BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9168

Length=785
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009802962.1|  PREDICTED: R3H domain-containing protein 2-l...    243   3e-73   Nicotiana sylvestris
ref|XP_009802963.1|  PREDICTED: R3H domain-containing protein 2-l...    242   5e-73   Nicotiana sylvestris
ref|XP_009596189.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...    241   1e-72   Nicotiana tomentosiformis
ref|XP_009596190.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...    241   2e-72   Nicotiana tomentosiformis
ref|XP_010312532.1|  PREDICTED: R3H domain-containing protein 2-like    239   7e-72   Solanum lycopersicum
ref|XP_006361456.1|  PREDICTED: R3H domain-containing protein 2-l...    238   1e-71   Solanum tuberosum [potatoes]
ref|XP_006361457.1|  PREDICTED: R3H domain-containing protein 2-l...    238   1e-71   Solanum tuberosum [potatoes]
emb|CDO99895.1|  unnamed protein product                                230   2e-68   Coffea canephora [robusta coffee]
ref|XP_006436623.1|  hypothetical protein CICLE_v10031477mg             224   1e-67   
gb|KDO42031.1|  hypothetical protein CISIN_1g012370mg                   226   6e-67   Citrus sinensis [apfelsine]
ref|XP_006436624.1|  hypothetical protein CICLE_v10031477mg             224   5e-66   Citrus clementina [clementine]
ref|XP_007211615.1|  hypothetical protein PRUPE_ppa005527mg             223   8e-66   Prunus persica
ref|XP_008232013.1|  PREDICTED: R3H domain-containing protein 2-like    223   1e-65   Prunus mume [ume]
ref|XP_009356121.1|  PREDICTED: uncharacterized protein LOC103947014    222   2e-65   
gb|EYU19781.1|  hypothetical protein MIMGU_mgv1a005930mg                221   7e-65   Erythranthe guttata [common monkey flower]
ref|XP_007010334.1|  Single-stranded nucleic acid binding R3H pro...    220   1e-64   
ref|XP_008363212.1|  PREDICTED: uncharacterized protein LOC103426912    219   3e-64   
ref|XP_007010335.1|  Single-stranded nucleic acid binding R3H pro...    219   4e-64   
gb|KHG02377.1|  R3hdm2                                                  217   1e-63   Gossypium arboreum [tree cotton]
gb|KJB73373.1|  hypothetical protein B456_011G230000                    217   2e-63   Gossypium raimondii
gb|KHG02375.1|  R3hdm2                                                  217   2e-63   Gossypium arboreum [tree cotton]
gb|KHG02376.1|  R3hdm2                                                  217   3e-63   Gossypium arboreum [tree cotton]
ref|XP_004307056.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...    216   6e-63   Fragaria vesca subsp. vesca
ref|XP_012074667.1|  PREDICTED: R3H domain-containing protein 2-l...    215   8e-63   
ref|XP_011076921.1|  PREDICTED: R3H domain-containing protein 1-like    214   1e-62   Sesamum indicum [beniseed]
ref|XP_012074666.1|  PREDICTED: R3H domain-containing protein 2-l...    215   1e-62   
ref|XP_011655833.1|  PREDICTED: R3H domain-containing protein 2-like    215   2e-62   Cucumis sativus [cucumbers]
ref|XP_006378811.1|  hypothetical protein POPTR_0010s24400g             210   3e-62   
ref|XP_010088775.1|  R3H domain-containing protein 2                    214   3e-62   Morus notabilis
gb|KHN00907.1|  R3H domain-containing protein 2                         214   3e-62   Glycine soja [wild soybean]
ref|XP_007143806.1|  hypothetical protein PHAVU_007G103200g             213   7e-62   Phaseolus vulgaris [French bean]
ref|XP_007143805.1|  hypothetical protein PHAVU_007G103200g             213   7e-62   Phaseolus vulgaris [French bean]
ref|XP_003556269.1|  PREDICTED: R3H domain-containing protein 2-l...    211   2e-61   Glycine max [soybeans]
ref|XP_008446764.1|  PREDICTED: R3H domain-containing protein 2-like    211   3e-61   Cucumis melo [Oriental melon]
ref|XP_010555980.1|  PREDICTED: R3H domain-containing protein 2-like    211   5e-61   Tarenaya hassleriana [spider flower]
ref|XP_003536315.1|  PREDICTED: R3H domain-containing protein 1-l...    210   1e-60   Glycine max [soybeans]
ref|XP_011024222.1|  PREDICTED: uncharacterized protein LOC105125463    209   2e-60   Populus euphratica
ref|XP_006378812.1|  hypothetical protein POPTR_0010s24400g             209   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_002311953.2|  hypothetical protein POPTR_0008s02260g             209   2e-60   
gb|KHN37830.1|  R3H domain-containing protein 2                         209   3e-60   Glycine soja [wild soybean]
ref|XP_010271700.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...    209   4e-60   Nelumbo nucifera [Indian lotus]
ref|XP_006378814.1|  hypothetical protein POPTR_0010s24400g             208   5e-60   
ref|XP_002524991.1|  r3h domain containing protein, putative            206   2e-59   Ricinus communis
ref|XP_004496195.1|  PREDICTED: R3H domain-containing protein 2-like    206   9e-59   Cicer arietinum [garbanzo]
ref|XP_010244514.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...    205   9e-59   Nelumbo nucifera [Indian lotus]
gb|EPS69925.1|  hypothetical protein M569_04838                         201   1e-58   Genlisea aurea
ref|XP_011626020.1|  PREDICTED: cAMP-regulated phosphoprotein 21        202   6e-58   Amborella trichopoda
ref|XP_011032851.1|  PREDICTED: uncharacterized protein LOC105131...    202   6e-58   Populus euphratica
ref|XP_011032850.1|  PREDICTED: uncharacterized protein LOC105131...    202   7e-58   Populus euphratica
ref|XP_003591774.1|  R3H domain-containing protein                      203   7e-58   Medicago truncatula
ref|XP_008375572.1|  PREDICTED: uncharacterized protein LOC103438798    199   1e-56   
gb|ERN13065.1|  hypothetical protein AMTR_s00040p00140300               201   1e-56   Amborella trichopoda
ref|XP_009336010.1|  PREDICTED: uncharacterized protein LOC103928658    198   3e-56   Pyrus x bretschneideri [bai li]
ref|XP_002265099.2|  PREDICTED: cAMP-regulated phosphoprotein 21        198   3e-56   Vitis vinifera
ref|XP_010067141.1|  PREDICTED: R3H domain-containing protein 1-like    196   3e-55   Eucalyptus grandis [rose gum]
ref|XP_010694526.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...    194   1e-54   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI35251.3|  unnamed protein product                                191   3e-54   Vitis vinifera
ref|XP_010912260.1|  PREDICTED: R3H domain-containing protein 1-like    191   3e-53   Elaeis guineensis
ref|XP_008804807.1|  PREDICTED: R3H domain-containing protein 2-like    190   5e-53   Phoenix dactylifera
ref|XP_010522754.1|  PREDICTED: uncharacterized protein LOC104801230    189   5e-53   Tarenaya hassleriana [spider flower]
ref|XP_009405301.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...    188   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004496196.1|  PREDICTED: R3H domain-containing protein 2-l...    187   5e-52   Cicer arietinum [garbanzo]
ref|XP_004496197.1|  PREDICTED: R3H domain-containing protein 2-l...    186   5e-52   Cicer arietinum [garbanzo]
ref|XP_008783999.1|  PREDICTED: uncharacterized protein LOC103703078    185   4e-51   Phoenix dactylifera
ref|XP_009384246.1|  PREDICTED: R3H domain-containing protein 1-like    184   6e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907139.1|  PREDICTED: R3H domain-containing protein 1-l...    179   4e-49   Elaeis guineensis
ref|XP_010907140.1|  PREDICTED: R3H domain-containing protein 1-l...    179   4e-49   Elaeis guineensis
ref|XP_010908184.1|  PREDICTED: R3H domain-containing protein 1-like    175   1e-47   Elaeis guineensis
ref|XP_003576865.1|  PREDICTED: R3H domain-containing protein 2-like    175   2e-47   Brachypodium distachyon [annual false brome]
ref|XP_008788209.1|  PREDICTED: R3H domain-containing protein 2-like    168   8e-45   
ref|XP_003591775.1|  R3H domain-containing protein                      166   2e-44   Medicago truncatula
ref|XP_008670037.1|  PREDICTED: uncharacterized protein LOC103647263    167   2e-44   Zea mays [maize]
ref|XP_006661565.1|  PREDICTED: R3H domain-containing protein 1-like    166   2e-44   
ref|XP_004956208.1|  PREDICTED: R3H domain-containing protein 2-like    165   9e-44   
dbj|BAD46211.1|  unknown protein                                        164   2e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008671174.1|  PREDICTED: LOW QUALITY PROTEIN: R3H domain-c...    158   7e-43   
dbj|BAJ97314.1|  predicted protein                                      160   5e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008652492.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...    156   1e-40   Zea mays [maize]
ref|XP_008652488.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...    156   1e-40   
ref|XP_008652491.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...    156   1e-40   
ref|XP_008652487.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...    156   2e-40   Zea mays [maize]
gb|KJB73375.1|  hypothetical protein B456_011G230000                    154   4e-40   Gossypium raimondii
gb|EMT03819.1|  60S ribosomal protein L10a-2                            154   1e-38   
gb|KGN52193.1|  hypothetical protein Csa_5G615180                       147   1e-37   Cucumis sativus [cucumbers]
emb|CAN60634.1|  hypothetical protein VITISV_041705                     146   3e-37   Vitis vinifera
gb|KJB73376.1|  hypothetical protein B456_011G230000                    142   5e-36   Gossypium raimondii
ref|XP_001770349.1|  predicted protein                                  138   5e-34   
ref|XP_001767100.1|  predicted protein                                  135   2e-32   
ref|XP_010543660.1|  PREDICTED: R3H domain-containing protein 2-like    131   4e-32   Tarenaya hassleriana [spider flower]
ref|XP_006398970.1|  hypothetical protein EUTSA_v10014404mg             129   8e-32   Eutrema salsugineum [saltwater cress]
ref|XP_010525439.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    131   8e-32   
ref|XP_010504574.1|  PREDICTED: R3H domain-containing protein 1-like    130   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_011652165.1|  PREDICTED: uncharacterized protein LOC101215...    129   2e-31   Cucumis sativus [cucumbers]
ref|XP_004136625.2|  PREDICTED: uncharacterized protein LOC101215...    129   2e-31   Cucumis sativus [cucumbers]
ref|XP_006292703.1|  hypothetical protein CARUB_v10018949mg             129   3e-31   Capsella rubella
ref|XP_010427506.1|  PREDICTED: R3H domain-containing protein 1-like    129   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009339978.1|  PREDICTED: R3H domain-containing protein 2-like    129   4e-31   Pyrus x bretschneideri [bai li]
ref|XP_008443221.1|  PREDICTED: R3H domain-containing protein 2-l...    128   5e-31   Cucumis melo [Oriental melon]
ref|XP_008443220.1|  PREDICTED: R3H domain-containing protein 2-l...    128   7e-31   
ref|XP_010111099.1|  R3H domain-containing protein 1                    128   1e-30   
ref|XP_010247210.1|  PREDICTED: R3H domain-containing protein 2         127   1e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010055671.1|  PREDICTED: R3H domain-containing protein 1         127   2e-30   Eucalyptus grandis [rose gum]
ref|XP_002283240.1|  PREDICTED: R3H domain-containing protein 2         127   2e-30   Vitis vinifera
ref|XP_010243833.1|  PREDICTED: R3H domain-containing protein 1-l...    126   3e-30   Nelumbo nucifera [Indian lotus]
ref|XP_002873193.1|  nucleic acid binding protein                       126   3e-30   
ref|XP_010243832.1|  PREDICTED: R3H domain-containing protein 1-l...    126   3e-30   Nelumbo nucifera [Indian lotus]
ref|XP_006288222.1|  hypothetical protein CARUB_v10001459mg             125   3e-30   Capsella rubella
ref|XP_006294497.1|  hypothetical protein CARUB_v10023526mg             126   4e-30   Capsella rubella
gb|EAZ10135.1|  hypothetical protein OsI_32444                          127   5e-30   Oryza sativa Indica Group [Indian rice]
ref|NP_568149.1|  Single-stranded nucleic acid binding R3H protein      125   6e-30   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11532.1|  unnamed protein product                                125   6e-30   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34908.1|  hypothetical protein AALP_AA5G209300                    125   6e-30   Arabis alpina [alpine rockcress]
ref|XP_010673076.1|  PREDICTED: uncharacterized protein LOC104889530    125   7e-30   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA55731.1|  TPA: putative casein kinase family protein             125   8e-30   
gb|ABK24455.1|  unknown                                                 125   1e-29   Picea sitchensis
ref|XP_010505858.1|  PREDICTED: uncharacterized protein LOC104782584    125   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010552904.1|  PREDICTED: uncharacterized protein LOC104823164    124   1e-29   Tarenaya hassleriana [spider flower]
emb|CDY52134.1|  BnaA03g55130D                                          124   1e-29   Brassica napus [oilseed rape]
gb|ERM99095.1|  hypothetical protein AMTR_s00101p00122520               124   1e-29   Amborella trichopoda
ref|XP_006407506.1|  hypothetical protein EUTSA_v10021089mg             122   1e-29   
ref|XP_007204692.1|  hypothetical protein PRUPE_ppa007799mg             124   2e-29   Prunus persica
ref|XP_006836242.2|  PREDICTED: uncharacterized protein LOC18427123     124   2e-29   Amborella trichopoda
emb|CDX80941.1|  BnaC03g01950D                                          124   2e-29   
gb|KFK42320.1|  single-stranded nucleic acid binding r3h protein        124   2e-29   Arabis alpina [alpine rockcress]
ref|XP_002521584.1|  r3h domain containing protein, putative            124   2e-29   Ricinus communis
ref|XP_008359462.1|  PREDICTED: R3H domain-containing protein 1-like    124   2e-29   Malus domestica [apple tree]
ref|XP_008244779.1|  PREDICTED: uncharacterized protein LOC103342896    124   2e-29   Prunus mume [ume]
gb|KEH43446.1|  single-stranded nucleic acid-binding protein R3H        124   2e-29   Medicago truncatula
ref|XP_008350136.1|  PREDICTED: R3H domain-containing protein 1-like    124   3e-29   
gb|KDO53661.1|  hypothetical protein CISIN_1g018220mg                   122   3e-29   Citrus sinensis [apfelsine]
gb|AAM64355.1|  unknown                                                 123   3e-29   Arabidopsis thaliana [mouse-ear cress]
gb|KDO53662.1|  hypothetical protein CISIN_1g018220mg                   122   3e-29   Citrus sinensis [apfelsine]
ref|XP_006298102.1|  hypothetical protein CARUB_v10014143mg             123   4e-29   Capsella rubella
ref|XP_009388814.1|  PREDICTED: uncharacterized protein LOC103975543    123   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009130861.1|  PREDICTED: uncharacterized protein LOC103855609    122   4e-29   Brassica rapa
emb|CDY00700.1|  BnaC03g36840D                                          122   4e-29   
gb|AFW71285.1|  hypothetical protein ZEAMMB73_459562                    117   4e-29   
ref|NP_001055538.2|  Os05g0411600                                       118   5e-29   
ref|XP_006407507.1|  hypothetical protein EUTSA_v10021089mg             122   5e-29   Eutrema salsugineum [saltwater cress]
gb|AFW76046.1|  hypothetical protein ZEAMMB73_671673                    117   5e-29   
gb|AFW78003.1|  hypothetical protein ZEAMMB73_274612                    121   6e-29   
ref|XP_006402961.1|  hypothetical protein EUTSA_v10006048mg             122   7e-29   Eutrema salsugineum [saltwater cress]
ref|NP_565947.1|  Single-stranded nucleic acid binding R3H protein      122   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008808576.1|  PREDICTED: uncharacterized protein LOC103720587    122   1e-28   Phoenix dactylifera
ref|XP_004962092.1|  PREDICTED: uncharacterized protein LOC101778...    122   1e-28   Setaria italica
ref|XP_002876378.1|  hypothetical protein ARALYDRAFT_486108             122   1e-28   
ref|XP_007028264.1|  Single-stranded nucleic acid binding R3H pro...    119   1e-28   
ref|XP_009135130.1|  PREDICTED: uncharacterized protein LOC103859362    121   1e-28   Brassica rapa
gb|KDO53660.1|  hypothetical protein CISIN_1g018220mg                   122   1e-28   Citrus sinensis [apfelsine]
tpg|DAA46760.1|  TPA: hypothetical protein ZEAMMB73_590191              121   1e-28   
ref|XP_006430510.1|  hypothetical protein CICLE_v10012047mg             122   1e-28   Citrus clementina [clementine]
ref|XP_008648332.1|  PREDICTED: DIP1 isoform X2                         121   1e-28   Zea mays [maize]
ref|XP_002884813.1|  nucleic acid binding protein                       121   2e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_004962091.1|  PREDICTED: uncharacterized protein LOC101778...    122   2e-28   
ref|XP_010486693.1|  PREDICTED: R3H domain-containing protein 1-l...    121   2e-28   Camelina sativa [gold-of-pleasure]
gb|ACF81487.1|  unknown                                                 121   2e-28   Zea mays [maize]
gb|EAY98040.1|  hypothetical protein OsI_19955                          121   2e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_010486692.1|  PREDICTED: R3H domain-containing protein 1-l...    121   2e-28   Camelina sativa [gold-of-pleasure]
gb|ACF85224.1|  unknown                                                 121   2e-28   Zea mays [maize]
ref|XP_003568455.1|  PREDICTED: uncharacterized protein LOC100835943    121   2e-28   Brachypodium distachyon [annual false brome]
ref|XP_006482042.1|  PREDICTED: R3H domain-containing protein 2-like    121   2e-28   Citrus sinensis [apfelsine]
ref|NP_001148805.1|  nucleic acid binding protein                       121   2e-28   
ref|XP_010508784.1|  PREDICTED: uncharacterized protein LOC104785299    121   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010464755.1|  PREDICTED: uncharacterized protein LOC104745...    120   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_012088643.1|  PREDICTED: R3H domain-containing protein 2-l...    121   2e-28   Jatropha curcas
gb|KDO53658.1|  hypothetical protein CISIN_1g018220mg                   121   2e-28   Citrus sinensis [apfelsine]
ref|XP_010464754.1|  PREDICTED: uncharacterized protein LOC104745...    120   2e-28   Camelina sativa [gold-of-pleasure]
ref|NP_850556.1|  Single-stranded nucleic acid binding R3H protein      120   3e-28   Arabidopsis thaliana [mouse-ear cress]
emb|CDY08578.1|  BnaA05g28140D                                          120   3e-28   Brassica napus [oilseed rape]
gb|AAM64684.1|  unknown                                                 120   3e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010905886.1|  PREDICTED: uncharacterized protein LOC105032977    120   3e-28   Elaeis guineensis
gb|KFK38469.1|  hypothetical protein AALP_AA3G116900                    120   3e-28   Arabis alpina [alpine rockcress]
ref|NP_566381.1|  Single-stranded nucleic acid binding R3H protein      120   3e-28   Arabidopsis thaliana [mouse-ear cress]
gb|ACF88162.1|  unknown                                                 120   3e-28   Zea mays [maize]
emb|CDX73904.1|  BnaA03g31430D                                          120   4e-28   
emb|CDY00970.1|  BnaC05g42300D                                          120   4e-28   
ref|XP_002322608.1|  hypothetical protein POPTR_0016s03230g             120   4e-28   Populus trichocarpa [western balsam poplar]
gb|AFW71284.1|  hypothetical protein ZEAMMB73_459562                    117   5e-28   
gb|KFK26109.1|  hypothetical protein AALP_AA8G203900                    120   5e-28   Arabis alpina [alpine rockcress]
ref|XP_002879898.1|  hypothetical protein ARALYDRAFT_483163             120   5e-28   
gb|KHN12174.1|  R3H domain-containing protein 2                         120   7e-28   Glycine soja [wild soybean]
ref|XP_008786865.1|  PREDICTED: uncharacterized protein LOC103705051    119   8e-28   Phoenix dactylifera
ref|NP_191227.1|  Single-stranded nucleic acid binding R3H protein      119   8e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007028262.1|  Single-stranded nucleic acid binding R3H pro...    119   8e-28   Theobroma cacao [chocolate]
ref|XP_010517577.1|  PREDICTED: uncharacterized protein LOC104793004    119   9e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006576254.1|  PREDICTED: uncharacterized protein LOC100814...    119   9e-28   
dbj|BAJ94462.1|  predicted protein                                      119   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAO72578.1|  unknown                                                 119   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001242845.1|  uncharacterized protein LOC100814835               119   1e-27   
dbj|BAK04407.1|  predicted protein                                      119   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006654401.1|  PREDICTED: uncharacterized protein LOC102704...    119   1e-27   Oryza brachyantha
ref|XP_009146807.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...    119   1e-27   Brassica rapa
ref|XP_009146806.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...    119   2e-27   Brassica rapa
ref|XP_010909706.1|  PREDICTED: uncharacterized protein LOC105035733    119   2e-27   Elaeis guineensis
emb|CAO02553.1|  putative single-stranded nucleic acid binding R3H      113   2e-27   Vigna unguiculata
ref|XP_010492949.1|  PREDICTED: uncharacterized protein LOC104770...    118   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010492872.1|  PREDICTED: uncharacterized protein LOC104770...    118   2e-27   Camelina sativa [gold-of-pleasure]
gb|EMT08505.1|  R3H domain-containing protein 2                         118   3e-27   
tpg|DAA46761.1|  TPA: hypothetical protein ZEAMMB73_590191              116   3e-27   
gb|AFW76047.1|  hypothetical protein ZEAMMB73_671673                    117   3e-27   
ref|XP_010558120.1|  PREDICTED: uncharacterized protein LOC104826881    117   3e-27   Tarenaya hassleriana [spider flower]
emb|CDP06226.1|  unnamed protein product                                119   3e-27   Coffea canephora [robusta coffee]
emb|CDY36274.1|  BnaA01g31440D                                          117   4e-27   Brassica napus [oilseed rape]
ref|XP_009386294.1|  PREDICTED: uncharacterized protein LOC103973455    117   5e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009770790.1|  PREDICTED: R3H domain-containing protein 1-like    117   7e-27   Nicotiana sylvestris
ref|XP_011079086.1|  PREDICTED: uncharacterized protein LOC105162694    117   7e-27   Sesamum indicum [beniseed]
ref|XP_009410414.1|  PREDICTED: R3H domain-containing protein 2-like    116   9e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009122628.1|  PREDICTED: uncharacterized protein LOC103847318    116   1e-26   Brassica rapa
ref|XP_004144321.1|  PREDICTED: cAMP-regulated phosphoprotein 21        116   1e-26   Cucumis sativus [cucumbers]
gb|KHG23664.1|  R3H domain-containing 1                                 116   1e-26   Gossypium arboreum [tree cotton]
ref|XP_009611070.1|  PREDICTED: R3H domain-containing protein 2         116   1e-26   Nicotiana tomentosiformis
ref|NP_001105871.1|  DIP1                                               116   1e-26   
ref|XP_004249122.1|  PREDICTED: R3H domain-containing protein 2         115   1e-26   Solanum lycopersicum
ref|XP_007162049.1|  hypothetical protein PHAVU_001G119400g             116   2e-26   Phaseolus vulgaris [French bean]
emb|CAO02563.1|  putative single-stranded nucleic acid binding R3H      110   2e-26   Vigna unguiculata
gb|KJB46182.1|  hypothetical protein B456_007G351600                    115   3e-26   Gossypium raimondii
ref|XP_004493365.1|  PREDICTED: uncharacterized protein LOC101493813    115   4e-26   Cicer arietinum [garbanzo]
ref|NP_001241328.1|  uncharacterized protein LOC100784326               115   4e-26   Glycine max [soybeans]
ref|XP_007145505.1|  hypothetical protein PHAVU_007G244200g             114   4e-26   Phaseolus vulgaris [French bean]
ref|XP_006366388.1|  PREDICTED: R3H domain-containing protein 2-like    110   5e-26   Solanum tuberosum [potatoes]
ref|XP_003624916.1|  R3H domain-containing protein                      112   5e-26   
ref|XP_010931539.1|  PREDICTED: R3H domain-containing protein 1-like    114   5e-26   
ref|XP_002517274.1|  r3h domain containing protein, putative            114   6e-26   Ricinus communis
ref|XP_011040734.1|  PREDICTED: uncharacterized protein LOC105136920    114   7e-26   Populus euphratica
ref|XP_011070087.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...    114   1e-25   Sesamum indicum [beniseed]
ref|XP_008455743.1|  PREDICTED: R3H domain-containing protein 1-l...    113   1e-25   Cucumis melo [Oriental melon]
ref|XP_006364781.1|  PREDICTED: R3H domain-containing protein 2-like    113   1e-25   Solanum tuberosum [potatoes]
gb|EYU20818.1|  hypothetical protein MIMGU_mgv1a008714mg                113   1e-25   Erythranthe guttata [common monkey flower]
ref|XP_010491040.1|  PREDICTED: uncharacterized protein LOC104768705    112   2e-25   Camelina sativa [gold-of-pleasure]
ref|XP_003624915.1|  R3H domain-containing protein                      113   2e-25   Medicago truncatula
gb|KHN08910.1|  R3H domain-containing protein 2                         113   2e-25   Glycine soja [wild soybean]
ref|XP_003554106.1|  PREDICTED: R3H domain-containing protein 2-like    113   2e-25   Glycine max [soybeans]
gb|EYU18596.1|  hypothetical protein MIMGU_mgv1a009115mg                113   2e-25   Erythranthe guttata [common monkey flower]
ref|XP_003535913.1|  PREDICTED: uncharacterized protein LOC100799336    113   2e-25   Glycine max [soybeans]
ref|XP_010452414.1|  PREDICTED: uncharacterized protein LOC104734514    111   6e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010423500.1|  PREDICTED: uncharacterized protein LOC104708604    110   8e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010543916.1|  PREDICTED: cysteine proteinase inhibitor 7         110   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_006398969.1|  hypothetical protein EUTSA_v10014404mg             105   2e-23   
emb|CDY61685.1|  BnaCnng38270D                                          102   1e-21   Brassica napus [oilseed rape]
ref|XP_009139085.1|  PREDICTED: protein encore                          101   2e-21   Brassica rapa
emb|CDX76005.1|  BnaA04g02690D                                          100   3e-21   
ref|XP_008648331.1|  PREDICTED: DIP1 isoform X1                       97.8    3e-20   Zea mays [maize]
ref|XP_002994204.1|  hypothetical protein SELMODRAFT_449328           98.2    3e-20   
ref|XP_008648333.1|  PREDICTED: DIP1 isoform X3                       97.4    4e-20   
gb|ABS18738.1|  superoxide dismutase-like protein                     96.7    6e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654402.1|  PREDICTED: uncharacterized protein LOC102704...  96.3    8e-20   Oryza brachyantha
ref|XP_008648334.1|  PREDICTED: DIP1 isoform X4                       92.4    2e-18   
ref|XP_012088644.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...  91.7    4e-18   Jatropha curcas
gb|EMS53007.1|  hypothetical protein TRIUR3_31024                     90.9    7e-18   Triticum urartu
ref|XP_002868409.1|  predicted protein                                85.5    9e-18   
ref|XP_002864508.1|  predicted protein                                85.5    1e-17   
ref|XP_002307959.2|  hypothetical protein POPTR_0006s03320g           90.5    1e-17   
ref|XP_002893481.1|  predicted protein                                84.0    4e-17   
ref|XP_006574397.1|  PREDICTED: uncharacterized protein LOC100784...  88.2    5e-17   Glycine max [soybeans]
ref|XP_008788551.1|  PREDICTED: R3H domain-containing protein 1-like  87.8    7e-17   
ref|XP_007028263.1|  Single-stranded nucleic acid binding R3H pro...  87.0    1e-16   Theobroma cacao [chocolate]
ref|XP_008455744.1|  PREDICTED: R3H domain-containing protein 1-l...  85.1    6e-16   Cucumis melo [Oriental melon]
ref|XP_002948605.1|  hypothetical protein VOLCADRAFT_116880           80.9    1e-13   Volvox carteri f. nagariensis
gb|ACE97706.1|  single-stranded nucleic acid binding R3H protein      76.3    1e-13   Populus tremula [European aspen]
gb|ACE97705.1|  single-stranded nucleic acid binding R3H protein      76.3    1e-13   Populus tremula [European aspen]
gb|ACE97685.1|  single-stranded nucleic acid binding R3H protein      76.3    1e-13   Populus tremula [European aspen]
gb|ACE97698.1|  single-stranded nucleic acid binding R3H protein      76.3    1e-13   Populus tremula [European aspen]
gb|ACE97703.1|  single-stranded nucleic acid binding R3H protein      76.3    1e-13   Populus tremula [European aspen]
gb|ACE97692.1|  single-stranded nucleic acid binding R3H protein      76.3    1e-13   Populus tremula [European aspen]
gb|ACE97681.1|  single-stranded nucleic acid binding R3H protein      76.3    2e-13   Populus tremula [European aspen]
gb|ACE97679.1|  single-stranded nucleic acid binding R3H protein      76.3    2e-13   Populus tremula [European aspen]
gb|ACE97701.1|  single-stranded nucleic acid binding R3H protein      75.9    2e-13   Populus tremula [European aspen]
gb|ACE97702.1|  single-stranded nucleic acid binding R3H protein      75.9    2e-13   Populus tremula [European aspen]
gb|ACE97696.1|  single-stranded nucleic acid binding R3H protein      75.1    4e-13   Populus tremula [European aspen]
gb|KER00435.1|  hypothetical protein AUEXF2481DRAFT_75517             73.6    2e-11   Aureobasidium subglaciale EXF-2481
gb|ESA14782.1|  hypothetical protein GLOINDRAFT_43769                 70.5    3e-11   
gb|KEQ87979.1|  hypothetical protein M438DRAFT_313035                 73.2    3e-11   Aureobasidium pullulans EXF-150
gb|KEQ70300.1|  hypothetical protein M436DRAFT_54037                  72.4    6e-11   Aureobasidium namibiae CBS 147.97
ref|XP_002862444.1|  predicted protein                                65.9    1e-10   
gb|EME44429.1|  hypothetical protein DOTSEDRAFT_152286                70.9    2e-10   Dothistroma septosporum NZE10
ref|XP_005844972.1|  hypothetical protein CHLNCDRAFT_58741            70.1    3e-10   Chlorella variabilis
gb|KEQ62868.1|  hypothetical protein M437DRAFT_48254                  69.3    6e-10   Aureobasidium melanogenum CBS 110374
pdb|1WHR|A  Chain A, Solution Structure Of The R3h Domain From Hu...  61.6    1e-08   Homo sapiens [man]
ref|XP_007253495.1|  PREDICTED: R3H domain-containing protein 2       63.9    3e-08   
ref|XP_009301050.1|  PREDICTED: R3H domain-containing protein 2       63.9    3e-08   
ref|XP_006629322.1|  PREDICTED: R3H domain-containing protein 2-like  63.2    6e-08   
ref|XP_007548668.1|  PREDICTED: R3H domain-containing protein 2-l...  62.8    6e-08   
ref|XP_007548644.1|  PREDICTED: R3H domain-containing protein 2-l...  62.8    6e-08   
emb|CAF96504.1|  unnamed protein product                              63.2    6e-08   
ref|XP_007548676.1|  PREDICTED: R3H domain-containing protein 2-l...  62.4    6e-08   
ref|XP_005797053.1|  PREDICTED: R3H domain-containing protein 2-like  63.2    7e-08   
ref|XP_011612452.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    7e-08   
ref|XP_011612453.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    8e-08   
ref|XP_007548614.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    8e-08   
ref|XP_011612451.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    8e-08   
ref|XP_011473199.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    8e-08   
ref|XP_007548597.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    8e-08   
ref|XP_007548587.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    8e-08   
ref|XP_007548632.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    8e-08   
ref|XP_007548622.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    8e-08   
ref|XP_005456437.1|  PREDICTED: R3H domain-containing protein 2       62.8    9e-08   
ref|XP_008406678.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_011612454.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_011612448.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
emb|CDQ69805.1|  unnamed protein product                              62.0    9e-08   
ref|XP_011612450.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_008406677.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_011612449.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_011612447.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_005740149.1|  PREDICTED: R3H domain-containing protein 2-like  62.8    9e-08   
emb|CDY56775.1|  BnaAnng14410D                                        58.5    9e-08   
ref|XP_011473197.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_007548606.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_010730420.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_008278945.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_011473198.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_006783497.1|  PREDICTED: R3H domain-containing protein 2-like  62.8    9e-08   
ref|XP_008278944.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_011473196.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_004547739.1|  PREDICTED: R3H domain-containing protein 2-like  62.8    9e-08   
ref|XP_008406679.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_011473190.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_008278946.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    9e-08   
ref|XP_011473195.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    1e-07   
ref|XP_008318862.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    1e-07   
ref|XP_008278939.1|  PREDICTED: R3H domain-containing protein 2 i...  62.8    1e-07   
ref|XP_008318861.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_011473186.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_011473193.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_008318858.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_008278943.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_011473194.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_008318860.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_011473191.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_010902844.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_010902846.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_010902845.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_010902842.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_010768940.1|  PREDICTED: R3H domain-containing protein 2       62.4    1e-07   
ref|XP_010902839.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_010902847.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_010902843.1|  PREDICTED: R3H domain-containing protein 2 i...  62.4    1e-07   
ref|XP_005986415.1|  PREDICTED: R3H domain-containing protein 2       62.0    2e-07   
ref|XP_005663979.1|  PREDICTED: R3H domain-containing protein 2-l...  60.8    2e-07   
ref|XP_007547695.1|  PREDICTED: cAMP-regulated phosphoprotein 21 ...  61.6    2e-07   
ref|XP_007547694.1|  PREDICTED: cAMP-regulated phosphoprotein 21 ...  61.6    2e-07   
ref|XP_008420081.1|  PREDICTED: cAMP-regulated phosphoprotein 21 ...  61.6    2e-07   
ref|XP_003355540.3|  PREDICTED: R3H domain-containing protein 2-l...  60.8    2e-07   
ref|XP_007547696.1|  PREDICTED: cAMP-regulated phosphoprotein 21 ...  61.6    2e-07   
ref|XP_008420080.1|  PREDICTED: cAMP-regulated phosphoprotein 21 ...  61.6    2e-07   
ref|XP_008420079.1|  PREDICTED: cAMP-regulated phosphoprotein 21 ...  61.6    2e-07   
ref|XP_007547692.1|  PREDICTED: cAMP-regulated phosphoprotein 21 ...  61.6    2e-07   
ref|XP_005797380.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...  61.2    2e-07   
ref|XP_005797381.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...  61.2    2e-07   
ref|XP_006116762.1|  PREDICTED: R3H domain-containing protein 2-like  60.8    2e-07   
ref|XP_008577875.1|  PREDICTED: R3H domain-containing protein 2 i...  61.2    3e-07   
ref|XP_006740122.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    3e-07   
ref|XP_006635780.1|  PREDICTED: cAMP-regulated phosphoprotein 21-...  60.8    3e-07   
ref|XP_008577874.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    3e-07   
ref|NP_001126053.1|  R3H domain-containing protein 2                  60.8    3e-07   
ref|XP_006093650.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    3e-07   
ref|XP_008531786.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    3e-07   
ref|XP_009179302.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    3e-07   
ref|XP_008001966.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    3e-07   
ref|XP_006821567.1|  PREDICTED: R3H domain-containing protein 1-like  60.8    4e-07   
ref|XP_008682173.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_005571373.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_005397426.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006933906.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_004861298.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
dbj|BAG10408.1|  R3H domain-containing protein 2                      60.8    4e-07   
ref|XP_004800746.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008001962.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008146908.1|  PREDICTED: R3H domain-containing protein 2       60.8    4e-07   
ref|XP_009002328.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008531781.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_004773255.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_005879077.1|  PREDICTED: LOW QUALITY PROTEIN: R3H domain c...  60.8    4e-07   
ref|XP_006093653.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008682166.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008976770.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_009179299.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_011843937.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006093649.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_002916055.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_004861299.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006093646.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006933901.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_007535022.1|  PREDICTED: R3H domain-containing protein 2       60.8    4e-07   
ref|XP_004429356.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_005397417.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_003988985.2|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008577879.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_005571371.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_005397420.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_009002333.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008682154.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006757409.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_005397425.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_009179301.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006757406.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008976766.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_010335529.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006909003.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_004861296.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_010335526.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_010387278.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_010387282.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_005397419.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008052827.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
gb|ELK35090.1|  R3H domain-containing protein 2                       60.8    4e-07   
ref|XP_010642931.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_007081602.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_011726799.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006933903.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_011918728.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_011726804.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008113287.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_003790605.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008052830.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_001381602.3|  PREDICTED: R3H domain-containing protein 2-like  60.5    4e-07   
ref|XP_010642929.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006757410.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008001956.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_004466237.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_003790607.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_004053468.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_011918724.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008577873.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_009002325.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008531777.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006973349.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_001488702.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006093647.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_009179296.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_011219063.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008531782.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_011219066.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008531785.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_005571372.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008577877.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006757408.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_005397421.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008052829.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_005571365.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008113289.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008001965.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|NP_055740.3|  R3H domain-containing protein 2                     60.8    4e-07   
ref|XP_009423352.1|  PREDICTED: R3H domain-containing protein 2       60.8    4e-07   
ref|XP_004466236.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_005611393.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_009179300.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008976762.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_004650068.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_004401772.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006909001.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_004466234.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008113288.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006093643.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006973347.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_010335524.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_005611392.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_010387275.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_011536340.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_003252822.1|  PREDICTED: R3H domain-containing protein 2       60.5    4e-07   
ref|XP_007081604.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_008113286.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_004773251.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008113285.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_008531780.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_003824918.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_005611390.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_009002331.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_005397427.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_858655.1|  PREDICTED: R3H domain-containing protein 2 isof...  60.5    4e-07   
ref|XP_010944596.1|  PREDICTED: LOW QUALITY PROTEIN: R3H domain-c...  60.5    4e-07   
ref|XP_008113290.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_008001961.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_004861297.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_011726793.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_010335528.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_011918727.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_004773257.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_008682127.1|  PREDICTED: R3H domain-containing protein 2 i...  60.8    4e-07   
ref|XP_006933907.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_006218000.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_006182558.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_009179295.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_008531783.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_003790608.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_005397423.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_006093641.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_010387277.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_011918721.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_004861294.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_006933900.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_006909002.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_006740121.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_007081603.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_009179294.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_003476203.2|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_009002327.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_004773249.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_011918723.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   
ref|XP_010642926.1|  PREDICTED: R3H domain-containing protein 2 i...  60.5    4e-07   



