKIIKSNQLDSVITIFKGKVEEVELPVEKVDIIISEWM  201

Query  806  GYFLLYE  826
            GY L YE
Sbjct  202  GYCLFYE  208



>gb|KFH05099.1| histone arginine methyltransferase PRMT1 [Toxoplasma gondii VAND]
Length=277

 Score =   182 bits (461),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ +SADYYF+SY+HFGIHEEM+KD VRT  YQ  I +NA LF +KVVLDVG+GTGILSL
Sbjct  64   ENLSSADYYFNSYAHFGIHEEMIKDSVRTGCYQRAICQNAHLFANKVVLDVGSGTGILSL  123

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAKHVY +ECS +  +A++IVK N   D +T ++GK EE+ LPV +VDIIISEWM
Sbjct  124  FAAKAGAKHVYGIECSEIVNIARKIVKENDMEDKVTFVQGKAEEVSLPVEKVDIIISEWM  183

Query  806  GYFLLYE  826
            GYFLLYE
Sbjct  184  GYFLLYE  190



>ref|XP_010789868.1| PREDICTED: protein arginine N-methyltransferase 8-B-like [Notothenia 
coriiceps]
Length=553

 Score =   189 bits (479),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGIL +
Sbjct  79   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNAMYHNKHVFKDKIVLDVGSGTGILCM  138

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F A  GAKHVY +ECS+++  +++I+KSN   +VIT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  139  FAANAGAKHVYGIECSSISEYSEKIIKSNHLHNVITIFKGKVEEVELPVEKVDIIISEWM  198

Query  806  GYFLLYE  826
            GY L YE
Sbjct  199  GYCLFYE  205



>ref|XP_004646490.1| PREDICTED: protein arginine N-methyltransferase 1 isoform X2 
[Octodon degus]
Length=353

 Score =   184 bits (467),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  410  CDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVV  589
            C P+   +    +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N ++ N  LFKDKVV
Sbjct  15   CGPAETSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVV  74

Query  590  LDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELP  769
            LDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N    V+T+IKGK+EE+ELP
Sbjct  75   LDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP  134

Query  770  VAQVDIIISEWMGYFLLYE  826
            V +VDIIISEWMGY L YE
Sbjct  135  VEKVDIIISEWMGYCLFYE  153



>ref|XP_007531365.1| PREDICTED: protein arginine N-methyltransferase 1 isoform X1 
[Erinaceus europaeus]
Length=371

 Score =   184 bits (468),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = +2

Query  362  TLTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  541
            TL    +L+   +   C  +   D    +D TS DYYFDSY+HFGIHEEMLKD VRT TY
Sbjct  17   TLANGMSLQPPLEEVSCGQAESTDKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTY  76

Query  542  QNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFS  721
            +N ++ N  LFKDKVVLDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N   
Sbjct  77   RNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLD  136

Query  722  DVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
             V+T+IKGK+EE+ELPV +VDIIISEWMGY L YE
Sbjct  137  HVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYE  171



>ref|XP_009503841.1| PREDICTED: protein arginine N-methyltransferase 8 [Phalacrocorax 
carbo]
Length=334

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  8    EDMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  67

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  68   FAAKAGAKKVYGIECSSISDYSEKIIKANHLENIITIFKGKVEEVELPVDKVDIIISEWM  127

Query  806  GYFLLYE  826
            GY L YE
Sbjct  128  GYCLFYE  134



>ref|XP_010079528.1| PREDICTED: protein arginine N-methyltransferase 8 [Pterocles 
gutturalis]
Length=272

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  8    EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  67

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY VECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  68   FAAKAGAKKVYGVECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDKVDIIISEWM  127

Query  806  GYFLLYE  826
            GY L YE
Sbjct  128  GYCLFYE  134



>ref|XP_003976090.1| PREDICTED: protein arginine N-methyltransferase 1 isoform X2 
[Takifugu rubripes]
Length=348

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 91/151 (60%), Positives = 112/151 (74%), Gaps = 7/151 (5%)
 Frame = +2

Query  374  SSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVI  553
            S  +EV +  +   P+A+       D TS DYYFDSY+HFGIHEEMLKD VRT TY+N +
Sbjct  5    SERMEVSQGESSVKPAAE-------DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSM  57

