BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9154

Length=759
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg             162   2e-43   Prunus persica
emb|CDP02673.1|  unnamed protein product                                162   2e-43   Coffea canephora [robusta coffee]
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9           160   1e-42   Prunus mume [ume]
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9           154   2e-40   Pyrus x bretschneideri [bai li]
gb|ADL36578.1|  ARF domain class transcription factor                   153   5e-40   Malus domestica [apple tree]
ref|XP_012079519.1|  PREDICTED: auxin-responsive protein IAA9           152   9e-40   Jatropha curcas
ref|XP_006426197.1|  hypothetical protein CICLE_v10025873mg             148   3e-38   Citrus clementina [clementine]
ref|XP_006466369.1|  PREDICTED: auxin-responsive protein IAA9-like      148   4e-38   Citrus sinensis [apfelsine]
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...    143   3e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...    142   9e-36   Nelumbo nucifera [Indian lotus]
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...    140   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_007047690.1|  Transcription factor, putative isoform 4           139   4e-35   
ref|XP_007047688.1|  Transcription factor, putative isoform 2           139   4e-35   Theobroma cacao [chocolate]
ref|XP_007047687.1|  Transcription factor, putative isoform 1           139   5e-35   Theobroma cacao [chocolate]
ref|XP_010105114.1|  Auxin-responsive protein IAA9                      137   2e-34   
gb|KJB18143.1|  hypothetical protein B456_003G035700                    132   3e-33   Gossypium raimondii
gb|KJB18142.1|  hypothetical protein B456_003G035700                    132   7e-33   Gossypium raimondii
ref|XP_008357957.1|  PREDICTED: LOW QUALITY PROTEIN: auxin-respon...    129   2e-32   
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9           132   2e-32   Fragaria vesca subsp. vesca
gb|KJB18140.1|  hypothetical protein B456_003G035700                    132   3e-32   Gossypium raimondii
gb|KJB18136.1|  hypothetical protein B456_003G035700                    132   3e-32   Gossypium raimondii
ref|XP_002528895.1|  transcription factor, putative                     130   1e-31   Ricinus communis
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like      128   7e-31   Sesamum indicum [beniseed]
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like      128   8e-31   Nelumbo nucifera [Indian lotus]
ref|XP_008440498.1|  PREDICTED: auxin-responsive protein IAA9-like      127   2e-30   Cucumis melo [Oriental melon]
gb|KCW59655.1|  hypothetical protein EUGRSUZ_H02407                     126   2e-30   Eucalyptus grandis [rose gum]
ref|XP_010023413.1|  PREDICTED: auxin-responsive protein IAA9 iso...    126   3e-30   
ref|XP_010023411.1|  PREDICTED: auxin-responsive protein IAA9 iso...    126   3e-30   Eucalyptus grandis [rose gum]
gb|KHG08155.1|  Auxin-responsive IAA9 -like protein                     124   2e-29   Gossypium arboreum [tree cotton]
ref|XP_003628839.1|  Indoleacetic acid-induced-like protein             123   4e-29   
ref|XP_007047689.1|  Transcription factor, putative isoform 3           121   2e-28   
gb|ACU19961.1|  unknown                                                 119   2e-28   Glycine max [soybeans]
gb|AFK49626.1|  unknown                                                 119   6e-28   Medicago truncatula
gb|ACJ84551.1|  unknown                                                 119   7e-28   Medicago truncatula
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g             119   8e-28   Phaseolus vulgaris [French bean]
ref|XP_002509993.1|  Auxin-responsive protein IAA19, putative           119   9e-28   
ref|XP_004143431.1|  PREDICTED: auxin-responsive protein IAA8-like      119   1e-27   Cucumis sativus [cucumbers]
ref|XP_004509715.1|  PREDICTED: auxin-responsive protein IAA9-lik...    119   1e-27   Cicer arietinum [garbanzo]
ref|XP_003534264.1|  PREDICTED: auxin-responsive protein IAA9           118   2e-27   Glycine max [soybeans]
gb|KJB71171.1|  hypothetical protein B456_011G109000                    116   3e-27   Gossypium raimondii
gb|KHG08881.1|  Auxin-responsive IAA9 -like protein                     117   5e-27   Gossypium arboreum [tree cotton]
gb|KJB71165.1|  hypothetical protein B456_011G109000                    117   5e-27   Gossypium raimondii
gb|KJB71166.1|  hypothetical protein B456_011G109000                    117   5e-27   Gossypium raimondii
gb|KJB71172.1|  hypothetical protein B456_011G109000                    117   5e-27   Gossypium raimondii
gb|AAM12952.1|  auxin-regulated protein                                 116   8e-27   Zinnia elegans [garden zinnia]
ref|XP_010547581.1|  PREDICTED: auxin-responsive protein IAA9-lik...    116   9e-27   
ref|XP_010547580.1|  PREDICTED: auxin-responsive protein IAA9-lik...    116   1e-26   Tarenaya hassleriana [spider flower]
ref|XP_002862301.1|  hypothetical protein ARALYDRAFT_920936             112   4e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_011073641.1|  PREDICTED: auxin-responsive protein IAA9-like      114   6e-26   Sesamum indicum [beniseed]
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g             113   1e-25   Phaseolus vulgaris [French bean]
gb|ADL70577.1|  indole-3-acetic acid inducible 9                        112   2e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70583.1|  indole-3-acetic acid inducible 9                        111   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29395.2|  indole-3-acetic acid inducible 9                        111   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70586.1|  indole-3-acetic acid inducible 9                        111   3e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70578.1|  indole-3-acetic acid inducible 9                        111   3e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002864969.1|  auxin-induced protein IAA9                         112   4e-25   
gb|ADC29394.1|  indole-3-acetic acid inducible 9                        111   4e-25   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29398.1|  indole-3-acetic acid inducible 9                        111   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_569017.2|  auxin-responsive protein IAA9                         111   5e-25   
dbj|BAB10673.1|  auxin-induced protein IAA9                             111   5e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851275.1|  auxin-responsive protein IAA9                         111   5e-25   Arabidopsis thaliana [mouse-ear cress]
gb|KHN46011.1|  Auxin-responsive protein IAA9                           111   5e-25   Glycine soja [wild soybean]
gb|ADL70579.1|  indole-3-acetic acid inducible 9                        110   6e-25   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64650.1|  auxin-induced protein IAA9                              111   6e-25   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001275473.1|  Aux/IAA protein                                    110   1e-24   Solanum tuberosum [potatoes]
ref|XP_003517136.1|  PREDICTED: auxin-responsive protein IAA9 iso...    110   1e-24   
ref|NP_001268170.1|  Aux/IAA protein                                    110   1e-24   Vitis vinifera
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1              110   1e-24   Vitis vinifera
ref|XP_006279648.1|  hypothetical protein CARUB_v10026736mg             110   1e-24   Capsella rubella
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg                109   1e-24   Erythranthe guttata [common monkey flower]
gb|EYU44548.1|  hypothetical protein MIMGU_mgv1a010252mg                110   1e-24   Erythranthe guttata [common monkey flower]
emb|CAN77436.1|  hypothetical protein VITISV_007399                     110   2e-24   Vitis vinifera
gb|ABB55368.1|  Aux/IAA protein-like                                    108   4e-24   Solanum tuberosum [potatoes]
gb|KJB58782.1|  hypothetical protein B456_009G226000                    108   5e-24   Gossypium raimondii
ref|XP_003531969.1|  PREDICTED: auxin-responsive protein IAA9-lik...    108   6e-24   Glycine max [soybeans]
gb|KJB58781.1|  hypothetical protein B456_009G226000                    108   6e-24   Gossypium raimondii
gb|KJB58777.1|  hypothetical protein B456_009G226000                    108   7e-24   Gossypium raimondii
ref|XP_006585902.1|  PREDICTED: auxin-responsive protein IAA9-lik...    108   7e-24   
gb|KHN22187.1|  Auxin-responsive protein IAA9                           108   7e-24   Glycine soja [wild soybean]
gb|AAL92850.1|  Aux/IAA protein                                         107   1e-23   Vitis vinifera
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like      107   2e-23   Glycine max [soybeans]
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...    107   2e-23   
gb|AAB70005.1|  GH1 protein                                             107   2e-23   Glycine max [soybeans]
ref|XP_010518881.1|  PREDICTED: auxin-responsive protein IAA9-like      106   3e-23   Tarenaya hassleriana [spider flower]
gb|ACU23129.1|  unknown                                                 104   3e-23   Glycine max [soybeans]
ref|XP_007018336.1|  Aux/IAA protein isoform 1                          106   5e-23   
gb|ABD98054.1|  auxin-regulated protein                                 105   5e-23   Striga asiatica [witchweed]
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg                104   1e-22   Erythranthe guttata [common monkey flower]
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)                 104   1e-22   
ref|XP_006394001.1|  hypothetical protein EUTSA_v10004532mg             104   2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_006394000.1|  hypothetical protein EUTSA_v10004532mg             103   2e-22   Eutrema salsugineum [saltwater cress]
ref|XP_012068087.1|  PREDICTED: auxin-responsive protein IAA9-like      104   2e-22   Jatropha curcas
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like      104   2e-22   Prunus mume [ume]
ref|XP_007225723.1|  hypothetical protein PRUPE_ppa006744mg             102   3e-22   
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9           103   4e-22   Glycine max [soybeans]
gb|KCW68554.1|  hypothetical protein EUGRSUZ_F02172                     102   5e-22   Eucalyptus grandis [rose gum]
gb|ADL70574.1|  indole-3-acetic acid inducible 9                        102   5e-22   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001280795.1|  auxin-responsive protein IAA8-like                 102   6e-22   Malus domestica [apple tree]
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg             102   7e-22   Prunus persica
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg             102   8e-22   
gb|AEI70507.1|  auxin-responsive protein                                102   9e-22   Gossypium hirsutum [American cotton]
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                     102   1e-21   Gossypium arboreum [tree cotton]
gb|KCW68553.1|  hypothetical protein EUGRSUZ_F02172                     102   1e-21   Eucalyptus grandis [rose gum]
ref|XP_010061570.1|  PREDICTED: auxin-responsive protein IAA9-like      102   1e-21   Eucalyptus grandis [rose gum]
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like      101   1e-21   
gb|KJB64034.1|  hypothetical protein B456_010G031600                    101   1e-21   Gossypium raimondii
emb|CDY68170.1|  BnaCnng57860D                                          100   2e-21   Brassica napus [oilseed rape]
gb|KJB64033.1|  hypothetical protein B456_010G031600                    100   3e-21   Gossypium raimondii
gb|KJB64027.1|  hypothetical protein B456_010G031600                    100   3e-21   Gossypium raimondii
ref|XP_010463449.1|  PREDICTED: auxin-responsive protein IAA9-lik...  99.8    6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010683059.1|  PREDICTED: auxin-responsive protein IAA9         99.0    1e-20   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001241389.1|  uncharacterized protein LOC100783314             98.6    2e-20   Glycine max [soybeans]
gb|AGV54485.1|  auxin-responsive protein                              98.6    2e-20   Phaseolus vulgaris [French bean]
gb|KHN08222.1|  Auxin-responsive protein IAA8                         98.6    2e-20   Glycine soja [wild soybean]
ref|XP_009150656.1|  PREDICTED: auxin-responsive protein IAA9-lik...  98.2    2e-20   Brassica rapa
ref|XP_009150655.1|  PREDICTED: auxin-responsive protein IAA9-lik...  98.2    2e-20   Brassica rapa
gb|KHN09036.1|  Auxin-responsive protein IAA8                         98.2    2e-20   Glycine soja [wild soybean]
ref|XP_010484401.1|  PREDICTED: auxin-responsive protein IAA9         98.2    2e-20   Camelina sativa [gold-of-pleasure]
gb|AFK38170.1|  unknown                                               97.8    3e-20   Lotus japonicus
emb|CAC84706.1|  aux/IAA protein                                      97.8    3e-20   Populus tremula x Populus tremuloides
ref|XP_007137671.1|  hypothetical protein PHAVU_009G146000g           97.4    5e-20   Phaseolus vulgaris [French bean]
emb|CDY08767.1|  BnaA06g24570D                                        96.7    6e-20   Brassica napus [oilseed rape]
gb|KDO81312.1|  hypothetical protein CISIN_1g017824mg                 95.1    7e-20   Citrus sinensis [apfelsine]
ref|XP_004512542.1|  PREDICTED: auxin-responsive protein IAA8-like    96.7    7e-20   Cicer arietinum [garbanzo]
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like    96.3    1e-19   Pyrus x bretschneideri [bai li]
gb|AFZ78618.1|  hypothetical protein                                  96.3    1e-19   Populus tomentosa [Chinese white poplar]
ref|XP_008338995.1|  PREDICTED: auxin-responsive protein IAA9-lik...  96.3    1e-19   
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...  96.3    1e-19   
gb|KDO81311.1|  hypothetical protein CISIN_1g017824mg                 95.5    1e-19   Citrus sinensis [apfelsine]
emb|CDY45607.1|  BnaCnng13150D                                        94.7    3e-19   Brassica napus [oilseed rape]
gb|KDO81310.1|  hypothetical protein CISIN_1g017824mg                 94.7    3e-19   Citrus sinensis [apfelsine]
ref|NP_001267710.1|  auxin-responsive protein IAA9-like               94.7    3e-19   Cucumis sativus [cucumbers]
gb|KDO81302.1|  hypothetical protein CISIN_1g017824mg                 94.7    4e-19   Citrus sinensis [apfelsine]
emb|CAJ13716.1|  auxin induced protein                                92.8    4e-19   Capsicum chinense [bonnet pepper]
emb|CDP00957.1|  unnamed protein product                              94.0    6e-19   Coffea canephora [robusta coffee]
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg           93.6    8e-19   
ref|XP_006433736.1|  hypothetical protein CICLE_v10001479mg           93.6    1e-18   Citrus clementina [clementine]
ref|XP_002302351.1|  auxin-responsive family protein                  93.2    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like    93.2    1e-18   Cucumis melo [Oriental melon]
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like    93.2    1e-18   Populus euphratica
gb|KHN04889.1|  Auxin-responsive protein IAA8                         92.4    2e-18   Glycine soja [wild soybean]
emb|CDY18679.1|  BnaA09g07160D                                        92.0    2e-18   Brassica napus [oilseed rape]
ref|XP_004299829.1|  PREDICTED: auxin-responsive protein IAA8-lik...  92.0    3e-18   Fragaria vesca subsp. vesca
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like    91.7    4e-18   Nicotiana tomentosiformis
ref|XP_010104556.1|  Auxin-responsive protein IAA9                    92.0    4e-18   
ref|XP_006472387.1|  PREDICTED: auxin-responsive protein IAA9-lik...  91.7    4e-18   Citrus sinensis [apfelsine]
ref|XP_010527157.1|  PREDICTED: auxin-responsive protein IAA8         91.7    4e-18   Tarenaya hassleriana [spider flower]
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like    90.9    6e-18   Nicotiana sylvestris
ref|XP_010444576.1|  PREDICTED: auxin-responsive protein IAA9-like    89.7    2e-17   
ref|XP_009112194.1|  PREDICTED: auxin-responsive protein IAA9-lik...  89.0    2e-17   Brassica rapa
ref|XP_009112193.1|  PREDICTED: auxin-responsive protein IAA9-lik...  89.0    2e-17   Brassica rapa
gb|AID60626.1|  auxin-responsive protein IAA8                         88.2    3e-17   Dimocarpus longan [longan]
emb|CAD10639.1|  IAA9 protein                                         88.6    4e-17   Nicotiana tabacum [American tobacco]
gb|AFK49555.1|  unknown                                               82.8    2e-16   Medicago truncatula
dbj|BAP94244.1|  auxin-responsive protein IAA homolog                 80.9    5e-16   Rubus grayanus
ref|XP_010555426.1|  PREDICTED: auxin-responsive protein IAA8-like    85.5    5e-16   Tarenaya hassleriana [spider flower]
ref|XP_011464769.1|  PREDICTED: auxin-responsive protein IAA8-lik...  85.1    6e-16   Fragaria vesca subsp. vesca
dbj|BAP94262.1|  auxin-responsive protein IAA homolog                 80.5    8e-16   Rubus sp. MM-2014
gb|AFK43616.1|  unknown                                               82.8    8e-16   Lotus japonicus
ref|XP_003612933.1|  Auxin-responsive protein (Aux/IAA)               84.7    9e-16   Medicago truncatula
dbj|BAP94276.1|  auxin-responsive protein IAA homolog                 80.1    9e-16   Rubus sp. MM-2014
ref|NP_001237053.1|  uncharacterized protein LOC100500373             82.8    1e-15   
gb|ABY48132.1|  GH1 protein                                           84.7    1e-15   Medicago truncatula
gb|AFK38538.1|  unknown                                               84.0    1e-15   Lotus japonicus
emb|CBI19314.3|  unnamed protein product                              83.6    2e-15   Vitis vinifera
emb|CAI77628.1|  Aux/IAA protein                                      80.1    3e-14   Solanum lycopersicum
ref|XP_010666360.1|  PREDICTED: auxin-responsive protein IAA8-like    80.5    3e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like    80.1    4e-14   Cicer arietinum [garbanzo]
ref|XP_010521481.1|  PREDICTED: auxin-responsive protein IAA8-lik...  78.2    2e-13   Tarenaya hassleriana [spider flower]
ref|XP_004509716.1|  PREDICTED: auxin-responsive protein IAA9-lik...  77.0    4e-13   
gb|KEH28135.1|  auxin response factor                                 75.5    8e-13   Medicago truncatula
ref|XP_003615390.1|  Auxin-responsive protein IAA5                    75.9    1e-12   Medicago truncatula
ref|XP_010521482.1|  PREDICTED: auxin-responsive protein IAA8-lik...  75.5    2e-12   Tarenaya hassleriana [spider flower]
ref|XP_010429195.1|  PREDICTED: auxin-responsive protein IAA8         74.7    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010472259.1|  PREDICTED: auxin-responsive protein IAA8-like    74.3    4e-12   Camelina sativa [gold-of-pleasure]
gb|EPS59988.1|  auxin-regulated protein                               74.3    4e-12   Genlisea aurea
emb|CDY66936.1|  BnaC02g47310D                                        73.2    5e-12   Brassica napus [oilseed rape]
gb|ADL70561.1|  indole-3-acetic acid inducible 8                      72.0    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70565.1|  indole-3-acetic acid inducible 8                      72.0    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70572.1|  indole-3-acetic acid inducible 8                      72.0    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70573.1|  indole-3-acetic acid inducible 8                      72.0    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70566.1|  indole-3-acetic acid inducible 8                      72.0    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29393.2|  indole-3-acetic acid inducible 8                      72.0    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70564.1|  indole-3-acetic acid inducible 8                      72.0    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70563.1|  indole-3-acetic acid inducible 8                      71.6    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70567.1|  indole-3-acetic acid inducible 8                      71.6    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70571.1|  indole-3-acetic acid inducible 8                      71.6    1e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70569.1|  indole-3-acetic acid inducible 8                      71.6    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29390.2|  indole-3-acetic acid inducible 8                      71.6    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70570.1|  indole-3-acetic acid inducible 8                      71.6    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADL70562.1|  indole-3-acetic acid inducible 8                      70.9    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29389.2|  indole-3-acetic acid inducible 8                      70.9    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006404728.1|  hypothetical protein EUTSA_v10000236mg           72.4    2e-11   Eutrema salsugineum [saltwater cress]
ref|NP_179852.1|  auxin-responsive protein IAA8                       71.6    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_850028.1|  auxin-responsive protein IAA8                       71.6    3e-11   
ref|NP_001189579.1|  auxin-responsive protein IAA8                    71.6    3e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006294567.1|  hypothetical protein CARUB_v10023602mg           71.2    5e-11   
ref|XP_006294565.1|  hypothetical protein CARUB_v10023602mg           71.2    5e-11   
ref|XP_002878628.1|  indoleacetic acid-induced protein 8              70.9    5e-11   Arabidopsis lyrata subsp. lyrata
gb|ADL70568.1|  indole-3-acetic acid inducible 8                      69.3    8e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006850381.1|  PREDICTED: auxin-responsive protein IAA9         70.5    1e-10   Amborella trichopoda
gb|ADC29391.2|  indole-3-acetic acid inducible 8                      67.8    3e-10   Arabidopsis thaliana [mouse-ear cress]
gb|ADC29392.2|  indole-3-acetic acid inducible 8                      67.8    3e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417025.1|  PREDICTED: auxin-responsive protein IAA8-like    68.2    5e-10   Camelina sativa [gold-of-pleasure]
emb|CDY25617.1|  BnaA04g13090D                                        63.5    2e-08   Brassica napus [oilseed rape]
ref|XP_009140376.1|  PREDICTED: auxin-responsive protein IAA8         63.5    2e-08   Brassica rapa
emb|CDX89499.1|  BnaC04g35180D                                        61.6    8e-08   
emb|CDY37837.1|  BnaAnng04980D                                        59.3    6e-07   Brassica napus [oilseed rape]
ref|XP_010463453.1|  PREDICTED: auxin-responsive protein IAA9-lik...  57.0    4e-06   Camelina sativa [gold-of-pleasure]
gb|AEI70506.1|  auxin-responsive protein                              57.0    4e-06   Gossypium hirsutum [American cotton]
gb|KHG09793.1|  Auxin-responsive IAA27 -like protein                  56.2    8e-06   Gossypium arboreum [tree cotton]
gb|AAM76220.1|  putative IAA-responsive protein 9                     52.8    2e-05   Gossypium herbaceum [Arabian cotton]
gb|AAM76222.1|  putative IAA-responsive protein 9                     52.8    2e-05   Gossypium hirsutum [American cotton]
gb|AAM76223.1|  putative IAA-responsive protein 9                     52.4    2e-05   Gossypium hirsutum [American cotton]
gb|KJB56780.1|  hypothetical protein B456_009G135900                  54.7    2e-05   Gossypium raimondii
gb|KJB56781.1|  hypothetical protein B456_009G135900                  54.7    2e-05   Gossypium raimondii
gb|KJB56779.1|  hypothetical protein B456_009G135900                  54.7    3e-05   Gossypium raimondii
gb|KJB56782.1|  hypothetical protein B456_009G135900                  54.7    3e-05   Gossypium raimondii
ref|XP_007152862.1|  hypothetical protein PHAVU_004G166400g           54.3    3e-05   Phaseolus vulgaris [French bean]
gb|KJB56783.1|  hypothetical protein B456_009G135900                  54.3    3e-05   Gossypium raimondii
gb|ACU24212.1|  unknown                                               52.0    5e-05   Glycine max [soybeans]
ref|XP_008242568.1|  PREDICTED: auxin-responsive protein IAA27        53.5    5e-05   Prunus mume [ume]
ref|NP_001280937.1|  auxin-responsive protein IAA27                   53.5    6e-05   Malus domestica [apple tree]
gb|AAM76221.1|  putative IAA-responsive protein 9                     50.8    7e-05   Gossypium raimondii
ref|XP_006833393.1|  PREDICTED: auxin-responsive protein IAA27        52.8    1e-04   Amborella trichopoda
gb|AAM76224.1|  putative IAA-responsive protein 9                     50.4    1e-04   Gossypioides kirkii
ref|XP_010062501.1|  PREDICTED: auxin-responsive protein IAA27        52.0    2e-04   Eucalyptus grandis [rose gum]
gb|KCW69643.1|  hypothetical protein EUGRSUZ_F03050                   52.0    2e-04   Eucalyptus grandis [rose gum]
gb|KCW69644.1|  hypothetical protein EUGRSUZ_F03050                   52.0    2e-04   Eucalyptus grandis [rose gum]
ref|XP_009352507.1|  PREDICTED: auxin-responsive protein IAA27-like   51.2    3e-04   Pyrus x bretschneideri [bai li]
ref|XP_003637871.1|  Auxin-responsive aux/iaa gene family member      50.4    4e-04   
ref|XP_003637872.1|  Auxin-responsive aux/iaa gene family member      50.1    4e-04   
ref|XP_009624916.1|  PREDICTED: auxin-responsive protein IAA27-like   50.8    4e-04   Nicotiana tomentosiformis
ref|XP_003534212.1|  PREDICTED: auxin-responsive protein IAA27        50.8    5e-04   Glycine max [soybeans]
gb|KEH27147.1|  auxin response factor                                 50.4    5e-04   Medicago truncatula
gb|AFK45766.1|  unknown                                               50.1    6e-04   Medicago truncatula
ref|XP_009793769.1|  PREDICTED: auxin-responsive protein IAA27-like   50.1    8e-04   Nicotiana sylvestris
ref|XP_009617338.1|  PREDICTED: auxin-responsive protein IAA27-like   50.1    8e-04   Nicotiana tomentosiformis
ref|XP_002284282.1|  PREDICTED: auxin-responsive protein IAA27-like   50.1    0.001   Vitis vinifera