>ref|XP_009802962.1| PREDICTED: R3H domain-containing protein 2-like isoform X1 [Nicotiana 
sylvestris]
Length=469

 Score =   243 bits (619),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV+  +DLGAPPE+WEVAD+DAS+RRL+LSSS   +      +S+ +   +S S++ 
Sbjct  1    MEGSVAITDDLGAPPESWEVADVDASMRRLILSSSKKDSESSVNNNSNQSELLDSSSSAL  60

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
            + A + GV ED+VN+VDQFLREALQNPRERLSVLRMEQDVEKFI+DP +QQMEFQQLPTS
Sbjct  61   ARAGSGGVSEDMVNTVDQFLREALQNPRERLSVLRMEQDVEKFIRDPGRQQMEFQQLPTS  120

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
            YLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTSECRMP IRLADIPV  PQ
Sbjct  121  YLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSECRMPLIRLADIPVNLPQ  177



>ref|XP_009802963.1| PREDICTED: R3H domain-containing protein 2-like isoform X2 [Nicotiana 
sylvestris]
Length=468

 Score =   242 bits (618),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/177 (72%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV+  +DLGAPPE+WEVAD+DAS+RRL+LSSS   +      +S+ +   +S S++ 
Sbjct  1    MEGSVAITDDLGAPPESWEVADVDASMRRLILSSSKKDSESSVNNNSNQSELLDSSSSAL  60

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
            + A + GV ED+VN+VDQFLREALQNPRERLSVLRMEQDVEKFI+DP +QQMEFQQLPTS
Sbjct  61   ARAGSGGVSEDMVNTVDQFLREALQNPRERLSVLRMEQDVEKFIRDPGRQQMEFQQLPTS  120

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
            YLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTSECRMP IRLADIPV  PQ
Sbjct  121  YLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSECRMPLIRLADIPVNLPQ  177



>ref|XP_009596189.1| PREDICTED: cAMP-regulated phosphoprotein 21-like isoform X1 [Nicotiana 
tomentosiformis]
Length=469

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV+  +DLGAPPE+WEVAD++AS+RRL+LSSS   +      +S+ +   +S S++ 
Sbjct  1    MEGSVAITDDLGAPPESWEVADVEASMRRLILSSSKKDSDSSVNNNSNQSELLDSSSSAL  60

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
            + A + GV ED+VN+VDQFLREALQNPRERLSVLRMEQDVEKFI+DP +QQMEFQQLPTS
Sbjct  61   ARAGSGGVSEDMVNTVDQFLREALQNPRERLSVLRMEQDVEKFIRDPGRQQMEFQQLPTS  120

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
            YLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTSECRMP IRLADIPV  PQ
Sbjct  121  YLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSECRMPLIRLADIPVNLPQ  177



>ref|XP_009596190.1| PREDICTED: cAMP-regulated phosphoprotein 21-like isoform X2 [Nicotiana 
tomentosiformis]
Length=468

 Score =   241 bits (614),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 150/177 (85%), Gaps = 0/177 (0%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV+  +DLGAPPE+WEVAD++AS+RRL+LSSS   +      +S+ +   +S S++ 
Sbjct  1    MEGSVAITDDLGAPPESWEVADVEASMRRLILSSSKKDSDSSVNNNSNQSELLDSSSSAL  60

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
            + A + GV ED+VN+VDQFLREALQNPRERLSVLRMEQDVEKFI+DP +QQMEFQQLPTS
Sbjct  61   ARAGSGGVSEDMVNTVDQFLREALQNPRERLSVLRMEQDVEKFIRDPGRQQMEFQQLPTS  120

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
            YLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTSECRMP IRLADIPV  PQ
Sbjct  121  YLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSECRMPLIRLADIPVNLPQ  177



>ref|XP_010312532.1| PREDICTED: R3H domain-containing protein 2-like [Solanum lycopersicum]
Length=471

 Score =   239 bits (610),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 150/188 (80%), Gaps = 19/188 (10%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSS-----------NDSNAQCDLadsss  398
            MEGSVS A+DLGAPPE+WEVADLDAS+RRL+LSSS           ND+ ++        
Sbjct  1    MEGSVSVADDLGAPPESWEVADLDASMRRLILSSSKKDADSSSSSVNDNQSEL-------  53

Query  399  asapnsesassssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQ  578
                ++ + + S+A +  V ED+VN+VDQFLREALQNPRERLSVLRMEQDVEKFI+DP +
Sbjct  54   -PDSSALAGAGSAAVSGSVSEDVVNTVDQFLREALQNPRERLSVLRMEQDVEKFIRDPGR  112

Query  579  QQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLA  758
            QQMEFQQLPTSYLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTSECRMP IRLA
Sbjct  113  QQMEFQQLPTSYLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSECRMPLIRLA  172

Query  759  DIPVTFPQ  782
            DIPV  PQ
Sbjct  173  DIPVNLPQ  180



>ref|XP_006361456.1| PREDICTED: R3H domain-containing protein 2-like isoform X1 [Solanum 
tuberosum]
Length=472

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasa---pnses  422
            MEGSVS A+DLGAPPE+WEVADLDAS+RRL+LSS  D +     + +++ S     ++ +
Sbjct  1    MEGSVSVADDLGAPPESWEVADLDASMRRLILSSKKDQSDSSSSSVNNNQSELPDSSALA  60

Query  423  assssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQL  602
             + S+A +  V ED+VN+VDQFLREALQNPRERLSVLRMEQDVEKFI+DP +QQMEFQQL
Sbjct  61   GAGSAAVSGSVSEDVVNTVDQFLREALQNPRERLSVLRMEQDVEKFIRDPGRQQMEFQQL  120

Query  603  PTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
            PTSYLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTSECRMP IRLADIPV  PQ
Sbjct  121  PTSYLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSECRMPLIRLADIPVNLPQ  180



>ref|XP_006361457.1| PREDICTED: R3H domain-containing protein 2-like isoform X2 [Solanum 
tuberosum]
Length=471

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 151/180 (84%), Gaps = 3/180 (2%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasa---pnses  422
            MEGSVS A+DLGAPPE+WEVADLDAS+RRL+LSS  D +     + +++ S     ++ +
Sbjct  1    MEGSVSVADDLGAPPESWEVADLDASMRRLILSSKKDQSDSSSSSVNNNQSELPDSSALA  60

Query  423  assssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQL  602
             + S+A +  V ED+VN+VDQFLREALQNPRERLSVLRMEQDVEKFI+DP +QQMEFQQL
Sbjct  61   GAGSAAVSGSVSEDVVNTVDQFLREALQNPRERLSVLRMEQDVEKFIRDPGRQQMEFQQL  120

Query  603  PTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
            PTSYLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTSECRMP IRLADIPV  PQ
Sbjct  121  PTSYLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSECRMPLIRLADIPVNLPQ  180



>emb|CDO99895.1| unnamed protein product [Coffea canephora]
Length=474

 Score =   230 bits (587),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 144/184 (78%), Gaps = 7/184 (4%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnse----  419
            M+GSV    DLG PPE+WEVADLDA++RRLMLSS+   +      + +  +         
Sbjct  1    MDGSV-VDSDLGVPPESWEVADLDATMRRLMLSSAKKESNSSVNNNGNGNNQSELGDALA  59

Query  420  --sassssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEF  593
              SA+SS+    GV ED++NSVDQFLREALQNPRERLSVLRMEQDVEKFI+DPT+QQMEF
Sbjct  60   PDSAASSANLGGGVSEDLINSVDQFLREALQNPRERLSVLRMEQDVEKFIRDPTRQQMEF  119

Query  594  QQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVT  773
             QLPTSYLRLAAHRVAQHYSLQS VL+D+++PDGS SRIIVRKTSECR+P IRLADIPV 
Sbjct  120  YQLPTSYLRLAAHRVAQHYSLQSMVLLDNNLPDGSGSRIIVRKTSECRIPLIRLADIPVN  179

Query  774  FPQD  785
             P +
Sbjct  180  LPSE  183



>ref|XP_006436623.1| hypothetical protein CICLE_v10031477mg [Citrus clementina]
 gb|ESR49863.1| hypothetical protein CICLE_v10031477mg [Citrus clementina]
Length=322

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 145/176 (82%), Gaps = 8/176 (5%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGS  AA+DLGAP E+WEVADLDA++ RL LSS ++ +   DL D++S++   S SA+ 
Sbjct  1    MEGS--AADDLGAP-ESWEVADLDATMSRLGLSSDSNPHQLDDLTDAASSAGAASASAAD  57

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
            +        ED++N VDQFLREA+QNPRERLS+LRMEQDVEKFI+DPTQQQ EFQQLPTS
Sbjct  58   NK-----FSEDVINQVDQFLREAIQNPRERLSILRMEQDVEKFIRDPTQQQFEFQQLPTS  112

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFP  779
            YLRLAAHRVAQHYSLQS VL+D+++PDGS SRIIVRKTSECR+P IRLADIPV  P
Sbjct  113  YLRLAAHRVAQHYSLQSMVLLDNNLPDGSGSRIIVRKTSECRLPPIRLADIPVNLP  168



>gb|KDO42031.1| hypothetical protein CISIN_1g012370mg [Citrus sinensis]
 gb|KDO42032.1| hypothetical protein CISIN_1g012370mg [Citrus sinensis]
Length=465

 Score =   226 bits (576),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 147/178 (83%), Gaps = 8/178 (4%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGS  AA+DLGAP E+WEVADLDA++ RL LSS ++ +   DL D++S++   S SA+ 
Sbjct  1    MEGS--AADDLGAP-ESWEVADLDATMSRLGLSSDSNPHQLDDLTDAASSAGAASASAAD  57

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
            +        ED++N VDQFLREA+QNPRERLS+LRMEQDVEKFI+DPTQQQ EFQQLPTS
Sbjct  58   NKFS-----EDVINQVDQFLREAIQNPRERLSILRMEQDVEKFIRDPTQQQFEFQQLPTS  112

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+++PDGS SRIIVRKTSECR+P IRLADIPV FP +
Sbjct  113  YLRLAAHRVAQHYSLQSMVLLDNNLPDGSGSRIIVRKTSECRLPPIRLADIPVNFPSE  170



>ref|XP_006436624.1| hypothetical protein CICLE_v10031477mg [Citrus clementina]
 ref|XP_006485215.1| PREDICTED: uncharacterized protein LOC102619616 [Citrus sinensis]
 gb|ESR49864.1| hypothetical protein CICLE_v10031477mg [Citrus clementina]
Length=460

 Score =   224 bits (570),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 146/178 (82%), Gaps = 8/178 (4%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGS  AA+DLGAP E+WEVADLDA++ RL LSS ++ +   DL D++S++   S SA+ 
Sbjct  1    MEGS--AADDLGAP-ESWEVADLDATMSRLGLSSDSNPHQLDDLTDAASSAGAASASAAD  57

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
            +        ED++N VDQFLREA+QNPRERLS+LRMEQDVEKFI+DPTQQQ EFQQLPTS
Sbjct  58   NKFS-----EDVINQVDQFLREAIQNPRERLSILRMEQDVEKFIRDPTQQQFEFQQLPTS  112

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+++PDGS SRIIVRKTSECR+P IRLADIPV  P +
Sbjct  113  YLRLAAHRVAQHYSLQSMVLLDNNLPDGSGSRIIVRKTSECRLPPIRLADIPVNLPSE  170



>ref|XP_007211615.1| hypothetical protein PRUPE_ppa005527mg [Prunus persica]
 gb|EMJ12814.1| hypothetical protein PRUPE_ppa005527mg [Prunus persica]
Length=456

 Score =   223 bits (568),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 142/178 (80%), Gaps = 11/178 (6%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV   EDLGAP E+WEVA LD ++ RLMLSS+ DS  Q DL D S   +  S+++  
Sbjct  1    MEGSV--VEDLGAP-ESWEVAGLDEAMNRLMLSSNKDSKPQ-DLNDVSPLVSSASDASDK  56

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
             S       ED +N VDQFLREALQNPRERLS+LRMEQDVEKFI+DP QQQ+EFQQLPTS
Sbjct  57   FS-------EDALNQVDQFLREALQNPRERLSILRMEQDVEKFIRDPIQQQLEFQQLPTS  109

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+++PDGS SRIIVRKTSECR+P IRLADIPV+ P +
Sbjct  110  YLRLAAHRVAQHYSLQSMVLLDNNLPDGSGSRIIVRKTSECRLPQIRLADIPVSLPSE  167



>ref|XP_008232013.1| PREDICTED: R3H domain-containing protein 2-like [Prunus mume]
 ref|XP_008232014.1| PREDICTED: R3H domain-containing protein 2-like [Prunus mume]
Length=456

 Score =   223 bits (567),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 142/178 (80%), Gaps = 11/178 (6%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV   EDLGAP E+WEVA LD ++ RLMLSS+ DS  Q DL D S   +  S+++  
Sbjct  1    MEGSV--VEDLGAP-ESWEVAGLDEAMNRLMLSSNKDSKPQ-DLNDVSPLVSSASDASDK  56

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
             S       ED +N VDQFLREALQNPRERLS+LRMEQDVEKFI+DP QQQ+EFQQLPTS
Sbjct  57   FS-------EDALNQVDQFLREALQNPRERLSILRMEQDVEKFIRDPIQQQLEFQQLPTS  109

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+++PDGS SRIIVRKTSECR+P IRLADIPV+ P +
Sbjct  110  YLRLAAHRVAQHYSLQSMVLLDNNLPDGSGSRIIVRKTSECRLPQIRLADIPVSLPSE  167



>ref|XP_009356121.1| PREDICTED: uncharacterized protein LOC103947014 [Pyrus x bretschneideri]
 ref|XP_009356122.1| PREDICTED: uncharacterized protein LOC103947014 [Pyrus x bretschneideri]
Length=457

 Score =   222 bits (565),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 139/178 (78%), Gaps = 10/178 (6%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV  AEDLGAP E+WEVA LD ++ RLMLSS+ DS     L D     + +S+++  
Sbjct  1    MEGSV--AEDLGAP-ESWEVAGLDEAMNRLMLSSNKDSKPPQTLNDLPPLVSSSSDASDK  57

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
             S       ED VN VDQFLREALQNPRERLS+LRMEQDVEKFI+DP QQQ+EFQQLPTS
Sbjct  58   FS-------EDAVNQVDQFLREALQNPRERLSILRMEQDVEKFIRDPIQQQLEFQQLPTS  110

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+++PDGS SRIIVRKT ECR+P IRLADIPV  P +
Sbjct  111  YLRLAAHRVAQHYSLQSMVLLDNNLPDGSGSRIIVRKTPECRLPLIRLADIPVNLPSE  168



>gb|EYU19781.1| hypothetical protein MIMGU_mgv1a005930mg [Erythranthe guttata]
 gb|EYU19782.1| hypothetical protein MIMGU_mgv1a005930mg [Erythranthe guttata]
Length=464

 Score =   221 bits (562),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 141/180 (78%), Gaps = 13/180 (7%)
 Frame = +3

Query  252  MEGS----VSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnse  419
            MEGS    ++AAED    PE+WEVAD+DAS+RRLMLS+  DSN   +             
Sbjct  1    MEGSSTASLAAAEDG---PESWEVADVDASMRRLMLSTRTDSNVSSN------KQGEIDL  51

Query  420  sassssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQ  599
             ++S     SG+P+D++++VDQFLREA+QNPRERLSVLRMEQDVEKFI+DPT++QMEFQQ
Sbjct  52   GSASDLDADSGMPDDLISTVDQFLREAIQNPRERLSVLRMEQDVEKFIQDPTREQMEFQQ  111

Query  600  LPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFP  779
            LPTSYLRLAAHRVAQHYSLQS VL+D+++PDGS SRIIVRK S  R+P +RLADIPVT P
Sbjct  112  LPTSYLRLAAHRVAQHYSLQSMVLLDNNLPDGSGSRIIVRKASHIRLPLVRLADIPVTLP  171



>ref|XP_007010334.1| Single-stranded nucleic acid binding R3H protein isoform 1 [Theobroma 
cacao]
 gb|EOY19144.1| Single-stranded nucleic acid binding R3H protein isoform 1 [Theobroma 
cacao]
Length=454

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 138/178 (78%), Gaps = 14/178 (8%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            M+GSV   EDLGAP E+WEVADLDA++ RLMLSS+ +   +                +SS
Sbjct  1    MDGSV--VEDLGAP-ESWEVADLDATMSRLMLSSNKEPKPEL-----------PDAISSS  46

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
            +S+    + ED+ N VDQFLREA+QNPRERLS+LRMEQDVEKFI DPTQQQ+EFQQLPTS
Sbjct  47   ASSAEKVIAEDVTNQVDQFLREAIQNPRERLSILRMEQDVEKFIHDPTQQQLEFQQLPTS  106

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+++PDGS  RIIVRKTSECR+P IRLADIPV  P +
Sbjct  107  YLRLAAHRVAQHYSLQSMVLLDNNLPDGSGFRIIVRKTSECRLPPIRLADIPVNLPSE  164



>ref|XP_008363212.1| PREDICTED: uncharacterized protein LOC103426912 [Malus domestica]
Length=457

 Score =   219 bits (557),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 138/178 (78%), Gaps = 10/178 (6%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV  AEDLGAP E+WEV  LD +++RLMLSS+ DS     L D     + +S+++  
Sbjct  1    MEGSV--AEDLGAP-ESWEVTGLDEAMKRLMLSSNKDSKXPQTLNDVPPLVSSSSDASDK  57

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
             S       ED VN VDQFLREALQNPRERLS+LRMEQDVEKFI+DP QQQ+EFQQLPTS
Sbjct  58   FS-------EDAVNQVDQFLREALQNPRERLSILRMEQDVEKFIRDPIQQQLEFQQLPTS  110

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+++PDGS SRIIVRKT  CR+P IRLADIPV  P +
Sbjct  111  YLRLAAHRVAQHYSLQSMVLLDNNLPDGSGSRIIVRKTPXCRLPLIRLADIPVNLPSE  168



>ref|XP_007010335.1| Single-stranded nucleic acid binding R3H protein isoform 2 [Theobroma 
cacao]
 gb|EOY19145.1| Single-stranded nucleic acid binding R3H protein isoform 2 [Theobroma 
cacao]
Length=486

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 138/178 (78%), Gaps = 14/178 (8%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            M+GSV   EDLGAP E+WEVADLDA++ RLMLSS+ +   +                +SS
Sbjct  1    MDGSV--VEDLGAP-ESWEVADLDATMSRLMLSSNKEPKPEL-----------PDAISSS  46

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
            +S+    + ED+ N VDQFLREA+QNPRERLS+LRMEQDVEKFI DPTQQQ+EFQQLPTS
Sbjct  47   ASSAEKVIAEDVTNQVDQFLREAIQNPRERLSILRMEQDVEKFIHDPTQQQLEFQQLPTS  106

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+++PDGS  RIIVRKTSECR+P IRLADIPV  P +
Sbjct  107  YLRLAAHRVAQHYSLQSMVLLDNNLPDGSGFRIIVRKTSECRLPPIRLADIPVNLPSE  164



>gb|KHG02377.1| R3hdm2 [Gossypium arboreum]
Length=442

 Score =   217 bits (552),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 138/178 (78%), Gaps = 11/178 (6%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV   EDLGAP ++WEVADLDA++ RLMLSS+ +S  +             S +++S
Sbjct  1    MEGSV--VEDLGAP-DSWEVADLDATMSRLMLSSNKESKPEF--------PDATSSASAS  49

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
             S     V ED +N VDQFLREA+QNPRERLS+LRMEQDVEKFI+DP QQQ EFQQLPTS
Sbjct  50   GSPDEKVVSEDAINEVDQFLREAIQNPRERLSILRMEQDVEKFIRDPNQQQFEFQQLPTS  109

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHR+AQHYSLQS VL+D+++PDGS SRIIV KTSECR+P IRLADIPV  P +
Sbjct  110  YLRLAAHRIAQHYSLQSMVLLDNNLPDGSGSRIIVCKTSECRLPRIRLADIPVNLPSE  167



>gb|KJB73373.1| hypothetical protein B456_011G230000 [Gossypium raimondii]
 gb|KJB73374.1| hypothetical protein B456_011G230000 [Gossypium raimondii]
Length=457

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 138/178 (78%), Gaps = 11/178 (6%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV   EDLGAP ++WEVADLDA++ RLMLSS+ +S  +             S +++S
Sbjct  1    MEGSV--VEDLGAP-DSWEVADLDATMSRLMLSSNKESKPEF--------PDATSSASAS  49

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
             S     V ED +N VDQFLREA+QNPRERLS+LRMEQDVEKFI+DP QQQ EFQQLPTS
Sbjct  50   GSPDEKVVSEDAINEVDQFLREAIQNPRERLSILRMEQDVEKFIRDPNQQQFEFQQLPTS  109

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHR+AQHYSLQS VL+D+++PDGS SRIIV KTSECR+P IRLADIPV  P +
Sbjct  110  YLRLAAHRIAQHYSLQSMVLLDNNLPDGSGSRIIVCKTSECRLPRIRLADIPVNLPSE  167



>gb|KHG02375.1| R3hdm2 [Gossypium arboreum]
Length=457

 Score =   217 bits (552),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 138/178 (78%), Gaps = 11/178 (6%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV   EDLGAP ++WEVADLDA++ RLMLSS+ +S  +             S +++S
Sbjct  1    MEGSV--VEDLGAP-DSWEVADLDATMSRLMLSSNKESKPEF--------PDATSSASAS  49

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
             S     V ED +N VDQFLREA+QNPRERLS+LRMEQDVEKFI+DP QQQ EFQQLPTS
Sbjct  50   GSPDEKVVSEDAINEVDQFLREAIQNPRERLSILRMEQDVEKFIRDPNQQQFEFQQLPTS  109

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHR+AQHYSLQS VL+D+++PDGS SRIIV KTSECR+P IRLADIPV  P +
Sbjct  110  YLRLAAHRIAQHYSLQSMVLLDNNLPDGSGSRIIVCKTSECRLPRIRLADIPVNLPSE  167



>gb|KHG02376.1| R3hdm2 [Gossypium arboreum]
Length=480

 Score =   217 bits (553),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 138/178 (78%), Gaps = 11/178 (6%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV   EDLGAP ++WEVADLDA++ RLMLSS+ +S  +             S +++S
Sbjct  1    MEGSV--VEDLGAP-DSWEVADLDATMSRLMLSSNKESKPEF--------PDATSSASAS  49