Query  554  YKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVIT  733
            + N  LFKDKVVLDVG+GTGIL +F AK GAK V  +ECS+++  A +IVK+N   DV+T
Sbjct  58   FHNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANKLDDVVT  117

Query  734  VIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            +IKGK+EE+ELPV  VDIIISEWMGY L YE
Sbjct  118  IIKGKVEEVELPVDGVDIIISEWMGYCLFYE  148



>ref|XP_009100912.1| PREDICTED: protein arginine N-methyltransferase 8 [Serinus canaria]
 ref|XP_009100913.1| PREDICTED: protein arginine N-methyltransferase 8 [Serinus canaria]
Length=394

 Score =   185 bits (469),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  68   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  127

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV QVDIIISEWM
Sbjct  128  FAAKAGAKQVYGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDQVDIIISEWM  187

Query  806  GYFLLYE  826
            GY L YE
Sbjct  188  GYCLFYE  194



>ref|XP_004646491.1| PREDICTED: protein arginine N-methyltransferase 1 isoform X3 
[Octodon degus]
Length=347

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 107/139 (77%), Gaps = 0/139 (0%)
 Frame = +2

Query  410  CDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVV  589
            C P+   +    +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N ++ N  LFKDKVV
Sbjct  9    CGPAETSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVV  68

Query  590  LDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELP  769
            LDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N    V+T+IKGK+EE+ELP
Sbjct  69   LDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP  128

Query  770  VAQVDIIISEWMGYFLLYE  826
            V +VDIIISEWMGY L YE
Sbjct  129  VEKVDIIISEWMGYCLFYE  147



>ref|XP_005815116.1| PREDICTED: protein arginine N-methyltransferase 1-like isoform 
X1 [Xiphophorus maculatus]
 ref|XP_007541681.1| PREDICTED: protein arginine N-methyltransferase 1 isoform X1 
[Poecilia formosa]
 ref|XP_008413240.1| PREDICTED: protein arginine N-methyltransferase 1 isoform X1 
[Poecilia reticulata]
Length=348

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 112/151 (74%), Gaps = 7/151 (5%)
 Frame = +2

Query  374  SSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVI  553
            +  +EV +  +   P+A+       D TS DYYFDSY+HFGIHEEMLKD VRT TY+N +
Sbjct  5    AERMEVSQGESSVKPAAE-------DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSM  57

Query  554  YKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVIT  733
            + N  LFKDKVVLDVG+GTGIL +F AK GAK V  +ECS+++  A +IVK+N   DV+T
Sbjct  58   FHNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANNLDDVVT  117

Query  734  VIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            +IKGK+EE+ELPV  VDIIISEWMGY L YE
Sbjct  118  IIKGKVEEVELPVEGVDIIISEWMGYCLFYE  148



>ref|XP_003269731.2| PREDICTED: protein arginine N-methyltransferase 1 [Nomascus leucogenys]
Length=346

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = +2

Query  362  TLTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  541
            TL    +L+   +   C  +   +    +D TS DYYFDSY+HFGIHEEMLKD VRT TY
Sbjct  17   TLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTY  76

Query  542  QNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFS  721
            +N ++ N  LFKDKVVLDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N   
Sbjct  77   RNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLD  136

Query  722  DVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
             V+T+IKGK+EE+ELPV +VDIIISEWMGY L YE
Sbjct  137  HVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYE  171



>ref|XP_011615232.1| PREDICTED: protein arginine N-methyltransferase 1 isoform X1 
[Takifugu rubripes]
Length=357

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 114/153 (75%), Gaps = 2/153 (1%)
 Frame = +2

Query  374  SSNLEVEEDTAMCDPSADEDSM--VGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQN  547
            S  +EV+   +  + S  E S+    +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N
Sbjct  5    SERMEVQSLKSNSNVSQGESSVKPAAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRN  64

Query  548  VIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDV  727
             ++ N  LFKDKVVLDVG+GTGIL +F AK GAK V  +ECS+++  A +IVK+N   DV
Sbjct  65   SMFHNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANKLDDV  124