>ref|XP_007205358.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 ref|XP_007205359.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06557.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06558.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
Length=378

 Score =   162 bits (410),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 123/167 (74%), Gaps = 11/167 (7%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MSP +LG   EGQ NGS++ASS ++DCIS  GS LKERNYLGLSD SSVDSS  S +  E
Sbjct  1    MSPPLLGGEEEGQSNGSMVASSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  427  K-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  600
            K ++LN +ATELRLGLPGSQ+P+R+ +L   S+GK DEKPLFPLLPSKDGI SS  K   
Sbjct  61   KKNKLNFQATELRLGLPGSQTPEREPDLCLLSSGKLDEKPLFPLLPSKDGICSSSQKNVV  120

Query  601  TGNKRGFLDTMEG------SVTTEANWMFTIPKSDSHTPQSAGQGNF  723
            +GNKRGF DTM+G      SV TE NWMF    SDS +P+S GQG F
Sbjct  121  SGNKRGFADTMDGYSEVKSSVYTEGNWMFHAAGSDSESPESVGQGKF  167



>emb|CDP02673.1| unnamed protein product [Coffea canephora]
Length=374

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 121/172 (70%), Gaps = 10/172 (6%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MSP +LG   EGQGN SVMASS ++DC+S  G  LKERNYLGLSDSS   +S ++    +
Sbjct  1    MSPPLLGIEGEGQGNVSVMASSKSVDCVSNNGLGLKERNYLGLSDSSEESTSMSTVSKEK  60

Query  427  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFT  603
            K  LNLKAT+LRLGLPGSQSP+R+ ELN  S+ KFDEKPLFPLLPSKDGI SS+ K+  +
Sbjct  61   KSSLNLKATDLRLGLPGSQSPERESELNLLSSDKFDEKPLFPLLPSKDGICSSIHKSVVS  120

Query  604  GNKRGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGI  741
            GNKR F DT++       S   E NWMF+   S+S T QS GQG F   AG+
Sbjct  121  GNKRVFSDTIDEYSTVKASTFNERNWMFSAAGSNSETHQSIGQGKFSGKAGV  172



>ref|XP_008236708.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236714.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236721.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236728.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
Length=378

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 121/167 (72%), Gaps = 11/167 (7%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MSP +LG   EGQ NGS++ASS ++DCIS  GS LKERNYLGLSD SSVDSS  S +  E
Sbjct  1    MSPPLLGGEEEGQSNGSMVASSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  427  K-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  600
            K ++LN +ATELRLGLPGSQSP+R  +L   S+GK DEKPLFPLLPSKDGI SS  K   
Sbjct  61   KKNKLNFQATELRLGLPGSQSPERVPDLCLLSSGKLDEKPLFPLLPSKDGICSSSQKNVV  120

Query  601  TGNKRGFLDTMEG------SVTTEANWMFTIPKSDSHTPQSAGQGNF  723
            +GNKRGF DTM+G      +V TE NWMF    SDS  P+S GQG F
Sbjct  121  SGNKRGFADTMDGFSEVKSAVYTEGNWMFHAAGSDSEAPESVGQGKF  167



>ref|XP_009344514.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344515.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344516.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
Length=373

 Score =   154 bits (388),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 113/166 (68%), Gaps = 12/166 (7%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYl-glsdsssvdssaasgvVN  423
            MSP +LG   EGQ NGS++A S ++DCIS  GS LKERNYL     SS   S+ ++    
Sbjct  1    MSPPLLGGEEEGQSNGSMVAFSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSNLSEG  60

Query  424  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  603
             K+ LN KATELRLGLPGSQSP+R+ +L   ++GK DEKPLFPLLPSKDGI SS + +  
Sbjct  61   TKNNLNFKATELRLGLPGSQSPEREPDLCLLNSGKLDEKPLFPLLPSKDGICSSSQKN--  118

Query  604  GNKRGFLDTMEG------SVTTEANWMFTIPKSDSHTPQSAGQGNF  723
            GNKRGF DTM+G      +  TE NWMF    SDS +P+S GQG F
Sbjct  119  GNKRGFADTMDGFSEVKSNAYTEGNWMFHAAGSDSESPESVGQGKF  164



>gb|ADL36578.1| ARF domain class transcription factor [Malus domestica]
Length=373

 Score =   153 bits (386),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 113/166 (68%), Gaps = 12/166 (7%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYl-glsdsssvdssaasgvVN  423
            MSP +LG   EGQ NGS++A S ++DCISQ  S LKERNYL     SS   S+ ++    
Sbjct  1    MSPPLLGGEEEGQSNGSMVAFSRSMDCISQNSSGLKERNYLGLSDCSSVDSSTVSNLSEG  60

Query  424  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  603
             K+ LN KATELRLGLPGSQSP+R+ +L   ++GK DEKPLFPLLPSKDGI SS + +  
Sbjct  61   TKNNLNFKATELRLGLPGSQSPEREPDLCLLNSGKLDEKPLFPLLPSKDGICSSSQKN--  118

Query  604  GNKRGFLDTMEG------SVTTEANWMFTIPKSDSHTPQSAGQGNF  723
            GNKRGF DTM+G      +  TE NWMF    SDS +P+S GQG F
Sbjct  119  GNKRGFADTMDGFSEVKSNAYTEGNWMFHAAGSDSESPESVGQGKF  164



>ref|XP_012079519.1| PREDICTED: auxin-responsive protein IAA9 [Jatropha curcas]
 gb|KDP32156.1| hypothetical protein JCGZ_12617 [Jatropha curcas]
Length=380

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 124/173 (72%), Gaps = 11/173 (6%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MSP +LG   EG+ N S++ASS ++DCISQ G  L ERNYLGLSD SSVDSSA   +  E
Sbjct  1    MSPPLLGVEEEGENNVSLVASSPSIDCISQNGCGLTERNYLGLSDCSSVDSSAVPSLSKE  60

Query  427  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  600
             K+ LNLKATELRLGLPGSQSP+R+ +++  STGK DEKPLFPLLP KDGI SS  K   
Sbjct  61   TKNNLNLKATELRLGLPGSQSPERETDVSLLSTGKLDEKPLFPLLPLKDGICSSSQKHVV  120

Query  601  TGNKRGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGI  741
            +GNKRGF DTM+      GSV +E NW+F    +D+ + QS GQG F  ++GI
Sbjct  121  SGNKRGFSDTMDGFSEVKGSVYSEKNWLFHSAGTDTDSLQSLGQGKFPGNSGI  173



>ref|XP_006426197.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 ref|XP_006426198.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39437.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39438.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
Length=376

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 122/178 (69%), Gaps = 13/178 (7%)
 Frame = +1

Query  253  MMSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYl-glsdsssvdssaasgvV  420
            M  P +LG   EGQ N S+MASS + DCISQ  S L+ERNYL     SS   S+A+S  V
Sbjct  1    MSPPLLLGVEEEGQSNVSLMASSPS-DCISQNVSGLQERNYLGLSDCSSVDSSAASSLPV  59

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKAS  597
            + K++LNLKATELRLGLPGS+SP+R+ +L+  S+GK DEKPLFPLLPSKDGI   S K  
Sbjct  60   DNKNKLNLKATELRLGLPGSESPEREPDLSLLSSGKLDEKPLFPLLPSKDGICPGSQKNV  119

Query  598  FTGNKRGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGIKSNV  753
             +GNKRGF DTM+       SV TE NWMF++   DS +PQS GQG F  ++G+   V
Sbjct  120  VSGNKRGFSDTMDRFSEVKSSVYTEKNWMFSV-GPDSESPQSVGQGKFPGNSGMNPMV  176



>ref|XP_006466369.1| PREDICTED: auxin-responsive protein IAA9-like [Citrus sinensis]
 gb|KDO78726.1| hypothetical protein CISIN_1g017170mg [Citrus sinensis]
Length=376

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 121/174 (70%), Gaps = 13/174 (7%)
 Frame = +1

Query  253  MMSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYl-glsdsssvdssaasgvV  420
            M  P +LG   EGQ N S+MASS + DCISQ  S L+ERNYL     SS   S+A+S  V
Sbjct  1    MSPPLLLGVEEEGQSNVSLMASSPS-DCISQNVSGLQERNYLGLSDCSSVDSSAASSLPV  59

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKAS  597
            + K++LNLKATELRLGLPGS+SP+R+ +L+  S+GK DEKPLFPLLPSKDGI   S K  
Sbjct  60   DNKNKLNLKATELRLGLPGSESPEREPDLSLLSSGKLDEKPLFPLLPSKDGICPGSQKNV  119

Query  598  FTGNKRGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGI  741
             +GNKRGF DTM+       SV TE NWMF++   DS +PQS GQG F  ++G+
Sbjct  120  VSGNKRGFSDTMDRFSEVKSSVYTEKNWMFSV-GPDSESPQSVGQGKFPGNSGM  172



>ref|XP_010275504.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Nelumbo 
nucifera]
Length=410

 Score =   143 bits (361),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 126/191 (66%), Gaps = 9/191 (5%)
 Frame = +1

Query  211  ISSRLRDELEFLYDMMSPTILGEGQGNGSVMASSSTLDCI-SQTGSALKERNYlglsdss  387
            + SRL  +L    ++MSP +LG G+G  +V   SS       Q GS LKERNY+GLSD S
Sbjct  8    LYSRLGGKLLSSGNLMSPPLLGVGEGQSNVSVVSSPSVDGSCQNGSGLKERNYMGLSDCS  67

Query  388  svdssaasgvVNE-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPS  564
            SVDSSA SG+  E K  LNLKATELRLGLPGSQSP+RD EL   + GK DEKPLFPLLPS
Sbjct  68   SVDSSAISGLAEENKSSLNLKATELRLGLPGSQSPERDPELCLLNPGKLDEKPLFPLLPS  127

Query  565  KDGIFSSV-KASFTGNKRGFLDTMEG------SVTTEANWMFTIPKSDSHTPQSAGQGNF  723
            KDGI+SS  KA  TGNKRGF D M+       +V TE NWMF    SDS T QS  QG F
Sbjct  128  KDGIYSSSQKAVVTGNKRGFSDAMDNFSEVKSAVFTEGNWMFPTVGSDSETSQSKPQGKF  187

Query  724  GSSAGIKSNVP  756
              S G+ + +P
Sbjct  188  HVSPGVNAILP  198



>ref|XP_010275505.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Nelumbo 
nucifera]
Length=409

 Score =   142 bits (358),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 120/178 (67%), Gaps = 9/178 (5%)
 Frame = +1

Query  250  DMMSPTILGEGQGNGSVMASSSTLDCI-SQTGSALKERNYlglsdsssvdssaasgvVNE  426
            ++MSP +LG G+G  +V   SS       Q GS LKERNY+GLSD SSVDSSA SG+  E
Sbjct  20   NLMSPPLLGVGEGQSNVSVVSSPSVDGSCQNGSGLKERNYMGLSDCSSVDSSAISGLAEE  79

Query  427  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  600
             K  LNLKATELRLGLPGSQSP+RD EL   + GK DEKPLFPLLPSKDGI+SS  KA  
Sbjct  80   NKSSLNLKATELRLGLPGSQSPERDPELCLLNPGKLDEKPLFPLLPSKDGIYSSSQKAVV  139

Query  601  TGNKRGFLDTMEG------SVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGIKSNVP  756
            TGNKRGF D M+       +V TE NWMF    SDS T QS  QG F  S G+ + +P
Sbjct  140  TGNKRGFSDAMDNFSEVKSAVFTEGNWMFPTVGSDSETSQSKPQGKFHVSPGVNAILP  197



>ref|XP_010275506.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010275507.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
Length=388

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 118/176 (67%), Gaps = 9/176 (5%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCI-SQTGSALKERNYlglsdsssvdssaasgvVNE-K  429
            MSP +LG G+G  +V   SS       Q GS LKERNY+GLSD SSVDSSA SG+  E K
Sbjct  1    MSPPLLGVGEGQSNVSVVSSPSVDGSCQNGSGLKERNYMGLSDCSSVDSSAISGLAEENK  60

Query  430  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTG  606
              LNLKATELRLGLPGSQSP+RD EL   + GK DEKPLFPLLPSKDGI+SS  KA  TG
Sbjct  61   SSLNLKATELRLGLPGSQSPERDPELCLLNPGKLDEKPLFPLLPSKDGIYSSSQKAVVTG  120

Query  607  NKRGFLDTMEG------SVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGIKSNVP  756
            NKRGF D M+       +V TE NWMF    SDS T QS  QG F  S G+ + +P
Sbjct  121  NKRGFSDAMDNFSEVKSAVFTEGNWMFPTVGSDSETSQSKPQGKFHVSPGVNAILP  176



>ref|XP_007047690.1| Transcription factor, putative isoform 4 [Theobroma cacao]
 gb|EOX91847.1| Transcription factor, putative isoform 4 [Theobroma cacao]
Length=372

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 117/173 (68%), Gaps = 15/173 (9%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MS  +LG   EGQ N     SS + DCISQ G  LKERNYLGLSD SSVDSS  S +  +
Sbjct  1    MSQPLLGVEEEGQSN----VSSPSDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  427  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  600
             K+ LNLKATELRLGLPGSQSP+R+ EL   ++GK DEKPLFPLLPSKDGI SS  K   
Sbjct  57   NKNNLNLKATELRLGLPGSQSPEREPELCLLNSGKLDEKPLFPLLPSKDGICSSSQKTVV  116

Query  601  TGNKRGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGI  741
            +GNKRGF DTM+      GSV TE  WMF    SDS +PQ+ G G +  + G+
Sbjct  117  SGNKRGFSDTMDGFSEVKGSVYTEKIWMFPGAGSDSESPQTVGHGKYPGNPGV  169



>ref|XP_007047688.1| Transcription factor, putative isoform 2 [Theobroma cacao]
 gb|EOX91845.1| Transcription factor, putative isoform 2 [Theobroma cacao]
Length=374

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 117/173 (68%), Gaps = 15/173 (9%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MS  +LG   EGQ N     SS + DCISQ G  LKERNYLGLSD SSVDSS  S +  +
Sbjct  1    MSQPLLGVEEEGQSN----VSSPSDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  427  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  600
             K+ LNLKATELRLGLPGSQSP+R+ EL   ++GK DEKPLFPLLPSKDGI SS  K   
Sbjct  57   NKNNLNLKATELRLGLPGSQSPEREPELCLLNSGKLDEKPLFPLLPSKDGICSSSQKTVV  116

Query  601  TGNKRGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGI  741
            +GNKRGF DTM+      GSV TE  WMF    SDS +PQ+ G G +  + G+
Sbjct  117  SGNKRGFSDTMDGFSEVKGSVYTEKIWMFPGAGSDSESPQTVGHGKYPGNPGV  169



>ref|XP_007047687.1| Transcription factor, putative isoform 1 [Theobroma cacao]
 gb|EOX91844.1| Transcription factor, putative isoform 1 [Theobroma cacao]
Length=376

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 117/173 (68%), Gaps = 15/173 (9%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MS  +LG   EGQ N     SS + DCISQ G  LKERNYLGLSD SSVDSS  S +  +
Sbjct  1    MSQPLLGVEEEGQSN----VSSPSDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  427  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  600
             K+ LNLKATELRLGLPGSQSP+R+ EL   ++GK DEKPLFPLLPSKDGI SS  K   
Sbjct  57   NKNNLNLKATELRLGLPGSQSPEREPELCLLNSGKLDEKPLFPLLPSKDGICSSSQKTVV  116

Query  601  TGNKRGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGI  741
            +GNKRGF DTM+      GSV TE  WMF    SDS +PQ+ G G +  + G+
Sbjct  117  SGNKRGFSDTMDGFSEVKGSVYTEKIWMFPGAGSDSESPQTVGHGKYPGNPGV  169



>ref|XP_010105114.1| Auxin-responsive protein IAA9 [Morus notabilis]
 gb|EXC03899.1| Auxin-responsive protein IAA9 [Morus notabilis]
Length=378

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 99/165 (60%), Positives = 116/165 (70%), Gaps = 10/165 (6%)
 Frame = +1