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
             S     V ED +N VDQFLREA+QNPRERLS+LRMEQDVEKFI+DP QQQ EFQQLPTS
Sbjct  50   GSPDEKVVSEDAINEVDQFLREAIQNPRERLSILRMEQDVEKFIRDPNQQQFEFQQLPTS  109

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHR+AQHYSLQS VL+D+++PDGS SRIIV KTSECR+P IRLADIPV  P +
Sbjct  110  YLRLAAHRIAQHYSLQSMVLLDNNLPDGSGSRIIVCKTSECRLPRIRLADIPVNLPSE  167



>ref|XP_004307056.1| PREDICTED: cAMP-regulated phosphoprotein 21-like [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   216 bits (549),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 141/179 (79%), Gaps = 12/179 (7%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSN-AQCDLadsssasapnsesas  428
            MEGSV  A+DLGAP E+WEVA +D ++ RLMLSS+ D   +Q DL + +S+   ++    
Sbjct  1    MEGSV--ADDLGAP-ESWEVAGVDEAMSRLMLSSNKDPKPSQQDLINDASSLVSSASDDK  57

Query  429  sssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPT  608
                    + ED +N VDQFLREALQNPRERLS+LRMEQDVEKFI+DP QQQ+EFQQLPT
Sbjct  58   --------LSEDALNQVDQFLREALQNPRERLSILRMEQDVEKFIRDPIQQQLEFQQLPT  109

Query  609  SYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            SYLRLAAHRVAQHY+LQS VL+D+++PDGS SRIIVRKT ECR+P IRLADIPV+ P +
Sbjct  110  SYLRLAAHRVAQHYALQSMVLLDNNLPDGSGSRIIVRKTPECRLPLIRLADIPVSLPSE  168



>ref|XP_012074667.1| PREDICTED: R3H domain-containing protein 2-like isoform X2 [Jatropha 
curcas]
Length=458

 Score =   215 bits (548),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 137/189 (72%), Gaps = 17/189 (9%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV   EDLGAP E+WEVADLD ++ RLML    DS   C  +    +    +   S 
Sbjct  1    MEGSV--VEDLGAP-ESWEVADLDETMSRLMLK---DSKRDCKQSSQELSIDSPTSVNSG  54

Query  432  ssapasG-----------VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQ  578
            S   +             V ED++N VDQFLREALQNPRERLS+LRMEQDVEKFI DPTQ
Sbjct  55   SVLGSGSSASGTGTGDKVVSEDLINQVDQFLREALQNPRERLSILRMEQDVEKFICDPTQ  114

Query  579  QQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLA  758
            QQ+EFQQLPTSYLRLAAHRVAQHYSL S VL+D+++PDGS SRIIVRKTSECR+PS+RLA
Sbjct  115  QQLEFQQLPTSYLRLAAHRVAQHYSLPSMVLLDNNLPDGSGSRIIVRKTSECRLPSVRLA  174

Query  759  DIPVTFPQD  785
            DIPV  P +
Sbjct  175  DIPVNLPSE  183



>ref|XP_011076921.1| PREDICTED: R3H domain-containing protein 1-like, partial [Sesamum 
indicum]
Length=414

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 135/162 (83%), Gaps = 4/162 (2%)
 Frame = +3

Query  294  PETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesassssapasGVPEDIVN  473
            PE+WEVAD+DAS+RRLMLSS  DS+  C+  +  +  + +  S +S S  +    +D+VN
Sbjct  16   PESWEVADVDASMRRLMLSSRKDSDVSCNKQEERAEDSGSGFSLNSCSVKS----DDLVN  71

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VDQFLR+ALQNPRERLSVLRMEQDVEKFI+DPT++QMEFQQLPTSYLRLAAHRVAQHYS
Sbjct  72   TVDQFLRDALQNPRERLSVLRMEQDVEKFIRDPTREQMEFQQLPTSYLRLAAHRVAQHYS  131

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFP  779
            L+S VL D+++P+GS+SRIIVRKTS  R+PS+RLAD+PV  P
Sbjct  132  LESMVLFDNNLPEGSSSRIIVRKTSNIRLPSVRLADVPVNLP  173



>ref|XP_012074666.1| PREDICTED: R3H domain-containing protein 2-like isoform X1 [Jatropha 
curcas]
 gb|KDP35782.1| hypothetical protein JCGZ_10418 [Jatropha curcas]
Length=472

 Score =   215 bits (547),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 137/189 (72%), Gaps = 17/189 (9%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV   EDLGAP E+WEVADLD ++ RLML    DS   C  +    +    +   S 
Sbjct  1    MEGSV--VEDLGAP-ESWEVADLDETMSRLMLK---DSKRDCKQSSQELSIDSPTSVNSG  54

Query  432  ssapasG-----------VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQ  578
            S   +             V ED++N VDQFLREALQNPRERLS+LRMEQDVEKFI DPTQ
Sbjct  55   SVLGSGSSASGTGTGDKVVSEDLINQVDQFLREALQNPRERLSILRMEQDVEKFICDPTQ  114

Query  579  QQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLA  758
            QQ+EFQQLPTSYLRLAAHRVAQHYSL S VL+D+++PDGS SRIIVRKTSECR+PS+RLA
Sbjct  115  QQLEFQQLPTSYLRLAAHRVAQHYSLPSMVLLDNNLPDGSGSRIIVRKTSECRLPSVRLA  174

Query  759  DIPVTFPQD  785
            DIPV  P +
Sbjct  175  DIPVNLPSE  183



>ref|XP_011655833.1| PREDICTED: R3H domain-containing protein 2-like [Cucumis sativus]
Length=471

 Score =   215 bits (547),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 141/182 (77%), Gaps = 9/182 (5%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGS  A EDLGAP E+WEVADLD ++ RLML SS+       L  + +A+A +  +AS 
Sbjct  1    MEGS--AVEDLGAP-ESWEVADLDEAMSRLMLPSSSPKKNSKSLDVADAAAAYHFSTASF  57

Query  432  ssapasG------VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEF  593
             S   S       V ED +N VDQFLREAL NPRERLS+LRMEQDVEKFI+DP +QQ+EF
Sbjct  58   PSLSGSAYSALDRVSEDAINQVDQFLREALHNPRERLSILRMEQDVEKFIRDPARQQLEF  117

Query  594  QQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVT  773
            QQLPTSYLRLAAHRVAQHYSLQS VL+D+S+PDGS S+IIVRKTSECR+P+IRLADIPV 
Sbjct  118  QQLPTSYLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSKIIVRKTSECRLPTIRLADIPVN  177

Query  774  FP  779
             P
Sbjct  178  LP  179



>ref|XP_006378811.1| hypothetical protein POPTR_0010s24400g [Populus trichocarpa]
 gb|ERP56608.1| hypothetical protein POPTR_0010s24400g [Populus trichocarpa]
Length=336

 Score =   210 bits (535),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 135/178 (76%), Gaps = 9/178 (5%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV   +DLGAP E+WEVADLD ++ RL+L+  +    Q      + + + +      
Sbjct  1    MEGSV-VVDDLGAP-ESWEVADLDETMSRLLLNKDSKQQKQQPQDQLARSGSGSLGPGEK  58

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
                   V +D++N VDQFLREALQNPRERLS+LRMEQDVEKFI+DP QQQ+EFQQLPTS
Sbjct  59   -------VTDDVINQVDQFLREALQNPRERLSILRMEQDVEKFIRDPNQQQLEFQQLPTS  111

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTS+C +P IRLADIP++ P +
Sbjct  112  YLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSDCSLPLIRLADIPLSLPSE  169



>ref|XP_010088775.1| R3H domain-containing protein 2 [Morus notabilis]
 gb|EXB36958.1| R3H domain-containing protein 2 [Morus notabilis]
Length=469

 Score =   214 bits (545),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 122/183 (67%), Positives = 142/183 (78%), Gaps = 15/183 (8%)
 Frame = +3

Query  264  VSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQ---CDLadsssasapnsesasss  434
            VSAAEDLGAP E+WEVADLD S+ RLML+SS+        CD       + P+  S+SS+
Sbjct  3    VSAAEDLGAP-ESWEVADLDESMTRLMLASSSSKKESARPCD-----EPNDPSDSSSSSA  56

Query  435  sapasGVP------EDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQ  596
            ++   G P      ED+V  VDQFLREALQNPRERLS+LRMEQDVEKFI DPTQQQ+EFQ
Sbjct  57   ASATPGAPAENTSYEDVVGQVDQFLREALQNPRERLSILRMEQDVEKFIHDPTQQQLEFQ  116

Query  597  QLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTF  776
            QLPTSYLRLAAHRVAQHYSLQS VL+D+++ DGS SRIIVRKT+ECR+P IRLADIPV  
Sbjct  117  QLPTSYLRLAAHRVAQHYSLQSMVLLDNNLADGSGSRIIVRKTAECRLPMIRLADIPVNL  176

Query  777  PQD  785
            P +
Sbjct  177  PSE  179



>gb|KHN00907.1| R3H domain-containing protein 2 [Glycine soja]
Length=461

 Score =   214 bits (544),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 136/177 (77%), Gaps = 8/177 (5%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRL--MLSSSNDSNAQCDLadsssasapnsesa  425
            MEGS   AED GAP E+WEVADLD S+ RL  MLSS+NDS            + P     
Sbjct  1    MEGS---AEDFGAP-ESWEVADLDESMNRLNLMLSSNNDSKQPHQRVADDDDAMPPPIPP  56

Query  426  ssssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLP  605
             SSS     V +D++N VDQFLREA+QNPRERLS+LRMEQDVE FI+DPTQQQ+EF+QLP
Sbjct  57   PSSSGDE--VSDDVINQVDQFLREAIQNPRERLSILRMEQDVENFIRDPTQQQLEFKQLP  114

Query  606  TSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTF  776
            TSYLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTSEC++P IRLADIPV  
Sbjct  115  TSYLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSECKLPVIRLADIPVKL  171



>ref|XP_007143806.1| hypothetical protein PHAVU_007G103200g [Phaseolus vulgaris]
 ref|XP_007143807.1| hypothetical protein PHAVU_007G103200g [Phaseolus vulgaris]
 gb|ESW15800.1| hypothetical protein PHAVU_007G103200g [Phaseolus vulgaris]
 gb|ESW15801.1| hypothetical protein PHAVU_007G103200g [Phaseolus vulgaris]
Length=462

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 135/177 (76%), Gaps = 7/177 (4%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRL--MLSSSNDSNAQCDLadsssasapnsesa  425
            MEGS   AEDLGAP E+WEVADLD S+ RL  MLSS+ DSN       S     P     
Sbjct  1    MEGS---AEDLGAP-ESWEVADLDESMNRLNLMLSSTKDSN-HPHQRLSDDDVPPPPPPP  55

Query  426  ssssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLP  605
               S+    V +D+VN VDQFLREA+QNPRERLS+LRMEQDVE FI+DPTQQQ+EF+QLP
Sbjct  56   PLPSSTGDKVSDDVVNQVDQFLREAIQNPRERLSILRMEQDVENFIRDPTQQQLEFKQLP  115

Query  606  TSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTF  776
            TSYLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTSE ++P IRLADIPV  
Sbjct  116  TSYLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSEYKLPVIRLADIPVKL  172



>ref|XP_007143805.1| hypothetical protein PHAVU_007G103200g [Phaseolus vulgaris]
 gb|ESW15799.1| hypothetical protein PHAVU_007G103200g [Phaseolus vulgaris]
Length=463

 Score =   213 bits (542),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 135/177 (76%), Gaps = 7/177 (4%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRL--MLSSSNDSNAQCDLadsssasapnsesa  425
            MEGS   AEDLGAP E+WEVADLD S+ RL  MLSS+ DSN       S     P     
Sbjct  1    MEGS---AEDLGAP-ESWEVADLDESMNRLNLMLSSTKDSN-HPHQRLSDDDVPPPPPPP  55

Query  426  ssssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLP  605
               S+    V +D+VN VDQFLREA+QNPRERLS+LRMEQDVE FI+DPTQQQ+EF+QLP
Sbjct  56   PLPSSTGDKVSDDVVNQVDQFLREAIQNPRERLSILRMEQDVENFIRDPTQQQLEFKQLP  115

Query  606  TSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTF  776
            TSYLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTSE ++P IRLADIPV  
Sbjct  116  TSYLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSEYKLPVIRLADIPVKL  172



>ref|XP_003556269.1| PREDICTED: R3H domain-containing protein 2-like isoform X1 [Glycine 
max]
 ref|XP_006606278.1| PREDICTED: R3H domain-containing protein 2-like isoform X2 [Glycine 
max]
Length=461

 Score =   211 bits (538),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 135/177 (76%), Gaps = 8/177 (5%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRL--MLSSSNDSNAQCDLadsssasapnsesa  425
            MEGS   AED GAP E+WEVADLD S+ RL  MLSS+NDS            + P     
Sbjct  1    MEGS---AEDFGAP-ESWEVADLDESMNRLNLMLSSNNDSKQPHQRVADDDDAMPPPIPP  56

Query  426  ssssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLP  605
             SSS     V +D++N VDQFLREA+QNPRERLS+LRMEQDVE FI+DPTQQQ+EF+QLP
Sbjct  57   PSSSGDE--VSDDVINQVDQFLREAIQNPRERLSILRMEQDVENFIRDPTQQQLEFKQLP  114

Query  606  TSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTF  776
            TSYLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKT EC++P IRLADIPV  
Sbjct  115  TSYLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTFECKLPVIRLADIPVKL  171



>ref|XP_008446764.1| PREDICTED: R3H domain-containing protein 2-like [Cucumis melo]
 ref|XP_008446765.1| PREDICTED: R3H domain-containing protein 2-like [Cucumis melo]
Length=471

 Score =   211 bits (538),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 140/182 (77%), Gaps = 9/182 (5%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGS  A EDLGAP E+WEVADLD ++ RLML SS+       L  + +A A +  SAS 
Sbjct  1    MEGS--AVEDLGAP-ESWEVADLDEAMSRLMLPSSSPKKNSKSLDVADAAPAYHFSSASF  57

Query  432  ssapasG------VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEF  593
             S  AS       V ED +N VDQFLREAL NPRERLS+LRMEQDVEKFI+DP +QQ+EF
Sbjct  58   PSLSASASSALDRVSEDAINQVDQFLREALHNPRERLSILRMEQDVEKFIRDPARQQLEF  117

Query  594  QQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVT  773
            QQLPTSYLRLAAHRVAQHYSLQS VL+D+S+PDGS S+IIVRKTSECR P+IRLADIPV 
Sbjct  118  QQLPTSYLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSKIIVRKTSECRHPAIRLADIPVN  177

Query  774  FP  779
             P
Sbjct  178  LP  179



>ref|XP_010555980.1| PREDICTED: R3H domain-containing protein 2-like [Tarenaya hassleriana]
 ref|XP_010555982.1| PREDICTED: R3H domain-containing protein 2-like [Tarenaya hassleriana]
Length=463

 Score =   211 bits (536),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 135/172 (78%), Gaps = 6/172 (3%)
 Frame = +3

Query  267  SAAEDLGAPPETWEVADLDASVRRLMLSS--SNDSNAQCDLadsssasapnsesassssa  440
            S  EDLG P E+WE ADLDA++ RLMLSS  SND   + +L D    S   +  +SSS  
Sbjct  4    STVEDLGLP-ESWEAADLDAALSRLMLSSTPSNDPAQREELPDVQPPSQIQTSGSSSSGE  62

Query  441  pasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLR  620
                V +D VN VDQFLREAL+NPRERLSVLRMEQ+VEKFI DP+QQQMEFQQ+PTSYLR
Sbjct  63   K---VLDDAVNQVDQFLREALENPRERLSVLRMEQEVEKFIHDPSQQQMEFQQIPTSYLR  119

Query  621  LAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTF  776
            LAAHRVAQHY+LQS VL+D+S+PDGS SRIIVRKTSECR P+IRLADIPV  
Sbjct  120  LAAHRVAQHYNLQSMVLLDNSLPDGSGSRIIVRKTSECRRPAIRLADIPVNL  171



>ref|XP_003536315.1| PREDICTED: R3H domain-containing protein 1-like isoform X1 [Glycine 
max]
 ref|XP_006589382.1| PREDICTED: R3H domain-containing protein 1-like isoform X2 [Glycine 
max]
Length=461

 Score =   210 bits (534),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 136/175 (78%), Gaps = 4/175 (2%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGS   AEDLGAP E+WEVADLD S+ RL L   ++++++      +  +  ++     
Sbjct  1    MEGS---AEDLGAP-ESWEVADLDESMNRLNLMVFSNNDSKQPHQRLADYNDDDAPLPPP  56

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
             S+    V +D +N VDQFLREA+QNPRERLS+LRMEQDVE FI+DPTQQQ+EF+QLPTS
Sbjct  57   PSSSCDEVSDDAINQVDQFLREAIQNPRERLSILRMEQDVENFIRDPTQQQLEFKQLPTS  116

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTF  776
            YLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTSEC++P IRLADIPV  
Sbjct  117  YLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSECKLPVIRLADIPVKL  171



>ref|XP_011024222.1| PREDICTED: uncharacterized protein LOC105125463 [Populus euphratica]
 ref|XP_011024223.1| PREDICTED: uncharacterized protein LOC105125463 [Populus euphratica]
 ref|XP_011024224.1| PREDICTED: uncharacterized protein LOC105125463 [Populus euphratica]
 ref|XP_011024225.1| PREDICTED: uncharacterized protein LOC105125463 [Populus euphratica]
Length=461

 Score =   209 bits (533),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 135/178 (76%), Gaps = 7/178 (4%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV   +DLGAP E+WEVADLD ++ RL+L+  +    Q      + + + +      
Sbjct  1    MEGSV-VVDDLGAP-ESWEVADLDETMSRLLLNKDSKQQQQQPQDQLARSGSGSGSLGPG  58

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
                   V +D++N VDQFLREALQNPRERLS+LRMEQDVEKFI+DP QQQ+EFQQLPTS
Sbjct  59   EK-----VTDDVINQVDQFLREALQNPRERLSILRMEQDVEKFIRDPNQQQLEFQQLPTS  113

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTS+C +P IRLADIP++ P +
Sbjct  114  YLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSDCGLPLIRLADIPLSLPSE  171



>ref|XP_006378812.1| hypothetical protein POPTR_0010s24400g [Populus trichocarpa]
 ref|XP_006378813.1| hypothetical protein POPTR_0010s24400g [Populus trichocarpa]
 gb|ERP56609.1| hypothetical protein POPTR_0010s24400g [Populus trichocarpa]
 gb|ERP56610.1| hypothetical protein POPTR_0010s24400g [Populus trichocarpa]
Length=459

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 135/178 (76%), Gaps = 9/178 (5%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV   +DLGAP E+WEVADLD ++ RL+L+  +    Q      + + + +      
Sbjct  1    MEGSV-VVDDLGAP-ESWEVADLDETMSRLLLNKDSKQQKQQPQDQLARSGSGSLGPGEK  58

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
                   V +D++N VDQFLREALQNPRERLS+LRMEQDVEKFI+DP QQQ+EFQQLPTS
Sbjct  59   -------VTDDVINQVDQFLREALQNPRERLSILRMEQDVEKFIRDPNQQQLEFQQLPTS  111

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTS+C +P IRLADIP++ P +
Sbjct  112  YLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSDCSLPLIRLADIPLSLPSE  169



>ref|XP_002311953.2| hypothetical protein POPTR_0008s02260g [Populus trichocarpa]
 ref|XP_006379464.1| hypothetical protein POPTR_0008s02260g [Populus trichocarpa]
 gb|EEE89320.2| hypothetical protein POPTR_0008s02260g [Populus trichocarpa]
 gb|ERP57261.1| hypothetical protein POPTR_0008s02260g [Populus trichocarpa]
Length=456

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 131/178 (74%), Gaps = 13/178 (7%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV A EDLGAP ++WEVADLD ++ RL L+         D            +   S
Sbjct  1    MEGSVVAEEDLGAP-DSWEVADLDQTMNRLSLNKETKHQQPQD------------QLPRS  47

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
             S P   V +D+VN VDQFL EALQN RERLS+LRMEQD+EKFI+DP QQQ+EFQQLPTS
Sbjct  48   GSGPGEKVTDDVVNQVDQFLLEALQNTRERLSILRMEQDIEKFIRDPNQQQLEFQQLPTS  107

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIV KTS CR+P IRLADIPV+ P +
Sbjct  108  YLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVCKTSNCRLPLIRLADIPVSLPSE  165



>gb|KHN37830.1| R3H domain-containing protein 2 [Glycine soja]
Length=466

 Score =   209 bits (531),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 134/180 (74%), Gaps = 9/180 (5%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRR--LMLSSSNDSNAQCDLadsssasapnsesa  425
            MEGS   AEDLGAP E+WEVADLD S+ R  LM+ S+NDS          +         
Sbjct  1    MEGS---AEDLGAP-ESWEVADLDESMNRLNLMVFSNNDSKQPHQRLADYNDDDAPLPPP  56

Query  426  ssssapasG---VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQ  596
                 P+S    V +D +N VDQFLREA+QNPRERLS+LRMEQDVE FI+DPTQQQ+EF+
Sbjct  57   PPPPPPSSSCDEVSDDAINQVDQFLREAIQNPRERLSILRMEQDVENFIRDPTQQQLEFK  116

Query  597  QLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTF  776
            QLPTSYLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTSEC++P IRLADIPV  
Sbjct  117  QLPTSYLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSECKLPVIRLADIPVKL  176



>ref|XP_010271700.1| PREDICTED: cAMP-regulated phosphoprotein 21-like [Nelumbo nucifera]
Length=482

 Score =   209 bits (531),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 120/194 (62%), Positives = 145/194 (75%), Gaps = 20/194 (10%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSS------------SNDSNA----QCDL  383
            MEGSV   EDLGAP ++WE+ DLD S+ RLM+S             ++DS A        
Sbjct  1    MEGSV---EDLGAP-DSWEMVDLDESMSRLMVSCKKNLTTASPPEFADDSAAAPRPASTA  56

Query  384  adsssasapnsesassssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFI  563
            + + S+S+ ++ S+S  S    GV ED +N VDQFLREALQNPRERLS+LRMEQDVEKFI
Sbjct  57   SSAVSSSSASASSSSVGSEKIRGVSEDPINQVDQFLREALQNPRERLSILRMEQDVEKFI  116

Query  564  KDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMP  743
             DPT+QQ+EFQQLPTSYLRLAAHRVAQHY LQS V++D+++PDGS SRI+VRKTSECR+P
Sbjct  117  CDPTRQQLEFQQLPTSYLRLAAHRVAQHYCLQSMVILDNNLPDGSGSRIVVRKTSECRLP  176

Query  744  SIRLADIPVTFPQD  785
             IRLADIPV  PQD
Sbjct  177  LIRLADIPVNLPQD  190



>ref|XP_006378814.1| hypothetical protein POPTR_0010s24400g [Populus trichocarpa]
 gb|ERP56611.1| hypothetical protein POPTR_0010s24400g [Populus trichocarpa]
Length=482

 Score =   208 bits (530),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 135/178 (76%), Gaps = 9/178 (5%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV   +DLGAP E+WEVADLD ++ RL+L+  +    Q      + + + +      
Sbjct  1    MEGSV-VVDDLGAP-ESWEVADLDETMSRLLLNKDSKQQKQQPQDQLARSGSGSLGPGEK  58

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
                   V +D++N VDQFLREALQNPRERLS+LRMEQDVEKFI+DP QQQ+EFQQLPTS
Sbjct  59   -------VTDDVINQVDQFLREALQNPRERLSILRMEQDVEKFIRDPNQQQLEFQQLPTS  111

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKTS+C +P IRLADIP++ P +
Sbjct  112  YLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTSDCSLPLIRLADIPLSLPSE  169



>ref|XP_002524991.1| r3h domain containing protein, putative [Ricinus communis]
 gb|EEF37398.1| r3h domain containing protein, putative [Ricinus communis]
Length=452

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 136/170 (80%), Gaps = 8/170 (5%)
 Frame = +3

Query  276  EDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesassssapasGV  455
            EDLGAP E+WEVADLD ++ RLML+++N +++      S  +S+  S   S S       
Sbjct  3    EDLGAP-ESWEVADLDQTMSRLMLNNNNSNDSSSSKQASRDSSSSVSVHNSGSG------  55

Query  456  PEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHR  635
             + ++N VDQFLR+AL NPRERLS+LRMEQDVEKFI+DPTQQQ+EFQQLPTSYLRLAAHR
Sbjct  56   -DGLINQVDQFLRDALNNPRERLSILRMEQDVEKFIRDPTQQQLEFQQLPTSYLRLAAHR  114

Query  636  VAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            VAQHYSLQS VL+D+++PDGS SRIIVRKTSECR+PSIRLADIPV  P +
Sbjct  115  VAQHYSLQSMVLLDNNLPDGSGSRIIVRKTSECRLPSIRLADIPVNLPSE  164



>ref|XP_004496195.1| PREDICTED: R3H domain-containing protein 2-like [Cicer arietinum]
Length=492

 Score =   206 bits (523),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 118/179 (66%), Positives = 139/179 (78%), Gaps = 7/179 (4%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRL-MLSSSNDSNAQCDLadsssasapnsesas  428
            MEGS   +ED+GAP ++WEVADLD S+ RL +L SSN  +   D AD  +A      S+S
Sbjct  1    MEGS---SEDIGAP-DSWEVADLDESMNRLNLLISSNKDSKTHDHADGGAAPHLPPSSSS  56

Query  429  sssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPT  608
            S+S     V +D VN VDQFLREA+QNPRERLSVLRMEQDV  FI+DP QQQ+EF QLPT
Sbjct  57   STSGDK--VSDDAVNQVDQFLREAIQNPRERLSVLRMEQDVLNFIQDPNQQQLEFNQLPT  114

Query  609  SYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            SYLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIVRKT+EC++P IRLADIPV  P +
Sbjct  115  SYLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVRKTAECKLPVIRLADIPVKLPSE  173



>ref|XP_010244514.1| PREDICTED: cAMP-regulated phosphoprotein 21-like [Nelumbo nucifera]
Length=475

 Score =   205 bits (521),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 137/183 (75%), Gaps = 10/183 (5%)
 Frame = +3

Query  264  VSAAEDLGAPPETWEVADLDASVRRLMLSSSNDS---------NAQCDLadsssasapns  416
              +A+D GA  ++WE ADL+ S+ RL +S   +S         +       ++ A + ++
Sbjct  2    TGSADDAGAS-DSWETADLEESMSRLRVSCRKNSATPPPQDFADDPPVPPPATPALSSSA  60

Query  417  esassssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQ  596
              +S  S   +GV ED++N VDQFLREALQNPRERLS+LRMEQDVEKFI+DPTQQQMEFQ
Sbjct  61   SPSSVGSERTAGVSEDVINQVDQFLREALQNPRERLSILRMEQDVEKFIRDPTQQQMEFQ  120

Query  597  QLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTF  776
            QLPTSYLRLAAHRVAQHYSLQS V++D+++PDGS SRI+VRKTSECR P IRL+DIPV  
Sbjct  121  QLPTSYLRLAAHRVAQHYSLQSMVILDNNLPDGSGSRIVVRKTSECRRPLIRLSDIPVNL  180

Query  777  PQD  785
            PQ+
Sbjct  181  PQE  183



>gb|EPS69925.1| hypothetical protein M569_04838 [Genlisea aurea]
Length=325

 Score =   201 bits (511),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/163 (63%), Positives = 129/163 (79%), Gaps = 3/163 (2%)
 Frame = +3

Query  294  PETWEVADLDASVRRLMLSSSNDSN-AQCDLadsssasapnsesassssapasGVPEDIV  470
            PE+WEVAD++ SVRRL+LSS  DSN     L D++  S      ++  ++  SG+ +D++
Sbjct  16   PESWEVADVETSVRRLLLSSIKDSNLGSKKLDDAAETSDSGLSVSTVQNSGPSGISDDLI  75

Query  471  NSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHY  650
            N+VDQFLREA+QNPRER+SVLR+EQD+E FI+D T++QMEFQQLPTSYLRLAAHRVAQHY
Sbjct  76   NTVDQFLREAIQNPRERVSVLRLEQDIENFIRDSTREQMEFQQLPTSYLRLAAHRVAQHY  135

Query  651  SLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFP  779
            SLQS VL D  +P+GS SRIIVRKTS  R+P +RLA+IPV  P
Sbjct  136  SLQSMVLTD--LPEGSGSRIIVRKTSNIRLPLVRLAEIPVNLP  176



>ref|XP_011626020.1| PREDICTED: cAMP-regulated phosphoprotein 21 [Amborella trichopoda]
Length=462

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 138/178 (78%), Gaps = 5/178 (3%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            ME SV   +D GAP E+WE+ADLD S++RLM++ +N S++     ++   ++     A+S
Sbjct  1    METSV---DDNGAP-ESWELADLDESMKRLMVACNNRSSSSSQAPENDFPASSVPVQATS  56

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
              + +    +D +N VDQFLREALQNPRERLS+LRMEQDVEKFI+DP QQQ+EFQQLPTS
Sbjct  57   MPSSSE-FSDDSLNQVDQFLREALQNPRERLSILRMEQDVEKFIRDPRQQQLEFQQLPTS  115

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHY LQS V++D+S+PDGS SRI++RKTS+ R+P IRLADIP   PQD
Sbjct  116  YLRLAAHRVAQHYGLQSMVMLDNSLPDGSGSRIVIRKTSDFRVPLIRLADIPANLPQD  173



>ref|XP_011032851.1| PREDICTED: uncharacterized protein LOC105131533 isoform X2 [Populus 
euphratica]
Length=457

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 129/178 (72%), Gaps = 8/178 (4%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV A EDLGAP ++WEVADLD ++  L L+         D         P S S   
Sbjct  1    MEGSVVAVEDLGAP-DSWEVADLDQTMNCLSLNKETKHQQAKD-------QLPRSGSGPG  52

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
            S  P   V  D+ N VDQFL EALQN RERLS+LRMEQD+EKFI+DP QQQ+EFQQLPTS
Sbjct  53   SLGPGEKVTYDVANQVDQFLLEALQNTRERLSILRMEQDIEKFIRDPNQQQLEFQQLPTS  112

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIV KTS CR+P IRLADIPV+ P +
Sbjct  113  YLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVCKTSNCRLPLIRLADIPVSLPSE  170



>ref|XP_011032850.1| PREDICTED: uncharacterized protein LOC105131533 isoform X1 [Populus 
euphratica]
Length=461