Query  728  ITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            +T+IKGK+EE+ELPV  VDIIISEWMGY L YE
Sbjct  125  VTIIKGKVEEVELPVDGVDIIISEWMGYCLFYE  157



>ref|XP_008633092.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X2 
[Corvus brachyrhynchos]
Length=343

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCA  634
            TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+F A
Sbjct  20   TSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSMFAA  79

Query  635  KVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYF  814
            K GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV QVDIIISEWMGY 
Sbjct  80   KAGAKKVYGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDQVDIIISEWMGYC  139

Query  815  LLYE  826
            L YE
Sbjct  140  LFYE  143



>ref|XP_005433881.1| PREDICTED: protein arginine N-methyltransferase 1-like [Falco 
cherrug]
Length=361

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/155 (56%), Positives = 111/155 (72%), Gaps = 0/155 (0%)
 Frame = +2

Query  362  TLTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  541
            TL    +L+   +   C P         ++ TS DYYFDSY+HFGIHEEMLKD VRT TY
Sbjct  7    TLANGMSLQTPLEDVSCPPGESSTKPSAEEMTSKDYYFDSYAHFGIHEEMLKDEVRTLTY  66

Query  542  QNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFS  721
            +N ++ N  LFKDKVVLDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N   
Sbjct  67   RNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARRVIGIECSSISDYAVKIVKANKLD  126

Query  722  DVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
             V+++IKGK+EE+ELPV +VDIIISEWMGY L YE
Sbjct  127  HVVSIIKGKVEEVELPVEKVDIIISEWMGYCLFYE  161



>ref|XP_001746880.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ88287.1| predicted protein [Monosiga brevicollis MX1]
Length=339

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = +2

Query  413  DPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVL  592
            D +AD       ++++ DYYFDSYSHFGIHEEM+KD VRT TY+  I +N  L KDK+VL
Sbjct  2    DSTADPMLQASAEQSAKDYYFDSYSHFGIHEEMIKDSVRTGTYRRSIVQNEHLIKDKIVL  61

Query  593  DVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPV  772
            DVG GTGILS+F A+ GAKHVYA++CS +A  A++IVK N F D ITVI+GK+E+++LPV
Sbjct  62   DVGCGTGILSMFAAQAGAKHVYAIDCSNIAKQARQIVKDNKFDDRITVIQGKMEDLKLPV  121

Query  773  AQVDIIISEWMGYFLLYE  826
             +VD+IISEWMGY L+YE
Sbjct  122  DKVDVIISEWMGYALIYE  139



>ref|XP_005011706.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X3 
[Anas platyrhynchos]
Length=337

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  68   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  127

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  128  FAAKAGAKKVYGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDKVDIIISEWM  187

Query  806  GYFLLYE  826
            GY L YE
Sbjct  188  GYCLFYE  194



>ref|XP_003456914.1| PREDICTED: protein arginine N-methyltransferase 1-like isoform 
X1 [Oreochromis niloticus]
 ref|XP_004573168.1| PREDICTED: protein arginine N-methyltransferase 1-like isoform 
X1 [Maylandia zebra]
 ref|XP_005749705.1| PREDICTED: protein arginine N-methyltransferase 1-like isoform 
X2 [Pundamilia nyererei]
 ref|XP_005949607.1| PREDICTED: protein arginine N-methyltransferase 1-like isoform 
X1 [Haplochromis burtoni]
Length=351

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 112/151 (74%), Gaps = 7/151 (5%)
 Frame = +2

Query  374  SSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVI  553
            +  +EV +  +   P+A+       D TS DYYFDSY+HFGIHEEMLKD VRT TY+N +
Sbjct  8    AEGMEVSQGESSAKPAAE-------DMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSM  60

Query  554  YKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVIT  733
            + N  LFKDKVVLDVG+GTGIL +F AK GAK V  +ECS+++  A +IVK+N   DV+T
Sbjct  61   FHNKHLFKDKVVLDVGSGTGILCMFAAKAGAKKVIGIECSSISDYAVKIVKANNLDDVVT  120

Query  734  VIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            +IKGK+EE+ELPV  VDIIISEWMGY L YE
Sbjct  121  IIKGKVEEVELPVDGVDIIISEWMGYCLFYE  151