Query  256  MSPTILG-EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-K  429
            MSP +LG E +G+ S++ASS T+DCISQ GS LKE NYLGLSD SSVDSSA S +  E K
Sbjct  1    MSPPLLGGEEEGHSSLVASSPTIDCISQNGSGLKEWNYLGLSDCSSVDSSAVSSLSEENK  60

Query  430  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT-G  606
            + LN KATELRLGLPGSQSP+R+ EL+   + K DEK LFPLLPSKDGI SS + +   G
Sbjct  61   NNLNFKATELRLGLPGSQSPEREPELSLLGSSKLDEKQLFPLLPSKDGICSSSQKNVVLG  120

Query  607  NKRGFLDTMEG------SVTTEANWMFTIPKSDSHTPQSAGQGNF  723
            NKRGF DTM+G      SV  E NW +T   SD  +PQS  QG  
Sbjct  121  NKRGFSDTMDGFSEVKTSVYGEGNWRYTA-GSDPDSPQSVAQGKI  164



>gb|KJB18143.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=255

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 111/169 (66%), Gaps = 14/169 (8%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  435
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDSS           
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGIGLKERNYLGLSDCSSVDSSG------VSSN  53

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNK  612
            LNLKATELRLGLPGSQSP+R+ EL   + GK DEKPLFPLLPSKDGI SS  K   TGNK
Sbjct  54   LNLKATELRLGLPGSQSPERETELCLLNLGKLDEKPLFPLLPSKDGICSSSQKNVVTGNK  113

Query  613  RGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGI  741
            RGF DTM+      G V TE +WMF    SDS +PQS G G +  ++G+
Sbjct  114  RGFSDTMDGFSEVKGYVYTEKSWMFHEAGSDSESPQSVGHGKYPGNSGV  162



>gb|KJB18142.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=296

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 111/169 (66%), Gaps = 14/169 (8%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  435
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDSS           
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGIGLKERNYLGLSDCSSVDSS------GVSSN  53

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNK  612
            LNLKATELRLGLPGSQSP+R+ EL   + GK DEKPLFPLLPSKDGI SS  K   TGNK
Sbjct  54   LNLKATELRLGLPGSQSPERETELCLLNLGKLDEKPLFPLLPSKDGICSSSQKNVVTGNK  113

Query  613  RGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGI  741
            RGF DTM+      G V TE +WMF    SDS +PQS G G +  ++G+
Sbjct  114  RGFSDTMDGFSEVKGYVYTEKSWMFHEAGSDSESPQSVGHGKYPGNSGV  162



>ref|XP_008357957.1| PREDICTED: LOW QUALITY PROTEIN: auxin-responsive protein IAA9-like 
[Malus domestica]
Length=216

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 106/167 (63%), Gaps = 18/167 (11%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN-  423
            MSP + G   EG+ NGS       +DCIS  GS LKE NY GLSD SSV+SS  S +   
Sbjct  1    MSPPLXGGEEEGKSNGS-------MDCISHNGSGLKELNYHGLSDCSSVNSSXVSNLSEG  53

Query  424  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  600
             K+ LN KA ELRLGLP SQSP+R+ +L   S+GK DEKPLFPLLPSKDGI SS  K   
Sbjct  54   NKNNLNFKAPELRLGLPASQSPERESDLCLLSSGKLDEKPLFPLLPSKDGIXSSSQKDGV  113

Query  601  TGNKRGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNF  723
            +GNKRGF DTM+       S  T   WMF    SDS +P+S GQG F
Sbjct  114  SGNKRGFADTMDRFSEVKSSAYTXKEWMFHAAGSDSESPESVGQGKF  160



>ref|XP_004288310.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
 ref|XP_011466548.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
Length=370

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 97/168 (58%), Positives = 111/168 (66%), Gaps = 17/168 (10%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MSP +LG   EG+ NGS++A S +++ I Q  S LKERNYLGLSD SSVDSS  S +  E
Sbjct  1    MSPPLLGGEGEGKSNGSMVACSPSMEMIPQNSSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  427  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  600
             K + N KATELRLGLPGSQSP+R  EL        DEKPLFPLLPSKDGI SS  K   
Sbjct  61   NKSKFNFKATELRLGLPGSQSPERQSEL-----CLLDEKPLFPLLPSKDGICSSSQKNVV  115

Query  601  TGNKRGFLDTMEG------SVTTEANWMF-TIPKSDSHTPQSAGQGNF  723
            +GNKRGF DTM+G      SV  E  WMF     SDS +P+S GQG F
Sbjct  116  SGNKRGFSDTMDGFSEVKSSVYNEGKWMFPAAAGSDSESPESVGQGKF  163



>gb|KJB18140.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=403

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 111/169 (66%), Gaps = 14/169 (8%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  435
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDSS           
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGIGLKERNYLGLSDCSSVDSS------GVSSN  53

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNK  612
            LNLKATELRLGLPGSQSP+R+ EL   + GK DEKPLFPLLPSKDGI SS  K   TGNK
Sbjct  54   LNLKATELRLGLPGSQSPERETELCLLNLGKLDEKPLFPLLPSKDGICSSSQKNVVTGNK  113

Query  613  RGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGI  741
            RGF DTM+      G V TE +WMF    SDS +PQS G G +  ++G+
Sbjct  114  RGFSDTMDGFSEVKGYVYTEKSWMFHEAGSDSESPQSVGHGKYPGNSGV  162



>gb|KJB18136.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18137.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18138.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18139.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18141.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
 gb|KJB18144.1| hypothetical protein B456_003G035700 [Gossypium raimondii]
Length=377

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 111/169 (66%), Gaps = 14/169 (8%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  435
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDSS           
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGIGLKERNYLGLSDCSSVDSS------GVSSN  53

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNK  612
            LNLKATELRLGLPGSQSP+R+ EL   + GK DEKPLFPLLPSKDGI SS  K   TGNK
Sbjct  54   LNLKATELRLGLPGSQSPERETELCLLNLGKLDEKPLFPLLPSKDGICSSSQKNVVTGNK  113

Query  613  RGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGI  741
            RGF DTM+      G V TE +WMF    SDS +PQS G G +  ++G+
Sbjct  114  RGFSDTMDGFSEVKGYVYTEKSWMFHEAGSDSESPQSVGHGKYPGNSGV  162



>ref|XP_002528895.1| transcription factor, putative [Ricinus communis]
 gb|EEF33475.1| transcription factor, putative [Ricinus communis]
Length=382

 Score =   130 bits (327),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 118/175 (67%), Gaps = 13/175 (7%)
 Frame = +1

Query  256  MSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaa-sgvVN  423
            MSP +LG    GQ   S++ASS ++DCISQ G  LKERNYLGLSD SSVDSSA  S    
Sbjct  1    MSPPLLGVEDGGQSKVSLVASSPSVDCISQNGCRLKERNYLGLSDCSSVDSSAVPSLSEE  60

Query  424  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKD--GIFS-SVKA  594
              + LNLKATELRLGLPGS SP+RD E++   +GK DEKPLFPLLP KD  GI S   K 
Sbjct  61   NNNNLNLKATELRLGLPGSLSPERDTEVSLLISGKLDEKPLFPLLPLKDGHGICSLPQKH  120

Query  595  SFTGNKRGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGI  741
              +GNKRGF DTM+      GS  +E NW+F    ++S +PQS GQG F  ++GI
Sbjct  121  VVSGNKRGFSDTMDGFSEVKGSAYSEKNWLFHSAGTESDSPQSVGQGKFSGASGI  175



>ref|XP_011099452.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=359

 Score =   128 bits (321),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 122/181 (67%), Gaps = 14/181 (8%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MSP +LG   + Q N S+MASS+++D +SQ G  LKERNYLGLSD SSVDSS  S V  E
Sbjct  1    MSPPLLGVEGQDQCNVSLMASSASVDTVSQNGLGLKERNYLGLSDCSSVDSSGVSSVPEE  60

Query  427  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI-FSSVKASF  600
             K+ LNLKATELRLGLPGSQSP+RD + +  S+ K DEK LFPL+PSKDGI   S K   
Sbjct  61   NKNNLNLKATELRLGLPGSQSPERDPDFSPLSSVKLDEKQLFPLVPSKDGICLLSPKTVV  120

Query  601  TGNKRGFLDTMEG------SVTTEANWMFTIPKSDSHTPQSAG---QGNFGSSAGIKSNV  753
            +GNKRGF DT++G      ++ TE NW+F    SD+ +  +       + G+ + IK++V
Sbjct  121  SGNKRGFADTVDGFLESKSTIFTEGNWIFNAAGSDTGSKLAGNMLSHRSSGTQSTIKTDV  180

Query  754  P  756
            P
Sbjct  181  P  181



>ref|XP_010254653.1| PREDICTED: auxin-responsive protein IAA9-like [Nelumbo nucifera]
Length=386

 Score =   128 bits (321),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 116/174 (67%), Gaps = 10/174 (6%)
 Frame = +1

Query  256  MSPTILG--EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-  426
            MSP +L   E   N +++ SS ++D   Q  S L+ERNY+GLSD SSVDSSA SG+  E 
Sbjct  1    MSPPLLNVVERPSNVTLVPSSPSVDSSCQNVSGLRERNYMGLSDCSSVDSSAISGLSEEN  60

Query  427  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFT  603
            K  LNLKATELRLGLPGSQSP+R  EL   S GK DEKPLFPLLPSKDGI SS  KA  +
Sbjct  61   KSSLNLKATELRLGLPGSQSPERGSELCLLSPGKLDEKPLFPLLPSKDGICSSSQKAVVS  120

Query  604  GNKRGFLDTMEG------SVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGIKS  747
            GNKRGF D M+G      +V TE NWMF    SDS T QS  QG F  + G+ S
Sbjct  121  GNKRGFSDAMDGFSEMKSAVFTEGNWMFPAAGSDSETTQSVAQGKFHVNPGLLS  174



>ref|XP_008440498.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
 ref|XP_008440499.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=377

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 109/175 (62%), Gaps = 11/175 (6%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MSP +L    E  GN  V+A+S ++DC SQ G+  +ERNYL LS  SSVDSSA S +  E
Sbjct  1    MSPPLLNSVEEALGNVPVVAASPSMDCHSQNGTKFRERNYLRLSPCSSVDSSAVSNLSEE  60

Query  427  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI-FSSVKASF  600
             K  LNLKATELRLGLPGS SP+RD E    S+G+ DEK L  LLPS DG   +S K   
Sbjct  61   NKSNLNLKATELRLGLPGSLSPERDQEFTLISSGEPDEKTLLQLLPSTDGYSVASQKNII  120

Query  601  TGNKRGFLDTMEGS------VTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGIKS  747
             G+KRGF DTMEG       + TE NWMF    SD  +P    QG F +S+GI +
Sbjct  121  AGSKRGFSDTMEGYSEVKGPLYTERNWMFHAASSDPESPYPVSQGKFHASSGINA  175



>gb|KCW59655.1| hypothetical protein EUGRSUZ_H02407 [Eucalyptus grandis]
Length=345

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 116/178 (65%), Gaps = 11/178 (6%)
 Frame = +1

Query  256  MSPTILG--EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-  426
            MSP +LG  EG GN S +A+S ++D  S     LKERNYLGLSD SSVDSSA S + +E 
Sbjct  1    MSPPLLGVEEGGGNTSTVATSPSIDGASHDCLGLKERNYLGLSDCSSVDSSAVSSLSDEN  60

Query  427  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASF  600
            K  LNLKATEL LGLPGSQSP+R+ +L   S+GK DEKPLFPLLP KDGI SS   K   
Sbjct  61   KSNLNLKATELTLGLPGSQSPEREPKLCLLSSGKLDEKPLFPLLPLKDGICSSSLQKNIA  120

Query  601  TGNKRGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGIKSNVP  756
            +GNKRGF DT++       S   + NWMF        T Q  GQG F  +AG+K+ +P
Sbjct  121  SGNKRGFSDTIDEFSELKSSKYPDGNWMFHATGPAPETAQCGGQGKFPGNAGMKAMLP  178



>ref|XP_010023413.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Eucalyptus 
grandis]
 gb|KCW59654.1| hypothetical protein EUGRSUZ_H02407 [Eucalyptus grandis]
Length=368

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 116/178 (65%), Gaps = 11/178 (6%)
 Frame = +1

Query  256  MSPTILG--EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-  426
            MSP +LG  EG GN S +A+S ++D  S     LKERNYLGLSD SSVDSSA S + +E 
Sbjct  1    MSPPLLGVEEGGGNTSTVATSPSIDGASHDCLGLKERNYLGLSDCSSVDSSAVSSLSDEN  60

Query  427  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASF  600
            K  LNLKATEL LGLPGSQSP+R+ +L   S+GK DEKPLFPLLP KDGI SS   K   
Sbjct  61   KSNLNLKATELTLGLPGSQSPEREPKLCLLSSGKLDEKPLFPLLPLKDGICSSSLQKNIA  120

Query  601  TGNKRGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGIKSNVP  756
            +GNKRGF DT++       S   + NWMF        T Q  GQG F  +AG+K+ +P
Sbjct  121  SGNKRGFSDTIDEFSELKSSKYPDGNWMFHATGPAPETAQCGGQGKFPGNAGMKAMLP  178



>ref|XP_010023411.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010023412.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Eucalyptus 
grandis]
Length=377

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 116/178 (65%), Gaps = 11/178 (6%)
 Frame = +1

Query  256  MSPTILG--EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-  426
            MSP +LG  EG GN S +A+S ++D  S     LKERNYLGLSD SSVDSSA S + +E 
Sbjct  1    MSPPLLGVEEGGGNTSTVATSPSIDGASHDCLGLKERNYLGLSDCSSVDSSAVSSLSDEN  60

Query  427  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASF  600
            K  LNLKATEL LGLPGSQSP+R+ +L   S+GK DEKPLFPLLP KDGI SS   K   
Sbjct  61   KSNLNLKATELTLGLPGSQSPEREPKLCLLSSGKLDEKPLFPLLPLKDGICSSSLQKNIA  120

Query  601  TGNKRGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGIKSNVP  756
            +GNKRGF DT++       S   + NWMF        T Q  GQG F  +AG+K+ +P
Sbjct  121  SGNKRGFSDTIDEFSELKSSKYPDGNWMFHATGPAPETAQCGGQGKFPGNAGMKAMLP  178



>gb|KHG08155.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
 gb|KHG17373.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=376

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 109/169 (64%), Gaps = 15/169 (9%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  435
            MSP +LG  +       SS +++CIS+ G  LKERNYLGLSD SSVDSS           
Sbjct  1    MSPPLLGVEE-EVQSSVSSPSVECISENGMGLKERNYLGLSDCSSVDSS------GVSSN  53

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNK  612
            LNL ATELRLGLPGSQSP+R+ E    + GK DEKPLFPLLPSKDGI SS  K   TGNK
Sbjct  54   LNL-ATELRLGLPGSQSPERETEFCLLNLGKLDEKPLFPLLPSKDGICSSSQKNVVTGNK  112

Query  613  RGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGI  741
            RGF DTM+      G V TE +WMF    SDS +PQS G G +  ++G+
Sbjct  113  RGFSDTMDGFSEVKGYVYTEKSWMFHEAGSDSESPQSVGHGKYPGNSGV  161



>ref|XP_003628839.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AET03315.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=356

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 104/138 (75%), Gaps = 7/138 (5%)
 Frame = +1

Query  244  LYDMMSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssaa  408
            ++++MSP +L    EGQ N S +AS+S  +LD  SQT + LKERNYLGLSD SSVDSS  
Sbjct  5    IWNLMSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSSTV  64

Query  409  sgvVNEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-  582
              + +EK + LNLKATELRLGLPGSQSP+RDL+L   ++ K DEKPLFPLLP+KDGI S 
Sbjct  65   PSLSDEKKENLNLKATELRLGLPGSQSPERDLDLFPLNSTKLDEKPLFPLLPTKDGICSL  124

Query  583  SVKASFTGNKRGFLDTME  636
            S K   +GNKRGF DT+E
Sbjct  125  SQKTVVSGNKRGFADTLE  142



>ref|XP_007047689.1| Transcription factor, putative isoform 3, partial [Theobroma 
cacao]
 gb|EOX91846.1| Transcription factor, putative isoform 3, partial [Theobroma 
cacao]
Length=345

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 7/114 (6%)
 Frame = +1

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  597
            + K+ LNLKATELRLGLPGSQSP+R+ EL   ++GK DEKPLFPLLPSKDGI SS  K  
Sbjct  25   DNKNNLNLKATELRLGLPGSQSPEREPELCLLNSGKLDEKPLFPLLPSKDGICSSSQKTV  84

Query  598  FTGNKRGFLDTME------GSVTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGI  741
             +GNKRGF DTM+      GSV TE  WMF    SDS +PQ+ G G +  + G+
Sbjct  85   VSGNKRGFSDTMDGFSEVKGSVYTEKIWMFPGAGSDSESPQTVGHGKYPGNPGV  138



>gb|ACU19961.1| unknown [Glycine max]
Length=235

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 91/134 (68%), Gaps = 5/134 (4%)
 Frame = +1

Query  253  MMSPTILGEGQGNGSVMA-SSSTLDCISQTGSALKERNY---lglsdsssvdssaasgvV  420
            M  PT++ E +G  +V + SS +LDC SQ G+ LKERNY      S   S  S+  S   
Sbjct  1    MSPPTLVTEEEGRSTVASDSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVPSLCD  60

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSS-VKAS  597
             +K+ +NLKATELRLGLPG QSP+R+ +L   S+ K DEKPLFPLLP+KDGI SS  KA 
Sbjct  61   EKKENMNLKATELRLGLPGFQSPEREPDLFSLSSPKLDEKPLFPLLPTKDGICSSGQKAV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF DTM+G
Sbjct  121  VSGNKRGFADTMDG  134



>gb|AFK49626.1| unknown [Medicago truncatula]
Length=348

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 104/143 (73%), Gaps = 9/143 (6%)
 Frame = +1

Query  256  MSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +L    EGQ N S +AS+S  +LD  SQT + LKERNYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  421  NEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  594
            +EK + LNLKATELRLGLPGSQSP+RDL+L   ++ K DEKPLFPLLP+KDGI S S K 
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERDLDLFPLNSTKLDEKPLFPLLPTKDGICSLSQKT  120

Query  595  SFTGNKRGFLDTMEGSVTTEANW  663
              +GNKRGF DT+E  V  EA +
Sbjct  121  VVSGNKRGFADTLE--VFPEAKY  141



>gb|ACJ84551.1| unknown [Medicago truncatula]
Length=348

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 104/143 (73%), Gaps = 9/143 (6%)
 Frame = +1

Query  256  MSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +L    EGQ N S +AS+S  +LD  SQT + LKERNYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  421  NEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  594
            +EK + LNLKATELRLGLPGSQSP+RDL+L   ++ K DEKPLFPLLP+KDGI S S K 
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERDLDLFPLNSTKLDEKPLFPLLPTKDGICSLSQKT  120

Query  595  SFTGNKRGFLDTMEGSVTTEANW  663
              +GNKRGF DT+E  V  EA +
Sbjct  121  VVSGNKRGFADTLE--VFPEAKY  141



>ref|XP_007156440.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
 gb|ESW28434.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
Length=348

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 78/133 (59%), Positives = 97/133 (73%), Gaps = 6/133 (5%)
 Frame = +1

Query  256  MSPTIL---GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +L    EGQ N S++AS+S+  ++C S   +  KERNYLG SD SSV+SS    + 
Sbjct  1    MSPPLLVTEDEGQSNASMVASASSPSMECFSPHEARFKERNYLGFSDCSSVESSTVPSLS  60

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKAS  597
            NEK  LNLKATELRLGLPGSQSP+R+ +L   ++ K DEKPLFPLLP+KDGIF+ S K  
Sbjct  61   NEKKNLNLKATELRLGLPGSQSPERNPDLFPLTSSKLDEKPLFPLLPTKDGIFALSQKTV  120

Query  598  FTGNKRGFLDTME  636
             +GNKRGF DTM+
Sbjct  121  VSGNKRGFADTMD  133



>ref|XP_002509993.1| Auxin-responsive protein IAA19, putative [Ricinus communis]
 gb|EEF52180.1| Auxin-responsive protein IAA19, putative [Ricinus communis]
Length=374

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MSP ++G   EGQ N +V+ASS++ + I Q GS LKERNY+GLSD SSVDSS A    +E
Sbjct  1    MSPPLIGVVEEGQSNVTVLASSTSAESICQNGSKLKERNYMGLSDCSSVDSSIAPSSSDE  60