 Score =   202 bits (515),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 113/178 (63%), Positives = 129/178 (72%), Gaps = 8/178 (4%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV A EDLGAP ++WEVADLD ++  L L+         D         P S S   
Sbjct  1    MEGSVVAVEDLGAP-DSWEVADLDQTMNCLSLNKETKHQQAKD-------QLPRSGSGPG  52

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
            S  P   V  D+ N VDQFL EALQN RERLS+LRMEQD+EKFI+DP QQQ+EFQQLPTS
Sbjct  53   SLGPGEKVTYDVANQVDQFLLEALQNTRERLSILRMEQDIEKFIRDPNQQQLEFQQLPTS  112

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D+S+PDGS SRIIV KTS CR+P IRLADIPV+ P +
Sbjct  113  YLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSRIIVCKTSNCRLPLIRLADIPVSLPSE  170



>ref|XP_003591774.1| R3H domain-containing protein [Medicago truncatula]
 gb|AES62025.1| single-stranded nucleic acid-binding protein R3H [Medicago truncatula]
Length=507

 Score =   203 bits (517),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 138/181 (76%), Gaps = 13/181 (7%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRL--MLSSSNDSNAQCDLadsssasapnsesa  425
            MEGS   +EDLG  PE+WEVADLD S+ RL  ++SS+ DSNA         A++P+  ++
Sbjct  1    MEGS---SEDLGGAPESWEVADLDDSMNRLNLLISSNKDSNADG-------AASPHLPNS  50

Query  426  ssssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLP  605
            SSSS     V +D VN VDQFLREA+QNPRERLS+LR+EQDV  FIKDP QQQ+EF QLP
Sbjct  51   SSSSISGDNVSDDAVNQVDQFLREAIQNPRERLSILRIEQDVLNFIKDPHQQQLEFNQLP  110

Query  606  TSYLRLAAHRVAQHYSLQSTVLVD-SSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
            TSYLRLAAHRVAQHYSLQS VL D +S+PDGS SRIIV KT+EC+ P IRLADIPV  P 
Sbjct  111  TSYLRLAAHRVAQHYSLQSMVLQDNNSLPDGSGSRIIVSKTAECKRPVIRLADIPVKLPS  170

Query  783  D  785
            +
Sbjct  171  E  171



>ref|XP_008375572.1| PREDICTED: uncharacterized protein LOC103438798 [Malus domestica]
Length=457

 Score =   199 bits (506),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 139/178 (78%), Gaps = 10/178 (6%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV  AEDLGAP E+WEVA LD ++ RLMLSS+ DS     L+D     + +S+++  
Sbjct  1    MEGSV--AEDLGAP-ESWEVAGLDDALNRLMLSSNKDSKPPQSLSDVPPLVSSSSDASDK  57

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
             S       ED VN VDQFLREALQNPRERLS+LRMEQDVEKFI+DP QQQ+EFQQLPTS
Sbjct  58   FS-------EDAVNQVDQFLREALQNPRERLSILRMEQDVEKFIRDPLQQQLEFQQLPTS  110

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D ++PDGS SRIIVRKT ECR+P IRLADIP+  P +
Sbjct  111  YLRLAAHRVAQHYSLQSMVLLDDNLPDGSGSRIIVRKTPECRLPLIRLADIPLNLPSE  168



>gb|ERN13065.1| hypothetical protein AMTR_s00040p00140300 [Amborella trichopoda]
Length=588

 Score =   201 bits (512),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 138/178 (78%), Gaps = 5/178 (3%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            ME SV   +D GAP E+WE+ADLD S++RLM++ +N S++     ++   ++     A+S
Sbjct  1    METSV---DDNGAP-ESWELADLDESMKRLMVACNNRSSSSSQAPENDFPASSVPVQATS  56

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
              + +    +D +N VDQFLREALQNPRERLS+LRMEQDVEKFI+DP QQQ+EFQQLPTS
Sbjct  57   MPSSSE-FSDDSLNQVDQFLREALQNPRERLSILRMEQDVEKFIRDPRQQQLEFQQLPTS  115

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHY LQS V++D+S+PDGS SRI++RKTS+ R+P IRLADIP   PQD
Sbjct  116  YLRLAAHRVAQHYGLQSMVMLDNSLPDGSGSRIVIRKTSDFRVPLIRLADIPANLPQD  173



>ref|XP_009336010.1| PREDICTED: uncharacterized protein LOC103928658 [Pyrus x bretschneideri]
 ref|XP_009336019.1| PREDICTED: uncharacterized protein LOC103928664 [Pyrus x bretschneideri]
Length=457

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 137/178 (77%), Gaps = 10/178 (6%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV  AED+GAP E+WEVA LD ++  LMLSS+ DS     L D     + +S+++  
Sbjct  1    MEGSV--AEDIGAP-ESWEVAGLDDALNHLMLSSTKDSKPPQSLTDVPPLVSSSSDASDK  57

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
             S       ED VN VDQFLREALQNPRERLS+LRMEQDVEKFI+DP QQQ+EFQQLPTS
Sbjct  58   FS-------EDAVNQVDQFLREALQNPRERLSILRMEQDVEKFIRDPLQQQLEFQQLPTS  110

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YLRLAAHRVAQHYSLQS VL+D ++PDGS SRIIVRKT ECR+P IRLADIPV  P +
Sbjct  111  YLRLAAHRVAQHYSLQSMVLLDDNLPDGSGSRIIVRKTPECRLPLIRLADIPVNLPSE  168



>ref|XP_002265099.2| PREDICTED: cAMP-regulated phosphoprotein 21 [Vitis vinifera]
 ref|XP_010658771.1| PREDICTED: cAMP-regulated phosphoprotein 21 [Vitis vinifera]
 ref|XP_010658772.1| PREDICTED: cAMP-regulated phosphoprotein 21 [Vitis vinifera]
 ref|XP_010658773.1| PREDICTED: cAMP-regulated phosphoprotein 21 [Vitis vinifera]
 ref|XP_010658774.1| PREDICTED: cAMP-regulated phosphoprotein 21 [Vitis vinifera]
Length=470

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 143/182 (79%), Gaps = 10/182 (5%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGS   A+DLGAP E+WEVADLD S+ RLMLSSS+        +   ++   ++ +++ 
Sbjct  1    MEGS---ADDLGAP-ESWEVADLDESMSRLMLSSSSSKKDSSSSSSLDASVPASASASAP  56

Query  432  ssapasG------VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEF  593
            + + +S       + ED VN VDQFLREALQNPRERLS+LRMEQD+EKFI DPTQQQ+EF
Sbjct  57   ALSSSSVPVGSGMISEDSVNQVDQFLREALQNPRERLSILRMEQDIEKFIHDPTQQQLEF  116

Query  594  QQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVT  773
            QQLPTSYLRLAAHRVAQHYSLQS VL+D+++PDGS S+IIVRKTSECR+P IRLADIPV+
Sbjct  117  QQLPTSYLRLAAHRVAQHYSLQSMVLLDNNLPDGSGSKIIVRKTSECRLPLIRLADIPVS  176

Query  774  FP  779
             P
Sbjct  177  LP  178



>ref|XP_010067141.1| PREDICTED: R3H domain-containing protein 1-like [Eucalyptus grandis]
 ref|XP_010067142.1| PREDICTED: R3H domain-containing protein 1-like [Eucalyptus grandis]
 ref|XP_010067143.1| PREDICTED: R3H domain-containing protein 1-like [Eucalyptus grandis]
 gb|KCW65205.1| hypothetical protein EUGRSUZ_G02696 [Eucalyptus grandis]
 gb|KCW65206.1| hypothetical protein EUGRSUZ_G02696 [Eucalyptus grandis]
 gb|KCW65207.1| hypothetical protein EUGRSUZ_G02696 [Eucalyptus grandis]
 gb|KCW65208.1| hypothetical protein EUGRSUZ_G02696 [Eucalyptus grandis]
Length=506

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 133/176 (76%), Gaps = 9/176 (5%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEG    AED  AP E+WEVAD+D ++RRL+LS+  + NAQ      S ++ P +  ++ 
Sbjct  1    MEG---PAEDAVAP-ESWEVADVDETMRRLLLSAK-EPNAQDPGGGGSGSAPPATSPSAP  55

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
                   V ED ++ VDQFLREAL+NPRERLS+LRMEQDVEKFI+DP Q+QMEFQQLPTS
Sbjct  56   PEK----VTEDALSQVDQFLREALENPRERLSILRMEQDVEKFIRDPMQKQMEFQQLPTS  111

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFP  779
            YLRLAAHRVAQHY LQS VL+D+++PD S SRIIV KTSECR+  IRLADIPV  P
Sbjct  112  YLRLAAHRVAQHYGLQSMVLLDTNLPDASNSRIIVSKTSECRIFPIRLADIPVNLP  167



>ref|XP_010694526.1| PREDICTED: cAMP-regulated phosphoprotein 21-like [Beta vulgaris 
subsp. vulgaris]
Length=472

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 140/189 (74%), Gaps = 15/189 (8%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSS----------NDSNAQCDLadsssa  401
            MEGS  A ED  AP E+WEVAD++ S++RLM SSS           +S A  DL  +S  
Sbjct  1    MEGS--AVEDPAAP-ESWEVADVEESMKRLMFSSSAKDSASSSSRTNSIAPDDLTSTSLN  57

Query  402  sapnsesassssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQ  581
             A +    + ++  + G+ +D +N VDQFLREALQNPRERLS+LRMEQDVEKFI+DPT+Q
Sbjct  58   LAFSIGGIADNADVS-GLSDDAINQVDQFLREALQNPRERLSILRMEQDVEKFIQDPTRQ  116

Query  582  QMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTS-ECRMPSIRLA  758
            QMEFQ LPTSYLRLAAHRVAQHY LQS VL+D+S+ DGS SRIIV+K S ECR+P IRLA
Sbjct  117  QMEFQLLPTSYLRLAAHRVAQHYFLQSMVLLDNSLLDGSGSRIIVQKASTECRLPRIRLA  176

Query  759  DIPVTFPQD  785
            DIPV  PQ+
Sbjct  177  DIPVHLPQE  185



>emb|CBI35251.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/107 (84%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +3

Query  459  EDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRV  638
            ED VN VDQFLREALQNPRERLS+LRMEQD+EKFI DPTQQQ+EFQQLPTSYLRLAAHRV
Sbjct  4    EDSVNQVDQFLREALQNPRERLSILRMEQDIEKFIHDPTQQQLEFQQLPTSYLRLAAHRV  63

Query  639  AQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFP  779
            AQHYSLQS VL+D+++PDGS S+IIVRKTSECR+P IRLADIPV+ P
Sbjct  64   AQHYSLQSMVLLDNNLPDGSGSKIIVRKTSECRLPLIRLADIPVSLP  110



>ref|XP_010912260.1| PREDICTED: R3H domain-containing protein 1-like [Elaeis guineensis]
Length=474

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 136/188 (72%), Gaps = 14/188 (7%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapns---es  422
            M GSV   ED GAP ++WE+ADLD S+ RLMLSS   SN    L   +   A  +     
Sbjct  1    MAGSV---EDAGAP-DSWELADLDDSMSRLMLSSKKSSNPSTLLPSMTVEFAEEAPPPLD  56

Query  423  assssapasGVPE-------DIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQ  581
            + +SS+ ASG+ E       +I++ VDQFLREAL+ PRERLS+LRMEQD+EKFI +PTQQ
Sbjct  57   SVASSSFASGLAEGRREPSEEILSQVDQFLREALEKPRERLSILRMEQDIEKFIHNPTQQ  116

Query  582  QMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLAD  761
            ++EFQ LPTSYLRLAAHRVA+HY LQS  + D+ +PDGS SRI++RKTS+CR P +RLAD
Sbjct  117  ELEFQDLPTSYLRLAAHRVARHYYLQSMAMSDNIMPDGSGSRIVLRKTSDCRFPPVRLAD  176

Query  762  IPVTFPQD  785
            IPV  P++
Sbjct  177  IPVNLPRE  184



>ref|XP_008804807.1| PREDICTED: R3H domain-containing protein 2-like [Phoenix dactylifera]
 ref|XP_008804808.1| PREDICTED: R3H domain-containing protein 2-like [Phoenix dactylifera]
 ref|XP_008804809.1| PREDICTED: R3H domain-containing protein 2-like [Phoenix dactylifera]
 ref|XP_008804810.1| PREDICTED: R3H domain-containing protein 2-like [Phoenix dactylifera]
 ref|XP_008804811.1| PREDICTED: R3H domain-containing protein 2-like [Phoenix dactylifera]
 ref|XP_008804813.1| PREDICTED: R3H domain-containing protein 2-like [Phoenix dactylifera]
 ref|XP_008804814.1| PREDICTED: R3H domain-containing protein 2-like [Phoenix dactylifera]
 ref|XP_008804815.1| PREDICTED: R3H domain-containing protein 2-like [Phoenix dactylifera]
Length=469

 Score =   190 bits (482),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 136/184 (74%), Gaps = 10/184 (5%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSND-----SNAQCDLadsssasapns  416
            MEGS   A+DLG P ++WEVADLD S+ RL++SS  +     S+   +LAD ++ +   S
Sbjct  1    MEGS---ADDLGVP-DSWEVADLDESMSRLLVSSRKNPVPSVSSPPRELADEAAPATSAS  56

Query  417  esassssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQ  596
            + A+   +   GV ED V+ VD FL EAL+ PRERLS+LRMEQD+ KFI DPTQQQ+EFQ
Sbjct  57   QVAAKEDSGGRGVSEDAVSQVDPFLMEALEKPRERLSILRMEQDIVKFIHDPTQQQLEFQ  116

Query  597  QLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTS-ECRMPSIRLADIPVT  773
             LPTSYLRLAAHRVAQ+Y LQS  + DSS+PDGS SRI++RKTS EC +P IRLADIP+ 
Sbjct  117  GLPTSYLRLAAHRVAQYYYLQSLAVPDSSLPDGSGSRIVLRKTSHECCLPPIRLADIPIN  176

Query  774  FPQD  785
             PQ+
Sbjct  177  LPQE  180



>ref|XP_010522754.1| PREDICTED: uncharacterized protein LOC104801230 [Tarenaya hassleriana]
Length=468

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 139/173 (80%), Gaps = 4/173 (2%)
 Frame = +3

Query  267  SAAEDLGAPPETWEVADLDASVRRLMLSS--SNDSNAQCDLadsssasapnsesassssa  440
            S+ ED+G PPE+WE ADLDA++ RLMLSS  SND+    DL ++   +   +  +SSSS+
Sbjct  4    SSPEDIG-PPESWESADLDAALSRLMLSSTPSNDAAGTGDLPEAELPTQIQTSGSSSSSS  62

Query  441  pas-GVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYL  617
             +   + +D +N VDQFLREALQNPRERLSVLRMEQ+VEKFI D +QQQMEFQQLPTSYL
Sbjct  63   SSGDKILDDAINQVDQFLREALQNPRERLSVLRMEQEVEKFINDQSQQQMEFQQLPTSYL  122

Query  618  RLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTF  776
            RLAAHR+AQHY+LQS VL+D+S+P+GS  RIIV KTSECR P+IRLADIPV F
Sbjct  123  RLAAHRIAQHYNLQSMVLLDNSLPEGSGCRIIVHKTSECRRPAIRLADIPVNF  175



>ref|XP_009405301.1| PREDICTED: cAMP-regulated phosphoprotein 21-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405302.1| PREDICTED: cAMP-regulated phosphoprotein 21-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405303.1| PREDICTED: cAMP-regulated phosphoprotein 21-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405304.1| PREDICTED: cAMP-regulated phosphoprotein 21-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405305.1| PREDICTED: cAMP-regulated phosphoprotein 21-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009405307.1| PREDICTED: cAMP-regulated phosphoprotein 21-like [Musa acuminata 
subsp. malaccensis]
Length=472

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 129/186 (69%), Gaps = 12/186 (6%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasap-------  410
            MEGS   A D GAP ++WE+ADLDAS+ RL+LSS N S     L                
Sbjct  1    MEGS---AGDPGAP-DSWEMADLDASMSRLLLSSKNGSALSPSLEAEEEEEEEEAAAALD  56

Query  411  nsesassssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQME  590
             + ++ +S   A GVP D V  VDQFLREAL+ PRERL++LRMEQD+ KFI DPTQQQ+E
Sbjct  57   TTRASLASVDGAEGVPMDAVGQVDQFLREALEKPRERLAILRMEQDIVKFICDPTQQQLE  116

Query  591  FQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTS-ECRMPSIRLADIP  767
            FQ +P SYLRLAAHR+AQHY LQS  + D+S+PD S SRI+++KTS  CR P +RLADIP
Sbjct  117  FQAIPNSYLRLAAHRIAQHYYLQSVAIQDNSMPDVSGSRILMQKTSFSCRRPPVRLADIP  176

Query  768  VTFPQD  785
            V FPQ+
Sbjct  177  VNFPQE  182



>ref|XP_004496196.1| PREDICTED: R3H domain-containing protein 2-like isoform X1 [Cicer 
arietinum]
Length=451

 Score =   187 bits (474),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 116/160 (73%), Gaps = 8/160 (5%)
 Frame = +3

Query  306  EVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesassssapasGVPEDIVNSVDQ  485
            EVADL+ S  RL L+ S++ +   D           +    SSS   +   +D++N VDQ
Sbjct  14   EVADLNESTNRLKLTISSEPHDHAD--------DAPNSPPPSSSGGRNSFSDDVINQVDQ  65

Query  486  FLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQST  665
            FLREA+QNPRERLSVLRMEQDV+KFI DP QQQ+EFQQLPTSYLRLAAHRVAQHYSLQS 
Sbjct  66   FLREAIQNPRERLSVLRMEQDVQKFINDPNQQQLEFQQLPTSYLRLAAHRVAQHYSLQSM  125

Query  666  VLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            VL+D S+PDGS SRIIV KTS C+ P I LADIPV  P D
Sbjct  126  VLLDDSLPDGSGSRIIVHKTSGCKPPLIHLADIPVKLPSD  165



>ref|XP_004496197.1| PREDICTED: R3H domain-containing protein 2-like isoform X2 [Cicer 
arietinum]
Length=450

 Score =   186 bits (473),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 116/160 (73%), Gaps = 8/160 (5%)
 Frame = +3

Query  306  EVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesassssapasGVPEDIVNSVDQ  485
            EVADL+ S  RL L+ S++ +   D           +    SSS   +   +D++N VDQ
Sbjct  14   EVADLNESTNRLKLTISSEPHDHAD--------DAPNSPPPSSSGGRNSFSDDVINQVDQ  65

Query  486  FLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQST  665
            FLREA+QNPRERLSVLRMEQDV+KFI DP QQQ+EFQQLPTSYLRLAAHRVAQHYSLQS 
Sbjct  66   FLREAIQNPRERLSVLRMEQDVQKFINDPNQQQLEFQQLPTSYLRLAAHRVAQHYSLQSM  125

Query  666  VLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            VL+D S+PDGS SRIIV KTS C+ P I LADIPV  P D
Sbjct  126  VLLDDSLPDGSGSRIIVHKTSGCKPPLIHLADIPVKLPSD  165



>ref|XP_008783999.1| PREDICTED: uncharacterized protein LOC103703078 [Phoenix dactylifera]
Length=474

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 132/188 (70%), Gaps = 14/188 (7%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQ----------CDLadsssa  401
            MEGSV   ED GAP ++WE+ADLD S+ RLMLSS    +             + A     
Sbjct  1    MEGSV---EDPGAP-DSWELADLDDSMTRLMLSSKKGFDPSTPPPSMTVEFAEEAPPPPD  56

Query  402  sapnsesassssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQ  581
            S  +S SAS  +    G  E+ ++ VDQFLREAL  PRERLS+LRMEQD+EKFI++PTQQ
Sbjct  57   SVGSSSSASGLAERRRGPSEEELSEVDQFLREALDKPRERLSILRMEQDIEKFIRNPTQQ  116

Query  582  QMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLAD  761
            ++EFQ LPTSYLRLAAHR+A+HY LQS  + D+ +PDGS SRI++RKTS+CR P +RLAD
Sbjct  117  ELEFQDLPTSYLRLAAHRLARHYYLQSIAMSDNVMPDGSGSRIVLRKTSDCRFPPVRLAD  176

Query  762  IPVTFPQD  785
            IPV  P++
Sbjct  177  IPVNLPRE  184



>ref|XP_009384246.1| PREDICTED: R3H domain-containing protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 134/186 (72%), Gaps = 12/186 (6%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDL-------adsssasap  410
            MEGS   A+  GAP ++WE+ DLDAS+ RL+LSS     +            + + A+  
Sbjct  1    MEGS---ADGSGAP-DSWEMVDLDASMSRLLLSSKKSPASSPPPDALEEEEEEEAVAALG  56

Query  411  nsesassssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQME  590
             S S+S +S   +GVP D V+ VDQFLREAL+ PRERL++LRMEQD+ KFI DPTQQQ+E
Sbjct  57   LSRSSSDTSERVAGVPVDAVSQVDQFLREALEKPRERLAILRMEQDIVKFIHDPTQQQLE  116

Query  591  FQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTS-ECRMPSIRLADIP  767
            FQ LP SYLRLAAHRVAQHY LQS  ++D+S+PDGS SRI++RKTS  CRMP +RLADIP
Sbjct  117  FQTLPNSYLRLAAHRVAQHYYLQSFAILDNSLPDGSGSRILLRKTSTNCRMPPVRLADIP  176

Query  768  VTFPQD  785
            V  PQ+
Sbjct  177  VNLPQE  182



>ref|XP_010907139.1| PREDICTED: R3H domain-containing protein 1-like isoform X1 [Elaeis 
guineensis]
Length=472

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 131/188 (70%), Gaps = 17/188 (9%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQ----------CDLadsssa  401
            MEGS   AE+    P  WE+ADLD S+ RLMLSS   S++            + A     
Sbjct  1    MEGS---AEE----PGEWELADLDDSMFRLMLSSKKSSDSSTPPPSMAVDFAEEAPPPPD  53

Query  402  sapnsesassssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQ  581
            S  +S  +S  +    G  E++++ VDQFLREAL+ PRERLS+LRMEQDVEKFI+DPTQQ
Sbjct  54   SVASSSFSSGLAERRRGPSEEVLSQVDQFLREALEKPRERLSILRMEQDVEKFIRDPTQQ  113

Query  582  QMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLAD  761
            ++EF+ LPTSYLRLAAHR+AQHY LQS  + D+ +PDGS SRI++RKTS+CR P +RLAD
Sbjct  114  ELEFKDLPTSYLRLAAHRLAQHYYLQSIAMSDTIMPDGSGSRIVLRKTSDCRFPPVRLAD  173

Query  762  IPVTFPQD  785
            IPV  PQ+
Sbjct  174  IPVNLPQE  181



>ref|XP_010907140.1| PREDICTED: R3H domain-containing protein 1-like isoform X2 [Elaeis 
guineensis]
Length=458

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 131/188 (70%), Gaps = 17/188 (9%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQ----------CDLadsssa  401
            MEGS   AE+    P  WE+ADLD S+ RLMLSS   S++            + A     
Sbjct  1    MEGS---AEE----PGEWELADLDDSMFRLMLSSKKSSDSSTPPPSMAVDFAEEAPPPPD  53

Query  402  sapnsesassssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQ  581
            S  +S  +S  +    G  E++++ VDQFLREAL+ PRERLS+LRMEQDVEKFI+DPTQQ
Sbjct  54   SVASSSFSSGLAERRRGPSEEVLSQVDQFLREALEKPRERLSILRMEQDVEKFIRDPTQQ  113

Query  582  QMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLAD  761
            ++EF+ LPTSYLRLAAHR+AQHY LQS  + D+ +PDGS SRI++RKTS+CR P +RLAD
Sbjct  114  ELEFKDLPTSYLRLAAHRLAQHYYLQSIAMSDTIMPDGSGSRIVLRKTSDCRFPPVRLAD  173

Query  762  IPVTFPQD  785
            IPV  PQ+
Sbjct  174  IPVNLPQE  181



>ref|XP_010908184.1| PREDICTED: R3H domain-containing protein 1-like [Elaeis guineensis]
 ref|XP_010908185.1| PREDICTED: R3H domain-containing protein 1-like [Elaeis guineensis]
 ref|XP_010908186.1| PREDICTED: R3H domain-containing protein 1-like [Elaeis guineensis]
 ref|XP_010908187.1| PREDICTED: R3H domain-containing protein 1-like [Elaeis guineensis]
 ref|XP_010908188.1| PREDICTED: R3H domain-containing protein 1-like [Elaeis guineensis]
 ref|XP_010908190.1| PREDICTED: R3H domain-containing protein 1-like [Elaeis guineensis]
 ref|XP_010908191.1| PREDICTED: R3H domain-containing protein 1-like [Elaeis guineensis]
 ref|XP_010908192.1| PREDICTED: R3H domain-containing protein 1-like [Elaeis guineensis]
 ref|XP_010908193.1| PREDICTED: R3H domain-containing protein 1-like [Elaeis guineensis]
Length=468

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 134/185 (72%), Gaps = 14/185 (8%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSND-----SNAQCDLadsssasapns  416
            MEGS   A+ LG    +WE+ADLD S+ RL++SS        S+   +LA+ +   A ++
Sbjct  1    MEGS---ADVLG----SWEMADLDESMSRLLVSSQKTPSPLASSPSQELAEEAPPPAASA  53

Query  417  esassssapasG-VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEF  593
               +++S+   G V ED V+ VD FLREAL+ PRERLS+LRMEQDV KFI++PTQQQ+EF
Sbjct  54   SQVAAASSGRGGEVLEDAVSQVDGFLREALEKPRERLSILRMEQDVVKFIRNPTQQQLEF  113

Query  594  QQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTS-ECRMPSIRLADIPV  770
            Q LPTSYLRLAAHRVAQHY LQS  + DSS+PDGS S I++RKTS EC +P IRLADIPV
Sbjct  114  QGLPTSYLRLAAHRVAQHYYLQSLAVPDSSLPDGSGSCIVLRKTSHECCLPPIRLADIPV  173

Query  771  TFPQD  785
              PQ+
Sbjct  174  NLPQE  178



>ref|XP_003576865.1| PREDICTED: R3H domain-containing protein 2-like [Brachypodium 
distachyon]
Length=464

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 119/165 (72%), Gaps = 5/165 (3%)
 Frame = +3

Query  294  PETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesassssapasGVPEDIVN  473
            P++WE ADLD ++ RL+LS+   +++     D   A+   +       A A    +D+V 
Sbjct  12   PDSWETADLDGAMSRLLLSARRVNSSPDLADDDDPAANAAAVQPQQPPARA----DDLVA  67

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
             VDQFLREAL+ PRERLSVLRMEQD+ KFI DP Q Q EFQ LPTSYLRLAAHR+AQHY 
Sbjct  68   QVDQFLREALEKPRERLSVLRMEQDILKFIHDPRQTQFEFQGLPTSYLRLAAHRLAQHYF  127

Query  654  LQSTVLVDSSVPDGSASRIIVRKT-SECRMPSIRLADIPVTFPQD  785
            LQS  L D+S+PDG++SRII+RKT  ECR+P+IRLADIPV  PQ+
Sbjct  128  LQSIALPDNSLPDGTSSRIILRKTLPECRLPAIRLADIPVNLPQE  172



>ref|XP_008788209.1| PREDICTED: R3H domain-containing protein 2-like [Phoenix dactylifera]
Length=470

 Score =   168 bits (425),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 97/187 (52%), Positives = 128/187 (68%), Gaps = 16/187 (9%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapns-----  416
            MEGS   AED    P  WE+AD+D S+ RLMLSS   S++      ++   A  +     
Sbjct  1    MEGS---AED----PGEWELADVDDSMFRLMLSSKKSSDSSTPPPSTAGDFAEEAPPLPD  53

Query  417  ----esassssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQ  584
                 S+S  +    G  E++++ VDQFLREAL+ PRERLS+LRMEQD+EKFI D TQ++
Sbjct  54   SVASSSSSGLAERRRGPSEEVLSQVDQFLREALEKPRERLSILRMEQDIEKFICDHTQRE  113

Query  585  MEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADI  764
            +EF+ LPTSYLRLAAHR+AQH+ LQS  + D+ +PDGS SRI++ KTS+CR P +RLADI
Sbjct  114  LEFKDLPTSYLRLAAHRLAQHFYLQSIAMSDTIMPDGSGSRIVLHKTSDCRFPPVRLADI  173

Query  765  PVTFPQD  785
            PV  PQ+
Sbjct  174  PVNLPQE  180



>ref|XP_003591775.1| R3H domain-containing protein [Medicago truncatula]
 gb|AES62026.1| single-stranded nucleic acid-binding protein R3H [Medicago truncatula]
Length=435

 Score =   166 bits (421),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/158 (57%), Positives = 112/158 (71%), Gaps = 11/158 (7%)
 Frame = +3

Query  312  ADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesassssapasGVPEDIVNSVDQFL  491
            ADL+ S+ RL L+ S+D ++        +   P+S              +D +N VDQFL
Sbjct  4    ADLNESMNRLNLTISSDKDSNSHQHADDAPIPPSSSGG-----------DDAINQVDQFL  52

Query  492  REALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVL  671
             +A+QNPR+RLS+LR+EQDV KFI+DP QQQ+EFQQLPTSYLRLAAHRVAQHYSLQS VL
Sbjct  53   LDAIQNPRQRLSILRLEQDVVKFIQDPNQQQLEFQQLPTSYLRLAAHRVAQHYSLQSMVL  112

Query  672  VDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            +D S+PD S S+IIV KTS C+ P IRLADIPV  P +
Sbjct  113  LDYSLPDDSGSQIIVHKTSGCKPPLIRLADIPVKLPSE  150



>ref|XP_008670037.1| PREDICTED: uncharacterized protein LOC103647263 [Zea mays]
 tpg|DAA39610.1| TPA: hypothetical protein ZEAMMB73_242839 [Zea mays]
 tpg|DAA39611.1| TPA: hypothetical protein ZEAMMB73_242839 [Zea mays]
Length=463

 Score =   167 bits (422),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 116/163 (71%), Gaps = 1/163 (1%)
 Frame = +3

Query  300  TWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesassssapasGVPEDIVNSV  479
            +WE AD+D  + RL+LS+   S++     D      P +     + +  S   ED+V  V
Sbjct  15   SWETADIDGPMSRLILSARRVSSSPDFADDQDPPQPPPTLQPQGAPSAPSDAREDVVAQV  74