>gb|KFV55408.1| Protein arginine N-methyltransferase 8, partial [Tyto alba]
Length=301

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  43   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  102

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  103  FAAKAGAKKVYGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDKVDIIISEWM  162

Query  806  GYFLLYE  826
            GY L YE
Sbjct  163  GYCLFYE  169



>ref|XP_004286220.1| PREDICTED: protein arginine N-methyltransferase 1 isoform 3 [Orcinus 
orca]
 ref|XP_004314527.1| PREDICTED: protein arginine N-methyltransferase 1 isoform 3 [Tursiops 
truncatus]
 ref|XP_007463441.1| PREDICTED: protein arginine N-methyltransferase 1 isoform X4 
[Lipotes vexillifer]
Length=285

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 114/152 (75%), Gaps = 3/152 (2%)
 Frame = +2

Query  371  ESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNV  550
            E++N  +E   A  + S   ++   +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N 
Sbjct  5    EAANCIMEVSCAQAESSEKPNA---EDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNS  61

Query  551  IYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVI  730
            ++ N  LFKDKVVLDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N    V+
Sbjct  62   MFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARKVIGIECSSISDYAVKIVKANKLDHVV  121

Query  731  TVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
            T+IKGK+EE+ELPV +VDIIISEWMGY L YE
Sbjct  122  TIIKGKVEEVELPVEKVDIIISEWMGYCLFYE  153



>gb|KFW91495.1| Protein arginine N-methyltransferase 8, partial [Phalacrocorax 
carbo]
Length=369

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  43   EDMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  102

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  103  FAAKAGAKKVYGIECSSISDYSEKIIKANHLENIITIFKGKVEEVELPVDKVDIIISEWM  162

Query  806  GYFLLYE  826
            GY L YE
Sbjct  163  GYCLFYE  169



>ref|XP_009968359.1| PREDICTED: protein arginine N-methyltransferase 8 [Tyto alba]
Length=272

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  8    EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  67

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  68   FAAKAGAKKVYGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDKVDIIISEWM  127

Query  806  GYFLLYE  826
            GY L YE
Sbjct  128  GYCLFYE  134



>ref|XP_004628126.1| PREDICTED: protein arginine N-methyltransferase 1-like, partial 
[Octodon degus]
Length=262

 Score =   181 bits (459),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  410  CDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVV  589
            C P+   +    +D  S DYYFDSY+HFGIH+EMLKD VRT TY+N ++ N  LFKDKVV
Sbjct  15   CGPAETSEKPNAEDMMSKDYYFDSYAHFGIHKEMLKDEVRTLTYRNSMFHNRHLFKDKVV  74

Query  590  LDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELP  769
            LDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N    V+T+IKGK+EE+ELP
Sbjct  75   LDVGSGTGILCMFAAKAGARKVIGIECSSISDYAMKIVKANKLDHVVTIIKGKVEEVELP  134

Query  770  VAQVDIIISEWMGYFLLYE  826
            V +VDIIISEWMGY L YE
Sbjct  135  VEKVDIIISEWMGYCLFYE  153



>gb|ABM83307.1| protein arginine methyltransferase 8 [synthetic construct]
 gb|ABM86519.1| protein arginine methyltransferase 8 [synthetic construct]
 gb|AIC60430.1| PRMT8, partial [synthetic construct]
Length=334

 Score =   183 bits (464),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDKVVLDVG+GTGILS+
Sbjct  8    EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSM  67

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK V+ +ECS+++  +Q+I+K+N   ++IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  68   FAAKAGAKKVFGIECSSISDYSQKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWM  127

Query  806  GYFLLYE  826
            GY L YE
Sbjct  128  GYCLFYE  134



>gb|KFO60019.1| Protein arginine N-methyltransferase 8, partial [Corvus brachyrhynchos]
Length=369

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  43   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  102

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV QVDIIISEWM
Sbjct  103  FAAKAGAKKVYGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDQVDIIISEWM  162

Query  806  GYFLLYE  826
            GY L YE
Sbjct  163  GYCLFYE  169



>ref|XP_005011705.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X2 
[Anas platyrhynchos]
Length=347

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  68   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  127

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  128  FAAKAGAKKVYGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDKVDIIISEWM  187