Query  427  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  600
             K RLNLKATELRLGLPGSQSP+R+ EL+  ++ +FDEKP FPL PS DG +SS  K   
Sbjct  61   SKTRLNLKATELRLGLPGSQSPQRNSELSLLNSTQFDEKPFFPLNPSNDGHYSSTQKNVV  120

Query  601  TGNKRGFLDTMEG  639
            +GNKRGF D M+G
Sbjct  121  SGNKRGFSDAMDG  133



>ref|XP_004143431.1| PREDICTED: auxin-responsive protein IAA8-like [Cucumis sativus]
 gb|KGN48671.1| ARF domain class transcription factor [Cucumis sativus]
Length=380

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 109/175 (62%), Gaps = 11/175 (6%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MSP +L    E  GN  V+A+S ++DC SQ G+  +ERNYL LS  SSVDSSA S +  E
Sbjct  1    MSPPLLNSVEEALGNVPVVAASPSMDCHSQNGTKFRERNYLRLSPCSSVDSSAVSNLSEE  60

Query  427  -KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF-  600
             K  LNLKATELRLGLPGS SP+RD E    S+ + DEK L  LLPS DG   S++ +  
Sbjct  61   NKSNLNLKATELRLGLPGSLSPERDQEFTLISSVEPDEKTLLQLLPSTDGYSVSLQKNIV  120

Query  601  TGNKRGFLDTMEGS------VTTEANWMFTIPKSDSHTPQSAGQGNFGSSAGIKS  747
            +G+KR F DTMEG       + TE NWMF    SD  +P    QG F +++GI +
Sbjct  121  SGSKRVFSDTMEGYSEVKGPLYTERNWMFHAASSDPESPYPVSQGKFHANSGINA  175



>ref|XP_004509715.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Cicer 
arietinum]
Length=353

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 99/135 (73%), Gaps = 7/135 (5%)
 Frame = +1

Query  256  MSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +L    E Q N S +AS+S  +LDC SQ G+ LKERNYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLVTEEERQSNTSTVASASPQSLDCFSQNGAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  421  NEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  594
            +EK + LNLKATELRLGLPGSQSP+RD +L   S+ K DEKPLFPLLP+KDGI S S K 
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERDPDLFLLSSTKLDEKPLFPLLPTKDGICSLSQKN  120

Query  595  SFTGNKRGFLDTMEG  639
              +GNKRGF D M+G
Sbjct  121  VVSGNKRGFSDAMDG  135



>ref|XP_003534264.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN38914.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=354

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 91/134 (68%), Gaps = 5/134 (4%)
 Frame = +1

Query  253  MMSPTILGEGQGNGSVMA-SSSTLDCISQTGSALKERNY---lglsdsssvdssaasgvV  420
            M  PT++ E +G  +V + SS +LDC SQ G+ LKERNY      S   S  S+  S   
Sbjct  1    MSPPTLVTEEEGRSTVASDSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVPSLCD  60

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSS-VKAS  597
             +K+ +NLKATELRLGLPG QSP+R+ +L   S+ K DEKPLFPLLP+KDGI SS  KA 
Sbjct  61   EKKENMNLKATELRLGLPGFQSPEREPDLFSLSSPKLDEKPLFPLLPTKDGICSSGQKAV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF DTM+G
Sbjct  121  VSGNKRGFADTMDG  134



>gb|KJB71171.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=289

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 109/169 (64%), Gaps = 6/169 (4%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  435
            MSP +LG  +  G    SS +++CISQ G  ++E NYLGLSD  SVDSS      +  + 
Sbjct  1    MSPLLLGVEE-EGQTRVSSPSVECISQNGLGIREWNYLGLSDFCSVDSSGVPD--DNGNN  57

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNK  612
            LNLKATELRLGLPGSQSP+R+ EL   ++GK DEK LFPLLPSKDGI SS  K+  TGNK
Sbjct  58   LNLKATELRLGLPGSQSPERETELCFLNSGKLDEKTLFPLLPSKDGICSSSQKSVVTGNK  117

Query  613  RGFLDTMEGSVTTEANWMFTIPKSDSHTPQSAGQGNFG-SSAGIKSNVP  756
            RGF + ++G++ TE  WM +    DS   Q    G +  + A +K + P
Sbjct  118  RGFSE-VKGTIYTEKKWMGSGAVPDSQYLQPVSHGKYSVAQASVKKDGP  165



>gb|KHG08881.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=351

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 114/171 (67%), Gaps = 10/171 (6%)
 Frame = +1

Query  256  MSPTILG-EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKD  432
            MSP +LG E +G   V  SS +++CISQ G  ++ERNYLGLSD  SVDSS      +  +
Sbjct  1    MSPPLLGVEEEGQSRV--SSPSVECISQNGLGIRERNYLGLSDFCSVDSSGVPD--DNGN  56

Query  433  RLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGN  609
             LNLKATELRLGLPGSQSP+R+ E    ++GK DEK LFPLLPSKDGI SS  K+  TGN
Sbjct  57   NLNLKATELRLGLPGSQSPERETEHCFLNSGKLDEKTLFPLLPSKDGICSSSQKSVVTGN  116

Query  610  KRGFLDTMEGSVTTEANWM--FTIPKSDSHTPQSAGQGNFGSSAGIKSNVP  756
            KRGF + ++G++ TE  WM    +P S S  P S G+ +  + A +K + P
Sbjct  117  KRGFSE-VKGTIYTEKKWMGHGAVPDSQSLQPVSHGKYSV-AQASVKKDGP  165



>gb|KJB71165.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71170.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=352

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 109/169 (64%), Gaps = 6/169 (4%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  435
            MSP +LG  +  G    SS +++CISQ G  ++E NYLGLSD  SVDSS      +  + 
Sbjct  1    MSPLLLGVEE-EGQTRVSSPSVECISQNGLGIREWNYLGLSDFCSVDSSGVPD--DNGNN  57

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNK  612
            LNLKATELRLGLPGSQSP+R+ EL   ++GK DEK LFPLLPSKDGI SS  K+  TGNK
Sbjct  58   LNLKATELRLGLPGSQSPERETELCFLNSGKLDEKTLFPLLPSKDGICSSSQKSVVTGNK  117

Query  613  RGFLDTMEGSVTTEANWMFTIPKSDSHTPQSAGQGNFG-SSAGIKSNVP  756
            RGF + ++G++ TE  WM +    DS   Q    G +  + A +K + P
Sbjct  118  RGFSE-VKGTIYTEKKWMGSGAVPDSQYLQPVSHGKYSVAQASVKKDGP  165



>gb|KJB71166.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71167.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71168.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71169.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=351

 Score =   117 bits (293),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 109/169 (64%), Gaps = 6/169 (4%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  435
            MSP +LG  +  G    SS +++CISQ G  ++E NYLGLSD  SVDSS      +  + 
Sbjct  1    MSPLLLGVEE-EGQTRVSSPSVECISQNGLGIREWNYLGLSDFCSVDSSGVPD--DNGNN  57

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNK  612
            LNLKATELRLGLPGSQSP+R+ EL   ++GK DEK LFPLLPSKDGI SS  K+  TGNK
Sbjct  58   LNLKATELRLGLPGSQSPERETELCFLNSGKLDEKTLFPLLPSKDGICSSSQKSVVTGNK  117

Query  613  RGFLDTMEGSVTTEANWMFTIPKSDSHTPQSAGQGNFG-SSAGIKSNVP  756
            RGF + ++G++ TE  WM +    DS   Q    G +  + A +K + P
Sbjct  118  RGFSE-VKGTIYTEKKWMGSGAVPDSQYLQPVSHGKYSVAQASVKKDGP  165



>gb|KJB71172.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=344

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 109/169 (64%), Gaps = 6/169 (4%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR  435
            MSP +LG  +  G    SS +++CISQ G  ++E NYLGLSD  SVDSS      +  + 
Sbjct  1    MSPLLLGVEE-EGQTRVSSPSVECISQNGLGIREWNYLGLSDFCSVDSSGVPD--DNGNN  57

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNK  612
            LNLKATELRLGLPGSQSP+R+ EL   ++GK DEK LFPLLPSKDGI SS  K+  TGNK
Sbjct  58   LNLKATELRLGLPGSQSPERETELCFLNSGKLDEKTLFPLLPSKDGICSSSQKSVVTGNK  117

Query  613  RGFLDTMEGSVTTEANWMFTIPKSDSHTPQSAGQGNFG-SSAGIKSNVP  756
            RGF + ++G++ TE  WM +    DS   Q    G +  + A +K + P
Sbjct  118  RGFSE-VKGTIYTEKKWMGSGAVPDSQYLQPVSHGKYSVAQASVKKDGP  165



>gb|AAM12952.1| auxin-regulated protein [Zinnia violacea]
Length=351

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 112/163 (69%), Gaps = 10/163 (6%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN-  423
            M P +LG   +G GN S+M S+ST++ I Q  + L ERNYLGLSD SS DS+A SG+   
Sbjct  1    MPPPLLGVEGDGLGNVSLMTSASTMESIFQKNAELTERNYLGLSDCSSFDSTAVSGISEV  60

Query  424  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF-  600
            +++ LNLKATELRLGLPGSQSP+RD++++  ++   DEKPLFPLLPSKDGI S+ +  F 
Sbjct  61   KRNNLNLKATELRLGLPGSQSPERDVDVDLVNSESLDEKPLFPLLPSKDGICSNSQKVFV  120

Query  601  TGNKRGFLDTMEGSVTTEANWMFTIPKSDSHTPQSAGQGNFGS  729
            +GNKRGF D ++     E  WMF    +DS T    G+ + G+
Sbjct  121  SGNKRGFSDAID-----EGKWMFGSSGTDSETSNMNGKISSGA  158



>ref|XP_010547581.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Tarenaya 
hassleriana]
Length=342

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 108/166 (65%), Gaps = 16/166 (10%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV-N  423
            MSP +     E Q N SV +SS T +C+S+  S  KE NYLGLS+ SSV SS   G+  +
Sbjct  1    MSPPVADVEEELQSNVSVASSSPTSECLSRNTSGPKEHNYLGLSECSSVGSSNLPGLAED  60

Query  424  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKASF  600
            +K+ ++LKATELRLGLPGSQSP+R+ + N  ++GK DEKPLFPL PSKDGI S S K S 
Sbjct  61   DKNSISLKATELRLGLPGSQSPERETDFNTLTSGKLDEKPLFPLAPSKDGICSQSQKNSG  120

Query  601  TGNKRGFLDTME------GSVTTEANWMF-----TIPKSDSHTPQS  705
            TGNKRGF DTM+       S  TE +WMF     T P +    PQS
Sbjct  121  TGNKRGFSDTMDQFAEVKSSEFTEKSWMFHGTGTTQPVTRKEAPQS  166



>ref|XP_010547580.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Tarenaya 
hassleriana]
Length=350

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 88/166 (53%), Positives = 108/166 (65%), Gaps = 16/166 (10%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV-N  423
            MSP +     E Q N SV +SS T +C+S+  S  KE NYLGLS+ SSV SS   G+  +
Sbjct  1    MSPPVADVEEELQSNVSVASSSPTSECLSRNTSGPKEHNYLGLSECSSVGSSNLPGLAED  60

Query  424  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKASF  600
            +K+ ++LKATELRLGLPGSQSP+R+ + N  ++GK DEKPLFPL PSKDGI S S K S 
Sbjct  61   DKNSISLKATELRLGLPGSQSPERETDFNTLTSGKLDEKPLFPLAPSKDGICSQSQKNSG  120

Query  601  TGNKRGFLDTME------GSVTTEANWMF-----TIPKSDSHTPQS  705
            TGNKRGF DTM+       S  TE +WMF     T P +    PQS
Sbjct  121  TGNKRGFSDTMDQFAEVKSSEFTEKSWMFHGTGTTQPVTRKEAPQS  166



>ref|XP_002862301.1| hypothetical protein ARALYDRAFT_920936 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH38559.1| hypothetical protein ARALYDRAFT_920936 [Arabidopsis lyrata subsp. 
lyrata]
Length=238

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 95/140 (68%), Gaps = 9/140 (6%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  450
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSLLAEDDKATISLKA  65

Query  451  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  627
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  66   TELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  125

Query  628  TME------GSVTTEANWMF  669
            TM+       SV TE NWMF
Sbjct  126  TMDQFAEAKSSVYTEKNWMF  145



>ref|XP_011073641.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=346

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 105/168 (63%), Gaps = 16/168 (10%)
 Frame = +1

Query  301  MASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEK-DRLNLKATELRLGLPG  477
            MASS++ D ++Q G  LKERNYLGLSD SSVDSSA S V  EK   LNLKATELRLGLPG
Sbjct  1    MASSASADRVAQNGLGLKERNYLGLSDCSSVDSSAVSSVPEEKKSNLNLKATELRLGLPG  60

Query  478  SQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTMEG------  639
            SQSP+R+ +    S  K DEK LFPL+PSKDGI  S K   +GNKRGF DT++G      
Sbjct  61   SQSPERESDFTLLSPSKLDEKQLFPLIPSKDGILLSQKTVVSGNKRGFSDTVDGFSESKS  120

Query  640  SVTTEANWMFTIPKSDSHTPQSAGQGNF---------GSSAGIKSNVP  756
            +V  + +WMF    SDS   + AG             G+   +K+ VP
Sbjct  121  TVFNDGSWMFNPAGSDSGQTKLAGNAGISVMLSNRSSGTQPSVKTEVP  168



>ref|XP_007158315.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 ref|XP_007158316.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|AGV54410.1| auxin-responsive protein IAA8 [Phaseolus vulgaris]
 gb|ESW30309.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|ESW30310.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
Length=350

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 95/138 (69%), Gaps = 9/138 (7%)
 Frame = +1

Query  253  MMSPTILGEGQGNGSVMA-----SSSTLDCISQTGSALKERNYlglsdsssvdssaasg-  414
            M  P ++ E  G   V +     SS +LDC SQ G+ LKERNYLGLSD SSVDS A++  
Sbjct  1    MSPPAVVTEEDGLSKVSSTLASGSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVP  60

Query  415  --vVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SS  585
                 +K+ +NLKATELRLGLPGSQSP+RD +L   S+ K DEKPLFPL P+KDGIF SS
Sbjct  61   GLGDEKKENMNLKATELRLGLPGSQSPERDPDLFSLSSAKIDEKPLFPLGPTKDGIFLSS  120

Query  586  VKASFTGNKRGFLDTMEG  639
             K   +GNKRGF DTM+ 
Sbjct  121  QKTVVSGNKRGFADTMDA  138



>gb|ADL70577.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=292

 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 98/147 (67%), Gaps = 11/147 (7%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEK  429
            MSP    E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K
Sbjct  1    MSPE--EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDK  58

Query  430  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTG  606
              ++LKATEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +G
Sbjct  59   ATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASG  118

Query  607  NKRGFLDTME------GSVTTEANWMF  669
            NKRGF DTM+       SV TE NWMF
Sbjct  119  NKRGFSDTMDQFAEAKSSVYTEKNWMF  145



>gb|ADL70583.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70584.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=302

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 95/140 (68%), Gaps = 9/140 (6%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  450
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  5    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  64

Query  451  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  627
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  65   TELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  124

Query  628  TME------GSVTTEANWMF  669
            TM+       SV TE NWMF
Sbjct  125  TMDQFAEAKSSVYTEKNWMF  144



>gb|ADC29395.2| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADC29396.2| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70575.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70576.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70580.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70581.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=303

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 95/140 (68%), Gaps = 9/140 (6%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  450
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  65

Query  451  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  627
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  66   TELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  125

Query  628  TME------GSVTTEANWMF  669
            TM+       SV TE NWMF
Sbjct  126  TMDQFAEAKSSVYTEKNWMF  145



>gb|ADL70586.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=302

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 95/140 (68%), Gaps = 9/140 (6%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  450
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  5    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  64

Query  451  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  627
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  65   TELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  124

Query  628  TME------GSVTTEANWMF  669
            TM+       SV TE NWMF
Sbjct  125  TMDQFAEAKSSVYTEKNWMF  144



>gb|ADL70578.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70582.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=303

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 98/147 (67%), Gaps = 11/147 (7%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEK  429
            MSP    E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K
Sbjct  1    MSPE--EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDK  58

Query  430  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTG  606
              ++LKATEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +G
Sbjct  59   ATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASG  118

Query  607  NKRGFLDTME------GSVTTEANWMF  669
            NKRGF DTM+       SV TE NWMF
Sbjct  119  NKRGFSDTMDQFAEAKSSVYTEKNWMF  145



>ref|XP_002864969.1| auxin-induced protein IAA9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41228.1| auxin-induced protein IAA9 [Arabidopsis lyrata subsp. lyrata]
Length=338

 Score =   112 bits (279),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 95/140 (68%), Gaps = 9/140 (6%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  450
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSLLAEDDKATISLKA  65

Query  451  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  627
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  66   TELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  125

Query  628  TME------GSVTTEANWMF  669
            TM+       SV TE NWMF
Sbjct  126  TMDQFAEAKSSVYTEKNWMF  145



>gb|ADC29394.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADC29397.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=300

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 95/140 (68%), Gaps = 9/140 (6%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  450
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  3    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  62

Query  451  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  627
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  63   TELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  122

Query  628  TME------GSVTTEANWMF  669
            TM+       SV TE NWMF
Sbjct  123  TMDQFAEAKSSVYTEKNWMF  142



>gb|ADC29398.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=300

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 95/140 (68%), Gaps = 9/140 (6%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  450
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  3    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  62

Query  451  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  627
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  63   TELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  122

Query  628  TME------GSVTTEANWMF  669
            TM+       SV TE NWMF
Sbjct  123  TMDQFAEAKSSVYTEKNWMF  142



>ref|NP_569017.2| auxin-responsive protein IAA9 [Arabidopsis thaliana]
 gb|AED98085.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
Length=336

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 98/147 (67%), Gaps = 11/147 (7%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEK  429
            MSP    E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K
Sbjct  1    MSPE--EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDK  58

Query  430  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTG  606
              ++LKATEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +G
Sbjct  59   ATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASG  118

Query  607  NKRGFLDTME------GSVTTEANWMF  669
            NKRGF DTM+       SV TE NWMF
Sbjct  119  NKRGFSDTMDQFAEAKSSVYTEKNWMF  145



>dbj|BAB10673.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
Length=333

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 95/140 (68%), Gaps = 9/140 (6%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  450
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  6    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  65

Query  451  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  627
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  66   TELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  125

Query  628  TME------GSVTTEANWMF  669
            TM+       SV TE NWMF
Sbjct  126  TMDQFAEAKSSVYTEKNWMF  145



>ref|NP_851275.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
 sp|Q38827.1|IAA9_ARATH RecName: Full=Auxin-responsive protein IAA9; AltName: Full=Indoleacetic 
acid-induced protein 9 [Arabidopsis thaliana]
 gb|AAG50093.1|AF334715_1 auxin-induced protein IAA9 [Arabidopsis thaliana]
 gb|AAC49050.1| IAA9 [Arabidopsis thaliana]
 emb|CAA16692.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
 gb|AED98084.1| auxin-responsive protein IAA9 [Arabidopsis thaliana]
Length=338

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 98/147 (67%), Gaps = 11/147 (7%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEK  429
            MSP    E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K
Sbjct  1    MSPE--EELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDK  58

Query  430  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTG  606
              ++LKATEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +G
Sbjct  59   ATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASG  118

Query  607  NKRGFLDTME------GSVTTEANWMF  669
            NKRGF DTM+       SV TE NWMF
Sbjct  119  NKRGFSDTMDQFAEAKSSVYTEKNWMF  145



>gb|KHN46011.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score =   111 bits (278),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 97/134 (72%), Gaps = 7/134 (5%)
 Frame = +1

Query  256  MSPTIL---GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +L    EGQ + S++AS+S+  L+C S   +  KE NYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLVTEDEGQCHASMVASASSPSLNCFSLNEAGFKECNYLGLSDCSSVDSSTVPNLS  60

Query  421  NEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  594
            +EK + LNLKATELRLGLPGSQSP+R+ EL   S+ K DEKPLFPLLP+KDGI S S K 
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERETELFSLSSTKLDEKPLFPLLPTKDGICSLSQKT  120