Query  480  DQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQ  659
            DQFLREAL+ PRERLSVLRMEQ++ KFI DP++ + EF  LPTSYLRLAAHR+AQHY LQ
Sbjct  75   DQFLREALEKPRERLSVLRMEQEILKFIHDPSRTEYEFNGLPTSYLRLAAHRLAQHYFLQ  134

Query  660  STVLVDSSVPDGSASRIIVRKTS-ECRMPSIRLADIPVTFPQD  785
            S  + D+S+PDG+ SRII+RKT+ +CR+P++RLADIPV  PQ+
Sbjct  135  SIAIPDNSLPDGTGSRIILRKTTFDCRLPAVRLADIPVNLPQE  177



>ref|XP_006661565.1| PREDICTED: R3H domain-containing protein 1-like [Oryza brachyantha]
Length=425

 Score =   166 bits (420),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +3

Query  456  PEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHR  635
            P D V+ +DQFLREAL+ PRERLSVLRMEQD+ KFI DP Q Q EF  LPTSYLRLAAHR
Sbjct  24   PHDSVDQLDQFLREALEKPRERLSVLRMEQDILKFIHDPRQTQFEFHGLPTSYLRLAAHR  83

Query  636  VAQHYSLQSTVLVDSSVPDGSASRIIVRKT-SECRMPSIRLADIPVTFPQD  785
            +AQHY LQS  L D+ +PDGS SRII+RKT SECR+P++RL+DIPV  PQD
Sbjct  84   LAQHYFLQSIALQDNGLPDGSGSRIILRKTSSECRLPAVRLSDIPVNLPQD  134



>ref|XP_004956208.1| PREDICTED: R3H domain-containing protein 2-like [Setaria italica]
Length=465

 Score =   165 bits (417),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 114/163 (70%), Gaps = 3/163 (2%)
 Frame = +3

Query  300  TWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesassssapasGVPEDIVNSV  479
            +WE AD+D  + RL+LS+   S++  DLA+        + +            +D    V
Sbjct  15   SWETADIDGPMSRLILSARRVSSS-PDLAEEQQQQDLPAPTQPQQGPAPPPR-DDSAAQV  72

Query  480  DQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQ  659
            DQFLREAL+ PRERLSVLRMEQD+ KFI+DP Q Q EF  LPTSYLRLAAHR+AQHY LQ
Sbjct  73   DQFLREALEKPRERLSVLRMEQDILKFIRDPRQTQFEFPALPTSYLRLAAHRLAQHYFLQ  132

Query  660  STVLVDSSVPDGSASRIIVRK-TSECRMPSIRLADIPVTFPQD  785
            S  + D+S+PDG+ SRII+RK +SECR+P++RLADIPV  PQ+
Sbjct  133  SIAIPDNSLPDGTGSRIILRKMSSECRLPAVRLADIPVNLPQE  175



>dbj|BAD46211.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG91112.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE70260.1| hypothetical protein OsJ_30394 [Oryza sativa Japonica Group]
Length=455

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 113/164 (69%), Gaps = 11/164 (7%)
 Frame = +3

Query  297  ETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesassssapasGVPEDIVNS  476
            ++WE ADLD  + RL L S+            SS+       A     P+SG P D V+ 
Sbjct  10   DSWETADLDEPMSRLHLPSA---------RRVSSSPDLADADADDPQHPSSGRP-DSVDQ  59

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            +DQFLREAL+ PRERLSVLRMEQD+ KFI DPTQ + +F  LPTSYLRLAAHR+AQHY L
Sbjct  60   LDQFLREALEKPRERLSVLRMEQDILKFIHDPTQTEFDFHGLPTSYLRLAAHRLAQHYFL  119

Query  657  QSTVLVDSSVPDGSASRIIVRKTS-ECRMPSIRLADIPVTFPQD  785
            QS  L D+ +PDGS SRII+RKTS ECR+P++RL+DI V  PQD
Sbjct  120  QSIALQDNGLPDGSGSRIILRKTSAECRLPAVRLSDIQVNLPQD  163



>ref|XP_008671174.1| PREDICTED: LOW QUALITY PROTEIN: R3H domain-containing protein 
2-like [Zea mays]
Length=277

 Score =   158 bits (400),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 93/112 (83%), Gaps = 1/112 (1%)
 Frame = +3

Query  453  VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAH  632
            V E +V  VDQFLREAL+ PRERLSVLRMEQ++ KFI DP++ + EF  LPTSYLRLAAH
Sbjct  32   VCEGLVAQVDQFLREALEKPRERLSVLRMEQEILKFIHDPSRTEYEFNGLPTSYLRLAAH  91

Query  633  RVAQHYSLQSTVLVDSSVPDGSASRIIVRKTS-ECRMPSIRLADIPVTFPQD  785
            R+AQHY LQS  + D+S+PDG+ SRII+RKT+ +CR+P++RLADIPV  PQ+
Sbjct  92   RLAQHYFLQSIAIPDNSLPDGTGSRIILRKTTFDCRLPAVRLADIPVNLPQE  143



>dbj|BAJ97314.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=468

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 91/107 (85%), Gaps = 1/107 (1%)
 Frame = +3

Query  468  VNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQH  647
            V  VDQFLREAL+ PRERLSVLRMEQD+ KF++DP Q Q EFQ LPTSYLRLAAHR+AQH
Sbjct  66   VAQVDQFLREALEKPRERLSVLRMEQDILKFLRDPGQTQFEFQGLPTSYLRLAAHRLAQH  125

Query  648  YSLQSTVLVDSSVPDGSASRIIVRKTS-ECRMPSIRLADIPVTFPQD  785
            Y L S  L D+S+PDG++SRII+RKTS ECR+P++RLADIPV  PQ+
Sbjct  126  YFLISIALPDNSLPDGTSSRIILRKTSAECRLPAVRLADIPVNLPQE  172



>ref|XP_008652492.1| PREDICTED: cAMP-regulated phosphoprotein 21-like isoform X4 [Zea 
mays]
Length=450

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 110/163 (67%), Gaps = 1/163 (1%)
 Frame = +3

Query  300  TWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesassssapasGVPEDIVNSV  479
            +WE AD+D  + RL+LS+   S++     +      P +       +  S   ED++  V
Sbjct  15   SWESADIDGPISRLILSARRVSSSPDLADNPDPPQPPPALQPQGPPSVPSAAREDLMAQV  74

Query  480  DQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQ  659
            DQFLREAL+ PRERLSVLRMEQ++ KFI DP   + EF  LPTSYLRLAAHR+AQHY LQ
Sbjct  75   DQFLREALEKPRERLSVLRMEQEILKFIGDPRFTEYEFNGLPTSYLRLAAHRLAQHYFLQ  134

Query  660  STVLVDSSVPDGSASRIIVRKT-SECRMPSIRLADIPVTFPQD  785
            S  + D+S+PDG+ S II+RKT SEC++P + LADIPV  PQ+
Sbjct  135  SIAIPDNSLPDGTGSHIILRKTSSECQLPDVCLADIPVNLPQE  177



>ref|XP_008652488.1| PREDICTED: cAMP-regulated phosphoprotein 21-like isoform X2 [Zea 
mays]
 ref|XP_008652489.1| PREDICTED: cAMP-regulated phosphoprotein 21-like isoform X2 [Zea 
mays]
 ref|XP_008652490.1| PREDICTED: cAMP-regulated phosphoprotein 21-like isoform X2 [Zea 
mays]
Length=468

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 110/163 (67%), Gaps = 1/163 (1%)
 Frame = +3

Query  300  TWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesassssapasGVPEDIVNSV  479
            +WE AD+D  + RL+LS+   S++     +      P +       +  S   ED++  V
Sbjct  15   SWESADIDGPISRLILSARRVSSSPDLADNPDPPQPPPALQPQGPPSVPSAAREDLMAQV  74

Query  480  DQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQ  659
            DQFLREAL+ PRERLSVLRMEQ++ KFI DP   + EF  LPTSYLRLAAHR+AQHY LQ
Sbjct  75   DQFLREALEKPRERLSVLRMEQEILKFIGDPRFTEYEFNGLPTSYLRLAAHRLAQHYFLQ  134

Query  660  STVLVDSSVPDGSASRIIVRKT-SECRMPSIRLADIPVTFPQD  785
            S  + D+S+PDG+ S II+RKT SEC++P + LADIPV  PQ+
Sbjct  135  SIAIPDNSLPDGTGSHIILRKTSSECQLPDVCLADIPVNLPQE  177



>ref|XP_008652491.1| PREDICTED: cAMP-regulated phosphoprotein 21-like isoform X3 [Zea 
mays]
 tpg|DAA60787.1| TPA: hypothetical protein ZEAMMB73_972810 [Zea mays]
 tpg|DAA60788.1| TPA: hypothetical protein ZEAMMB73_972810 [Zea mays]
Length=466

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 110/163 (67%), Gaps = 1/163 (1%)
 Frame = +3

Query  300  TWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesassssapasGVPEDIVNSV  479
            +WE AD+D  + RL+LS+   S++     +      P +       +  S   ED++  V
Sbjct  15   SWESADIDGPISRLILSARRVSSSPDLADNPDPPQPPPALQPQGPPSVPSAAREDLMAQV  74

Query  480  DQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQ  659
            DQFLREAL+ PRERLSVLRMEQ++ KFI DP   + EF  LPTSYLRLAAHR+AQHY LQ
Sbjct  75   DQFLREALEKPRERLSVLRMEQEILKFIGDPRFTEYEFNGLPTSYLRLAAHRLAQHYFLQ  134

Query  660  STVLVDSSVPDGSASRIIVRKT-SECRMPSIRLADIPVTFPQD  785
            S  + D+S+PDG+ S II+RKT SEC++P + LADIPV  PQ+
Sbjct  135  SIAIPDNSLPDGTGSHIILRKTSSECQLPDVCLADIPVNLPQE  177



>ref|XP_008652487.1| PREDICTED: cAMP-regulated phosphoprotein 21-like isoform X1 [Zea 
mays]
Length=515

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 110/163 (67%), Gaps = 1/163 (1%)
 Frame = +3

Query  300  TWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesassssapasGVPEDIVNSV  479
            +WE AD+D  + RL+LS+   S++     +      P +       +  S   ED++  V
Sbjct  15   SWESADIDGPISRLILSARRVSSSPDLADNPDPPQPPPALQPQGPPSVPSAAREDLMAQV  74

Query  480  DQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQ  659
            DQFLREAL+ PRERLSVLRMEQ++ KFI DP   + EF  LPTSYLRLAAHR+AQHY LQ
Sbjct  75   DQFLREALEKPRERLSVLRMEQEILKFIGDPRFTEYEFNGLPTSYLRLAAHRLAQHYFLQ  134

Query  660  STVLVDSSVPDGSASRIIVRKT-SECRMPSIRLADIPVTFPQD  785
            S  + D+S+PDG+ S II+RKT SEC++P + LADIPV  PQ+
Sbjct  135  SIAIPDNSLPDGTGSHIILRKTSSECQLPDVCLADIPVNLPQE  177



>gb|KJB73375.1| hypothetical protein B456_011G230000 [Gossypium raimondii]
Length=428

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 111/178 (62%), Gaps = 40/178 (22%)
 Frame = +3

Query  252  MEGSVSAAEDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesass  431
            MEGSV   EDLGAP ++WEVADLDA++ RLMLSS+ +S  +             S +++S
Sbjct  1    MEGSV--VEDLGAP-DSWEVADLDATMSRLMLSSNKESKPEF--------PDATSSASAS  49

Query  432  ssapasGVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTS  611
             S     V ED +N VDQFLREA+QNPRERLS+LRMEQDVEKFI+DP QQQ EFQQLPTS
Sbjct  50   GSPDEKVVSEDAINEVDQFLREAIQNPRERLSILRMEQDVEKFIRDPNQQQFEFQQLPTS  109

Query  612  YLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            YL                             RIIV KTSECR+P IRLADIPV  P +
Sbjct  110  YL-----------------------------RIIVCKTSECRLPRIRLADIPVNLPSE  138



>gb|EMT03819.1| 60S ribosomal protein L10a-2 [Aegilops tauschii]
Length=855

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 110/183 (60%), Gaps = 34/183 (19%)
 Frame = +3

Query  294  PETWEVADLDASV-------------RRLMLSSSNDSNAQCDLadsssasapnsesasss  434
            P++WE ADLD ++             RR+  S     + Q D                  
Sbjct  15   PDSWETADLDGAMSRLLLSSSSGGAARRVSSSPDLADDRQADAQQEEGQQQRA-------  67

Query  435  sapasGVPEDIVNSVDQFLREALQNPRERL-----SVLRMEQDVEKFIKDPTQQQMEFQQ  599
                    +D    VDQFLREAL+ PRERL     +VLRMEQD+ KF++DP Q Q EFQ 
Sbjct  68   --------DDPAAQVDQFLREALEKPRERLQGDRIAVLRMEQDILKFLRDPGQTQFEFQG  119

Query  600  LPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTS-ECRMPSIRLADIPVTF  776
            LPTSYLRLAAHR+AQHY L S  L D+S+PDG++SRII+RKTS ECR+P++RLADIPV  
Sbjct  120  LPTSYLRLAAHRLAQHYFLISIALPDNSLPDGTSSRIILRKTSAECRLPAVRLADIPVNL  179

Query  777  PQD  785
            PQ+
Sbjct  180  PQE  182



>gb|KGN52193.1| hypothetical protein Csa_5G615180 [Cucumis sativus]
Length=373

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/81 (83%), Positives = 76/81 (94%), Gaps = 0/81 (0%)
 Frame = +3

Query  537  MEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIV  716
            MEQDVEKFI+DP +QQ+EFQQLPTSYLRLAAHRVAQHYSLQS VL+D+S+PDGS S+IIV
Sbjct  1    MEQDVEKFIRDPARQQLEFQQLPTSYLRLAAHRVAQHYSLQSMVLLDNSLPDGSGSKIIV  60

Query  717  RKTSECRMPSIRLADIPVTFP  779
            RKTSECR+P+IRLADIPV  P
Sbjct  61   RKTSECRLPTIRLADIPVNLP  81



>emb|CAN60634.1| hypothetical protein VITISV_041705 [Vitis vinifera]
Length=408

 Score =   146 bits (369),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +3

Query  537  MEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIV  716
            MEQD+EKFI DPTQQQ+EFQQLPTSYLRLAAHRVAQHYSLQS VL+D+++PDGS S+IIV
Sbjct  1    MEQDIEKFIHDPTQQQLEFQQLPTSYLRLAAHRVAQHYSLQSMVLLDNNLPDGSGSKIIV  60

Query  717  RKTSECRMPSIRLADIPVTFPQD  785
            RKTSECR+P IRLADIPV+ P +
Sbjct  61   RKTSECRLPLIRLADIPVSLPPE  83



>gb|KJB73376.1| hypothetical protein B456_011G230000 [Gossypium raimondii]
Length=373

 Score =   142 bits (359),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +3

Query  537  MEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIV  716
            MEQDVEKFI+DP QQQ EFQQLPTSYLRLAAHR+AQHYSLQS VL+D+++PDGS SRIIV
Sbjct  1    MEQDVEKFIRDPNQQQFEFQQLPTSYLRLAAHRIAQHYSLQSMVLLDNNLPDGSGSRIIV  60

Query  717  RKTSECRMPSIRLADIPVTFPQD  785
             KTSECR+P IRLADIPV  P +
Sbjct  61   CKTSECRLPRIRLADIPVNLPSE  83



>ref|XP_001770349.1| predicted protein [Physcomitrella patens]
 gb|EDQ64839.1| predicted protein [Physcomitrella patens]
Length=465

 Score =   138 bits (348),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 76/165 (46%), Positives = 110/165 (67%), Gaps = 4/165 (2%)
 Frame = +3

Query  276  EDLGAPPETWEVADLDASVRRLMLSSSNDSNAQCDLadsssasapnsesassssapasGV  455
            E+  + PE+WE+ DL+ ++++L L+SS  +++Q  +    +       +        +  
Sbjct  13   EEESSAPESWEMVDLEENMKKL-LASSEIASSQVSVEPCITNDGNGVTTGLLPFRTDAAD  71

Query  456  PEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHR  635
                 + VD FL+EALQNPR+RL++LR+EQ+VE+FI++P+ Q +EFQ +P+SYLRLAAHR
Sbjct  72   AARGPDQVDGFLKEALQNPRDRLTILRLEQEVERFIRNPSLQVLEFQPMPSSYLRLAAHR  131

Query  636  VAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            VAQHY LQS V VD    +G   RI+ RKTSE R PS+RL DIPV
Sbjct  132  VAQHYYLQSMV-VDGGSAEG--MRIVARKTSETRFPSLRLVDIPV  173



>ref|XP_001767100.1| predicted protein [Physcomitrella patens]
 gb|EDQ68021.1| predicted protein [Physcomitrella patens]
Length=659

 Score =   135 bits (340),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/162 (48%), Positives = 112/162 (69%), Gaps = 12/162 (7%)
 Frame = +3

Query  297  ETWEVADLDASVRRLM----LSSSNDSNAQCDLadsssasapnsesassssapasGVPED  464
            E+WE+ DL  ++++L+    ++SS  S   C  ++S+  +       + S   ASG    
Sbjct  185  ESWEMVDLKVNMKKLLSTSQVASSQVSAEACIASESNGLTTELLPFRTDSIDAASGP---  241

Query  465  IVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQ  644
              + VD FL+EALQNPR+RL++LR+EQ+VE+FI++P+ Q +EFQ +P+SYLRLAAHRVAQ
Sbjct  242  --DQVDGFLKEALQNPRDRLTILRLEQEVERFIRNPSLQILEFQPMPSSYLRLAAHRVAQ  299

Query  645  HYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            HY+LQS V VD    +G  +RI+ +KTSE R PS+RL DIPV
Sbjct  300  HYNLQSMV-VDGGSAEG--TRIVAKKTSETRFPSLRLVDIPV  338



>ref|XP_010543660.1| PREDICTED: R3H domain-containing protein 2-like [Tarenaya hassleriana]
Length=328

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 81/111 (73%), Gaps = 2/111 (2%)
 Frame = +3

Query  453  VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAH  632
             P +    +D FL EALQNPR RL++LRME +V++F++DP QQQ EFQ  PTSYLRLAAH
Sbjct  3    APGEKETMLDPFLFEALQNPRHRLTILRMELEVQRFLQDPDQQQFEFQHYPTSYLRLAAH  62

Query  633  RVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            RVAQHY L    +V  S  DG  +RI+VRKT+E R P +RL++IPV  P++
Sbjct  63   RVAQHYGL--VTMVTDSGSDGPGNRILVRKTAETRYPLVRLSEIPVKQPEN  111



>ref|XP_006398970.1| hypothetical protein EUTSA_v10014404mg [Eutrema salsugineum]
 gb|ESQ40423.1| hypothetical protein EUTSA_v10014404mg [Eutrema salsugineum]
Length=266

 Score =   129 bits (323),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF + P QQQ EF+ LPTSYLRLAAHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLAILRMELDIQKFYQSPEQQQFEFRPLPTSYLRLAAHRVAQHYGL  70

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
             +T L DS   DGS +RI+V KT+E R P + L++IPV  P+
Sbjct  71   FTTAL-DSGALDGSGNRILVTKTAESRYPYVCLSEIPVKQPE  111



>ref|XP_010525439.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104803234 
[Tarenaya hassleriana]
Length=376

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 81/102 (79%), Gaps = 2/102 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+++P QQQ EFQ  PTSYLRLAAHR+A HY L
Sbjct  26   VDPFLVEALQNPRHRLTILRMELDIQRFLQNPEQQQFEFQPFPTSYLRLAAHRIAHHYGL  85

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
             +TVL D  + DG+ +RI+VRKT+E R P++RL++IP   P+
Sbjct  86   VTTVL-DCGL-DGNGNRILVRKTAESRFPAVRLSEIPAKQPE  125



>ref|XP_010504574.1| PREDICTED: R3H domain-containing protein 1-like [Camelina sativa]
Length=360

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            + D FL EALQNPR RL++LRME DV++F+++P QQQ EFQ  PTSYLRLAAHRVA HY 
Sbjct  23   NADPFLVEALQNPRHRLTILRMELDVQRFLQNPEQQQFEFQHFPTSYLRLAAHRVANHYG  82

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            L + VL DS   DG+ +RI+V KT+E R P++RL++IPV  P +
Sbjct  83   LATAVL-DSGA-DGNENRILVTKTAESRFPAVRLSEIPVAKPSE  124



>ref|XP_011652165.1| PREDICTED: uncharacterized protein LOC101215817 isoform X2 [Cucumis 
sativus]
Length=345

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF+ +P QQ  EFQ  PTSYLRLAAHRVAQHY L
Sbjct  20   VDPFLVEALQNPRHRLTILRMELDIQKFLHNPDQQLFEFQHFPTSYLRLAAHRVAQHYGL  79

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ DS + DG  +RI+VRK +E R+PS+RL++IP 
Sbjct  80   Q-TMVQDSGI-DGFGNRIVVRKMAENRLPSVRLSEIPA  115



>ref|XP_004136625.2| PREDICTED: uncharacterized protein LOC101215817 isoform X1 [Cucumis 
sativus]
 gb|KGN59412.1| hypothetical protein Csa_3G817720 [Cucumis sativus]
Length=354

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF+ +P QQ  EFQ  PTSYLRLAAHRVAQHY L
Sbjct  20   VDPFLVEALQNPRHRLTILRMELDIQKFLHNPDQQLFEFQHFPTSYLRLAAHRVAQHYGL  79

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ DS + DG  +RI+VRK +E R+PS+RL++IP 
Sbjct  80   Q-TMVQDSGI-DGFGNRIVVRKMAENRLPSVRLSEIPA  115



>ref|XP_006292703.1| hypothetical protein CARUB_v10018949mg [Capsella rubella]
 gb|EOA25601.1| hypothetical protein CARUB_v10018949mg [Capsella rubella]
Length=355

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = +3

Query  462  DIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVA  641
            D   SVD FL EALQNPR RL++LRME DV++F+++P QQQ EFQ  PTSYLRLAAHRVA
Sbjct  19   DYGFSVDPFLVEALQNPRHRLTILRMELDVQRFLQNPEQQQFEFQHFPTSYLRLAAHRVA  78

Query  642  QHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             HY L     V  S  DG+ +RI+V KT+E + P++RL++IPV  P +
Sbjct  79   NHYGL--VTAVQDSGADGNENRILVTKTTESKFPAVRLSEIPVAKPSE  124



>ref|XP_010427506.1| PREDICTED: R3H domain-containing protein 1-like [Camelina sativa]
Length=361

 Score =   129 bits (324),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 80/104 (77%), Gaps = 2/104 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            + D FL EALQNPR RL++LRME DV++F+++P QQQ EFQ  PTSYLRLAAHRVA HY 
Sbjct  23   NADPFLVEALQNPRHRLTILRMELDVQRFLQNPEQQQFEFQHFPTSYLRLAAHRVANHYG  82

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            L +T + DS   DG+ +RI+V KT+E R P++RL++IPV  P +
Sbjct  83   L-ATAVQDSGA-DGNENRILVTKTAESRFPAVRLSEIPVAKPSE  124



>ref|XP_009339978.1| PREDICTED: R3H domain-containing protein 2-like [Pyrus x bretschneideri]
Length=353

 Score =   129 bits (323),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+K P QQ  EFQ  PTSYLRLAAHRV+QHY L
Sbjct  21   VDPFLVEALQNPRHRLTILRMELDIQRFLKSPDQQLFEFQHFPTSYLRLAAHRVSQHYGL  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q+  +V    PDG  +RI+VRKT+E + P+I+L++IP 
Sbjct  81   QT--MVQDGGPDGQGNRILVRKTAESKYPAIQLSEIPA  116



>ref|XP_008443221.1| PREDICTED: R3H domain-containing protein 2-like isoform X2 [Cucumis 
melo]
Length=354

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF+ +P QQ  EFQ  PTSYLRLAAHRVAQHY L
Sbjct  20   VDPFLVEALQNPRHRLTILRMELDIQKFLNNPDQQLFEFQHFPTSYLRLAAHRVAQHYGL  79

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ DS + DG  +RI+VRK  E R+PS+RL++IP 
Sbjct  80   Q-TMVQDSGI-DGFGNRIVVRKMVENRLPSVRLSEIPA  115



>ref|XP_008443220.1| PREDICTED: R3H domain-containing protein 2-like isoform X1 [Cucumis 
melo]
Length=372

 Score =   128 bits (322),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF+ +P QQ  EFQ  PTSYLRLAAHRVAQHY L
Sbjct  20   VDPFLVEALQNPRHRLTILRMELDIQKFLNNPDQQLFEFQHFPTSYLRLAAHRVAQHYGL  79

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ DS + DG  +RI+VRK  E R+PS+RL++IP 
Sbjct  80   Q-TMVQDSGI-DGFGNRIVVRKMVENRLPSVRLSEIPA  115



>ref|XP_010111099.1| R3H domain-containing protein 1 [Morus notabilis]
 gb|EXC30128.1| R3H domain-containing protein 1 [Morus notabilis]
Length=383

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+ +  QQQ EFQ  PTSYLRLAAHRVAQHY L
Sbjct  20   VDPFLVEALQNPRHRLTILRMELDIQRFLHNSDQQQFEFQHFPTSYLRLAAHRVAQHYGL  79

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ DS   DG  ++I+VRKT+E R PS+RL++IP 
Sbjct  80   Q-TMVQDSGF-DGQGNKILVRKTAESRYPSVRLSEIPA  115



>ref|XP_010247210.1| PREDICTED: R3H domain-containing protein 2 [Nelumbo nucifera]
Length=357

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 78/102 (76%), Gaps = 2/102 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL+EALQNPR RL+VLRME D++KF+++P Q+Q EFQ  PTSYLRLAAHRVAQHY L
Sbjct  25   VDPFLKEALQNPRHRLTVLRMELDIQKFMQNPDQKQFEFQHFPTSYLRLAAHRVAQHYGL  84

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
            QS V+   +V DG   RI+V KTSE R P++ L++I    P+
Sbjct  85   QSMVM--DNVSDGLGIRIVVTKTSESRFPAVCLSEITAKQPE  124



>ref|XP_010055671.1| PREDICTED: R3H domain-containing protein 1 [Eucalyptus grandis]
 gb|KCW90005.1| hypothetical protein EUGRSUZ_A02200 [Eucalyptus grandis]
Length=361

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 76/105 (72%), Gaps = 2/105 (2%)
 Frame = +3

Query  456  PEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHR  635
            P D    VD FL EALQNPR RL++LRME DV KFI++  QQ  EFQ  PTSYLRLAAHR
Sbjct  18   PNDKEAMVDPFLVEALQNPRHRLTILRMELDVRKFIQNTGQQHFEFQHFPTSYLRLAAHR  77

Query  636  VAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            VAQHY LQ+  +V     DG+ +RI+V KT+  R+P++RL+DIP 
Sbjct  78   VAQHYGLQT--MVQEGGLDGNGNRILVIKTAGSRLPAVRLSDIPA  120



>ref|XP_002283240.1| PREDICTED: R3H domain-containing protein 2 [Vitis vinifera]
 ref|XP_010653643.1| PREDICTED: R3H domain-containing protein 2 [Vitis vinifera]
 emb|CAN73572.1| hypothetical protein VITISV_007445 [Vitis vinifera]
 emb|CBI32816.3| unnamed protein product [Vitis vinifera]
Length=356

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = +3

Query  450  GVPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAA  629
              P D  + VD FL EALQNPR RL++LRME D+++F+++P QQQ EFQ  PTSYLRLAA
Sbjct  12   ATPGDKESMVDPFLVEALQNPRHRLTILRMELDIQRFLQNPDQQQFEFQHFPTSYLRLAA  71

Query  630  HRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            HRVA HY LQ T++ D+SV DG A+RI+V KT+E R P+I L++IP 
Sbjct  72   HRVALHYGLQ-TMVQDNSV-DGLANRIVVMKTAESRCPAICLSEIPA  116



>ref|XP_010243833.1| PREDICTED: R3H domain-containing protein 1-like isoform X2 [Nelumbo 
nucifera]
Length=348

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = +3

Query  465  IVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQ  644
            +++ VD FL+EAL+NPR R +VLRME D+++F+++P QQ+ EF   PTSYLRLAAHRVAQ
Sbjct  20   VISMVDSFLKEALENPRHRFTVLRMELDIQRFMQNPDQQKFEFSHFPTSYLRLAAHRVAQ  79

Query  645  HYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            HY L + V+   ++ DG  +RIIVRKT+E R P++ L++IP+
Sbjct  80   HYGLHTMVM--DNLIDGQGTRIIVRKTAESRYPAVCLSEIPL  119



>ref|XP_002873193.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49452.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
Length=324

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 75/102 (74%), Gaps = 1/102 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF + P QQQ EFQ LPTSYLRL AHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQSPEQQQYEFQPLPTSYLRLIAHRVAQHYGL  70

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
             +T L    V DGS +RI+  KT+E R P + L++IPV  P+
Sbjct  71   FTTALDGGGV-DGSGNRILATKTAESRYPYVCLSEIPVKQPE  111



>ref|XP_010243832.1| PREDICTED: R3H domain-containing protein 1-like isoform X1 [Nelumbo 
nucifera]
Length=355

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 80/102 (78%), Gaps = 2/102 (2%)
 Frame = +3

Query  465  IVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQ  644
            +++ VD FL+EAL+NPR R +VLRME D+++F+++P QQ+ EF   PTSYLRLAAHRVAQ
Sbjct  20   VISMVDSFLKEALENPRHRFTVLRMELDIQRFMQNPDQQKFEFSHFPTSYLRLAAHRVAQ  79

Query  645  HYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            HY L + V+   ++ DG  +RIIVRKT+E R P++ L++IP+
Sbjct  80   HYGLHTMVM--DNLIDGQGTRIIVRKTAESRYPAVCLSEIPL  119



>ref|XP_006288222.1| hypothetical protein CARUB_v10001459mg [Capsella rubella]
 gb|EOA21120.1| hypothetical protein CARUB_v10001459mg [Capsella rubella]
Length=323

 Score =   125 bits (315),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 75/102 (74%), Gaps = 1/102 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF + P QQQ EFQ LPTSYLRL AHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQSPEQQQYEFQPLPTSYLRLIAHRVAQHYGL  70

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
             +T L    V DGS +RI+  KT+E R P + L++IPV  P+
Sbjct  71   FTTALDGGGV-DGSGNRILATKTAESRYPFVCLSEIPVKQPE  111



>ref|XP_006294497.1| hypothetical protein CARUB_v10023526mg [Capsella rubella]
 gb|EOA27395.1| hypothetical protein CARUB_v10023526mg [Capsella rubella]
Length=352