Query  806  GYFLLYE  826
            GY L YE
Sbjct  188  GYCLFYE  194



>ref|XP_010176495.1| PREDICTED: protein arginine N-methyltransferase 8 [Caprimulgus 
carolinensis]
Length=272

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  8    EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  67

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  68   FAAKAGAKKVYGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDKVDIIISEWM  127

Query  806  GYFLLYE  826
            GY L YE
Sbjct  128  GYCLFYE  134



>ref|XP_004381697.1| PREDICTED: protein arginine N-methyltransferase 1 isoform 3 [Trichechus 
manatus latirostris]
Length=285

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 106/139 (76%), Gaps = 0/139 (0%)
 Frame = +2

Query  410  CDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVV  589
            C  +   +    +D TS DYYFDSY+HFGIHEEMLKD VRT TY+N ++ N  LFKDKVV
Sbjct  15   CGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMFHNRHLFKDKVV  74

Query  590  LDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELP  769
            LDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N    V+T+IKGK+EE+ELP
Sbjct  75   LDVGSGTGILCMFAAKAGARRVIGIECSSISDYAVKIVKANKLDHVVTIIKGKVEEVELP  134

Query  770  VAQVDIIISEWMGYFLLYE  826
            V +VDIIISEWMGY L YE
Sbjct  135  VEKVDIIISEWMGYCLFYE  153



>gb|KFZ52530.1| Protein arginine N-methyltransferase 8, partial [Caprimulgus 
carolinensis]
Length=301

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  43   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  102

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  103  FAAKAGAKKVYGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDKVDIIISEWM  162

Query  806  GYFLLYE  826
            GY L YE
Sbjct  163  GYCLFYE  169



>ref|XP_005494607.1| PREDICTED: protein arginine N-methyltransferase 8 [Zonotrichia 
albicollis]
 ref|XP_005430909.1| PREDICTED: protein arginine N-methyltransferase 8 [Geospiza fortis]
Length=394

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  68   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  127

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV QVDIIISEWM
Sbjct  128  FAAKAGAKKVYGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDQVDIIISEWM  187

Query  806  GYFLLYE  826
            GY L YE
Sbjct  188  GYCLFYE  194



>ref|XP_005061526.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X1 
[Ficedula albicollis]
Length=394

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  68   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  127

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV QVDIIISEWM
Sbjct  128  FAAKAGAKKVYGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDQVDIIISEWM  187

Query  806  GYFLLYE  826
            GY L YE
Sbjct  188  GYCLFYE  194



>ref|XP_008633090.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X1 
[Corvus brachyrhynchos]
 ref|XP_008633091.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X1 
[Corvus brachyrhynchos]
 ref|XP_010399230.1| PREDICTED: protein arginine N-methyltransferase 8 [Corvus cornix 
cornix]
 ref|XP_010399231.1| PREDICTED: protein arginine N-methyltransferase 8 [Corvus cornix 
cornix]
Length=394

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  68   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  127

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV QVDIIISEWM
Sbjct  128  FAAKAGAKKVYGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDQVDIIISEWM  187

Query  806  GYFLLYE  826
            GY L YE
Sbjct  188  GYCLFYE  194



>ref|XP_002194561.1| PREDICTED: protein arginine N-methyltransferase 8 [Taeniopygia 
guttata]
Length=394

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  68   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  127

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV QVDIIISEWM
Sbjct  128  FAAKAGAKKVYGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDQVDIIISEWM  187

Query  806  GYFLLYE  826
            GY L YE
Sbjct  188  GYCLFYE  194



>ref|XP_003273857.2| PREDICTED: protein arginine N-methyltransferase 8 [Nomascus leucogenys]
Length=326

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDKVVLDVG+GTGILS+
Sbjct  68   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSM  127

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK V+ +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  128  FAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWM  187

Query  806  GYFLLYE  826
            GY L YE
Sbjct  188  GYCLFYE  194



>ref|XP_005531089.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X1 
[Pseudopodoces humilis]
Length=394

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  68   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  127

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV QVDIIISEWM
Sbjct  128  FAAKAGAKKVYGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDQVDIIISEWM  187