Query  595  SFTGNKRGFLDTME  636
              +GNKRGF DTM+
Sbjct  121  VVSGNKRGFADTMD  134



>gb|ADL70579.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=302

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 84/140 (60%), Positives = 95/140 (68%), Gaps = 9/140 (6%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKA  450
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKA
Sbjct  5    ELQSNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKA  64

Query  451  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLD  627
            TEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF D
Sbjct  65   TELTLGLPGSQSPVRDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSD  124

Query  628  TME------GSVTTEANWMF  669
            TM+       SV TE NWMF
Sbjct  125  TMDQFAEAKSSVYTEKNWMF  144



>gb|AAM64650.1| auxin-induced protein IAA9 [Arabidopsis thaliana]
Length=338

 Score =   111 bits (277),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 98/147 (67%), Gaps = 11/147 (7%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEK  429
            MSP    E Q N SV +SS T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K
Sbjct  1    MSPE--EELQTNVSVASSSPTSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDK  58

Query  430  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTG  606
              ++LKATEL LGLPGSQSP RD ELN  S  K DEKP FPLLPSKD I SS  K + +G
Sbjct  59   ATISLKATELTLGLPGSQSPARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASG  118

Query  607  NKRGFLDTME------GSVTTEANWMF  669
            NKRGF DTM+       SV TE NWMF
Sbjct  119  NKRGFSDTMDQFAEAKSSVYTEKNWMF  145



>ref|NP_001275473.1| Aux/IAA protein [Solanum tuberosum]
 gb|AAM29182.1| Aux/IAA protein [Solanum tuberosum]
Length=349

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 94/135 (70%), Gaps = 7/135 (5%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ N +++ASS++L  I + GSALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICKKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  424  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  594
            + +   LNLKATELRLGLPGSQSP+R  E    S+ K DEK LFPL P+KD  FS S K 
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEETCPVSSTKVDEKLLFPLHPAKDTAFSVSQKT  120

Query  595  SFTGNKRGFLDTMEG  639
              TGNKRGF DTM+G
Sbjct  121  VVTGNKRGFSDTMDG  135



>ref|XP_003517136.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Glycine 
max]
 ref|XP_006572983.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Glycine 
max]
Length=359

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 90/139 (65%), Gaps = 10/139 (7%)
 Frame = +1

Query  253  MMSP-TILGEGQGNGSVMA-----SSSTLDCISQTGSALKERNY---lglsdsssvdssa  405
            MMSP  ++ E +G  +V +     SS +LD  SQ G+ LKERNY      S   S  S+ 
Sbjct  1    MMSPPAVVTEEEGRSNVSSTVASGSSQSLDRFSQNGAGLKERNYLGLSDCSSVDSSASTV  60

Query  406  asgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI-FS  582
             S    +K+ +NLKATELRLGLPGSQSP+R+ +L   S  K DEKPLFPLLP+KDGI  S
Sbjct  61   PSLCDEKKENMNLKATELRLGLPGSQSPEREPDLFSLSPAKLDEKPLFPLLPTKDGICLS  120

Query  583  SVKASFTGNKRGFLDTMEG  639
            + K   +GNKRGF DTM+G
Sbjct  121  AQKTVVSGNKRGFADTMDG  139



>ref|NP_001268170.1| Aux/IAA protein [Vitis vinifera]
 gb|AEV89794.1| indole-3-acetic acid-induced protein 4 [Vitis vinifera]
Length=359

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 94/134 (70%), Gaps = 6/134 (4%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ N +++ASS++++ + Q  S LKERNY+GLS+ SSVDSSA S   +
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  424  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKAS  597
              K  LNLKATELRLGLPGS SP R+ EL   S+ K DEKPLFPL PSKD  + SS K  
Sbjct  61   GNKSSLNLKATELRLGLPGSLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKTV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M G
Sbjct  121  VSGNKRGFADAMNG  134



>ref|XP_010664066.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664068.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664069.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 gb|ADR80320.1| indole-3-acetic acid-induced protein 9 [Vitis vinifera]
Length=359

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 94/134 (70%), Gaps = 6/134 (4%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ N +++ASS++++ + Q  S LKERNY+GLS+ SSVDSSA S   +
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  424  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKAS  597
              K  LNLKATELRLGLPGS SP R+ EL   S+ K DEKPLFPL PSKD  + SS K  
Sbjct  61   GNKSSLNLKATELRLGLPGSLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKTV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M G
Sbjct  121  VSGNKRGFADAMNG  134



>ref|XP_006279648.1| hypothetical protein CARUB_v10026736mg [Capsella rubella]
 gb|EOA12546.1| hypothetical protein CARUB_v10026736mg [Capsella rubella]
Length=339

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 103/165 (62%), Gaps = 19/165 (12%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgvVNEKDR--LNLK  447
            E Q N SV +SS T +CIS+ T   LKE NYLGLSD SS   S+    + + D+  ++LK
Sbjct  6    ELQSNVSVASSSPTSNCISRSTVGGLKEHNYLGLSDCSSSVGSSTLSGLADDDKATISLK  65

Query  448  ATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFL  624
            ATEL LGLPGSQSP RD +LN  +  K DEKP FPLLPSKD I SS  K + +GNKRGF 
Sbjct  66   ATELTLGLPGSQSPARDTDLNLMTPVKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFS  125

Query  625  DTME------GSVTTEANWMF-------TIPKSDSHTPQSAGQGN  720
            DTM+       SV TE NWMF       ++ K D   PQS  +G+
Sbjct  126  DTMDQFAEAKSSVYTEKNWMFPEVAATQSVTKKD--VPQSTPKGH  168



>gb|EYU44549.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=306

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 88/133 (66%), Gaps = 15/133 (11%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV--  420
            MSP +LG     Q N S MASSS+ DC+SQ  S LKERNYLGLSD SSVDSS     V  
Sbjct  1    MSPPLLGIEGHNQANVSPMASSSSTDCVSQNVSCLKERNYLGLSDCSSVDSSTVMLTVPA  60

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  600
            + K  LNLKATELRLGLPGS SP R+ E     +   DEK LFPL+PSKDGIFSS     
Sbjct  61   DPKSNLNLKATELRLGLPGSHSPGRESEF----SPLIDEKQLFPLIPSKDGIFSS-----  111

Query  601  TGNKRGFLDTMEG  639
             GNKRGF DT+  
Sbjct  112  -GNKRGFADTVNA  123



>gb|EYU44548.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=318

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 88/133 (66%), Gaps = 15/133 (11%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV--  420
            MSP +LG     Q N S MASSS+ DC+SQ  S LKERNYLGLSD SSVDSS     V  
Sbjct  1    MSPPLLGIEGHNQANVSPMASSSSTDCVSQNVSCLKERNYLGLSDCSSVDSSTVMLTVPA  60

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  600
            + K  LNLKATELRLGLPGS SP R+ E     +   DEK LFPL+PSKDGIFSS     
Sbjct  61   DPKSNLNLKATELRLGLPGSHSPGRESEF----SPLIDEKQLFPLIPSKDGIFSS-----  111

Query  601  TGNKRGFLDTMEG  639
             GNKRGF DT+  
Sbjct  112  -GNKRGFADTVNA  123



>emb|CAN77436.1| hypothetical protein VITISV_007399 [Vitis vinifera]
Length=359

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 78/134 (58%), Positives = 94/134 (70%), Gaps = 6/134 (4%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ N +++ASS++++ + Q  S LKERNY+GLS+ SSVDSSA S   +
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  424  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKAS  597
              K  LNLKATELRLGLPGS SP R+ EL   S+ K DEKPLFPL PSKD  + SS K  
Sbjct  61   GNKSSLNLKATELRLGLPGSLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKTV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M G
Sbjct  121  VSGNKRGFADAMNG  134



>gb|ABB55368.1| Aux/IAA protein-like [Solanum tuberosum]
Length=349

 Score =   108 bits (271),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 93/135 (69%), Gaps = 7/135 (5%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ N +++ASS++L  I + GSALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICKKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  424  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  594
            + +   LNLKATELRLGLPGSQSP+R  E    S+ K DEK LFPL P+KD  FS S K 
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEETCPVSSTKVDEKLLFPLHPAKDTAFSVSQKT  120

Query  595  SFTGNKRGFLDTMEG  639
              TGNKRGF D M+G
Sbjct  121  VVTGNKRGFSDAMDG  135



>gb|KJB58782.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58783.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=334

 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 5/133 (4%)
 Frame = +1

Query  256  MSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MSP +LG    GQ N +++ SS ++D + Q  + LKERNY+GLSD SS+D S  +   ++
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGLSDCSSIDCSVVTLGSDD  60

Query  427  KD-RLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKASF  600
             +  LNLKATELRLGLPGSQSP+R+ EL   S+ + DEKPLFPL PS DG  F S K   
Sbjct  61   SNVSLNLKATELRLGLPGSQSPERNSELCLLSSAQLDEKPLFPLHPSSDGHCFPSQKTVV  120

Query  601  TGNKRGFLDTMEG  639
            +GNKRGF D M+G
Sbjct  121  SGNKRGFSDAMDG  133



>ref|XP_003531969.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Glycine 
max]
 ref|XP_006585901.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Glycine 
max]
Length=350

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 8/135 (6%)
 Frame = +1

Query  256  MSPTIL----GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgv  417
            MSP +L     EGQ N S++AS+S+   +C +   + LKERNYLGLSD SSVDSS    +
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  418  VNEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVK  591
             +EK + LNLKATELRLGLPGSQSP+RD +L   S+ K DEKPLF LLP+KDGI S S K
Sbjct  61   SDEKKENLNLKATELRLGLPGSQSPERDPDLFSLSSTKLDEKPLFSLLPTKDGICSLSQK  120

Query  592  ASFTGNKRGFLDTME  636
               +GNKRGF DT++
Sbjct  121  TVVSGNKRGFADTID  135



>gb|KJB58781.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=368

 Score =   108 bits (270),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 5/133 (4%)
 Frame = +1

Query  256  MSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MSP +LG    GQ N +++ SS ++D + Q  + LKERNY+GLSD SS+D S  +   ++
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGLSDCSSIDCSVVTLGSDD  60

Query  427  KD-RLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKASF  600
             +  LNLKATELRLGLPGSQSP+R+ EL   S+ + DEKPLFPL PS DG  F S K   
Sbjct  61   SNVSLNLKATELRLGLPGSQSPERNSELCLLSSAQLDEKPLFPLHPSSDGHCFPSQKTVV  120

Query  601  TGNKRGFLDTMEG  639
            +GNKRGF D M+G
Sbjct  121  SGNKRGFSDAMDG  133



>gb|KJB58777.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58778.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58779.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58780.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=367

 Score =   108 bits (270),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 5/133 (4%)
 Frame = +1

Query  256  MSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MSP +LG    GQ N +++ SS ++D + Q  + LKERNY+GLSD SS+D S  +   ++
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGLSDCSSIDCSVVTLGSDD  60

Query  427  KD-RLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKASF  600
             +  LNLKATELRLGLPGSQSP+R+ EL   S+ + DEKPLFPL PS DG  F S K   
Sbjct  61   SNVSLNLKATELRLGLPGSQSPERNSELCLLSSAQLDEKPLFPLHPSSDGHCFPSQKTVV  120

Query  601  TGNKRGFLDTMEG  639
            +GNKRGF D M+G
Sbjct  121  SGNKRGFSDAMDG  133



>ref|XP_006585902.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Glycine 
max]
Length=348

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 8/135 (6%)
 Frame = +1

Query  256  MSPTIL----GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgv  417
            MSP +L     EGQ N S++AS+S+   +C +   + LKERNYLGLSD SSVDSS    +
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  418  VNEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVK  591
             +EK + LNLKATELRLGLPGSQSP+RD +L   S+ K DEKPLF LLP+KDGI S S K
Sbjct  61   SDEKKENLNLKATELRLGLPGSQSPERDPDLFSLSSTKLDEKPLFSLLPTKDGICSLSQK  120

Query  592  ASFTGNKRGFLDTME  636
               +GNKRGF DT++
Sbjct  121  TVVSGNKRGFADTID  135



>gb|KHN22187.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score =   108 bits (269),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 97/135 (72%), Gaps = 8/135 (6%)
 Frame = +1

Query  256  MSPTIL----GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgv  417
            MSP +L     EGQ N S++AS+S+   +C +   + LKERNYLGLSD SSVDSS    +
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  418  VNEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVK  591
             +EK + LNLKATELRLGLPGSQSP+RD +L   S+ K DEKPLF LLP+KDGI S S K
Sbjct  61   SDEKKENLNLKATELRLGLPGSQSPERDPDLFSLSSTKLDEKPLFSLLPTKDGICSLSQK  120

Query  592  ASFTGNKRGFLDTME  636
               +GNKRGF DT++
Sbjct  121  TVVSGNKRGFADTID  135



>gb|AAL92850.1| Aux/IAA protein [Vitis vinifera]
Length=359

 Score =   107 bits (268),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 93/134 (69%), Gaps = 6/134 (4%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ N +++ASS++++ + Q  S LKERNY+GLS+ SSVDSSA S   +
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  424  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKAS  597
              K  LNLKATELRLGLPG  SP R+ EL   S+ K DEKPLFPL PSKD  + SS K  
Sbjct  61   GNKSSLNLKATELRLGLPGFLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKTV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M G
Sbjct  121  VSGNKRGFADAMNG  134



>ref|XP_003519213.1| PREDICTED: auxin-responsive protein IAA9-like [Glycine max]
 gb|KHN26175.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=366

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/133 (58%), Positives = 91/133 (68%), Gaps = 5/133 (4%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSS-TLDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MS  +LG    EGQ N +++ SSS T++ +    S LKERNY+GLSD SSVDSSA S   
Sbjct  1    MSKPLLGIAEEEGQSNVTLLVSSSATMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  600
              K  LNLKATELRLGLPGSQSP+RD +L   S+ +FDEKPLFPL P+ D   SS K + 
Sbjct  61   ETKSNLNLKATELRLGLPGSQSPERDSDLCLRSSIQFDEKPLFPLHPATDEHHSSSKPAV  120

Query  601  TGNKRGFLDTMEG  639
             GNKRGF D M G
Sbjct  121  LGNKRGFSDVMSG  133



>ref|XP_010320058.1| PREDICTED: auxin-responsive protein (Aux/IAA) isoform X1 [Solanum 
lycopersicum]
Length=349

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 92/135 (68%), Gaps = 7/135 (5%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ N +++ASS++L  I   GSALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICIKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  424  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  594
            + +   LNLKATELRLGLPGSQSP+R  E    S+ K DEK LFPL PSKD  FS S K 
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEETCPVSSTKVDEKLLFPLHPSKDTAFSVSQKT  120

Query  595  SFTGNKRGFLDTMEG  639
              +GNKRGF D M+G
Sbjct  121  VVSGNKRGFSDAMDG  135



>gb|AAB70005.1| GH1 protein [Glycine max]
Length=339

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/115 (57%), Positives = 78/115 (68%), Gaps = 4/115 (3%)
 Frame = +1

Query  307  SSSTLDCISQTGSALKERNY---lglsdsssvdssaasgvVNEKDRLNLKATELRLGLPG  477
            SS +LD  SQ G+ LKERNY      S   S  S+  S    +K+ +NLKATELRLGLPG
Sbjct  5    SSQSLDRFSQNGAGLKERNYLGLSDCSSVDSSASTVPSLCDEKKENMNLKATELRLGLPG  64

Query  478  SQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI-FSSVKASFTGNKRGFLDTMEG  639
            SQSP+R+ +L   S  K DEKPLFPLLP+KDGI  S+ K   +GNKRGF DTM+G
Sbjct  65   SQSPEREPDLFSLSPAKLDEKPLFPLLPTKDGICLSAQKTVVSGNKRGFADTMDG  119



>ref|XP_010518881.1| PREDICTED: auxin-responsive protein IAA9-like [Tarenaya hassleriana]
Length=312

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 77/157 (49%), Positives = 93/157 (59%), Gaps = 26/157 (17%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MSP I     E Q N SV +SS   +C+S+  S LKE NYLGLSD SS     +    ++
Sbjct  1    MSPPIAEVEEELQSNVSVASSSPISECLSRNTSGLKEHNYLGLSDCSSTLPDLSE---DD  57

Query  427  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTG  606
            K  ++LKATELRLGLPGSQSP+RD +LN        EKP FPL+PSKDGI S       G
Sbjct  58   KSGISLKATELRLGLPGSQSPERDTDLN--------EKPFFPLVPSKDGICS-------G  102

Query  607  NKRGFLDTMEGSVTTEANWMF-----TIPKSDSHTPQ  702
            NKRGF DT+E S   E NW+F     T P +    P+
Sbjct  103  NKRGFSDTVEASAYIEKNWIFNGSGSTQPATKKEVPK  139



>gb|ACU23129.1| unknown [Glycine max]
Length=210

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 96/150 (64%), Gaps = 11/150 (7%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTL-DCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MS  +LG    EGQ N +++ SSS + + +    S LKERNY+GLSD SSVDSSA S   
Sbjct  1    MSKPLLGIGEEEGQSNVTLLVSSSVIMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  600
              K  LNLKATELRLGLPG QSP+RD +L   S+ +FDEKPLFPL P+ D   SS K + 
Sbjct  61   ETKSNLNLKATELRLGLPGLQSPERDSDLCLRSSIQFDEKPLFPLHPATDDHHSSSKPAV  120

Query  601  TGNKRGFLDTMEG------SVTTEANWMFT  672
             GNKRGF D M G       V++E N + +
Sbjct  121  LGNKRGFSDVMSGFAEEKLLVSSEVNTILS  150



>ref|XP_007018336.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 ref|XP_007018337.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15561.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15562.1| Aux/IAA protein isoform 1 [Theobroma cacao]
Length=368

 Score =   106 bits (264),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 92/134 (69%), Gaps = 6/134 (4%)
 Frame = +1

Query  256  MSPTILGE----GQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG     GQ N + + SS ++D + Q  + LKERNY+GLSD SSVDSS  S V  
Sbjct  1    MSPPLLGVEEEGGQSNVTCLGSSGSMDSVCQNSAELKERNYMGLSDCSSVDSSVGSPVSE  60

Query  424  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKAS  597
            E K  LNLKATELRLGLPGSQSPKR+ EL   S+ + DEKPLFPL PS DG  S S K  
Sbjct  61   ESKGNLNLKATELRLGLPGSQSPKRNPELCLLSSPQLDEKPLFPLHPSSDGHCSASQKTV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  121  VSGNKRGFSDAMDG  134



>gb|ABD98054.1| auxin-regulated protein [Striga asiatica]
Length=305

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 95/148 (64%), Gaps = 19/148 (13%)
 Frame = +1

Query  268  ILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-KDRLNL  444
            I G+ Q N  +MASSS+ DCI+Q    LKERNYLGLSD SSVDSS  S   +E K  LNL
Sbjct  8    IEGQNQFNAHLMASSSSADCITQNTLGLKERNYLGLSDCSSVDSSTVSSSPDEGKTNLNL  67

Query  445  KATELRLGLPGSQSPKRDLELN-GPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGF  621
            KATELRLGLPGSQSPKRDL+ +   S  K DEK LFPL+P+            +GNKRGF
Sbjct  68   KATELRLGLPGSQSPKRDLDFSLLSSVNKLDEKQLFPLVPN--------TVIVSGNKRGF  119

Query  622  LDTMEGSVTTEANWMFTIPKSDSHTPQS  705
             DT+       ANWMF    +DS  P++
Sbjct  120  SDTV------NANWMFN---ADSGLPKT  138



>gb|EYU41350.1| hypothetical protein MIMGU_mgv1a009380mg [Erythranthe guttata]
Length=344

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 97/143 (68%), Gaps = 16/143 (11%)
 Frame = +1

Query  268  ILGEGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE--KDRLN  441
            + G+ Q N S+MASS++ DCI+Q GS+LKERNYLGLSD SSVDSSA S   +   K  LN
Sbjct  8    VEGQSQCNVSLMASSASADCITQNGSSLKERNYLGLSDCSSVDSSAVSCGADTEIKSNLN  67

Query  442  LKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGF  621
            LKATEL LGLPGSQSP    EL+   T   DEK LFPL+PSKD    + K+  +GNKRGF
Sbjct  68   LKATELTLGLPGSQSPHHQ-ELS--FTALLDEKQLFPLIPSKD----AQKSVVSGNKRGF  120