 Score =   126 bits (316),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 75/99 (76%), Gaps = 6/99 (6%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VD FL EALQNPR RL++LRME DV+ F+KDP QQQ EFQ  PTSYLRLAAHRVA HY 
Sbjct  20   TVDPFLVEALQNPRHRLTILRMELDVQMFLKDPDQQQFEFQHFPTSYLRLAAHRVANHYG  79

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L       +SV DG+ SRI+V K++E R P++RL++IP 
Sbjct  80   LV------TSVRDGNVSRILVTKSTESRFPAVRLSEIPA  112



>gb|EAZ10135.1| hypothetical protein OsI_32444 [Oryza sativa Indica Group]
Length=441

 Score =   127 bits (318),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +3

Query  528  VLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASR  707
            VLRMEQD+ KFI DPT+ + +F  LPTSYLRLAAHR+AQHY LQS  L D+ +PDGS SR
Sbjct  63   VLRMEQDILKFIHDPTRTEFDFHGLPTSYLRLAAHRLAQHYFLQSIALQDNGLPDGSGSR  122

Query  708  IIVRKTS-ECRMPSIRLADIPVTFPQD  785
            II+RKTS ECR+P++RL+DI V  PQD
Sbjct  123  IILRKTSAECRLPAVRLSDIQVNLPQD  149



>ref|NP_568149.1| Single-stranded nucleic acid binding R3H protein [Arabidopsis 
thaliana]
 gb|AAL24400.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM48013.1| unknown protein [Arabidopsis thaliana]
 gb|AED90828.1| Single-stranded nucleic acid binding R3H protein [Arabidopsis 
thaliana]
Length=324

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF + P QQQ EFQ LPTSYLRL AHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQSPEQQQYEFQPLPTSYLRLIAHRVAQHYGL  70

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
             +T L    V DGS +RI+  KT E R P + L++IPV  P+
Sbjct  71   FTTALEGGGV-DGSGNRILATKTVESRYPYVCLSEIPVKQPE  111



>dbj|BAB11532.1| unnamed protein product [Arabidopsis thaliana]
Length=343

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/102 (61%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF + P QQQ EFQ LPTSYLRL AHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQSPEQQQYEFQPLPTSYLRLIAHRVAQHYGL  70

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
             +T L    V DGS +RI+  KT E R P + L++IPV  P+
Sbjct  71   FTTALEGGGV-DGSGNRILATKTVESRYPYVCLSEIPVKQPE  111



>gb|KFK34908.1| hypothetical protein AALP_AA5G209300 [Arabis alpina]
Length=354

 Score =   125 bits (314),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 79/99 (80%), Gaps = 2/99 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VD FL EALQNPR+RL++LRME DV++F++ P QQQ EFQ  PTSYLRLAAHRVA HY 
Sbjct  20   AVDPFLVEALQNPRQRLTILRMELDVQRFLQSPEQQQFEFQHFPTSYLRLAAHRVANHYG  79

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L +T + +S V DG+ + I+V KT+E R P++RL++IPV
Sbjct  80   L-ATAVQESGV-DGNENVILVTKTTESRFPAVRLSEIPV  116



>ref|XP_010673076.1| PREDICTED: uncharacterized protein LOC104889530 [Beta vulgaris 
subsp. vulgaris]
Length=362

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 81/108 (75%), Gaps = 6/108 (6%)
 Frame = +3

Query  459  EDIVNS----VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLA  626
            E +VN+    VD FL EALQNPR RL++LRME D++KF++ P Q Q EFQ  PTSYLRLA
Sbjct  17   EALVNNYASLVDPFLVEALQNPRHRLTILRMELDIQKFLQTPEQLQFEFQHFPTSYLRLA  76

Query  627  AHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            AHRVAQHY LQ+ VL   ++ DG+ ++I+V KT+E + PS+ L+DIP 
Sbjct  77   AHRVAQHYGLQTMVL--DNLTDGAGAKIMVMKTAESKYPSVCLSDIPA  122



>tpg|DAA55731.1| TPA: putative casein kinase family protein [Zea mays]
Length=372

 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/96 (63%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  453  VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAH  632
            V E +V  VDQFLREAL+ PRERLSVLRMEQ++ KFI DP++ + EF  LPTSYLRLAAH
Sbjct  32   VCEGLVAQVDQFLREALEKPRERLSVLRMEQEILKFIHDPSRTEYEFNGLPTSYLRLAAH  91

Query  633  RVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRM  740
            R+AQHY LQS  + D+S+PDG+ SRII+  +   R+
Sbjct  92   RLAQHYFLQSIAIPDNSLPDGTGSRIILPSSRSNRI  127



>gb|ABK24455.1| unknown [Picea sitchensis]
Length=376

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 67/83 (81%), Gaps = 0/83 (0%)
 Frame = +3

Query  537  MEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIV  716
            MEQ VEKFI++P+QQQ++F+QLPTSYLRL AHRVAQHY LQS V++D    DGS SRII 
Sbjct  1    MEQQVEKFIQNPSQQQLDFEQLPTSYLRLVAHRVAQHYGLQSMVVIDCHSADGSGSRIIA  60

Query  717  RKTSECRMPSIRLADIPVTFPQD  785
            RKTS+   P IRLADIPV  PQD
Sbjct  61   RKTSQSGYPVIRLADIPVNLPQD  83



>ref|XP_010505858.1| PREDICTED: uncharacterized protein LOC104782584 [Camelina sativa]
Length=359

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VD FL EALQNPR RL++LRME DV+KF+++P +QQ EFQ  PTSYLRLAAHRVA HY 
Sbjct  20   TVDPFLVEALQNPRHRLTILRMELDVQKFLQNPDEQQFEFQHFPTSYLRLAAHRVANHYG  79

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L ++V    +  DG+ SRI+V K++E R P++RL++IP 
Sbjct  80   LVTSVRDGGA--DGNVSRILVTKSTESRFPAVRLSEIPA  116



>ref|XP_010552904.1| PREDICTED: uncharacterized protein LOC104823164 [Tarenaya hassleriana]
Length=333

 Score =   124 bits (312),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME +V+KF+++  Q Q EFQ  PTSYLRLAAHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELEVQKFLRNTEQDQFEFQHYPTSYLRLAAHRVAQHYGL  70

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
              T+ +D  + DGS +RI+VRKT+E R PS+ L++IP   P++
Sbjct  71   -VTMAMDGGL-DGSGNRILVRKTAEIRYPSVCLSEIPAKQPEN  111



>emb|CDY52134.1| BnaA03g55130D [Brassica napus]
Length=319

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF + P QQQ EF   PTSYLRLAAHRVA HY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQSPEQQQYEFPPYPTSYLRLAAHRVAHHYGL  70

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
             +T L D +  DGS +RI+V KT E R P + L++IPV  P+
Sbjct  71   FTTAL-DGAALDGSGNRILVTKTGESRYPFVCLSEIPVKQPE  111



>gb|ERM99095.1| hypothetical protein AMTR_s00101p00122520 [Amborella trichopoda]
Length=343

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD+FL EALQNPR RL+VLRME D++  +K+P QQQ+E    PTSYLRLAAHRVA HY L
Sbjct  19   VDRFLLEALQNPRHRLTVLRMELDIQMLMKNPEQQQLELPHFPTSYLRLAAHRVALHYGL  78

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            QS  +   +  DGS SRIIVRKT E R PSI L +IP 
Sbjct  79   QS--MASDNTADGSGSRIIVRKTPESRYPSICLCEIPA  114



>ref|XP_006407506.1| hypothetical protein EUTSA_v10021089mg [Eutrema salsugineum]
 gb|ESQ48959.1| hypothetical protein EUTSA_v10021089mg [Eutrema salsugineum]
Length=250

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF+  PTSYLRLAAHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFRPFPTSYLRLAAHRVAQHYGL  70

Query  657  QSTVLVD-SSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L + S   DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  71   VTMALDNGSGAGDGSENRILVTKTAESRFPYVCLSEIPVKQPEN  114



>ref|XP_007204692.1| hypothetical protein PRUPE_ppa007799mg [Prunus persica]
 gb|EMJ05891.1| hypothetical protein PRUPE_ppa007799mg [Prunus persica]
Length=355

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 76/98 (78%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+ +P +Q  EFQ  PTSYLRLAAHRV+QHY L
Sbjct  22   VDPFLVEALQNPRHRLTILRMELDIQRFLHNPDEQLFEFQHFPTSYLRLAAHRVSQHYGL  81

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q+  +V  S  DG  +RI+VRKT E + P+I+L++IPV
Sbjct  82   QT--MVQDSGSDGQGNRILVRKTGERKYPAIQLSEIPV  117



>ref|XP_006836242.2| PREDICTED: uncharacterized protein LOC18427123 [Amborella trichopoda]
Length=352

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/98 (63%), Positives = 72/98 (73%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD+FL EALQNPR RL+VLRME D++  +K+P QQQ+E    PTSYLRLAAHRVA HY L
Sbjct  19   VDRFLLEALQNPRHRLTVLRMELDIQMLMKNPEQQQLELPHFPTSYLRLAAHRVALHYGL  78

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            QS  +   +  DGS SRIIVRKT E R PSI L +IP 
Sbjct  79   QS--MASDNTADGSGSRIIVRKTPESRYPSICLCEIPA  114



>emb|CDX80941.1| BnaC03g01950D [Brassica napus]
Length=352

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF + P QQQ EF   PTSYLRLAAHRVA HY L
Sbjct  12   VDPFLVEALQNPRHRLTILRMELDIQKFFQSPEQQQYEFPPYPTSYLRLAAHRVAHHYGL  71

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
             +T L D +  DGS +RI+V KT E R P + L++IPV  P+
Sbjct  72   FTTAL-DGAALDGSGNRILVTKTGESRYPFVCLSEIPVKQPE  112



>gb|KFK42320.1| single-stranded nucleic acid binding r3h protein [Arabis alpina]
Length=351

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 79/102 (77%), Gaps = 2/102 (2%)
 Frame = +3

Query  465  IVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQ  644
            + ++VD FL EALQNPR+RL++LRME D+++F++   QQQ EFQ  PTSYLRLAAHRVA 
Sbjct  14   MADTVDPFLVEALQNPRQRLTILRMEFDIQRFLQSSDQQQFEFQHFPTSYLRLAAHRVAN  73

Query  645  HYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            HY L  T++ DS V DG+ SRI+V K +E R P++RL++IP 
Sbjct  74   HYGL-ITLVQDSGV-DGNGSRILVSKAAESRFPAVRLSEIPA  113



>ref|XP_002521584.1| r3h domain containing protein, putative [Ricinus communis]
 gb|EEF40855.1| r3h domain containing protein, putative [Ricinus communis]
Length=349

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+++P QQQ EFQ  PTSYLRLAAHRVAQHY L
Sbjct  14   VDPFLVEALQNPRHRLTILRMELDIQRFLQNPVQQQFEFQHFPTSYLRLAAHRVAQHYGL  73

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
              T++ D+S  DG  ++I+V+KT+E R P++RL +IP 
Sbjct  74   -ITMVQDNSF-DGLVNKILVKKTAEIRYPAVRLCEIPA  109



>ref|XP_008359462.1| PREDICTED: R3H domain-containing protein 1-like [Malus domestica]
Length=353

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+K P QQ  EFQ  PTSYLRLAAHRV+QHY L
Sbjct  21   VDPFLVEALQNPRHRLTILRMELDIQRFLKSPDQQLFEFQHFPTSYLRLAAHRVSQHYGL  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q+  +V     DG  +RI+VRKT+E + P+I+L++IP 
Sbjct  81   QT--MVQDWGSDGQGNRILVRKTAESKYPAIQLSEIPA  116



>ref|XP_008244779.1| PREDICTED: uncharacterized protein LOC103342896 [Prunus mume]
Length=355

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 77/98 (79%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+ +P +Q  EFQ  PTSYLRLAAHRV+QHY L
Sbjct  22   VDPFLVEALQNPRHRLTILRMELDIQRFLHNPDEQLFEFQHFPTSYLRLAAHRVSQHYGL  81

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q+  +V  S  DG  +RI+VRKT+E + P+I+L++IP+
Sbjct  82   QT--MVQDSGSDGQGNRILVRKTAERKYPAIQLSEIPI  117



>gb|KEH43446.1| single-stranded nucleic acid-binding protein R3H [Medicago truncatula]
Length=399

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  546  DVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIVRKT  725
            DV KFI+DP QQQ+EFQQLPTSYLRLAAHRVAQHYSLQS VL+D S+PD S S+IIV KT
Sbjct  35   DVVKFIQDPNQQQLEFQQLPTSYLRLAAHRVAQHYSLQSMVLLDYSLPDDSGSQIIVHKT  94

Query  726  SECRMPSIRLADIPVTFPQD  785
            S C+ P IRLADIPV  P +
Sbjct  95   SGCKPPLIRLADIPVKLPSE  114



>ref|XP_008350136.1| PREDICTED: R3H domain-containing protein 1-like [Malus domestica]
Length=352

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+K P QQ  EFQ  PTSYLRLAAHRV+QHY L
Sbjct  21   VDPFLVEALQNPRHRLTILRMELDIQRFLKSPDQQLFEFQHFPTSYLRLAAHRVSQHYGL  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q+  +V     DG  +RI+VRKT+E + P+I+L++IP 
Sbjct  81   QT--MVQDWGSDGQGNRILVRKTAESKYPAIQLSEIPA  116



>gb|KDO53661.1| hypothetical protein CISIN_1g018220mg [Citrus sinensis]
Length=274

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+++P QQ  EFQ  PTSYLRLAAHRV+QHY L
Sbjct  21   VDPFLVEALQNPRHRLTILRMELDIQRFLQNPDQQHFEFQHFPTSYLRLAAHRVSQHYGL  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
                +V  +  +G  +RI+VRKT+E + P++RL++IP 
Sbjct  81   --VTMVQENGIEGLGNRILVRKTAESKYPAVRLSEIPA  116



>gb|AAM64355.1| unknown [Arabidopsis thaliana]
Length=351

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 76/99 (77%), Gaps = 2/99 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VD FL EALQNPR RL++LRME DV++F++ P QQQ EFQ  PTSYLRLAAHRVA HY 
Sbjct  20   NVDPFLVEALQNPRHRLTILRMELDVQRFLQSPDQQQFEFQHFPTSYLRLAAHRVANHYG  79

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L ++V    +  DG+ SRI+V K+S+ R P+ RL++IPV
Sbjct  80   LITSVRDGGA--DGNESRIVVTKSSDSRFPAARLSEIPV  116



>gb|KDO53662.1| hypothetical protein CISIN_1g018220mg [Citrus sinensis]
Length=282

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+++P QQ  EFQ  PTSYLRLAAHRV+QHY L
Sbjct  21   VDPFLVEALQNPRHRLTILRMELDIQRFLQNPDQQHFEFQHFPTSYLRLAAHRVSQHYGL  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
                +V  +  +G  +RI+VRKT+E + P++RL++IP 
Sbjct  81   --VTMVQENGIEGLGNRILVRKTAESKYPAVRLSEIPA  116



>ref|XP_006298102.1| hypothetical protein CARUB_v10014143mg [Capsella rubella]
 gb|EOA31000.1| hypothetical protein CARUB_v10014143mg [Capsella rubella]
Length=334

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF+  PTSYLRLAAHRVAQHY L
Sbjct  12   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFRPFPTSYLRLAAHRVAQHYGL  71

Query  657  QSTVLVD-SSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L + S   DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  72   VTMALDNGSGAGDGSENRILVTKTAESRFPHVCLSEIPVKQPEN  115



>ref|XP_009388814.1| PREDICTED: uncharacterized protein LOC103975543 [Musa acuminata 
subsp. malaccensis]
Length=348

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 79/109 (72%), Gaps = 2/109 (2%)
 Frame = +3

Query  459  EDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRV  638
            E I   VD FL EAL+NPR RL+VLRME D+++F+++P QQQ EFQ LPTSYLR AAHRV
Sbjct  22   ESIFGQVDPFLIEALENPRHRLTVLRMELDIQRFMQNPDQQQFEFQHLPTSYLRCAAHRV  81

Query  639  AQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            AQH+ LQ+  L D+   DG  +R++ +KT + + P + L+++P   P++
Sbjct  82   AQHFGLQTMALEDAV--DGLGNRVVAKKTPDSKFPYVCLSELPAKVPEN  128



>ref|XP_009130861.1| PREDICTED: uncharacterized protein LOC103855609 [Brassica rapa]
Length=318

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF + P Q Q EF   PTSYLRLAAHRVA HY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQSPEQHQYEFPPYPTSYLRLAAHRVAHHYGL  70

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
             +T L D +  DGS +RI+V KT+E R P + L++IPV  P+
Sbjct  71   FTTAL-DGAALDGSGNRILVTKTAESRYPFVCLSEIPVKQPE  111



>emb|CDY00700.1| BnaC03g36840D [Brassica napus]
Length=317

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EFQ  PTSYLRLAAHRVAQHY L
Sbjct  12   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFQPFPTSYLRLAAHRVAQHYGL  71

Query  657  QSTVLVDSSVP-DGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L + +   DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  72   PTMSLENGNGSLDGSDNRILVTKTAESRFPHVCLSEIPVKQPEN  115



>gb|AFW71285.1| hypothetical protein ZEAMMB73_459562, partial [Zea mays]
Length=125

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +3

Query  537  MEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIV  716
            MEQ++ KFI DP++ + EF  LPTSYLRLAAHR+AQHY LQS  + D+S+PDG+ SRII+
Sbjct  1    MEQEILKFIHDPSRTEYEFNGLPTSYLRLAAHRLAQHYFLQSIDIPDNSLPDGTGSRIIL  60

Query  717  RKTS-ECRMPSIRLADIPVTFPQD  785
            RKT+ +CR+P++RLADIPV  PQ+
Sbjct  61   RKTTFDCRLPAVRLADIPVNLPQE  84



>ref|NP_001055538.2| Os05g0411600 [Oryza sativa Japonica Group]
 dbj|BAF17452.2| Os05g0411600 [Oryza sativa Japonica Group]
Length=148

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%), Gaps = 2/101 (2%)
 Frame = +3

Query  465  IVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQ  644
            + + VD FL EAL NPR RL VLRM  D++KF+++P   + EFQ  PTSYLR AAHRVAQ
Sbjct  21   VTSHVDPFLVEALDNPRHRLMVLRMAMDIQKFMQNPQLHEFEFQHFPTSYLRCAAHRVAQ  80

Query  645  HYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            HY L++TV  DS V DGS S+I+ +KTSE ++P I L+++P
Sbjct  81   HYGLETTV-ADSLV-DGSVSKIVAKKTSESKLPVIALSEVP  119



>ref|XP_006407507.1| hypothetical protein EUTSA_v10021089mg [Eutrema salsugineum]
 gb|ESQ48960.1| hypothetical protein EUTSA_v10021089mg [Eutrema salsugineum]
Length=337

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF+  PTSYLRLAAHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFRPFPTSYLRLAAHRVAQHYGL  70

Query  657  QSTVLVD-SSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L + S   DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  71   VTMALDNGSGAGDGSENRILVTKTAESRFPYVCLSEIPVKQPEN  114



>gb|AFW76046.1| hypothetical protein ZEAMMB73_671673, partial [Zea mays]
Length=122

 Score =   117 bits (293),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +3

Query  537  MEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIV  716
            MEQ++ KFI DP++ + EF  LPTSYLRLAAHR+AQHY LQS  + D+S+PDG+ S II+
Sbjct  1    MEQEILKFIHDPSRTEYEFNGLPTSYLRLAAHRLAQHYFLQSIAIPDNSLPDGTGSHIIL  60

Query  717  RKTS-ECRMPSIRLADIPVTFPQD  785
            RKT+ +CR+P++RLADIPV  PQ+
Sbjct  61   RKTTFDCRLPAVRLADIPVNLPQE  84



>gb|AFW78003.1| hypothetical protein ZEAMMB73_274612 [Zea mays]
Length=283

 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 78/105 (74%), Gaps = 2/105 (2%)
 Frame = +3

Query  453  VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAH  632
            V E + + VD FL EAL NPR RL VLRME D++ F+++P  Q+ EFQ  PTSYLR AAH
Sbjct  31   VDERVASHVDPFLVEALDNPRHRLMVLRMELDIQNFMQNPQLQEFEFQNFPTSYLRCAAH  90

Query  633  RVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            RVAQHY L+ T++ DS V +GS SRI+ RKT+E R P+I L+++P
Sbjct  91   RVAQHYGLE-TIVADSLV-EGSVSRIVARKTAESRYPAIFLSEVP  133



>ref|XP_006402961.1| hypothetical protein EUTSA_v10006048mg [Eutrema salsugineum]
 gb|ESQ44414.1| hypothetical protein EUTSA_v10006048mg [Eutrema salsugineum]
Length=364

 Score =   122 bits (307),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            SVD FL EALQNPR RL++LRME DV++F+++  QQQ EFQ  PTSYLRLAAHRVA HY 
Sbjct  27   SVDPFLVEALQNPRHRLTILRMELDVQRFLQNLEQQQFEFQHFPTSYLRLAAHRVANHYG  86

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L +T + DS V DG+ + I+V KT+E R P++RL++IP 
Sbjct  87   L-ATAVQDSGV-DGNENIILVTKTTESRFPAVRLSEIPT  123



>ref|NP_565947.1| Single-stranded nucleic acid binding R3H protein [Arabidopsis 
thaliana]
 gb|AAB86456.2| expressed protein [Arabidopsis thaliana]
 gb|AAM14924.1| expressed protein [Arabidopsis thaliana]
 gb|AEC09907.1| Single-stranded nucleic acid binding R3H protein [Arabidopsis 
thaliana]
Length=351

 Score =   122 bits (306),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VD FL EALQNPR RL++LRME DV++F++ P QQQ EFQ  PTSYLR AAHRVA HY 
Sbjct  20   NVDPFLVEALQNPRHRLTILRMELDVQRFLQSPDQQQFEFQHFPTSYLRFAAHRVANHYG  79

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L ++V    +  DG+ SRI+V K+S+ R P+ RL++IPV
Sbjct  80   LITSVRDGGA--DGNESRIVVTKSSDSRFPAARLSEIPV  116



>ref|XP_008808576.1| PREDICTED: uncharacterized protein LOC103720587 [Phoenix dactylifera]
Length=354

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VDQFL EAL+NPR RL+VLRME D+++F++     Q EFQ LPTSYLR AAHRVAQHY L
Sbjct  24   VDQFLLEALENPRHRLTVLRMELDIQRFMQSSDLHQFEFQHLPTSYLRCAAHRVAQHYGL  83

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ DS++ DG   RII RKTSE R P++ L+D+P 
Sbjct  84   Q-TMVADSTL-DGLNGRIIARKTSESRFPAVFLSDVPA  119



>ref|XP_004962092.1| PREDICTED: uncharacterized protein LOC101778097 isoform X2 [Setaria 
italica]
Length=352

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 76/102 (75%), Gaps = 2/102 (2%)
 Frame = +3

Query  459  EDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRV  638
            E + ++VD FL EAL NPR RL VLRME D++KF+++P  Q+ EFQ  PTSYLR AAHRV
Sbjct  35   ERVASNVDPFLVEALDNPRHRLMVLRMELDIQKFMQNPQLQEFEFQNFPTSYLRCAAHRV  94

Query  639  AQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADI  764
            AQHY L++TV  DS V DGS SRI+ RKT E R P I L+++
Sbjct  95   AQHYGLETTV-ADSLV-DGSVSRIVARKTPESRYPPIALSEV  134



>ref|XP_002876378.1| hypothetical protein ARALYDRAFT_486108 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52637.1| hypothetical protein ARALYDRAFT_486108 [Arabidopsis lyrata subsp. 
lyrata]
Length=354

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VD FL EALQN R RL++LRME DV++ +++P QQQ EFQ  PTSYLRLAAHRVA HY 
Sbjct  23   NVDPFLVEALQNSRHRLTILRMELDVQRLLQNPEQQQFEFQHFPTSYLRLAAHRVANHYG  82

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L +   V  S  DG+ +RI+V KT+E + PS+RL++IPV
Sbjct  83   LATA--VQESGADGNENRILVTKTTESKFPSVRLSEIPV  119



>ref|XP_007028264.1| Single-stranded nucleic acid binding R3H protein isoform 3 [Theobroma 
cacao]
 gb|EOY08766.1| Single-stranded nucleic acid binding R3H protein isoform 3 [Theobroma 
cacao]
Length=246

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 77/108 (71%), Gaps = 2/108 (2%)
 Frame = +3

Query  462  DIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVA  641
            DI ++VD FL EALQNPR RL++LRME D+++F++   Q Q EFQ  PTSYLRLAAHRVA
Sbjct  18   DIESAVDPFLVEALQNPRHRLTILRMELDIQRFLQQSDQHQFEFQHFPTSYLRLAAHRVA  77

Query  642  QHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            QHY L    +V  +  DG  SRI+V +T E R P++RL+++P    ++
Sbjct  78   QHYGL--ITMVQDNGLDGLGSRIMVTRTGEIRCPAVRLSEVPAKHSEN  123



>ref|XP_009135130.1| PREDICTED: uncharacterized protein LOC103859362 [Brassica rapa]
Length=316

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME +++KF ++P Q Q EFQ  PTSYLRLAAHRVAQHY L
Sbjct  12   VDPFLVEALQNPRHRLTILRMELNIQKFFQNPDQLQFEFQPFPTSYLRLAAHRVAQHYGL  71

Query  657  QSTVLVDSSVP-DGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L + +   DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  72   TTMSLENGNGSLDGSDNRILVTKTAESRFPHVCLSEIPVKQPEN  115



>gb|KDO53660.1| hypothetical protein CISIN_1g018220mg [Citrus sinensis]
Length=348

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+++P QQ  EFQ  PTSYLRLAAHRV+QHY L
Sbjct  21   VDPFLVEALQNPRHRLTILRMELDIQRFLQNPDQQHFEFQHFPTSYLRLAAHRVSQHYGL  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
                +V  +  +G  +RI+VRKT+E + P++RL++IP 
Sbjct  81   --VTMVQENGIEGLGNRILVRKTAESKYPAVRLSEIPA  116



>tpg|DAA46760.1| TPA: hypothetical protein ZEAMMB73_590191 [Zea mays]
Length=306

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +3

Query  525  SVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSAS  704
            ++LRMEQ++ KFI DP++ + EF  LPTSYLRLAAHR+AQHY LQS  + D+S+PDG+ S
Sbjct  42   ALLRMEQEILKFIHDPSRTEYEFDGLPTSYLRLAAHRLAQHYFLQSIDIPDNSLPDGTGS  101

Query  705  RIIVRKTS-ECRMPSIRLADIPVTFPQD  785
            RII+RKT+ +CR+P +RLADIPV  PQ+
Sbjct  102  RIILRKTTFDCRLPVVRLADIPVNLPQE  129



>ref|XP_006430510.1| hypothetical protein CICLE_v10012047mg [Citrus clementina]
 gb|ESR43750.1| hypothetical protein CICLE_v10012047mg [Citrus clementina]
Length=359

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME DV++F+++P QQ  EFQ  PTSYLRLAAHRV+QHY L
Sbjct  21   VDPFLVEALQNPRHRLTILRMELDVQRFLQNPDQQHFEFQHFPTSYLRLAAHRVSQHYGL  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
                +V  +  +G  +RI+VRKT+E + P++RL++IP 
Sbjct  81   --VTMVQENGIEGLGNRILVRKTAESKYPAVRLSEIPA  116



>ref|XP_008648332.1| PREDICTED: DIP1 isoform X2 [Zea mays]
Length=341

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 78/105 (74%), Gaps = 2/105 (2%)
 Frame = +3

Query  453  VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAH  632
            V E + + VD FL EAL NPR RL VLRME D++ F+++P  Q+ EFQ  PTSYLR AAH
Sbjct  31   VDERVASHVDPFLVEALDNPRHRLMVLRMELDIQNFMQNPQLQEFEFQNFPTSYLRCAAH  90

Query  633  RVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            RVAQHY L+ T++ DS V +GS SRI+ RKT+E R P+I L+++P
Sbjct  91   RVAQHYGLE-TIVADSLV-EGSVSRIVARKTAESRYPAIFLSEVP  133



>ref|XP_002884813.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61072.1| nucleic acid binding protein [Arabidopsis lyrata subsp. lyrata]
Length=333

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF+  PTSYLRLAAHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFRPFPTSYLRLAAHRVAQHYGL  70

Query  657  QSTVLVD-SSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L + +   DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  71   VTMALDNGTGAGDGSENRILVTKTAESRFPYVCLSEIPVKQPEN  114



>ref|XP_004962091.1| PREDICTED: uncharacterized protein LOC101778097 isoform X1 [Setaria 
italica]
Length=361

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 76/102 (75%), Gaps = 2/102 (2%)
 Frame = +3

Query  459  EDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRV  638
            E + ++VD FL EAL NPR RL VLRME D++KF+++P  Q+ EFQ  PTSYLR AAHRV
Sbjct  35   ERVASNVDPFLVEALDNPRHRLMVLRMELDIQKFMQNPQLQEFEFQNFPTSYLRCAAHRV  94

Query  639  AQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADI  764
            AQHY L++TV  DS V DGS SRI+ RKT E R P I L+++
Sbjct  95   AQHYGLETTV-ADSLV-DGSVSRIVARKTPESRYPPIALSEV  134



>ref|XP_010486693.1| PREDICTED: R3H domain-containing protein 1-like isoform X2 [Camelina 
sativa]
Length=332

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF   PTSYLRLAAHRVAQHY L
Sbjct  14   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFMPFPTSYLRLAAHRVAQHYGL  73

Query  657  QSTVLVDS-SVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L +     DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  74   VTMALDNGIGAGDGSENRILVTKTAESRFPCVCLSEIPVKQPEN  117



>gb|ACF81487.1| unknown [Zea mays]
 gb|AFW78002.1| DIP1 [Zea mays]
Length=349

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 78/105 (74%), Gaps = 2/105 (2%)
 Frame = +3

Query  453  VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAH  632
            V E + + VD FL EAL NPR RL VLRME D++ F+++P  Q+ EFQ  PTSYLR AAH
Sbjct  31   VDERVASHVDPFLVEALDNPRHRLMVLRMELDIQNFMQNPQLQEFEFQNFPTSYLRCAAH  90

Query  633  RVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            RVAQHY L+ T++ DS V +GS SRI+ RKT+E R P+I L+++P
Sbjct  91   RVAQHYGLE-TIVADSLV-EGSVSRIVARKTAESRYPAIFLSEVP  133



>gb|EAY98040.1| hypothetical protein OsI_19955 [Oryza sativa Indica Group]
Length=335