Query  806  GYFLLYE  826
            GY L YE
Sbjct  188  GYCLFYE  194



>gb|KFV00595.1| Protein arginine N-methyltransferase 8, partial [Pterocles gutturalis]
Length=301

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDK+VLDVG+GTGILS+
Sbjct  43   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKIVLDVGSGTGILSM  102

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK VY VECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  103  FAAKAGAKKVYGVECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVDKVDIIISEWM  162

Query  806  GYFLLYE  826
            GY L YE
Sbjct  163  GYCLFYE  169



>ref|XP_006069078.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X3 
[Bubalus bubalis]
 ref|XP_006069079.1| PREDICTED: protein arginine N-methyltransferase 8 isoform X4 
[Bubalus bubalis]
Length=330

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  446  DDKTSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSL  625
            ++ TS DYYFDSY+HFGIHEEMLKD VRT TY+N +Y N  +FKDKVVLDVG+GTGILS+
Sbjct  68   EEMTSRDYYFDSYAHFGIHEEMLKDEVRTLTYRNSMYHNKHVFKDKVVLDVGSGTGILSM  127

Query  626  FCAKVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWM  805
            F AK GAK V+ +ECS+++  +++I+K+N   ++IT+ KGK+EE+ELPV +VDIIISEWM
Sbjct  128  FAAKAGAKKVFGIECSSISDYSEKIIKANHLDNIITIFKGKVEEVELPVEKVDIIISEWM  187

Query  806  GYFLLYE  826
            GY L YE
Sbjct  188  GYCLFYE  194



>dbj|GAN06098.1| protein arginine N-methyltransferase [Mucor ambiguus]
Length=338

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +2

Query  455  TSADYYFDSYSHFGIHEEMLKDVVRTKTYQNVIYKNAFLFKDKVVLDVGAGTGILSLFCA  634
            TS DYYFDSY+HFGIHEEMLKD VRT +Y+N IY N  LFKDKVVLDVG GTGILS+F A
Sbjct  15   TSKDYYFDSYAHFGIHEEMLKDEVRTLSYRNSIYNNKHLFKDKVVLDVGCGTGILSMFAA  74

Query  635  KVGAKHVYAVECSTMAGMAQEIVKSNGFSDVITVIKGKIEEIELPVAQVDIIISEWMGYF  814
            K GAKHVY ++ S +   A+ IVK NG +D +T+I+GK+EE+ LPV +VDIIISEWMGYF
Sbjct  75   KAGAKHVYGIDMSNIIHQARIIVKDNGLADKVTLIQGKMEEVVLPVDKVDIIISEWMGYF  134

Query  815  LLYE  826
            LLYE
Sbjct  135  LLYE  138



>ref|XP_003406851.1| PREDICTED: protein arginine N-methyltransferase 1 isoform X1 
[Loxodonta africana]
 ref|XP_004381695.1| PREDICTED: protein arginine N-methyltransferase 1 isoform 1 [Trichechus 
manatus latirostris]
Length=371

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 112/155 (72%), Gaps = 0/155 (0%)
 Frame = +2

Query  362  TLTESSNLEVEEDTAMCDPSADEDSMVGDDKTSADYYFDSYSHFGIHEEMLKDVVRTKTY  541
            TL    +L+   +   C  +   +    +D TS DYYFDSY+HFGIHEEMLKD VRT TY
Sbjct  17   TLANGMSLQPPLEEVSCGQAESSEKPNAEDMTSKDYYFDSYAHFGIHEEMLKDEVRTLTY  76

Query  542  QNVIYKNAFLFKDKVVLDVGAGTGILSLFCAKVGAKHVYAVECSTMAGMAQEIVKSNGFS  721
            +N ++ N  LFKDKVVLDVG+GTGIL +F AK GA+ V  +ECS+++  A +IVK+N   
Sbjct  77   RNSMFHNRHLFKDKVVLDVGSGTGILCMFAAKAGARRVIGIECSSISDYAVKIVKANKLD  136

Query  722  DVITVIKGKIEEIELPVAQVDIIISEWMGYFLLYE  826
             V+T+IKGK+EE+ELPV +VDIIISEWMGY L YE
Sbjct  137  HVVTIIKGKVEEVELPVEKVDIIISEWMGYCLFYE  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1779792308916