Query  622  LDTMEGSVTTEA-------NWMF  669
             DT++G   +++       NWMF
Sbjct  121  ADTVDGFSDSKSAMLGEGKNWMF  143



>ref|NP_001265888.1| auxin-responsive protein (Aux/IAA) [Solanum lycopersicum]
 gb|AAZ20313.1| AUX/IAA protein [Solanum lycopersicum]
 gb|ADN51993.1| entire [Solanum lycopersicum]
 gb|AEX00353.1| IAA9 [Solanum lycopersicum]
Length=349

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 91/135 (67%), Gaps = 7/135 (5%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ N +++ASS++L  I   GSALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICIKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  424  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  594
            + +   LNLKATELRLGLPGSQSP+R  E     + K DEK LFPL PSKD  FS S K 
Sbjct  61   DNNGCGLNLKATELRLGLPGSQSPERGEETCPVISTKVDEKLLFPLHPSKDTAFSVSQKT  120

Query  595  SFTGNKRGFLDTMEG  639
              +GNKRGF D M+G
Sbjct  121  VVSGNKRGFSDAMDG  135



>ref|XP_006394001.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 ref|XP_006394002.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 dbj|BAJ33783.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31287.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 gb|ESQ31288.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
Length=339

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 92/141 (65%), Gaps = 10/141 (7%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQ--TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLK  447
            E Q N SV +SS T +CIS+   G  LKE NYLGLSD SSV SS  SG+  ++K  ++LK
Sbjct  6    ELQSNVSVASSSPTSNCISRNTAGGGLKEHNYLGLSDCSSVGSSTLSGLAEDDKATISLK  65

Query  448  ATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT-GNKRGFL  624
            ATEL LGLPG QSP RD +LN  S  K DEK  FPLLPSKD I SS + +   GNKRGF 
Sbjct  66   ATELTLGLPGPQSPARDTDLNLLSPAKLDEKTFFPLLPSKDEICSSSQKNIALGNKRGFS  125

Query  625  DTME------GSVTTEANWMF  669
            D M+       SV TE NWMF
Sbjct  126  DAMDQFSEAKSSVYTEKNWMF  146



>ref|XP_006394000.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
 gb|ESQ31286.1| hypothetical protein EUTSA_v10004532mg [Eutrema salsugineum]
Length=337

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 92/141 (65%), Gaps = 10/141 (7%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQ--TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLK  447
            E Q N SV +SS T +CIS+   G  LKE NYLGLSD SSV SS  SG+  ++K  ++LK
Sbjct  6    ELQSNVSVASSSPTSNCISRNTAGGGLKEHNYLGLSDCSSVGSSTLSGLAEDDKATISLK  65

Query  448  ATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT-GNKRGFL  624
            ATEL LGLPG QSP RD +LN  S  K DEK  FPLLPSKD I SS + +   GNKRGF 
Sbjct  66   ATELTLGLPGPQSPARDTDLNLLSPAKLDEKTFFPLLPSKDEICSSSQKNIALGNKRGFS  125

Query  625  DTME------GSVTTEANWMF  669
            D M+       SV TE NWMF
Sbjct  126  DAMDQFSEAKSSVYTEKNWMF  146



>ref|XP_012068087.1| PREDICTED: auxin-responsive protein IAA9-like [Jatropha curcas]
 ref|XP_012068088.1| PREDICTED: auxin-responsive protein IAA9-like [Jatropha curcas]
 gb|KDP41528.1| hypothetical protein JCGZ_15935 [Jatropha curcas]
Length=368

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 93/134 (69%), Gaps = 6/134 (4%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MS  +LG    EGQ N +++ASS++ +   QTGS L+ERNY+GLSD SSVDSS      +
Sbjct  1    MSSPLLGAVEEEGQSNVTLLASSTSAESTCQTGSELRERNYMGLSDCSSVDSSVIPAACD  60

Query  424  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  597
            + K RL LKATELRLGLPGSQSP+R+ EL   S+ + DEKP FPL PS +   SSV K  
Sbjct  61   QNKTRLILKATELRLGLPGSQSPERNSELCLLSSAQLDEKPFFPLHPSNERHCSSVQKNV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  121  VSGNKRGFSDAMDG  134



>ref|XP_008219180.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
 ref|XP_008219181.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
Length=366

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 94/135 (70%), Gaps = 8/135 (6%)
 Frame = +1

Query  256  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +LG     EG  + ++++SS +++ +    S LKERNY+GLSD SSVDSS  S V 
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  421  N-EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KA  594
               K  LNLKAT+LRLGLPGSQSP+RD EL   ST + DEKPLFPL P KDG +SS+ K 
Sbjct  61   GGSKSSLNLKATDLRLGLPGSQSPERDSELRLIST-QLDEKPLFPLHPIKDGNYSSLQKT  119

Query  595  SFTGNKRGFLDTMEG  639
              +GNKRGF D M+G
Sbjct  120  VVSGNKRGFSDAMDG  134



>ref|XP_007225723.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26922.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=293

 Score =   102 bits (255),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 94/135 (70%), Gaps = 8/135 (6%)
 Frame = +1

Query  256  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +LG     EG  + ++++SS +++ +    S LKERNY+GLSD SSVDSS  S V 
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  421  N-EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KA  594
               K+ LNLKAT+LRLGLPGSQSP+RD EL   ST + DEKPLFPL P  DG +SS+ K 
Sbjct  61   GGSKNSLNLKATDLRLGLPGSQSPERDSELRLIST-QLDEKPLFPLHPIMDGNYSSLQKT  119

Query  595  SFTGNKRGFLDTMEG  639
              +GNKRGF D M+G
Sbjct  120  VVSGNKRGFSDAMDG  134



>ref|XP_003544843.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN39979.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=367

 Score =   103 bits (257),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 89/133 (67%), Gaps = 5/133 (4%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTL-DCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MS  +LG    EGQ N +++ SSS + + +    S LKERNY+GLSD SSVDSSA S   
Sbjct  1    MSKPLLGIGEEEGQSNVTLLVSSSVIMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  600
              K  LNLKATELRLGLPG QSP+RD +L   S+ +FDEKPLFPL P+ D   SS K + 
Sbjct  61   ETKSNLNLKATELRLGLPGLQSPERDSDLCLRSSIQFDEKPLFPLHPATDDHHSSSKPAV  120

Query  601  TGNKRGFLDTMEG  639
             GNKRGF D M G
Sbjct  121  LGNKRGFSDVMSG  133



>gb|KCW68554.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
 gb|KCW68555.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=321

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 88/142 (62%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +L     E + N +++AS S+L  + Q    LKERNY+G+ D  S D S      +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQNAE-LKERNYMGMGDHPSADGSVIPNAFD  59

Query  424  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  600
              K  LNL+ATELRLGLPGSQSP+RD +    S+ K DEKP FPL PS DG +SS K   
Sbjct  60   GCKITLNLRATELRLGLPGSQSPERDADFCTISSAKLDEKPFFPLHPSNDGHYSSQKIVV  119

Query  601  TGNKRGFLDTMEGSVTTEANWM  666
            +GNKRGF D M G   +EA +M
Sbjct  120  SGNKRGFADAMGGD--SEAKFM  139



>gb|ADL70574.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
 gb|ADL70585.1| indole-3-acetic acid inducible 9 [Arabidopsis thaliana]
Length=286

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 87/127 (69%), Gaps = 9/127 (7%)
 Frame = +1

Query  316  TLDCISQ-TGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKATELRLGLPGSQSP  489
            T +CIS+ T   LKE NYLGLSD SSV SS  S +  ++K  ++LKATEL LGLPGSQSP
Sbjct  2    TSNCISRNTLGGLKEHNYLGLSDCSSVGSSTLSPLAEDDKATISLKATELTLGLPGSQSP  61

Query  490  KRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGNKRGFLDTME------GSVT  648
             RD ELN  S  K DEKP FPLLPSKD I SS  K + +GNKRGF DTM+       SV 
Sbjct  62   ARDTELNLLSPAKLDEKPFFPLLPSKDEICSSSQKNNASGNKRGFSDTMDQFAEAKSSVY  121

Query  649  TEANWMF  669
            TE NWMF
Sbjct  122  TEKNWMF  128



>ref|NP_001280795.1| auxin-responsive protein IAA8-like [Malus domestica]
 gb|ADL36582.1| ARF domain class transcription factor [Malus domestica]
Length=363

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 94/133 (71%), Gaps = 7/133 (5%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ + +++ASS +++ + Q    LKERNY+GLSD SSVDSS  S V +
Sbjct  1    MSPPLLGVDEEEGQSDVTLLASSGSMESVCQNSLELKERNYMGLSDCSSVDSSKVSAVSD  60

Query  424  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  597
              +  L+LKATELRLGLPGSQSP+RD E    ST + DEKPLFPL P KDG +SS+ K  
Sbjct  61   GSRSSLHLKATELRLGLPGSQSPERDSEARVIST-QLDEKPLFPLHPLKDGHYSSLQKTV  119

Query  598  FTGNKRGFLDTME  636
             +GNKRGF D M+
Sbjct  120  VSGNKRGFSDAMD  132



>ref|XP_007225727.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26926.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=397

 Score =   102 bits (255),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 75/145 (52%), Positives = 98/145 (68%), Gaps = 8/145 (6%)
 Frame = +1

Query  256  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +LG     EG  + ++++SS +++ +    S LKERNY+GLSD SSVDSS  S V 
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  421  N-EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KA  594
               K+ LNLKAT+LRLGLPGSQSP+RD EL   ST + DEKPLFPL P  DG +SS+ K 
Sbjct  61   GGSKNSLNLKATDLRLGLPGSQSPERDSELRLIST-QLDEKPLFPLHPIMDGNYSSLQKT  119

Query  595  SFTGNKRGFLDTMEGSVTTEANWMF  669
              +GNKRGF D M+G +  +   ++
Sbjct  120  VVSGNKRGFSDAMDGFLEVKTTSLY  144



>ref|XP_007225724.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225725.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225726.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26923.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26924.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26925.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=366

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 94/135 (70%), Gaps = 8/135 (6%)
 Frame = +1

Query  256  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +LG     EG  + ++++SS +++ +    S LKERNY+GLSD SSVDSS  S V 
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  421  N-EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KA  594
               K+ LNLKAT+LRLGLPGSQSP+RD EL   ST + DEKPLFPL P  DG +SS+ K 
Sbjct  61   GGSKNSLNLKATDLRLGLPGSQSPERDSELRLIST-QLDEKPLFPLHPIMDGNYSSLQKT  119

Query  595  SFTGNKRGFLDTMEG  639
              +GNKRGF D M+G
Sbjct  120  VVSGNKRGFSDAMDG  134



>gb|AEI70507.1| auxin-responsive protein [Gossypium hirsutum]
Length=357

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 93/134 (69%), Gaps = 6/134 (4%)
 Frame = +1

Query  256  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGVQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  424  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKAS  597
            E K  LNLKATELRLGLPG QSP+R+ EL   S+ + DEKPLFPL PS DG  F+S K  
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPLFPLHPSSDGHCFASQKNV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  121  VSGNKRGFSDAMDG  134



>gb|KHG13564.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=357

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 93/134 (69%), Gaps = 6/134 (4%)
 Frame = +1

Query  256  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGVQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  424  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKAS  597
            E K  LNLKATELRLGLPG QSP+R+ EL   S+ + DEKPLFPL PS DG  F+S K  
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPLFPLHPSSDGHCFASQKNV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  121  VSGNKRGFSDAMDG  134



>gb|KCW68553.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=330

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 89/142 (63%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +L     E + N +++AS S+L  + Q  + LKERNY+G+ D  S D S      +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQN-AELKERNYMGMGDHPSADGSVIPNAFD  59

Query  424  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  600
              K  LNL+ATELRLGLPGSQSP+RD +    S+ K DEKP FPL PS DG +SS K   
Sbjct  60   GCKITLNLRATELRLGLPGSQSPERDADFCTISSAKLDEKPFFPLHPSNDGHYSSQKIVV  119

Query  601  TGNKRGFLDTMEGSVTTEANWM  666
            +GNKRGF D M G   +EA +M
Sbjct  120  SGNKRGFADAMGGD--SEAKFM  139



>ref|XP_010061570.1| PREDICTED: auxin-responsive protein IAA9-like [Eucalyptus grandis]
 ref|XP_010061571.1| PREDICTED: auxin-responsive protein IAA9-like [Eucalyptus grandis]
 gb|KCW68552.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=359

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 89/142 (63%), Gaps = 8/142 (6%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +L     E + N +++AS S+L  + Q  + LKERNY+G+ D  S D S      +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQN-AELKERNYMGMGDHPSADGSVIPNAFD  59

Query  424  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  600
              K  LNL+ATELRLGLPGSQSP+RD +    S+ K DEKP FPL PS DG +SS K   
Sbjct  60   GCKITLNLRATELRLGLPGSQSPERDADFCTISSAKLDEKPFFPLHPSNDGHYSSQKIVV  119

Query  601  TGNKRGFLDTMEGSVTTEANWM  666
            +GNKRGF D M G   +EA +M
Sbjct  120  SGNKRGFADAMGGD--SEAKFM  139



>ref|XP_008378626.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
 ref|XP_008378627.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
Length=363

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 93/133 (70%), Gaps = 7/133 (5%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ + +++ASS +++ + Q    LKERNY+GLSD SSVDSS  S V +
Sbjct  1    MSPPLLGVDEEEGQSDVTLLASSGSMESVCQNSLELKERNYMGLSDCSSVDSSKVSAVSD  60

Query  424  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  597
                 L+LKATELRLGLPGSQSP+RD E    ST + DEKPLFPL P KDG +SS+ K  
Sbjct  61   GSXSSLHLKATELRLGLPGSQSPERDSEARVIST-QLDEKPLFPLHPLKDGHYSSLQKTV  119

Query  598  FTGNKRGFLDTME  636
             +GNKRGF D M+
Sbjct  120  VSGNKRGFSDAMD  132



>gb|KJB64034.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64035.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=303

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 92/134 (69%), Gaps = 6/134 (4%)
 Frame = +1

Query  256  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  424  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKAS  597
            E K  LNLKATELRLGLPG QSP+R+ EL   S+ + DEKP FPL PS DG  F+S K  
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPFFPLHPSSDGHCFASQKNV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  121  VSGNKRGFSDAMDG  134



>emb|CDY68170.1| BnaCnng57860D [Brassica napus]
Length=311

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 97/153 (63%), Gaps = 17/153 (11%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV-NEKDRLNLKAT  453
            E Q N SV +SS T +CIS+ G  LK  NY GLSDSSSV+SS  S  V ++K  ++LKAT
Sbjct  6    ELQSNVSVASSSPTSNCISK-GGGLKVHNYFGLSDSSSVESSTLSRNVEDDKATISLKAT  64

Query  454  ELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF-TGNKRGFLDT  630
            EL LGLPGSQSP R+ EL        DEKP FPLLP+KD IFSS   +   GNKRGF DT
Sbjct  65   ELTLGLPGSQSPARETEL--------DEKPFFPLLPTKDEIFSSSHKNIGPGNKRGFSDT  116

Query  631  MEGSVTTEANWMFTIPKSDSHTPQSAGQGNFGS  729
            M     TE NWMF  P+ +    Q+  +G  G+
Sbjct  117  M----YTEKNWMF--PEVNKEVTQNIPKGQLGT  143



>gb|KJB64033.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=330

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 92/134 (69%), Gaps = 6/134 (4%)
 Frame = +1

Query  256  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  424  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKAS  597
            E K  LNLKATELRLGLPG QSP+R+ EL   S+ + DEKP FPL PS DG  F+S K  
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPFFPLHPSSDGHCFASQKNV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  121  VSGNKRGFSDAMDG  134



>gb|KJB64027.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64028.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64029.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64030.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64031.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64032.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=357

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 92/134 (69%), Gaps = 6/134 (4%)
 Frame = +1

Query  256  MSPTILG---EG-QGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG   EG Q N +++ SS +++ + Q  + LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  424  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKAS  597
            E K  LNLKATELRLGLPG QSP+R+ EL   S+ + DEKP FPL PS DG  F+S K  
Sbjct  61   ERKASLNLKATELRLGLPGLQSPERNPELCLLSSSQLDEKPFFPLHPSSDGHCFASQKNV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  121  VSGNKRGFSDAMDG  134



>ref|XP_010463449.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Camelina 
sativa]
Length=339

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 103/172 (60%), Gaps = 23/172 (13%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgv-VNEK  429
            MSP    E Q N SV +SS T +CIS+ T  ALKE NYLGLSD SS   S+     + E 
Sbjct  1    MSPE--EELQSNVSVASSSPTSNCISRGTTVALKEHNYLGLSDCSSSVGSSTLSAGLTED  58

Query  430  DR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASF  600
            D+  ++LKATEL LGLPGSQ+   DL L   S  K DEKP FPLLPSKD I SS  K + 
Sbjct  59   DKASISLKATELTLGLPGSQARDTDLNLMKNSV-KLDEKPFFPLLPSKDEICSSSQKNNA  117

Query  601  TGNKRGFLDTME------GSVTTEANWMF-------TIPKSDSHTPQSAGQG  717
            +GNKRGF DTM+       SV TE NWMF       ++ K D   PQS  +G
Sbjct  118  SGNKRGFSDTMDQFAEAKSSVYTEKNWMFPEAAATKSVTKKD--VPQSIPKG  167



>ref|XP_010683059.1| PREDICTED: auxin-responsive protein IAA9 [Beta vulgaris subsp. 
vulgaris]
Length=339

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 87/163 (53%), Positives = 96/163 (59%), Gaps = 19/163 (12%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE  426
            MSP +LG    GQ N   +  S T  C     S LKE NY GLSD SSVDSS  S +  E
Sbjct  1    MSPPLLGLEGGGQSNDHSLVPSPT--CAE---SGLKELNYFGLSDCSSVDSSNVSSLSEE  55

Query  427  -KDRLNL--KATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KA  594
             KD LNL  KATELRLGLPGSQSP+RD +L   S  K DEKPLFPL P KDGI SS  KA
Sbjct  56   NKDSLNLNFKATELRLGLPGSQSPERDSDLCLLSASKLDEKPLFPLTPLKDGISSSSQKA  115

Query  595  SFTGNKRGFLDTMEGSVTTEANWMFTIPKSDSHTPQSAGQGNF  723
            + +G+KRGF D       TEA W F     DS  P+   QG  
Sbjct  116  AVSGSKRGFSD-------TEAKWTFKSTGLDSDAPKPGAQGKL  151



>ref|NP_001241389.1| uncharacterized protein LOC100783314 [Glycine max]
 ref|XP_006577803.1| PREDICTED: uncharacterized protein LOC100783314 isoform X1 [Glycine 
max]
 gb|ACU23462.1| unknown [Glycine max]
Length=360

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 6/145 (4%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSST-LDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +L     EG+ N +++ SSST ++ +       KERNY+G SD SSVDSS  S   
Sbjct  1    MSPPVLSMGEEEGKSNVTLLGSSSTAMESVCLKSLEFKERNYMGSSDCSSVDSSVPSFSE  60

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  600
              K  LNLKATELRLGLPGSQSP+RD +L   S+ + DEKPLFPL P  D   SS K + 
Sbjct  61   ECKSNLNLKATELRLGLPGSQSPERDSDLCLRSSTQLDEKPLFPLHPLTDDHHSSAKTAV  120

Query  601  TGNKRGFLDTMEGSVTTEANWMFTI  675
             GNKRGF D M G +++E  ++  +
Sbjct  121  LGNKRGFSDAMNG-LSSEGKFLVDL  144



>gb|AGV54485.1| auxin-responsive protein [Phaseolus vulgaris]
Length=352

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 90/139 (65%), Gaps = 10/139 (7%)
 Frame = +1

Query  253  MMSPTILGEGQGNGSVMA-----SSSTLDCISQTGSALKERNYlglsdsssvdssaasg-  414
            M  P ++ E  G   V +     SS +LDC SQ G+ LKERNYLGLSD SSVDS A++  
Sbjct  1    MSPPAVVTEEDGLSKVSSTLASGSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVP  60

Query  415  --vVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV  588
                 +K+ +NLKATELRLGLPGSQSP+RD +L   S+ K DEKPLFPL P+KDGIF S 
Sbjct  61   GLGDEKKENMNLKATELRLGLPGSQSPERDPDLFSLSSAKIDEKPLFPLGPTKDGIFLSS  120