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/101 (57%), Positives = 76/101 (75%), Gaps = 2/101 (2%)
 Frame = +3

Query  465  IVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQ  644
            + + VD FL EAL NPR RL VLRME D++KF+++P   + EFQ  PTSYLR AAHRVAQ
Sbjct  21   VTSHVDPFLVEALDNPRHRLMVLRMEMDIQKFMQNPQLHEFEFQHFPTSYLRCAAHRVAQ  80

Query  645  HYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            HY L++TV  DS V DGS S+I+ +KTSE ++P I L+++P
Sbjct  81   HYGLETTV-ADSLV-DGSVSKIVAKKTSESKLPVIALSEVP  119



>ref|XP_010486692.1| PREDICTED: R3H domain-containing protein 1-like isoform X1 [Camelina 
sativa]
Length=340

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF   PTSYLRLAAHRVAQHY L
Sbjct  14   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFMPFPTSYLRLAAHRVAQHYGL  73

Query  657  QSTVLVDS-SVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L +     DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  74   VTMALDNGIGAGDGSENRILVTKTAESRFPCVCLSEIPVKQPEN  117



>gb|ACF85224.1| unknown [Zea mays]
 gb|ACN34703.1| unknown [Zea mays]
 gb|AFW81931.1| nucleic acid binding protein isoform 1 [Zea mays]
 gb|AFW81932.1| nucleic acid binding protein isoform 2 [Zea mays]
Length=349

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 2/105 (2%)
 Frame = +3

Query  453  VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAH  632
            V E + + VD FL EAL NPR RL VLRME D+  F+++P  Q+ EFQ  PTSYLR AAH
Sbjct  32   VDERVASHVDPFLVEALDNPRHRLMVLRMELDIRNFMQNPQLQEFEFQNFPTSYLRCAAH  91

Query  633  RVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            RVAQHY L+ T++ DS V +GS SRI+ RKT E R P+I LA++P
Sbjct  92   RVAQHYGLE-TIVADSLV-EGSVSRIVARKTPESRCPAISLAEVP  134



>ref|XP_003568455.1| PREDICTED: uncharacterized protein LOC100835943 [Brachypodium 
distachyon]
Length=348

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 75/102 (74%), Gaps = 2/102 (2%)
 Frame = +3

Query  465  IVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQ  644
            I + VD FL EAL NPR RL VLRME D++KF+++P   + EFQ  PTSYLR AAHRVAQ
Sbjct  32   IASHVDPFLVEALDNPRHRLMVLRMELDIQKFMQNPQLHEFEFQHFPTSYLRCAAHRVAQ  91

Query  645  HYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            HY L++TV  D  V DGS SRI+ RKT E + P+I L+D+P+
Sbjct  92   HYGLETTV-ADILV-DGSISRIVARKTPESKYPAIVLSDVPI  131



>ref|XP_006482042.1| PREDICTED: R3H domain-containing protein 2-like [Citrus sinensis]
Length=359

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+++P QQ  EFQ  PTSYLRLAAHRV+QHY L
Sbjct  21   VDPFLVEALQNPRHRLTILRMELDIQRFLQNPDQQHFEFQHFPTSYLRLAAHRVSQHYGL  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
                +V  +  +G  +RI+VRKT+E + P++RL++IP 
Sbjct  81   --VTMVQENGIEGLGNRILVRKTAESKYPAVRLSEIPA  116



>ref|NP_001148805.1| nucleic acid binding protein [Zea mays]
 gb|ACG32964.1| nucleic acid binding protein [Zea mays]
Length=349

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 2/105 (2%)
 Frame = +3

Query  453  VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAH  632
            V E + + VD FL EAL NPR RL VLRME D+  F+++P  Q+ EFQ  PTSYLR AAH
Sbjct  32   VDERVASHVDPFLVEALDNPRHRLMVLRMELDIRNFMQNPQLQEFEFQNFPTSYLRCAAH  91

Query  633  RVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            RVAQHY L+ T++ DS V +GS SRI+ RKT E R P+I LA++P
Sbjct  92   RVAQHYGLE-TIVADSLV-EGSVSRIVARKTPESRCPAISLAEVP  134



>ref|XP_010508784.1| PREDICTED: uncharacterized protein LOC104785299 [Camelina sativa]
Length=358

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 77/99 (78%), Gaps = 2/99 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VD FL EALQNPR RL++LRME DV+KF+++P +QQ EFQ  PTSYLRLAAHRVA HY 
Sbjct  20   TVDPFLVEALQNPRHRLTILRMELDVQKFLQNPDEQQFEFQYFPTSYLRLAAHRVANHYG  79

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L ++V    +  DG+ SRI+V K+++ R P++RL++IP 
Sbjct  80   LVTSVRDVGA--DGNMSRILVTKSTDSRFPAVRLSEIPA  116



>ref|XP_010464755.1| PREDICTED: uncharacterized protein LOC104745258 isoform X2 [Camelina 
sativa]
Length=330

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF   PTSYLRLAAHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFMPFPTSYLRLAAHRVAQHYGL  70

Query  657  QSTVLVDS-SVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L +     DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  71   VTMALDNGIGAGDGSENRILVTKTAESRFPCVCLSEIPVKQPEN  114



>ref|XP_012088643.1| PREDICTED: R3H domain-containing protein 2-like isoform X1 [Jatropha 
curcas]
 gb|KDP23817.1| hypothetical protein JCGZ_00069 [Jatropha curcas]
Length=352

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 80/99 (81%), Gaps = 3/99 (3%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+++P QQQ EFQ  PTSYLRLAAHRVAQHY L
Sbjct  16   VDPFLVEALQNPRHRLTILRMELDIQRFLQNPDQQQFEFQHFPTSYLRLAAHRVAQHYGL  75

Query  657  QSTVLVDSSVPDGSASRIIVRKTS-ECRMPSIRLADIPV  770
              T++ D+S+ DG  ++I+V+KT+ E R P++RL++IP 
Sbjct  76   -ITMVQDNSI-DGLTNKILVKKTTAESRYPAVRLSEIPA  112



>gb|KDO53658.1| hypothetical protein CISIN_1g018220mg [Citrus sinensis]
Length=359

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+++P QQ  EFQ  PTSYLRLAAHRV+QHY L
Sbjct  21   VDPFLVEALQNPRHRLTILRMELDIQRFLQNPDQQHFEFQHFPTSYLRLAAHRVSQHYGL  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
                +V  +  +G  +RI+VRKT+E + P++RL++IP 
Sbjct  81   --VTMVQENGIEGLGNRILVRKTAESKYPAVRLSEIPA  116



>ref|XP_010464754.1| PREDICTED: uncharacterized protein LOC104745258 isoform X1 [Camelina 
sativa]
Length=338

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF   PTSYLRLAAHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFMPFPTSYLRLAAHRVAQHYGL  70

Query  657  QSTVLVDS-SVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L +     DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  71   VTMALDNGIGAGDGSENRILVTKTAESRFPCVCLSEIPVKQPEN  114



>ref|NP_850556.1| Single-stranded nucleic acid binding R3H protein [Arabidopsis 
thaliana]
 gb|AEE74953.1| Single-stranded nucleic acid binding R3H protein [Arabidopsis 
thaliana]
Length=325

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF   PTSYLRLAAHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFPPFPTSYLRLAAHRVAQHYGL  70

Query  657  QSTVLVD-SSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L + +   DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  71   VTMALDNGTGAGDGSDNRILVTKTAESRFPYVCLSEIPVKQPEN  114



>emb|CDY08578.1| BnaA05g28140D [Brassica napus]
Length=343

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF   PTSYLRLAAHRVAQHY L
Sbjct  17   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFSPFPTSYLRLAAHRVAQHYGL  76

Query  657  QSTVLVDSSVP-DGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L +     DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  77   VTMALDNGGGAVDGSDNRILVTKTAESRFPHVCLSEIPVKQPEN  120



>gb|AAM64684.1| unknown [Arabidopsis thaliana]
Length=333

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF   PTSYLRLAAHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFPPFPTSYLRLAAHRVAQHYGL  70

Query  657  QSTVLVD-SSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L + +   DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  71   VTMALDNGTGTGDGSDNRILVTKTAESRFPYVCLSEIPVKQPEN  114



>ref|XP_010905886.1| PREDICTED: uncharacterized protein LOC105032977 [Elaeis guineensis]
Length=354

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 2/104 (2%)
 Frame = +3

Query  459  EDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRV  638
            E  ++ VDQFL EAL+NPR RL+VLRME D+++F+++    Q EF   PTSYLR AAHRV
Sbjct  18   EARLSQVDQFLLEALENPRHRLTVLRMELDIQRFMQNSDLHQFEFPHFPTSYLRCAAHRV  77

Query  639  AQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            AQHY LQ T++ DS++ DGS  RII RKTSE R P++ L+ IP 
Sbjct  78   AQHYGLQ-TMVADSTL-DGSGGRIIARKTSESRFPAVSLSYIPA  119



>gb|KFK38469.1| hypothetical protein AALP_AA3G116900 [Arabis alpina]
Length=336

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF+  PTSYLRLAAHRVAQHY L
Sbjct  12   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFRPFPTSYLRLAAHRVAQHYGL  71

Query  657  QSTVLVD-SSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L + +   DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  72   VTMALDNGNGAVDGSDNRILVTKTAESRFPYVCLSEIPVKQPEN  115



>ref|NP_566381.1| Single-stranded nucleic acid binding R3H protein [Arabidopsis 
thaliana]
 gb|AAF19572.1|AC011708_15 unknown protein [Arabidopsis thaliana]
 dbj|BAE98500.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE74952.1| Single-stranded nucleic acid binding R3H protein [Arabidopsis 
thaliana]
Length=333

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF   PTSYLRLAAHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFPPFPTSYLRLAAHRVAQHYGL  70

Query  657  QSTVLVD-SSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L + +   DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  71   VTMALDNGTGAGDGSDNRILVTKTAESRFPYVCLSEIPVKQPEN  114



>gb|ACF88162.1| unknown [Zea mays]
Length=349

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 76/105 (72%), Gaps = 2/105 (2%)
 Frame = +3

Query  453  VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAH  632
            V E + + VD FL EAL NPR RL VLRME D+  F+++P  Q+ EFQ  PTSYLR AAH
Sbjct  32   VDERVASHVDPFLVEALDNPRHRLMVLRMELDIRDFMQNPQLQEFEFQNFPTSYLRCAAH  91

Query  633  RVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            RVAQHY L+ T++ DS V +GS SRI+ RKT E R P+I LA++P
Sbjct  92   RVAQHYGLE-TIVADSLV-EGSVSRIVARKTPESRCPAISLAEVP  134



>emb|CDX73904.1| BnaA03g31430D [Brassica napus]
Length=316

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++K  ++P Q Q EFQ  PTSYLRLAAHRVAQHY L
Sbjct  12   VDPFLVEALQNPRHRLTILRMELDIQKLFQNPDQLQFEFQPFPTSYLRLAAHRVAQHYGL  71

Query  657  QSTVLVDSSVP-DGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L + +   DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  72   TTMSLENGNGSLDGSDNRILVTKTAESRFPHVCLSEIPVKQPEN  115



>emb|CDY00970.1| BnaC05g42300D [Brassica napus]
Length=338

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF   PTSYLRLAAHRVAQHY L
Sbjct  13   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPDQLQFEFSPFPTSYLRLAAHRVAQHYGL  72

Query  657  QSTVLVDSSVP-DGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L +     DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  73   VTMALDNGGGAVDGSDNRILVTKTAESRFPHVCLSEIPVKQPEN  116



>ref|XP_002322608.1| hypothetical protein POPTR_0016s03230g [Populus trichocarpa]
 gb|EEF04369.1| hypothetical protein POPTR_0016s03230g [Populus trichocarpa]
Length=354

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 78/98 (80%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            +D FL EALQNPR RL++LRME D+++F+++P QQ  EF   PTSYLRLAAHRVAQHY L
Sbjct  19   MDPFLVEALQNPRHRLTILRMELDIQRFLQNPDQQVFEFPHFPTSYLRLAAHRVAQHYGL  78

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
              T++ D+ + DG  ++I+V+KT+ECR P++RL++IP 
Sbjct  79   -ITMVQDNGI-DGLLNKILVQKTAECRYPAVRLSEIPA  114



>gb|AFW71284.1| hypothetical protein ZEAMMB73_459562 [Zea mays]
Length=228

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 70/84 (83%), Gaps = 1/84 (1%)
 Frame = +3

Query  537  MEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIV  716
            MEQ++ KFI DP++ + EF  LPTSYLRLAAHR+AQHY LQS  + D+S+PDG+ SRII+
Sbjct  1    MEQEILKFIHDPSRTEYEFNGLPTSYLRLAAHRLAQHYFLQSIDIPDNSLPDGTGSRIIL  60

Query  717  RKTS-ECRMPSIRLADIPVTFPQD  785
            RKT+ +CR+P++RLADIPV  PQ+
Sbjct  61   RKTTFDCRLPAVRLADIPVNLPQE  84



>gb|KFK26109.1| hypothetical protein AALP_AA8G203900 [Arabis alpina]
Length=337

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF + P QQQ EF+ LPTSYLRLAAHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQSPEQQQYEFKPLPTSYLRLAAHRVAQHYGL  70

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
             +T L    V DGS +RI+  KT E R P + L++I V  P+
Sbjct  71   FTTALEGGGV-DGSENRILATKTVESRYPLVCLSEILVKQPE  111



>ref|XP_002879898.1| hypothetical protein ARALYDRAFT_483163 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56157.1| hypothetical protein ARALYDRAFT_483163 [Arabidopsis lyrata subsp. 
lyrata]
Length=355

 Score =   120 bits (301),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VD FL EALQNPR R ++LRME D+++F + P QQ  EFQQ PTSYLRLAAHRVA HY 
Sbjct  20   TVDPFLVEALQNPRHRPTILRMELDIQRFFQSPDQQLFEFQQFPTSYLRLAAHRVANHYG  79

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L ++V    +  DG+ SRI+V K++E R P++RL++IP 
Sbjct  80   LITSVRDGGA--DGNGSRIVVTKSTESRFPAVRLSEIPA  116



>gb|KHN12174.1| R3H domain-containing protein 2 [Glycine soja]
Length=356

 Score =   120 bits (300),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF+ +  QQ  EFQ  P+SYLRLAAHRVAQHY++
Sbjct  22   VDPFLVEALQNPRHRLTILRMELDIQKFLNNADQQHFEFQHFPSSYLRLAAHRVAQHYNM  81

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q+  +V+ +  DG  S+I+VRK  E + P +RL++IP 
Sbjct  82   QT--MVEDNGLDGQGSKILVRKLPESKYPVVRLSEIPA  117



>ref|XP_008786865.1| PREDICTED: uncharacterized protein LOC103705051 [Phoenix dactylifera]
Length=354

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 78/108 (72%), Gaps = 2/108 (2%)
 Frame = +3

Query  459  EDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRV  638
            E + + VD FL E+L+NPR RLSVLRME D+++FI++  Q Q EFQ LPTSYLR  AHRV
Sbjct  21   EVVFDLVDPFLVESLENPRHRLSVLRMELDIQRFIQNSDQYQFEFQHLPTSYLRRVAHRV  80

Query  639  AQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
            AQHY LQ+  L   S+ DG  SR+I RKT + R P++ L+++PV  P+
Sbjct  81   AQHYGLQTMSL--DSIIDGLGSRVIARKTPDSRFPAVYLSEVPVKQPE  126



>ref|NP_191227.1| Single-stranded nucleic acid binding R3H protein [Arabidopsis 
thaliana]
 emb|CAC00731.1| putative protein [Arabidopsis thaliana]
 gb|AAL67112.1| AT3g56680/T8M16_10 [Arabidopsis thaliana]
 gb|AAM51574.1| AT3g56680/T8M16_10 [Arabidopsis thaliana]
 gb|AAM63842.1| unknown [Arabidopsis thaliana]
 gb|AEE79551.1| Single-stranded nucleic acid binding R3H protein [Arabidopsis 
thaliana]
Length=353

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = +3

Query  462  DIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVA  641
            D   +VD FL EAL N R RL++LRME DV++ +++P QQQ EFQ  PTSYLRLAAHRVA
Sbjct  19   DYGFNVDPFLVEALHNSRHRLTILRMELDVQRLLQNPEQQQFEFQHFPTSYLRLAAHRVA  78

Query  642  QHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
             HY L +   V  S  DG+ +RI+V KT+E + P++RL++IPV
Sbjct  79   NHYGLATA--VQESGADGNENRILVTKTTESKFPAVRLSEIPV  119



>ref|XP_007028262.1| Single-stranded nucleic acid binding R3H protein isoform 1 [Theobroma 
cacao]
 gb|EOY08764.1| Single-stranded nucleic acid binding R3H protein isoform 1 [Theobroma 
cacao]
Length=357

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = +3

Query  462  DIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVA  641
            DI ++VD FL EALQNPR RL++LRME D+++F++   Q Q EFQ  PTSYLRLAAHRVA
Sbjct  18   DIESAVDPFLVEALQNPRHRLTILRMELDIQRFLQQSDQHQFEFQHFPTSYLRLAAHRVA  77

Query  642  QHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            QHY L    +V  +  DG  SRI+V +T E R P++RL+++P 
Sbjct  78   QHYGL--ITMVQDNGLDGLGSRIMVTRTGEIRCPAVRLSEVPA  118



>ref|XP_010517577.1| PREDICTED: uncharacterized protein LOC104793004 [Camelina sativa]
Length=358

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/99 (57%), Positives = 74/99 (75%), Gaps = 2/99 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VD FL EALQNPR RL++LRME DV+KF+++P +QQ EFQ  P SYLRLAAHRVA HY 
Sbjct  20   TVDPFLVEALQNPRHRLTILRMELDVQKFLQNPDEQQFEFQHFPISYLRLAAHRVANHYG  79

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L ++V    +   G+ SRI+V K++E R P++RL +IP 
Sbjct  80   LVTSVRDGGA--GGNVSRILVTKSTESRFPAVRLFEIPA  116



>ref|XP_006576254.1| PREDICTED: uncharacterized protein LOC100814835 isoform X1 [Glycine 
max]
Length=356

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF+ +  QQ  EFQ  P+SYLRLAAHRVAQHY++
Sbjct  22   VDPFLVEALQNPRHRLTILRMELDIQKFLNNADQQHFEFQHFPSSYLRLAAHRVAQHYNM  81

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ D+ + DG  S+I+VRK  E + P +RL++IP 
Sbjct  82   Q-TMVQDNGL-DGQGSKILVRKLPESKYPVVRLSEIPA  117



>dbj|BAJ94462.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK02634.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=354

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 2/102 (2%)
 Frame = +3

Query  465  IVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQ  644
            + + VD FL EAL NPR RL VLRME D++KF+++    + EFQ  PTSYLR AAHRVAQ
Sbjct  40   VASHVDPFLVEALDNPRHRLMVLRMEMDIQKFMQNHQLHEFEFQHFPTSYLRCAAHRVAQ  99

Query  645  HYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            HY L++TV  DS V DGS SRI+ RKT E + P+I L+++PV
Sbjct  100  HYGLETTV-ADSLV-DGSNSRIVARKTPESKYPAIALSEVPV  139



>gb|AAO72578.1| unknown [Oryza sativa Japonica Group]
 gb|EEE63719.1| hypothetical protein OsJ_18537 [Oryza sativa Japonica Group]
Length=335

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 75/101 (74%), Gaps = 2/101 (2%)
 Frame = +3

Query  465  IVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQ  644
            + + VD FL EAL NPR RL VLRM  D++KF+++P   + EFQ  PTSYLR AAHRVAQ
Sbjct  21   VTSHVDPFLVEALDNPRHRLMVLRMAMDIQKFMQNPQLHEFEFQHFPTSYLRCAAHRVAQ  80

Query  645  HYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            HY L++TV  DS V DGS S+I+ +KTSE ++P I L+++P
Sbjct  81   HYGLETTV-ADSLV-DGSVSKIVAKKTSESKLPVIALSEVP  119



>ref|NP_001242845.1| uncharacterized protein LOC100814835 [Glycine max]
 gb|ACU23119.1| unknown [Glycine max]
Length=336

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF+ +  QQ  EFQ  P+SYLRLAAHRVAQHY++
Sbjct  2    VDPFLVEALQNPRHRLTILRMELDIQKFLDNADQQHFEFQHFPSSYLRLAAHRVAQHYNM  61

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ D+ + DG  S+I+VRK  E + P +RL++IP 
Sbjct  62   Q-TMVQDNGL-DGQGSKILVRKLPESKYPVVRLSEIPA  97



>dbj|BAK04407.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=354

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/102 (58%), Positives = 75/102 (74%), Gaps = 2/102 (2%)
 Frame = +3

Query  465  IVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQ  644
            + + VD FL EAL NPR RL VLRME D++KF+++    + EFQ  PTSYLR AAHRVAQ
Sbjct  40   VASHVDPFLVEALDNPRHRLMVLRMEMDIQKFMQNHQLHEFEFQHFPTSYLRCAAHRVAQ  99

Query  645  HYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            HY L++TV  DS V DGS SRI+ RKT E + P+I L+++PV
Sbjct  100  HYGLETTV-ADSLV-DGSNSRIVARKTPESKYPAIALSEVPV  139



>ref|XP_006654401.1| PREDICTED: uncharacterized protein LOC102704805 isoform X1 [Oryza 
brachyantha]
Length=338

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 74/101 (73%), Gaps = 2/101 (2%)
 Frame = +3

Query  465  IVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQ  644
            + + VD FL EAL NPR RL VLRME D++KF+++P   + EFQ  PTSYLR AAHRVAQ
Sbjct  25   VTSHVDPFLVEALDNPRHRLMVLRMEMDIQKFMQNPQLHEFEFQHFPTSYLRCAAHRVAQ  84

Query  645  HYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            HY L++TV  DS V DGS S+I+ +KT E + P I L+++P
Sbjct  85   HYGLETTV-ADSLV-DGSVSKIVAKKTPESKFPVIALSEVP  123



>ref|XP_009146807.1| PREDICTED: cAMP-regulated phosphoprotein 21-like isoform X2 [Brassica 
rapa]
Length=334

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF   PTSYLRLAAHRVAQHY L
Sbjct  16   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFSPFPTSYLRLAAHRVAQHYGL  75

Query  657  QSTVLVDSSVP-DGSASRIIVRKTSECRMPSIRLADIPV  770
             +  L +     DGS +RI+V KT+E R P + L++IPV
Sbjct  76   VTMALDNGGGSVDGSDNRILVAKTAESRFPHVCLSEIPV  114



>ref|XP_009146806.1| PREDICTED: cAMP-regulated phosphoprotein 21-like isoform X1 [Brassica 
rapa]
Length=342

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF   PTSYLRLAAHRVAQHY L
Sbjct  16   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFEFSPFPTSYLRLAAHRVAQHYGL  75

Query  657  QSTVLVDSSVP-DGSASRIIVRKTSECRMPSIRLADIPV  770
             +  L +     DGS +RI+V KT+E R P + L++IPV
Sbjct  76   VTMALDNGGGSVDGSDNRILVAKTAESRFPHVCLSEIPV  114



>ref|XP_010909706.1| PREDICTED: uncharacterized protein LOC105035733 [Elaeis guineensis]
Length=361

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 75/102 (74%), Gaps = 2/102 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EAL+NPR RL+VLRME D++KF+++  Q Q EFQ LPTSYL+ AAHRVAQHY L
Sbjct  34   VDPFLVEALENPRHRLTVLRMELDIQKFMRNSDQYQFEFQHLPTSYLKCAAHRVAQHYGL  93

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
            Q+  L   S+ DG  SR+I RKT + + P++ L+++P   P+
Sbjct  94   QTMAL--DSIIDGLGSRVIARKTPDSKFPAVCLSEVPAKQPE  133



>emb|CAO02553.1| putative single-stranded nucleic acid binding R3H [Vigna unguiculata]
Length=131

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+ +  QQ  EF   P+SYLRLAAHRVAQHYS+
Sbjct  21   VDPFLVEALQNPRHRLTILRMELDIQRFMNNADQQHFEFPHFPSSYLRLAAHRVAQHYSM  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            Q T++ D  + DG  S+I+VRK  E + P ++L++IP
Sbjct  81   Q-TMVQDIGL-DGQGSKILVRKLPESKYPMVKLSEIP  115



>ref|XP_010492949.1| PREDICTED: uncharacterized protein LOC104770158 isoform X2 [Camelina 
sativa]
Length=329

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q E    PTSYLRLAAHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFELMPFPTSYLRLAAHRVAQHYGL  70

Query  657  QSTVLVDS-SVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L +     DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  71   VTMALDNGIGAGDGSENRILVTKTAESRFPCVCLSEIPVKQPEN  114



>ref|XP_010492872.1| PREDICTED: uncharacterized protein LOC104770158 isoform X1 [Camelina 
sativa]
Length=337

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q E    PTSYLRLAAHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPEQLQFELMPFPTSYLRLAAHRVAQHYGL  70

Query  657  QSTVLVDS-SVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
             +  L +     DGS +RI+V KT+E R P + L++IPV  P++
Sbjct  71   VTMALDNGIGAGDGSENRILVTKTAESRFPCVCLSEIPVKQPEN  114



>gb|EMT08505.1| R3H domain-containing protein 2 [Aegilops tauschii]
Length=347

 Score =   118 bits (295),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/102 (57%), Positives = 75/102 (74%), Gaps = 2/102 (2%)
 Frame = +3

Query  465  IVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQ  644
            + + VD FL EAL NPR RL +LRME D++KF+++    + EFQ  PTSYLR AAHRVAQ
Sbjct  33   VASHVDPFLVEALDNPRHRLMILRMELDIQKFMQNHHLHEFEFQHFPTSYLRCAAHRVAQ  92

Query  645  HYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            HY L++TV  DS V DGS SRI+ RKT E + P+I L+++PV
Sbjct  93   HYGLETTV-ADSLV-DGSNSRIVARKTPESKYPAIALSEVPV  132



>tpg|DAA46761.1| TPA: hypothetical protein ZEAMMB73_590191 [Zea mays]
Length=261

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +3

Query  537  MEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIV  716
            MEQ++ KFI DP++ + EF  LPTSYLRLAAHR+AQHY LQS  + D+S+PDG+ SRII+
Sbjct  1    MEQEILKFIHDPSRTEYEFDGLPTSYLRLAAHRLAQHYFLQSIDIPDNSLPDGTGSRIIL  60

Query  717  RKTS-ECRMPSIRLADIPVTFPQD  785
            RKT+ +CR+P +RLADIPV  PQ+
Sbjct  61   RKTTFDCRLPVVRLADIPVNLPQE  84



>gb|AFW76047.1| hypothetical protein ZEAMMB73_671673 [Zea mays]
Length=273

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 69/84 (82%), Gaps = 1/84 (1%)
 Frame = +3

Query  537  MEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIV  716
            MEQ++ KFI DP++ + EF  LPTSYLRLAAHR+AQHY LQS  + D+S+PDG+ S II+
Sbjct  1    MEQEILKFIHDPSRTEYEFNGLPTSYLRLAAHRLAQHYFLQSIAIPDNSLPDGTGSHIIL  60

Query  717  RKTS-ECRMPSIRLADIPVTFPQD  785
            RKT+ +CR+P++RLADIPV  PQ+
Sbjct  61   RKTTFDCRLPAVRLADIPVNLPQE  84



>ref|XP_010558120.1| PREDICTED: uncharacterized protein LOC104826881 [Tarenaya hassleriana]
Length=333

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 56/96 (58%), Positives = 73/96 (76%), Gaps = 2/96 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME +V++F+++P QQQ EFQ  PTSYLRLAAHR+AQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMEFEVQRFLQNPEQQQFEFQHYPTSYLRLAAHRIAQHYGL  70

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADI  764
             + V+   S  DGS + I+ RKT+E R P + L++I
Sbjct  71   VTMVMDSGS--DGSGNGILARKTAESRHPLVCLSEI  104



>emb|CDP06226.1| unnamed protein product [Coffea canephora]
Length=464

 Score =   119 bits (297),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 75/103 (73%), Gaps = 2/103 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF+++   QQ EFQ  PTSYLRLAAHRVAQHY L
Sbjct  132  VDPFLVEALQNPRHRLTILRMELDIQKFLQNGDLQQFEFQHFPTSYLRLAAHRVAQHYGL  191

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
                +V  ++ DG  +RI+VRK +E + P++ L+D+P    ++
Sbjct  192  --LTMVKDNLVDGQGTRILVRKQAESKFPAVCLSDVPAKLSEN  232



>emb|CDY36274.1| BnaA01g31440D [Brassica napus]
Length=319

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF   PTSYLRLAAHRVAQHY L
Sbjct  14   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPDQLQFEFPPFPTSYLRLAAHRVAQHYGL  73

Query  657  QSTVLVDSSVP-DGSASRIIVRKTSECRMPSIRLADIPV  770
             +T L + +   DGS  RI+  KT+E R P + L++IPV
Sbjct  74   VTTALDNGAGALDGSDIRILATKTAESRFPHVCLSEIPV  112



>ref|XP_009386294.1| PREDICTED: uncharacterized protein LOC103973455 [Musa acuminata 
subsp. malaccensis]
Length=360

 Score =   117 bits (294),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 76/104 (73%), Gaps = 2/104 (2%)
 Frame = +3

Query  459  EDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRV  638
            E++++ VD FL E L+NPR RL+VLRME D+++F+++P  Q  EFQ LPTSYLR AAHRV
Sbjct  27   EELLSQVDPFLLEVLENPRHRLTVLRMELDIQRFMQNPYHQHFEFQPLPTSYLRCAAHRV  86

Query  639  AQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            AQHY LQ+  L   +V DG  SR++ RKT + + P + L+++P 
Sbjct  87   AQHYGLQTMAL--DNVVDGLGSRVVARKTPQSKYPVVCLSEVPA  128



>ref|XP_009770790.1| PREDICTED: R3H domain-containing protein 1-like [Nicotiana sylvestris]
Length=343

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 73/97 (75%), Gaps = 2/97 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF+++   QQ EF   PTSYLRLAAHRVAQHY L
Sbjct  12   VDPFLVEALQNPRHRLTILRMEFDIQKFLQNSDLQQFEFPHFPTSYLRLAAHRVAQHYGL  71

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            Q+  +V  +V DG  ++I+V +  E + P++RL+DIP
Sbjct  72   QT--MVQDNVVDGQGAKILVTRKPESKYPAVRLSDIP  106



>ref|XP_011079086.1| PREDICTED: uncharacterized protein LOC105162694 [Sesamum indicum]
Length=364