Query  589  K--ASFTGNKRGFLDTMEG  639
            +    F   ++   DTM+ 
Sbjct  121  RKNCCFRQTRKVLPDTMDA  139



>gb|KHN08222.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=360

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/145 (50%), Positives = 92/145 (63%), Gaps = 6/145 (4%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSST-LDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +L     EG+ N +++ SSST ++ +       KERNY+G SD SSVDSS  S   
Sbjct  1    MSPPVLSMGEEEGKSNVTLLGSSSTAMESVCLKSLEFKERNYMGSSDCSSVDSSVPSFSE  60

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  600
              K  LNLKATELRLGLPGSQSP+RD +L   S+ + DEKPLFPL P  D   SS K + 
Sbjct  61   ECKSNLNLKATELRLGLPGSQSPERDSDLCLRSSTQLDEKPLFPLHPLTDDHHSSAKIAV  120

Query  601  TGNKRGFLDTMEGSVTTEANWMFTI  675
             GNKRGF D M G +++E  ++  +
Sbjct  121  LGNKRGFSDAMNG-LSSEGKFLVDL  144



>ref|XP_009150656.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Brassica 
rapa]
Length=330

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 89/135 (66%), Gaps = 10/135 (7%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-KDRLNLKAT  453
            E Q NGSV +S+  +  +      LKE NYLGLSD SSV SS  SG+ ++ K  ++LKAT
Sbjct  6    ELQSNGSVASSTRNIVGV------LKEHNYLGLSDCSSVGSSNLSGLADDDKATISLKAT  59

Query  454  ELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLD  627
            EL LGLPGSQSP RD ELN     K DEKP FPLLPSKD + SS   K   +GNKRGF D
Sbjct  60   ELTLGLPGSQSPARDTELNLLGPAKLDEKPFFPLLPSKDEMCSSSSHKNIASGNKRGFSD  119

Query  628  TMEGS-VTTEANWMF  669
            TM+   V TE NWMF
Sbjct  120  TMDKVPVYTEKNWMF  134



>ref|XP_009150655.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Brassica 
rapa]
Length=332

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 89/135 (66%), Gaps = 10/135 (7%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-KDRLNLKAT  453
            E Q NGSV +S+  +  +      LKE NYLGLSD SSV SS  SG+ ++ K  ++LKAT
Sbjct  6    ELQSNGSVASSTRNIVGV------LKEHNYLGLSDCSSVGSSNLSGLADDDKATISLKAT  59

Query  454  ELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLD  627
            EL LGLPGSQSP RD ELN     K DEKP FPLLPSKD + SS   K   +GNKRGF D
Sbjct  60   ELTLGLPGSQSPARDTELNLLGPAKLDEKPFFPLLPSKDEMCSSSSHKNIASGNKRGFSD  119

Query  628  TMEGS-VTTEANWMF  669
            TM+   V TE NWMF
Sbjct  120  TMDKVPVYTEKNWMF  134



>gb|KHN09036.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=361

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 86/133 (65%), Gaps = 5/133 (4%)
 Frame = +1

Query  256  MSPTIL--GEGQGNGSV---MASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +L  GE +G  +V   ++SS+T++ +       KERNY+GLSD SSVDSS  S   
Sbjct  1    MSPPVLSIGEEEGKSNVTLLVSSSTTMESVCLKSLEFKERNYMGLSDCSSVDSSVPSFSE  60

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  600
              K  LNLKATELRLGLPGSQSP RD +L   S+ +FDEK LFPL P  D   SS K + 
Sbjct  61   ETKSNLNLKATELRLGLPGSQSPDRDSDLCLRSSTQFDEKTLFPLRPLTDDHHSSAKTAV  120

Query  601  TGNKRGFLDTMEG  639
             GNKRGF D M G
Sbjct  121  LGNKRGFSDAMNG  133



>ref|XP_010484401.1| PREDICTED: auxin-responsive protein IAA9 [Camelina sativa]
 ref|XP_010484402.1| PREDICTED: auxin-responsive protein IAA9 [Camelina sativa]
Length=343

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 92/146 (63%), Gaps = 16/146 (11%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQ---TGSALKERNYlglsdsssvdssaasgv-VNEKDR--L  438
            E Q N SV +SS T +CIS+    G  LKE NYLGLSD SS   S+     + E D+  +
Sbjct  6    ELQSNVSVASSSPTSNCISRGTTLGGGLKEHNYLGLSDCSSSVGSSTLSTGLTEDDKASI  65

Query  439  NLKATELRLGLPGSQSPKRDLELN--GPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGN  609
            +LKATEL LGLPGS+SP RD +LN   P   K DEKP FPLLPSKD I SS  K + +GN
Sbjct  66   SLKATELTLGLPGSRSPARDTDLNLMTPPV-KLDEKPFFPLLPSKDEICSSSQKINASGN  124

Query  610  KRGFLDTME------GSVTTEANWMF  669
            KRGF DTM+       SV T  NWMF
Sbjct  125  KRGFSDTMDQFAEAKSSVYTGKNWMF  150



>gb|AFK38170.1| unknown [Lotus japonicus]
Length=347

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 69/136 (51%), Positives = 84/136 (62%), Gaps = 7/136 (5%)
 Frame = +1

Query  253  MMSPTILGEGQGNGSVMASSSTLDCISQTGS-ALKERNY---lglsdsssvdssaasgvV  420
            M  P ++ E +G   + ++++     SQ     LKERNY      S   S  S+  S   
Sbjct  1    MTPPAVVTEEEGRCKLTSTTTVATASSQVDCFELKERNYLGLSDCSSVDSCASTVPSLCD  60

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTG--KFDEKPLFPLLPSKDGIFS-SVK  591
             +K  LNLKATELRLGLPGSQSP+RD EL   S+   K DEKPLFPLLP+KDGI S S K
Sbjct  61   EKKGNLNLKATELRLGLPGSQSPERDPELFSLSSAATKLDEKPLFPLLPTKDGISSTSQK  120

Query  592  ASFTGNKRGFLDTMEG  639
            A  +GNKRGF DTM+G
Sbjct  121  AVVSGNKRGFADTMDG  136



>emb|CAC84706.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=365

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 91/132 (69%), Gaps = 5/132 (4%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ N +++AS ++ +     G  LKERNY+GLSD SSVDSSA S   +
Sbjct  1    MSPPLLGVVEEEGQSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  424  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  600
            E K  LNLKATELRLGLPGSQSP+R+ EL+  S+   DEKP FPL PS DG +S+ K   
Sbjct  61   ERKASLNLKATELRLGLPGSQSPERNHELSLLSSALLDEKPFFPLHPSNDGHYSTQKNVV  120

Query  601  TGNKRGFLDTME  636
            +GNKR F D M+
Sbjct  121  SGNKRVFSDAMD  132



>ref|XP_007137671.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 ref|XP_007137672.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09665.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09666.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
Length=366

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +1

Query  256  MSPTILG---EGQGNGSVMASSST-LDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG   EG+ N +++ SSST ++ +      LKERNY+GLSD SSVDSS  S    
Sbjct  1    MSPPLLGIGEEGKSNVTLLVSSSTTMESVCLKTLELKERNYMGLSDCSSVDSSVPSVSEE  60

Query  424  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  603
             K  LNLKATEL LGLPGSQS +RD +L   S+ +FDEK LFPL P  D   SS K +  
Sbjct  61   TKSNLNLKATELTLGLPGSQSSERDSDLCLRSSTQFDEKALFPLCPLADDHHSSTKTAVL  120

Query  604  GNKRGFLDTMEG  639
            GNKRGF D M G
Sbjct  121  GNKRGFSDAMNG  132



>emb|CDY08767.1| BnaA06g24570D [Brassica napus]
Length=332

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 89/135 (66%), Gaps = 10/135 (7%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-KDRLNLKAT  453
            E Q NGSV +S+  +  +      LKE NYLGLSD SSV SS  SG+ ++ K  ++LKAT
Sbjct  6    ELQSNGSVASSTRNIVGV------LKEHNYLGLSDCSSVGSSNLSGLADDDKATISLKAT  59

Query  454  ELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLD  627
            EL LGLPGSQSP RD ELN     K DEKP FPLLPSKD + SS   K   +GNKRGF D
Sbjct  60   ELTLGLPGSQSPARDTELNLLGPAKLDEKPFFPLLPSKDEMCSSSSHKNIASGNKRGFSD  119

Query  628  TMEGS-VTTEANWMF  669
            TM+   + TE NWMF
Sbjct  120  TMDKVPLYTEKNWMF  134



>gb|KDO81312.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=210

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 80/134 (60%), Gaps = 5/134 (4%)
 Frame = +1

Query  253  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  417
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  418  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  597
             + K  LNLKATELRLGLPGSQSP+R  EL      + DEKPLFPL P+ D  + S K  
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  121  VSGNKRGFSDAMDG  134



>ref|XP_004512542.1| PREDICTED: auxin-responsive protein IAA8-like [Cicer arietinum]
Length=348

 Score = 96.7 bits (239),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 84/134 (63%), Gaps = 12/134 (9%)
 Frame = +1

Query  256  MSPTIL---GEGQGNGSVMASSSTLDCISQTGSALKERNY---lglsdsssvdssaasgv  417
            MSP ++    EG+   S    S++    SQ G+ LKERNY      S   S DS+  S  
Sbjct  1    MSPAVVVTEEEGRNKLSSTVVSASSQSFSQIGADLKERNYLGLSDCSSVDSCDSTVPSLC  60

Query  418  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  597
              +K+ LNLKATELRLGLPGSQSP+RD +     + K DEKPLFPL+P+KDGI  +V   
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERDSDF---YSTKLDEKPLFPLVPTKDGIQKNV---  114

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF DT++G
Sbjct  115  VSGNKRGFADTVDG  128



>ref|XP_009366395.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
 ref|XP_009366396.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
Length=363

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 7/133 (5%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ + + ++SS +++ + Q    LKE+NY+GLSD SSV SS  S   +
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSLELKEQNYMGLSDCSSVGSSKVSTASD  60

Query  424  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  597
              K  LNLKATELRLGLPGSQSP+RD +L   +T + DEK LFPL P KDG +SS  K  
Sbjct  61   GSKSSLNLKATELRLGLPGSQSPERDSDLRVITT-QLDEKSLFPLHPLKDGHYSSSQKIV  119

Query  598  FTGNKRGFLDTME  636
             +GNKRGF D M+
Sbjct  120  VSGNKRGFSDAMD  132



>gb|AFZ78618.1| hypothetical protein [Populus tomentosa]
Length=365

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 90/132 (68%), Gaps = 5/132 (4%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EG  N +++AS ++ +     G  LKERNY+GLSD SSVDSSA S   +
Sbjct  1    MSPPLLGVVEEEGHSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  424  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASF  600
            E K  LNLKATELRLGLPGSQSP+R+ EL+  S+   DEKP FPL PS DG +S+ K   
Sbjct  61   ERKTSLNLKATELRLGLPGSQSPERNHELSLLSSALLDEKPFFPLHPSNDGHYSTQKNVV  120

Query  601  TGNKRGFLDTME  636
            +GNKR F D M+
Sbjct  121  SGNKRVFSDAMD  132



>ref|XP_008338995.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338996.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338997.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338999.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
Length=366

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 87/133 (65%), Gaps = 7/133 (5%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ + + ++SS +++ + Q  S LKE+NY+GLSD SSV SS  S   +
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSSELKEQNYMGLSDCSSVGSSNVSTASD  60

Query  424  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  597
                 LNLKATELRLGLPGSQSP RD       T + DEKPLFPL P KDG +SS  K  
Sbjct  61   GSNSSLNLKATELRLGLPGSQSPXRDSXXRVIXT-QLDEKPLFPLHPLKDGHYSSXQKXV  119

Query  598  FTGNKRGFLDTME  636
             +GNKRGF D M+
Sbjct  120  VSGNKRGFSDAMD  132



>ref|XP_008339000.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Malus 
domestica]
Length=363

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 87/133 (65%), Gaps = 7/133 (5%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ + + ++SS +++ + Q  S LKE+NY+GLSD SSV SS  S   +
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSSELKEQNYMGLSDCSSVGSSNVSTASD  60

Query  424  -EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  597
                 LNLKATELRLGLPGSQSP RD       T + DEKPLFPL P KDG +SS  K  
Sbjct  61   GSNSSLNLKATELRLGLPGSQSPXRDSXXRVIXT-QLDEKPLFPLHPLKDGHYSSXQKXV  119

Query  598  FTGNKRGFLDTME  636
             +GNKRGF D M+
Sbjct  120  VSGNKRGFSDAMD  132



>gb|KDO81311.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=288

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 80/134 (60%), Gaps = 5/134 (4%)
 Frame = +1

Query  253  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  417
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  418  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  597
             + K  LNLKATELRLGLPGSQSP+R  EL      + DEKPLFPL P+ D  + S K  
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  121  VSGNKRGFSDAMDG  134



>emb|CDY45607.1| BnaCnng13150D [Brassica napus]
Length=329

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 76/134 (57%), Positives = 87/134 (65%), Gaps = 9/134 (7%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNE-KDRLNLKAT  453
            E Q N SV +S+  +  +      LKE NYLGLSD SSV SS  SG+ ++ K  ++LKAT
Sbjct  6    ELQSNVSVASSTRNIVGV------LKEHNYLGLSDCSSVGSSNLSGLADDDKATISLKAT  59

Query  454  ELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKASFTGNKRGFLDT  630
            EL LGLPGSQSP RD ELN     K DEK  FPLLPSKD I  SS K   +GNKRGF DT
Sbjct  60   ELTLGLPGSQSPARDTELNSLGPAKLDEKLFFPLLPSKDEICPSSQKNIASGNKRGFADT  119

Query  631  MEGS-VTTEANWMF  669
            M+   V TE NWMF
Sbjct  120  MDKVPVYTEKNWMF  133



>gb|KDO81310.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=333

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 80/134 (60%), Gaps = 5/134 (4%)
 Frame = +1

Query  253  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  417
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  418  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  597
             + K  LNLKATELRLGLPGSQSP+R  EL      + DEKPLFPL P+ D  + S K  
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  121  VSGNKRGFSDAMDG  134



>ref|NP_001267710.1| auxin-responsive protein IAA9-like [Cucumis sativus]
 dbj|BAA85821.1| Aux/IAA protein [Cucumis sativus]
 gb|KGN62776.1| hypothetical protein Csa_2G372720 [Cucumis sativus]
Length=355

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 89/133 (67%), Gaps = 7/133 (5%)
 Frame = +1

Query  256  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +L      E + N +++ASS++++ +S      +ERNY+GLSDSSS DS   +   
Sbjct  1    MSPPLLDVGEVEESRSNVTLLASSNSMESVSPNNLEFEERNYMGLSDSSSEDSCMTATKS  60

Query  421  N-EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSS-VKA  594
            +  K  LNLKATELRLGLPGS+SP+RD +    S+ + DEKPLFPL PS DG++SS  K 
Sbjct  61   DGNKPSLNLKATELRLGLPGSESPERDPDNCLRSSSQLDEKPLFPLHPSSDGLYSSPQKT  120

Query  595  SFTGNKRGFLDTM  633
              +GNKRGF D M
Sbjct  121  VVSGNKRGFSDAM  133



>gb|KDO81302.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81303.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81304.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81305.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81306.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81307.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81308.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81309.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=365

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 80/134 (60%), Gaps = 5/134 (4%)
 Frame = +1

Query  253  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  417
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  418  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  597
             + K  LNLKATELRLGLPGSQSP+R  EL      + DEKPLFPL P+ D  + S K  
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  121  VSGNKRGFSDAMDG  134



>emb|CAJ13716.1| auxin induced protein [Capsicum chinense]
Length=210

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 89/135 (66%), Gaps = 7/135 (5%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ N +++ SSS+L  I Q G ALKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLGVGEEEGQSNVTLLGSSSSLGSICQKGLALKERNYMGLSDCSSVDSCNISTSSE  60

Query  424  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  594
            + +   LNLKATELRLGLPGSQSP+R        + K DEK LFPL P+KD  FS S K 
Sbjct  61   DNNGVGLNLKATELRLGLPGSQSPERGTAPCPLGSTKVDEKLLFPLHPAKDTAFSVSQKT  120

Query  595  SFTGNKRGFLDTMEG  639
              TGNKRGF D M+G
Sbjct  121  VVTGNKRGFSDAMDG  135



>emb|CDP00957.1| unnamed protein product [Coffea canephora]
Length=366

 Score = 94.0 bits (232),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 112/180 (62%), Gaps = 12/180 (7%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV-  420
            MS  +LG    EGQ N S++ SSS+LD   Q GS  KERNY+GLS+ SSVDSS  S +  
Sbjct  1    MSTPLLGVGEEEGQSNVSLLTSSSSLDSSRQNGSVFKERNYMGLSECSSVDSSTISNISG  60

Query  421  -NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  597
             +    LNLKATELRLGLPGSQSP+RD EL   S+ K DEKPLFPL P KDG  S+++ +
Sbjct  61   GSNGSCLNLKATELRLGLPGSQSPERDSELCLVSSTKLDEKPLFPLHPLKDGNCSNLQRT  120

Query  598  FT-GNKRGFLDTMEG---SVTTEANWMFT-IPKSDSHTPQSAGQGNFGSSAG-IKSNVPQ  759
             T GNKRGF D M+G      +E N M +  P  +S     + +   G+ A  +K  VPQ
Sbjct  121  ITSGNKRGFSDAMDGFSEGKFSEVNVMLSPRPSLNSSMKSVSAKETTGTQAAKLKEVVPQ  180



>ref|XP_006433732.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433733.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433734.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433735.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433737.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433738.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433739.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433740.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46972.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46973.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46974.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46975.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46977.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46978.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46979.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46980.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=365

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 80/134 (60%), Gaps = 5/134 (4%)
 Frame = +1

Query  253  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  417
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPGVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  418  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  597
             + K  LNLKATELRLGLPGSQSP+R  EL      + DEKPLFPL P+ D  + S K  
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  121  VSGNKRGFSDAMDG  134



>ref|XP_006433736.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46976.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=383

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 80/134 (60%), Gaps = 5/134 (4%)
 Frame = +1

Query  253  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  417
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPGVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  418  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  597
             + K  LNLKATELRLGLPGSQSP+R  EL      + DEKPLFPL P+ D  + S K  
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLDEKPLFPLHPTSDSHYPSQKNV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  121  VSGNKRGFSDAMDG  134



>ref|XP_002302351.1| auxin-responsive family protein [Populus trichocarpa]
 gb|ABK95187.1| unknown [Populus trichocarpa]
 gb|EEE81624.1| auxin-responsive family protein [Populus trichocarpa]
Length=366

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 90/133 (68%), Gaps = 6/133 (5%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EG  N +++AS ++ +     G  LKERNY+GLSD SSVDSSA S   +
Sbjct  1    MSPPLLGVVEEEGHSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  424  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  597
            E K  LNLKATELRLGLPGSQSP+R+ EL+  S+   DEKP FPL PS DG +SS  K  
Sbjct  61   ERKTSLNLKATELRLGLPGSQSPERNHELSLLSSALLDEKPFFPLHPSNDGHYSSTQKNV  120

Query  598  FTGNKRGFLDTME  636
             +GNKR F D M+
Sbjct  121  VSGNKRVFSDAMD  133



>ref|XP_008444965.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=355

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 88/133 (66%), Gaps = 7/133 (5%)
 Frame = +1

Query  256  MSPTILG-----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +L      E + N +++ASS++++ +S      +ERNY+GLSDSSS DS   +   
Sbjct  1    MSPPLLDVGEVEESRSNVTLLASSNSMESVSPNNLGFEERNYMGLSDSSSEDSCMTATKS  60

Query  421  N-EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSS-VKA  594
            +  K  LNLKATELRLGLPGS+SP+RD +    S+ + DEKPLFPL PS DG +SS  K 
Sbjct  61   DGNKPSLNLKATELRLGLPGSESPERDPDNCLRSSSQLDEKPLFPLHPSSDGHYSSPQKT  120

Query  595  SFTGNKRGFLDTM  633
              +GNKRGF D M
Sbjct  121  VVSGNKRGFSDAM  133



>ref|XP_011016963.1| PREDICTED: auxin-responsive protein IAA9-like [Populus euphratica]
Length=366

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 89/133 (67%), Gaps = 6/133 (5%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +LG    EGQ N ++++S  + +     G  LKERNY+GLSD SSVDSSA S   N
Sbjct  1    MSPPLLGVVEEEGQSNVTLLSSPVSAESACLNGLELKERNYMGLSDCSSVDSSAVSAASN  60