 Score =   117 bits (292),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/101 (58%), Positives = 76/101 (75%), Gaps = 2/101 (2%)
 Frame = +3

Query  468  VNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQH  647
            V+ VD FL EALQNPR RL++LRME DV+KF+K+   QQ EF   PTSYLRLAAHRVAQH
Sbjct  31   VSMVDPFLVEALQNPRHRLNILRMELDVQKFLKNSDVQQFEFPHFPTSYLRLAAHRVAQH  90

Query  648  YSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Y +Q T++ D++V DG  SRI+V K  E + P++ L+D+P 
Sbjct  91   YGVQ-TLVQDNAV-DGQGSRILVIKKPESKFPTVCLSDVPA  129



>ref|XP_009410414.1| PREDICTED: R3H domain-containing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=339

 Score =   116 bits (291),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 76/103 (74%), Gaps = 2/103 (2%)
 Frame = +3

Query  459  EDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRV  638
            E  +  VD FL +AL+NPR RL+VLRME  +++F+++P Q Q EFQ LPTSYLR AAHRV
Sbjct  13   EGFLAQVDSFLVDALENPRHRLTVLRMELAIQRFMQNPDQHQFEFQHLPTSYLRCAAHRV  72

Query  639  AQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            AQHY L  T+ +D+SV DG  SR+I RKT   + P+I L+++P
Sbjct  73   AQHYGLH-TMSLDNSV-DGLGSRVIARKTPNSKYPAICLSEVP  113



>ref|XP_009122628.1| PREDICTED: uncharacterized protein LOC103847318 [Brassica rapa]
Length=319

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 72/99 (73%), Gaps = 1/99 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF ++P Q Q EF   PTSYLRLAAHRVAQHY L
Sbjct  14   VDPFLVEALQNPRHRLTILRMELDIQKFFQNPDQLQFEFPPFPTSYLRLAAHRVAQHYGL  73

Query  657  QSTVLVDSSVP-DGSASRIIVRKTSECRMPSIRLADIPV  770
             +T L + +   DGS  RI+  +T+E R P + L++IPV
Sbjct  74   VTTALDNGAGALDGSDIRILATRTAESRFPHVCLSEIPV  112



>ref|XP_004144321.1| PREDICTED: cAMP-regulated phosphoprotein 21 [Cucumis sativus]
 ref|XP_011653850.1| PREDICTED: cAMP-regulated phosphoprotein 21 [Cucumis sativus]
 gb|KGN54682.1| hypothetical protein Csa_4G420720 [Cucumis sativus]
Length=339

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 78/104 (75%), Gaps = 3/104 (3%)
 Frame = +3

Query  459  EDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRV  638
            +D V++VD FL EAL NPR RL++LRME D+++F+++  QQ  EFQ  PTSYLRLAAHRV
Sbjct  17   KDKVSTVDPFLIEALHNPRHRLTILRMELDIQRFLQNQDQQLFEFQHFPTSYLRLAAHRV  76

Query  639  AQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            AQHY LQ T++ D+ + DG   RI+V+KT E R P+I L+ IP 
Sbjct  77   AQHYGLQ-TMVQDNGI-DGQG-RILVKKTVEARFPTICLSQIPA  117



>gb|KHG23664.1| R3H domain-containing 1 [Gossypium arboreum]
Length=361

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VD FL EALQNPR RL++LRME D+++F+++  QQQ EFQ  PTSYLRLAAHRVAQHY 
Sbjct  25   AVDPFLVEALQNPRHRLTILRMELDIQRFVQNSEQQQFEFQHFPTSYLRLAAHRVAQHYG  84

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L  T++ D+ + DG  +RI+ +K  E + P++ L++IP 
Sbjct  85   L-VTMVYDNGL-DGLGNRIVAKKAGEIKWPAVCLSEIPA  121



>ref|XP_009611070.1| PREDICTED: R3H domain-containing protein 2 [Nicotiana tomentosiformis]
Length=342

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF+++   Q  EF   PTSYLRLAAHRVAQHY L
Sbjct  12   VDPFLVEALQNPRHRLTILRMELDIQKFLQNSDLQHFEFPHFPTSYLRLAAHRVAQHYGL  71

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            Q+  +V  +V DG  ++I+V +  E + P++RL+DIP
Sbjct  72   QT--MVQDNVVDGQGAKILVTRKPESKFPAVRLSDIP  106



>ref|NP_001105871.1| DIP1 [Zea mays]
 gb|AAZ73119.1| DIP1 [Zea mays]
Length=348

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 58/99 (59%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +3

Query  453  VPEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAH  632
            V E + + VD FL EAL NPR RL VLRME D++ F+++P  Q+ EFQ  PTSYLR AAH
Sbjct  31   VDERVASHVDPFLVEALDNPRHRLMVLRMELDIQNFMQNPQLQEFEFQNFPTSYLRCAAH  90

Query  633  RVAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSI  749
            RVAQHY L+ T++ DS V +GS SRI+ RKT+E R P+I
Sbjct  91   RVAQHYGLE-TIVADSLV-EGSVSRIVARKTAESRYPAI  127



>ref|XP_004249122.1| PREDICTED: R3H domain-containing protein 2 [Solanum lycopersicum]
Length=342

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF++    QQ EF   PTSYLRLAAHRVAQHY L
Sbjct  12   VDPFLVEALQNPRHRLTILRMELDIQKFLQSSDVQQFEFPHFPTSYLRLAAHRVAQHYGL  71

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            Q+  +V  +V DG  ++I+V +  E + P++RL+D+P
Sbjct  72   QT--MVQDNVVDGQGAKILVTRKPESKYPAVRLSDVP  106



>ref|XP_007162049.1| hypothetical protein PHAVU_001G119400g [Phaseolus vulgaris]
 gb|ESW34043.1| hypothetical protein PHAVU_001G119400g [Phaseolus vulgaris]
Length=355

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+ +  QQ  EF   P+SYLRLAAHRVAQHYSL
Sbjct  21   VDPFLVEALQNPRHRLTILRMELDIQRFMNNADQQHFEFPHFPSSYLRLAAHRVAQHYSL  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ D+ + DG  S+I+VRK  E + P +RL++IP 
Sbjct  81   Q-TMVQDNGL-DGQGSKILVRKLPERKYPVVRLSEIPA  116



>emb|CAO02563.1| putative single-stranded nucleic acid binding R3H [Vigna unguiculata]
Length=118

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 74/103 (72%), Gaps = 2/103 (2%)
 Frame = +3

Query  459  EDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRV  638
            +D  + VD FL EALQNPR RL++LRME D+++F+    QQ  EF   P+SYLRLAAHRV
Sbjct  15   KDKESMVDPFLVEALQNPRHRLTILRMELDIQRFMTSADQQHFEFPHFPSSYLRLAAHRV  74

Query  639  AQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            AQ YS+Q T++ D  + DG  S+I+VRK  E + P ++L+DIP
Sbjct  75   AQRYSMQ-TMVQDIGL-DGQGSKILVRKLPESKYPMVKLSDIP  115



>gb|KJB46182.1| hypothetical protein B456_007G351600 [Gossypium raimondii]
Length=362

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 73/99 (74%), Gaps = 2/99 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VD FL EALQNPR RL++LRME D+++F++   QQQ EFQ  PTSYLRLAAHRVAQHY 
Sbjct  26   AVDPFLVEALQNPRHRLTILRMELDIQRFVQSSEQQQFEFQHFPTSYLRLAAHRVAQHYG  85

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L  T++ D+ + DG  +RI+ +K  E + P + L++IP 
Sbjct  86   L-VTMVYDNGL-DGLGNRIVAKKAGEIKWPGVCLSEIPA  122



>ref|XP_004493365.1| PREDICTED: uncharacterized protein LOC101493813 [Cicer arietinum]
Length=354

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 78/104 (75%), Gaps = 3/104 (3%)
 Frame = +3

Query  459  EDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRV  638
            +D  + VD FL EALQNPR RL++LRME D++KF+ +  QQ  EFQ  P+SYLRLAAHRV
Sbjct  16   KDKESMVDPFLVEALQNPRHRLTILRMELDIQKFLNNGDQQHFEFQHFPSSYLRLAAHRV  75

Query  639  AQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            AQHY +Q T++ D+ + DG  S+I+VRK +E + P +RL++IP 
Sbjct  76   AQHYGMQ-TMVQDTGL-DGQ-SKILVRKLAESKYPVVRLSEIPA  116



>ref|NP_001241328.1| uncharacterized protein LOC100784326 [Glycine max]
 gb|ACU18394.1| unknown [Glycine max]
 gb|KHN21668.1| cAMP-regulated phosphoprotein 21 [Glycine soja]
Length=355

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 74/98 (76%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EAL+NPR R+++LRME D+++F+ +   Q  EFQ  P+SYLRLAAHRVAQHY +
Sbjct  21   VDPFLVEALENPRHRVTILRMELDIQRFLSNADYQHFEFQHFPSSYLRLAAHRVAQHYGM  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ D+ + DG  +RI+VRK +E R P +RL++IP 
Sbjct  81   Q-TMVQDNGL-DGQGTRIMVRKMAESRYPMVRLSEIPA  116



>ref|XP_007145505.1| hypothetical protein PHAVU_007G244200g [Phaseolus vulgaris]
 gb|ESW17499.1| hypothetical protein PHAVU_007G244200g [Phaseolus vulgaris]
Length=356

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/96 (55%), Positives = 74/96 (77%), Gaps = 2/96 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR R+++LRME D+++F+ +  QQ  EFQ  P+SY+RLAAHRVAQHY +
Sbjct  21   VDPFLIEALQNPRHRVTILRMELDIQRFLNNADQQHFEFQHFPSSYIRLAAHRVAQHYGM  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADI  764
            Q T++ D+ + DG  +RI+VRK +E R P +RL++I
Sbjct  81   Q-TMVQDNGL-DGQGTRIMVRKLAESRYPVVRLSEI  114



>ref|XP_006366388.1| PREDICTED: R3H domain-containing protein 2-like [Solanum tuberosum]
Length=159

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (70%), Gaps = 2/96 (2%)
 Frame = +3

Query  480  DQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQ  659
            D FL EALQNPR RL++LRME D++KF++    QQ E+   PTSYL LAAHRV QHY LQ
Sbjct  13   DPFLVEALQNPRHRLTILRMELDIQKFLQSSDVQQFEYPHFPTSYLHLAAHRVPQHYGLQ  72

Query  660  STVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            +  +V  SV DG  ++I V +  E + P +RL+DIP
Sbjct  73   T--MVQDSVVDGQGAKIPVTRKPESKYPGVRLSDIP  106



>ref|XP_003624916.1| R3H domain-containing protein [Medicago truncatula]
Length=244

 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 3/98 (3%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF+ +  QQ  EFQ  P+SYLRLAAHRVAQHY +
Sbjct  21   VDPFLVEALQNPRHRLTILRMELDIQKFMNNADQQHFEFQHFPSSYLRLAAHRVAQHYGM  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ D  + DG  S+I+VRK  E + P +RL++IP 
Sbjct  81   Q-TMVQDIGL-DGQ-SKILVRKLPESKYPVVRLSEIPA  115



>ref|XP_010931539.1| PREDICTED: R3H domain-containing protein 1-like [Elaeis guineensis]
Length=362

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 73/102 (72%), Gaps = 2/102 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EAL+NPR RL+VLRME D++KFI++  Q Q EFQ LPTSYLR  AHRVAQHY L
Sbjct  35   VDPFLVEALENPRHRLAVLRMELDIQKFIQNCDQYQFEFQHLPTSYLRRVAHRVAQHYGL  94

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
            Q+  +   S+ DG  SR+  RKT + R P++ L+++P   P+
Sbjct  95   QT--MSPDSIIDGLGSRVTARKTPDSRFPAVCLSEVPAKQPE  134



>ref|XP_002517274.1| r3h domain containing protein, putative [Ricinus communis]
 gb|EEF45067.1| r3h domain containing protein, putative [Ricinus communis]
Length=350

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/98 (55%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EAL NP  RL++LRME D+++F++ P QQQ EFQ  PTSYLRLAAHRVAQHY L
Sbjct  16   VDPFLVEALHNPSHRLTILRMEHDIQRFLQIPDQQQFEFQHFPTSYLRLAAHRVAQHYGL  75

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
                +V     DG  ++I+V+KT+E R P++ L +IP 
Sbjct  76   --ITMVQDYGYDGLVNKILVKKTAESRYPAVCLCEIPA  111



>ref|XP_011040734.1| PREDICTED: uncharacterized protein LOC105136920 [Populus euphratica]
Length=354

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 75/98 (77%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D+++F+++P QQ  EFQ  PTSYLRLAAHRVA HY L
Sbjct  19   VDPFLVEALQNPRHRLTILRMELDIQRFLQNPDQQLFEFQHFPTSYLRLAAHRVAHHYGL  78

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
              T+  D+ + DG A++I+V+KT++ R P++ L +IP 
Sbjct  79   -ITMGQDNGI-DGLANKILVQKTAQSRYPAVCLTEIPA  114



>ref|XP_011070087.1| PREDICTED: cAMP-regulated phosphoprotein 21-like [Sesamum indicum]
Length=367

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 73/105 (70%), Gaps = 2/105 (2%)
 Frame = +3

Query  456  PEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHR  635
            P   V+ VD FL EALQNPR RL++LRME DV+KF++    QQ EF   PTSYLRLAAHR
Sbjct  28   PPAYVSMVDPFLVEALQNPRHRLTILRMELDVQKFLQSSDLQQFEFPHFPTSYLRLAAHR  87

Query  636  VAQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            VAQHY LQ+  +V  +V DG   RI+V +  E + P++ L+D+P 
Sbjct  88   VAQHYGLQT--MVQDNVVDGQGIRILVIRKPESKFPAVCLSDVPA  130



>ref|XP_008455743.1| PREDICTED: R3H domain-containing protein 1-like isoform X1 [Cucumis 
melo]
Length=338

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = +3

Query  459  EDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRV  638
            +D V+ VD FL E L NPR RL++LRME D+++F+++  QQ  EFQ  PTSYLRLAAHRV
Sbjct  17   KDKVSVVDPFLIEVLHNPRHRLTILRMELDIQRFLQNQEQQVFEFQHFPTSYLRLAAHRV  76

Query  639  AQHYSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            AQHY LQ T++ D+ + DG   RI+V+KT E R P+I L+ IP 
Sbjct  77   AQHYGLQ-TMVQDNGI-DGQG-RILVKKTVEARFPTICLSQIPA  117



>ref|XP_006364781.1| PREDICTED: R3H domain-containing protein 2-like [Solanum tuberosum]
Length=342

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 72/97 (74%), Gaps = 2/97 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF++    QQ+E    PTSYLRLAAHRVAQHY L
Sbjct  12   VDPFLVEALQNPRHRLTILRMELDIQKFLQSSDVQQLELPHFPTSYLRLAAHRVAQHYGL  71

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIP  767
            Q+  +V  +V DG  ++I+V +  E + P++RL+D+P
Sbjct  72   QT--MVQDNVVDGQGAKILVTRKPESKYPAVRLSDVP  106



>gb|EYU20818.1| hypothetical protein MIMGU_mgv1a008714mg [Erythranthe guttata]
Length=364

 Score =   113 bits (283),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 75/101 (74%), Gaps = 2/101 (2%)
 Frame = +3

Query  468  VNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQH  647
            V++VD FL EALQNPR RL++LRME D++KF+++P   Q EF   PTSYLRLAAHRVAQH
Sbjct  37   VSAVDPFLVEALQNPRHRLTILRMELDMQKFLQNPDMHQFEFPHFPTSYLRLAAHRVAQH  96

Query  648  YSLQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Y LQ T++ D+++ D    RI+V K  E + P++ L+D+P 
Sbjct  97   YGLQ-TMVQDNTI-DAQGIRILVIKRPESKFPAVCLSDVPA  135



>ref|XP_010491040.1| PREDICTED: uncharacterized protein LOC104768705 [Camelina sativa]
Length=325

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 75/102 (74%), Gaps = 1/102 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF + P QQQ EFQ LPTSYLRL AHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQSPEQQQYEFQPLPTSYLRLIAHRVAQHYGL  70

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
             +T L    + DGS +RI+  KT+E R P + L++IPV  P+
Sbjct  71   FTTALDGGGL-DGSGNRILATKTAESRYPYVCLSEIPVKQPE  111



>ref|XP_003624915.1| R3H domain-containing protein [Medicago truncatula]
 gb|ABN09177.1| Single-stranded nucleic acid binding R3H [Medicago truncatula]
 gb|AES81133.1| single-stranded nucleic acid-binding protein R3H [Medicago truncatula]
Length=353

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/98 (57%), Positives = 73/98 (74%), Gaps = 3/98 (3%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF+ +  QQ  EFQ  P+SYLRLAAHRVAQHY +
Sbjct  21   VDPFLVEALQNPRHRLTILRMELDIQKFMNNADQQHFEFQHFPSSYLRLAAHRVAQHYGM  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ D  + DG  S+I+VRK  E + P +RL++IP 
Sbjct  81   Q-TMVQDIGL-DGQ-SKILVRKLPESKYPVVRLSEIPA  115



>gb|KHN08910.1| R3H domain-containing protein 2 [Glycine soja]
Length=355

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME +++KF+ +  Q   EF   P+SYLRLAAHRVAQHY++
Sbjct  21   VDPFLVEALQNPRHRLTILRMELEIQKFLNNADQLHFEFHHFPSSYLRLAAHRVAQHYNM  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ D+ + DG  S+I+VRK  E + P +RL++IP 
Sbjct  81   Q-TMVQDNGL-DGQGSKILVRKLPESKYPVVRLSEIPA  116



>ref|XP_003554106.1| PREDICTED: R3H domain-containing protein 2-like [Glycine max]
Length=355

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME +++KF+ +  Q   EF   P+SYLRLAAHRVAQHY++
Sbjct  21   VDPFLVEALQNPRHRLTILRMELEIQKFLNNADQLHFEFHHFPSSYLRLAAHRVAQHYNM  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ D+ + DG  S+I+VRK  E + P +RL++IP 
Sbjct  81   Q-TMVQDNGL-DGQGSKILVRKLPESKYPVVRLSEIPA  116



>gb|EYU18596.1| hypothetical protein MIMGU_mgv1a009115mg [Erythranthe guttata]
Length=353

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 70/98 (71%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF++    QQ EF   PTSYLRLAAHRVAQHY L
Sbjct  38   VDPFLVEALQNPRHRLTILRMELDIQKFLQTSALQQFEFPHFPTSYLRLAAHRVAQHYGL  97

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q+  +V  + PDG   +I+V K  E + P++ L+++P 
Sbjct  98   QT--MVQDTAPDGQGVQILVIKNQESKFPAVCLSEVPA  133



>ref|XP_003535913.1| PREDICTED: uncharacterized protein LOC100799336 [Glycine max]
 gb|KHN25128.1| R3H domain-containing protein 2 [Glycine soja]
Length=352

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 73/98 (74%), Gaps = 2/98 (2%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR R+++LRME D+++F+ +  QQ  EFQ  P+SYLRLAAHRVAQHY +
Sbjct  21   VDPFLVEALQNPRHRVTILRMELDIQRFLNNADQQHFEFQHFPSSYLRLAAHRVAQHYGM  80

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            Q T++ D+   +G  +RI+VRK +E R P + L++IP 
Sbjct  81   Q-TMVQDNGF-NGQGTRIMVRKIAESRYPVVCLSEIPA  116



>ref|XP_010452414.1| PREDICTED: uncharacterized protein LOC104734514 [Camelina sativa]
Length=324

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 75/102 (74%), Gaps = 1/102 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF + P QQQ EFQ LPTSYLRL AHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQSPEQQQYEFQPLPTSYLRLIAHRVAQHYGL  70

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
             +T L    + DGS +RI+  KT++ R P + L++IPV  P+
Sbjct  71   FTTALDGGGL-DGSGNRILATKTADSRYPYVCLSEIPVKQPE  111



>ref|XP_010423500.1| PREDICTED: uncharacterized protein LOC104708604 [Camelina sativa]
Length=324

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 75/102 (74%), Gaps = 1/102 (1%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++LRME D++KF + P QQQ EFQ LPTSYLRL AHRVAQHY L
Sbjct  11   VDPFLVEALQNPRHRLTILRMELDIQKFFQSPEQQQYEFQPLPTSYLRLIAHRVAQHYGL  70

Query  657  QSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPVTFPQ  782
             +T L    + DGS +RI+  KT++ R P + L++IPV  P+
Sbjct  71   FTTALDGGGL-DGSGNRILATKTADSRYPYVCLSEIPVKQPE  111



>ref|XP_010543916.1| PREDICTED: cysteine proteinase inhibitor 7 [Tarenaya hassleriana]
Length=299

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 66/92 (72%), Gaps = 2/92 (2%)
 Frame = +3

Query  510  PRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVP  689
            P     VLRME +V++F++DP QQQ EFQ  PTSYLRLAAHRVAQHY L    +V  S  
Sbjct  115  PWMNFHVLRMELEVQRFLQDPDQQQFEFQHYPTSYLRLAAHRVAQHYGL--VTMVTDSGS  172

Query  690  DGSASRIIVRKTSECRMPSIRLADIPVTFPQD  785
            DG  +RI+VRKT+E R P +RL++IPV  P++
Sbjct  173  DGPGNRILVRKTAETRYPLVRLSEIPVKQPEN  204



>ref|XP_006398969.1| hypothetical protein EUTSA_v10014404mg [Eutrema salsugineum]
 gb|ESQ40422.1| hypothetical protein EUTSA_v10014404mg [Eutrema salsugineum]
Length=241

 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = +3

Query  522  LSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSA  701
            + VLRME D++KF + P QQQ EF+ LPTSYLRLAAHRVAQHY L +T L DS   DGS 
Sbjct  1    MPVLRMELDIQKFYQSPEQQQFEFRPLPTSYLRLAAHRVAQHYGLFTTAL-DSGALDGSG  59

Query  702  SRIIVRKTSECRMPSIRLADIPVTFPQ  782
            +RI+V KT+E R P + L++IPV  P+
Sbjct  60   NRILVTKTAESRYPYVCLSEIPVKQPE  86



>emb|CDY61685.1| BnaCnng38270D [Brassica napus]
Length=341

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VD FL EALQNPR RL++LRME DV++F++   QQQ EFQ+ PTSYLRLAAHRVA HY 
Sbjct  23   TVDPFLVEALQNPRHRLTILRMELDVQRFLQSQEQQQFEFQRFPTSYLRLAAHRVANHYG  82

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L ++V  D  V DG+ + I+V KTS  + P+++L+DIP 
Sbjct  83   LATSVQ-DGGV-DGNENIILVTKTSASKFPTVKLSDIPA  119



>ref|XP_009139085.1| PREDICTED: protein encore [Brassica rapa]
Length=338

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VD FL EALQNPR RL++LRME DV++F++   QQQ EFQ+ PTSYLRLAAHRVA HY 
Sbjct  18   TVDPFLVEALQNPRHRLTILRMELDVQRFLQSQEQQQFEFQRFPTSYLRLAAHRVASHYG  77

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L ++V  D  V DGS + I+V KT+  + P+++L+DIP 
Sbjct  78   LATSVQ-DGGV-DGSENIILVTKTAVSKFPTVKLSDIPA  114



>emb|CDX76005.1| BnaA04g02690D [Brassica napus]
Length=338

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 75/99 (76%), Gaps = 2/99 (2%)
 Frame = +3

Query  474  SVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYS  653
            +VD FL EALQNPR RL++LRME DV++F++   QQQ EFQ+ PTSYLRLAAHRVA HY 
Sbjct  18   TVDPFLVEALQNPRHRLTILRMELDVQRFLQSQEQQQFEFQRFPTSYLRLAAHRVASHYG  77

Query  654  LQSTVLVDSSVPDGSASRIIVRKTSECRMPSIRLADIPV  770
            L ++V  D  V DGS + I+V KT+  + P+++L+DIP 
Sbjct  78   LATSVQ-DGGV-DGSENIILVTKTAVSKFPTVKLSDIPA  114



>ref|XP_008648331.1| PREDICTED: DIP1 isoform X1 [Zea mays]
Length=344

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +3

Query  528  VLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASR  707
            VLRME D++ F+++P  Q+ EFQ  PTSYLR AAHRVAQHY L+ T++ DS V +GS SR
Sbjct  51   VLRMELDIQNFMQNPQLQEFEFQNFPTSYLRCAAHRVAQHYGLE-TIVADSLV-EGSVSR  108

Query  708  IIVRKTSECRMPSIRLADIP  767
            I+ RKT+E R P+I L+++P
Sbjct  109  IVARKTAESRYPAIFLSEVP  128



>ref|XP_002994204.1| hypothetical protein SELMODRAFT_449328 [Selaginella moellendorffii]
 gb|EFJ04709.1| hypothetical protein SELMODRAFT_449328 [Selaginella moellendorffii]
Length=402

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 74/106 (70%), Gaps = 7/106 (7%)
 Frame = +3

Query  456  PEDIVNSVDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHR  635
            PE + + VD FL EALQNPR+RL+VLR+EQ+++KF K+   QQ+EFQ + + + +LA  R
Sbjct  29   PEIVSDQVDNFLLEALQNPRDRLTVLRLEQEIQKFAKNAEVQQLEFQPMGSPFCQLATQR  88

Query  636  VAQHYSLQSTVLVDSSVPDGSASRIIVRKT--SECRMPSIRLADIP  767
            VAQHY L+++V V+SS      +RI V K+   E R   IRLADIP
Sbjct  89   VAQHYGLKTSV-VESS----GGARIHVTKSLDGENRQSGIRLADIP  129



>ref|XP_008648333.1| PREDICTED: DIP1 isoform X3 [Zea mays]
Length=338

 Score = 97.4 bits (241),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 62/80 (78%), Gaps = 2/80 (3%)
 Frame = +3

Query  528  VLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASR  707
            VLRME D++ F+++P  Q+ EFQ  PTSYLR AAHRVAQHY L+ T++ DS V +GS SR
Sbjct  45   VLRMELDIQNFMQNPQLQEFEFQNFPTSYLRCAAHRVAQHYGLE-TIVADSLV-EGSVSR  102

Query  708  IIVRKTSECRMPSIRLADIP  767
            I+ RKT+E R P+I L+++P
Sbjct  103  IVARKTAESRYPAIFLSEVP  122



>gb|ABS18738.1| superoxide dismutase-like protein [Oryza sativa Japonica Group]
Length=283

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +3

Query  528  VLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASR  707
            VLRM  D++KF+++P   + EFQ  PTSYLR AAHRVAQHY L++TV  DS V DGS S+
Sbjct  2    VLRMAMDIQKFMQNPQLHEFEFQHFPTSYLRCAAHRVAQHYGLETTV-ADSLV-DGSVSK  59

Query  708  IIVRKTSECRMPSIRLADIP  767
            I+ +KTSE ++P I L+++P
Sbjct  60   IVAKKTSESKLPVIALSEVP  79



>ref|XP_006654402.1| PREDICTED: uncharacterized protein LOC102704805 isoform X2 [Oryza 
brachyantha]
Length=294

 Score = 96.3 bits (238),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 60/80 (75%), Gaps = 2/80 (3%)
 Frame = +3

Query  528  VLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASR  707
            VLRME D++KF+++P   + EFQ  PTSYLR AAHRVAQHY L++TV  DS V DGS S+
Sbjct  2    VLRMEMDIQKFMQNPQLHEFEFQHFPTSYLRCAAHRVAQHYGLETTV-ADSLV-DGSVSK  59

Query  708  IIVRKTSECRMPSIRLADIP  767
            I+ +KT E + P I L+++P
Sbjct  60   IVAKKTPESKFPVIALSEVP  79



>ref|XP_008648334.1| PREDICTED: DIP1 isoform X4 [Zea mays]
Length=291

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 59/77 (77%), Gaps = 2/77 (3%)
 Frame = +3

Query  537  MEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIV  716
            ME D++ F+++P  Q+ EFQ  PTSYLR AAHRVAQHY L+ T++ DS V +GS SRI+ 
Sbjct  1    MELDIQNFMQNPQLQEFEFQNFPTSYLRCAAHRVAQHYGLE-TIVADSLV-EGSVSRIVA  58

Query  717  RKTSECRMPSIRLADIP  767
            RKT+E R P+I L+++P
Sbjct  59   RKTAESRYPAIFLSEVP  75



>ref|XP_012088644.1| PREDICTED: cAMP-regulated phosphoprotein 21-like isoform X2 [Jatropha 
curcas]
Length=317

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 63/79 (80%), Gaps = 3/79 (4%)
 Frame = +3

Query  537  MEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIV  716
            ME D+++F+++P QQQ EFQ  PTSYLRLAAHRVAQHY L  T++ D+S+ DG  ++I+V
Sbjct  1    MELDIQRFLQNPDQQQFEFQHFPTSYLRLAAHRVAQHYGL-ITMVQDNSI-DGLTNKILV  58

Query  717  RKTS-ECRMPSIRLADIPV  770
            +KT+ E R P++RL++IP 
Sbjct  59   KKTTAESRYPAVRLSEIPA  77



>gb|EMS53007.1| hypothetical protein TRIUR3_31024 [Triticum urartu]
Length=322

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 44/78 (56%), Positives = 58/78 (74%), Gaps = 2/78 (3%)
 Frame = +3

Query  537  MEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSLQSTVLVDSSVPDGSASRIIV  716
            ME D++KF+++    + EFQ  PTSYLR AAHRVAQHY L++TV  DS V DGS SRI+ 
Sbjct  1    MELDIQKFMQNHHLHEFEFQHFPTSYLRCAAHRVAQHYGLETTV-ADSLV-DGSNSRIVA  58

Query  717  RKTSECRMPSIRLADIPV  770
            RKT E + P+I L+++PV
Sbjct  59   RKTPESKYPAIALSEVPV  76



>ref|XP_002868409.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44668.1| predicted protein, partial [Arabidopsis lyrata subsp. lyrata]
Length=70

 Score = 85.5 bits (210),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 47/60 (78%), Gaps = 0/60 (0%)
 Frame = +3

Query  477  VDQFLREALQNPRERLSVLRMEQDVEKFIKDPTQQQMEFQQLPTSYLRLAAHRVAQHYSL  656
            VD FL EALQNPR RL++L ME D++KF ++P Q Q+EF   PTSY+R AAHRVAQHY +
Sbjct  11   VDPFLVEALQNPRHRLTILSMEIDIQKFFQNPEQLQLEFLPFPTSYMRFAAHRVAQHYVI  70



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1572839714856