Query  424  E-KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KAS  597
            E K  LNLKATELRLGLPGSQSP+R  EL+  S+   DEKP FPL PS DG ++S  K  
Sbjct  61   ERKTSLNLKATELRLGLPGSQSPERHHELSLLSSALLDEKPFFPLHPSIDGHYTSTQKNV  120

Query  598  FTGNKRGFLDTME  636
             +GNKR F D M+
Sbjct  121  VSGNKRVFSDAMD  133



>gb|KHN04889.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=289

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 1/69 (1%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI-FSSVKASFTGNK  612
            +NLKATELRLGLPGSQSP+R+ +L   S  K DEKPLFPLLP+KDGI  S+ K   +GNK
Sbjct  1    MNLKATELRLGLPGSQSPEREPDLFSLSPAKLDEKPLFPLLPTKDGICLSAQKTVVSGNK  60

Query  613  RGFLDTMEG  639
            RGF DTM+G
Sbjct  61   RGFADTMDG  69



>emb|CDY18679.1| BnaA09g07160D [Brassica napus]
Length=312

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 83/131 (63%), Gaps = 17/131 (13%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATE  456
            E Q N S+ +SS T +CIS+ G  LK  NY GLSDSSSV+SS  S   ++K  ++LKATE
Sbjct  6    ELQSNVSLASSSPTSNCISK-GGGLKVHNYFGLSDSSSVESSTLSCGEDDKGTISLKATE  64

Query  457  LRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME  636
            L LGLPGSQSP RD         K DEKP FPLLPSKD I SS       NKRGF DT  
Sbjct  65   LTLGLPGSQSPARDT--------KLDEKPFFPLLPSKDEICSSSHK----NKRGFSDT--  110

Query  637  GSVTTEANWMF  669
              + TE NWMF
Sbjct  111  --IYTEKNWMF  119



>ref|XP_004299829.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=356

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 84/123 (68%), Gaps = 6/123 (5%)
 Frame = +1

Query  274  GEGQGNGSVMASSSTL--DCISQTGSALKERNYlglsdsssvdssaasgvVNEKDRLNLK  447
            GE +G+  V A SS+L  D +    S LKERNY+GLSD SSVDSS  S V   K RLNL 
Sbjct  9    GEEEGSSDVTALSSSLSMDSVCPNSSDLKERNYMGLSDCSSVDSSKGSDVDGSKSRLNLM  68

Query  448  ATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLD  627
            ATELRLGLPGSQSP+R+ EL   ST + DEKPLFPL P KD +  ++    +GNKRGF D
Sbjct  69   ATELRLGLPGSQSPERNSELRLIST-QPDEKPLFPLHPVKDSLQKTI---VSGNKRGFSD  124

Query  628  TME  636
             M+
Sbjct  125  AMD  127



>ref|XP_009608764.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana tomentosiformis]
Length=346

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 89/135 (66%), Gaps = 10/135 (7%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +L     EGQ N +++ASS++L  I + GS LKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSE  60

Query  424  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  594
            + +   LNLKATELRLGLPGS SP+R +E    ++   +EK LFPL P+KD   + S K 
Sbjct  61   DNNACGLNLKATELRLGLPGSLSPERGIETCPLAS---NEKLLFPLHPAKDSALAVSQKT  117

Query  595  SFTGNKRGFLDTMEG  639
              TGNKRGF D M+G
Sbjct  118  VVTGNKRGFSDAMDG  132



>ref|XP_010104556.1| Auxin-responsive protein IAA9 [Morus notabilis]
 gb|EXC01157.1| Auxin-responsive protein IAA9 [Morus notabilis]
Length=378

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 88/136 (65%), Gaps = 17/136 (13%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP + G    EGQ N +V+ SS +++      S LKERNY+GLSD SS D S  S   +
Sbjct  1    MSPPLHGVGEDEGQSNVTVLTSSPSME------SELKERNYMGLSDCSSGDCSVVSPASD  54

Query  424  EKDR-LNLKATELRLGLPGSQSPKRDLELNGP--STGKFDEKPLFPLLPSKDGIFS-SVK  591
            E  R LNLKATELRLGLPGSQSP+RD    GP  S+ + DEK LFPL PS D  ++ S+K
Sbjct  55   ESKRTLNLKATELRLGLPGSQSPERD---PGPRQSSAQLDEKKLFPLHPSNDVHYNHSLK  111

Query  592  ASFTGNKRGFLDTMEG  639
               +GNKRGF D M G
Sbjct  112  TVVSGNKRGFSDAMNG  127



>ref|XP_006472387.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472388.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Citrus 
sinensis]
 ref|XP_006472389.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Citrus 
sinensis]
 ref|XP_006472390.1| PREDICTED: auxin-responsive protein IAA9-like isoform X4 [Citrus 
sinensis]
Length=365

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 79/134 (59%), Gaps = 5/134 (4%)
 Frame = +1

Query  253  MMSPTILGE---GQGNGSVMASSSTLDCISQTGSALKERNYl--glsdsssvdssaasgv  417
            M  P  +GE   G GN +++AS +++  + Q  S +KERNY+    S S      ++   
Sbjct  1    MSPPPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSG  60

Query  418  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  597
             + K  LNLKATELRLGLPGSQSP+R  EL      +  EKPLFPL P+ D  + S K  
Sbjct  61   ESSKSSLNLKATELRLGLPGSQSPERGSELCLLGPAQLGEKPLFPLHPTNDSHYPSQKNV  120

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  121  VSGNKRGFSDAMDG  134



>ref|XP_010527157.1| PREDICTED: auxin-responsive protein IAA8, partial [Tarenaya hassleriana]
Length=354

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 89/140 (64%), Gaps = 8/140 (6%)
 Frame = +1

Query  328  ISQTGSALKERNYlglsdsssvdssaasgvVN-EKDRLNLKATELRLGLPGSQSPKRDLE  504
            I Q+  +LKERNYLGLSD SSVDSS    V + EK  LN+KATELRLGLPGS+S + + +
Sbjct  9    IPQSALSLKERNYLGLSDCSSVDSSTVPNVPDDEKGNLNVKATELRLGLPGSRSSEGESD  68

Query  505  LNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME------GSVTTEANWM  666
               PS    DEK LFPL PSKD   +  K   + NKRGF DT++      GSV  E NWM
Sbjct  69   FGLPSPRTPDEKLLFPLAPSKDPA-TGHKNVVSRNKRGFSDTLDEFSEVKGSVFPEKNWM  127

Query  667  FTIPKSDSHTPQSAGQGNFG  726
            F   +S+  TPQSA QG  G
Sbjct  128  FNWAESNPETPQSARQGKPG  147



>ref|XP_009789143.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana sylvestris]
Length=346

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 71/135 (53%), Positives = 89/135 (66%), Gaps = 10/135 (7%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +L     EGQ N +++ASS++L  I + GS LKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSG  60

Query  424  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKA  594
            + +   LNLKATELRLGLPGS SP+R +E    ++   +EK LFPL P+KD  +  S K 
Sbjct  61   DNNACGLNLKATELRLGLPGSLSPERGIETCPLAS---NEKLLFPLHPAKDSDLVVSQKT  117

Query  595  SFTGNKRGFLDTMEG  639
              TGNKRGF D M+G
Sbjct  118  VVTGNKRGFSDAMDG  132



>ref|XP_010444576.1| PREDICTED: auxin-responsive protein IAA9-like [Camelina sativa]
Length=341

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 92/169 (54%), Gaps = 27/169 (16%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQ-----TGSALKERNY---lglsdsssvdssaasgvVNEKD  432
            E Q N SV +SS T +CIS+         LKE NY      S S    + +A  V ++K 
Sbjct  6    ELQSNVSVASSSPTSNCISRGTTVSVCGGLKEHNYLGLSDCSSSVGSSTLSAGLVEDDKA  65

Query  433  RLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV-KASFTGN  609
              +LKATEL LGLPGS+    DL L  P   K DEKP FPLLPSKD I SS  K + +GN
Sbjct  66   TFSLKATELTLGLPGSRD--TDLNLMTPPV-KLDEKPFFPLLPSKDDICSSSQKNNASGN  122

Query  610  KRGFLDTME------GSVTTEANWMF-------TIPKSDSHTPQSAGQG  717
            KRGF DTM+       SV TE NWMF       ++ K D   PQS  +G
Sbjct  123  KRGFSDTMDQFAEAKSSVYTEKNWMFPEAAATQSVTKKD--VPQSIPKG  169



>ref|XP_009112194.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Brassica 
rapa]
Length=278

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 82/131 (63%), Gaps = 17/131 (13%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATE  456
            E Q N SV +SS T +CIS+ G  LK  NY GLSDSSSV+SS  S   ++K  ++LKATE
Sbjct  6    ELQSNVSVASSSPTSNCISK-GGGLKVHNYFGLSDSSSVESSTLSCGEDDKGTISLKATE  64

Query  457  LRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME  636
            L LGLPGSQS  R+         K DEKP FPLLPSKD I SS       NKRGF DT  
Sbjct  65   LTLGLPGSQSHARET--------KLDEKPFFPLLPSKDEICSSSHK----NKRGFSDT--  110

Query  637  GSVTTEANWMF  669
              V TE NWMF
Sbjct  111  --VYTEKNWMF  119



>ref|XP_009112193.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Brassica 
rapa]
Length=312

 Score = 89.0 bits (219),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 82/131 (63%), Gaps = 17/131 (13%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATE  456
            E Q N SV +SS T +CIS+ G  LK  NY GLSDSSSV+SS  S   ++K  ++LKATE
Sbjct  6    ELQSNVSVASSSPTSNCISK-GGGLKVHNYFGLSDSSSVESSTLSCGEDDKGTISLKATE  64

Query  457  LRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME  636
            L LGLPGSQS  R+         K DEKP FPLLPSKD I SS       NKRGF DT  
Sbjct  65   LTLGLPGSQSHARET--------KLDEKPFFPLLPSKDEICSSSHK----NKRGFSDT--  110

Query  637  GSVTTEANWMF  669
              V TE NWMF
Sbjct  111  --VYTEKNWMF  119



>gb|AID60626.1| auxin-responsive protein IAA8 [Dimocarpus longan]
Length=257

 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 91/136 (67%), Gaps = 12/136 (9%)
 Frame = +1

Query  256  MSPTILG----EGQ-GNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +LG    EG   N +++ASSS+LD I Q    LKERNY+GLSD SSVDSS  S + 
Sbjct  1    MSPPLLGVEEEEGHPSNVTLLASSSSLDSICQNNPELKERNYMGLSDCSSVDSSVISNLS  60

Query  421  NE---KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVK  591
            NE   K  LNLKATELRLGLPGSQSP+RD  L   S+ + DEKPLFPL P+ DG +   K
Sbjct  61   NETKSKSSLNLKATELRLGLPGSQSPERDPNLCLLSSAQLDEKPLFPLHPTNDGHYPLQK  120

Query  592  ASFTGNKRGFLDTMEG  639
                 NKRGF D M+G
Sbjct  121  ----NNKRGFSDAMDG  132



>emb|CAD10639.1| IAA9 protein [Nicotiana tabacum]
Length=346

 Score = 88.6 bits (218),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 88/135 (65%), Gaps = 10/135 (7%)
 Frame = +1

Query  256  MSPTILG----EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVN  423
            MSP +L     EGQ N +++ASS++L  I + GS LKERNY+GLSD SSVDS   S    
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSE  60

Query  424  EKDR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  594
            + +   LNLKATELRLGLPGS SP+R +E    ++   +EK LFPL P+KD   + S K 
Sbjct  61   DNNACGLNLKATELRLGLPGSLSPERGIETCPLAS---NEKLLFPLHPAKDSALAVSQKT  117

Query  595  SFTGNKRGFLDTMEG  639
              TGNKR F D M+G
Sbjct  118  VVTGNKRRFSDAMDG  132



>gb|AFK49555.1| unknown [Medicago truncatula]
Length=99

 Score = 82.8 bits (203),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 4/72 (6%)
 Frame = +1

Query  424  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  603
            +K  LNLKATELRLGLPGSQSP+R+++ +   T K DEKPLFPLLP+KDG+  +V    +
Sbjct  28   KKVNLNLKATELRLGLPGSQSPEREMDSDFYLT-KLDEKPLFPLLPAKDGLQKNV---VS  83

Query  604  GNKRGFLDTMEG  639
            GNKRGF DT++G
Sbjct  84   GNKRGFADTVDG  95



>dbj|BAP94244.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94245.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94246.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94247.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94248.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94249.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94250.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94251.1| auxin-responsive protein IAA homolog, partial [Rubus grayanus]
 dbj|BAP94252.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94253.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94254.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94255.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94256.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94257.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94258.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94259.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94260.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94261.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94263.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94264.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94265.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94266.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94268.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94269.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94270.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94271.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94272.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94273.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94275.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94292.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94293.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94294.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94295.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94296.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94297.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94298.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94299.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94300.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94301.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94303.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94304.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94305.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94306.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94311.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94313.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
Length=78

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 52/70 (74%), Gaps = 4/70 (6%)
 Frame = +1

Query  427  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTG  606
            K  LNLKATELRLGLPGSQSP+RD EL   ST + DEKPLFPL P KD +  +V    +G
Sbjct  9    KSSLNLKATELRLGLPGSQSPERDSELRLIST-QLDEKPLFPLHPLKDSLQKTV---VSG  64

Query  607  NKRGFLDTME  636
            NKRGF DTM+
Sbjct  65   NKRGFSDTMD  74



>ref|XP_010555426.1| PREDICTED: auxin-responsive protein IAA8-like [Tarenaya hassleriana]
 ref|XP_010555427.1| PREDICTED: auxin-responsive protein IAA8-like [Tarenaya hassleriana]
Length=360

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 69/147 (47%), Positives = 77/147 (52%), Gaps = 15/147 (10%)
 Frame = +1

Query  328  ISQTGSALKERNYlglsdsssvdssaasgvVNE-KDRLNLKATELRLGLPGSQSPKRD--  498
            + Q    LKE NYL  S  SS   S      NE K  LN KATELRLGLPG QSP+R+  
Sbjct  20   VHQYAFGLKEHNYLVRSVDSSTLCSVPD---NEGKGNLNFKATELRLGLPGLQSPERESN  76

Query  499  LELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME------GSVTTEAN  660
              L  P T   DEK LFPL  SKD      K   +GNKRGF DT++      GSV  E  
Sbjct  77   FALLNPRTP--DEKLLFPLSASKDPAIVH-KNVVSGNKRGFSDTLDEFSVVKGSVYPEKT  133

Query  661  WMFTIPKSDSHTPQSAGQGNFGSSAGI  741
            W     +S+  TPQSA QG F    GI
Sbjct  134  WTLNESESNPETPQSARQGTFADKTGI  160



>ref|XP_011464769.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=331

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 74/106 (70%), Gaps = 4/106 (4%)
 Frame = +1

Query  319  LDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRD  498
            +D +    S LKERNY+GLSD SSVDSS  S V   K RLNL ATELRLGLPGSQSP+R+
Sbjct  1    MDSVCPNSSDLKERNYMGLSDCSSVDSSKGSDVDGSKSRLNLMATELRLGLPGSQSPERN  60

Query  499  LELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFLDTME  636
             EL   ST + DEKPLFPL P KD +  ++    +GNKRGF D M+
Sbjct  61   SELRLIST-QPDEKPLFPLHPVKDSLQKTI---VSGNKRGFSDAMD  102



>dbj|BAP94262.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94267.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94274.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94283.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94302.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94307.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94308.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94309.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94310.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94312.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94314.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94315.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
Length=78

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +1

Query  427  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTG  606
            K  LNLKATELRLGLPGSQSP RD EL   ST + DEKPLFPL P KD +  +V    +G
Sbjct  9    KSSLNLKATELRLGLPGSQSPXRDSELRLIST-QLDEKPLFPLHPLKDSLQKTV---VSG  64

Query  607  NKRGFLDTME  636
            NKRGF DTM+
Sbjct  65   NKRGFSDTMD  74



>gb|AFK43616.1| unknown [Lotus japonicus]
Length=180

 Score = 82.8 bits (203),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  427  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTG  606
            K  LNLKATELRLGLPGSQSP+RD  L    + +FDEKPLFPL P  D   SS K +  G
Sbjct  66   KSNLNLKATELRLGLPGSQSPERDSNLCLRGSAQFDEKPLFPLHPVTDDHHSSSKPAVLG  125

Query  607  NKRGFLDTMEG  639
            +KRGF D M G
Sbjct  126  SKRGFSDAMNG  136



>ref|XP_003612933.1| Auxin-responsive protein (Aux/IAA) [Medicago truncatula]
 gb|AES95891.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=335

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 4/72 (6%)
 Frame = +1

Query  424  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  603
            +K  LNLKATELRLGLPGSQSP+R+++ +   T K DEKPLFPLLP+KDG+  +V    +
Sbjct  47   KKVNLNLKATELRLGLPGSQSPEREMDSDFYLT-KLDEKPLFPLLPAKDGLQKNV---VS  102

Query  604  GNKRGFLDTMEG  639
            GNKRGF DT++G
Sbjct  103  GNKRGFADTVDG  114



>dbj|BAP94276.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94277.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94278.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94279.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94280.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94281.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94282.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94284.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94285.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94286.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94287.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94288.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94289.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94290.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94291.1| auxin-responsive protein IAA homolog, partial [Rubus palmatus]
 dbj|BAP94316.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94317.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94318.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94319.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94320.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94321.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94322.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
 dbj|BAP94323.1| auxin-responsive protein IAA homolog, partial [Rubus sp. MM-2014]
Length=78

 Score = 80.1 bits (196),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = +1

Query  427  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTG  606
            K  LNLKATELRLGLPGSQSP RD EL   ST + DEKPLFPL P KD +  +V    +G
Sbjct  9    KSSLNLKATELRLGLPGSQSPDRDSELRLIST-QLDEKPLFPLHPLKDSLQKTV---VSG  64

Query  607  NKRGFLDTME  636
            NKRGF DTM+
Sbjct  65   NKRGFSDTMD  74



>ref|NP_001237053.1| uncharacterized protein LOC100500373 [Glycine max]
 gb|ACU15430.1| unknown [Glycine max]
Length=193

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 86/134 (64%), Gaps = 20/134 (15%)
 Frame = +1

Query  256  MSPTIL---GEGQGNGSVMASSST--LDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +L    EGQ + S++AS+S+  L+C S   +  KE NYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLVTEDEGQCHASMVASASSPSLNCFSLNEAGFKECNYLGLSDCSSVDSSTVPNLS  60

Query  421  NEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKA  594
            +EK + LNLKATELRLGLPGSQSP+R+ E             LF L  +KDGI S S K 
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERETE-------------LFSLSSTKDGICSLSQKT  107

Query  595  SFTGNKRGFLDTME  636
              +GNKRGF DTM+
Sbjct  108  VVSGNKRGFADTMD  121



>gb|ABY48132.1| GH1 protein [Medicago truncatula]
Length=335

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 45/72 (63%), Positives = 57/72 (79%), Gaps = 4/72 (6%)
 Frame = +1

Query  424  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  603
            +K  LNLKATELRLGLPGSQSP+R+++ +   T K DEKPLFPLLP+KDG+  +V    +
Sbjct  47   KKVNLNLKATELRLGLPGSQSPEREMDSDFYLT-KLDEKPLFPLLPAKDGLQKNV---VS  102

Query  604  GNKRGFLDTMEG  639
            GNKRGF DT++G
Sbjct  103  GNKRGFADTVDG  114



>gb|AFK38538.1| unknown [Lotus japonicus]
Length=318

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 49/71 (69%), Gaps = 0/71 (0%)
 Frame = +1

Query  427  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTG  606
            K  LNLKATELRLGLPGSQSP+RD  L    + +FDEKPLFPL P  D   SS K +  G
Sbjct  33   KSNLNLKATELRLGLPGSQSPERDSNLCLRGSAQFDEKPLFPLHPVTDDHHSSSKPAVLG  92

Query  607  NKRGFLDTMEG  639
            +KRGF D M G
Sbjct  93   SKRGFSDAMNG  103



>emb|CBI19314.3| unnamed protein product [Vitis vinifera]
Length=318

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/72 (65%), Positives = 51/72 (71%), Gaps = 1/72 (1%)
 Frame = +1

Query  427  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIF-SSVKASFT  603
            K  LNLKATELRLGLPGS SP R+ EL   S+ K DEKPLFPL PSKD  + SS K   +
Sbjct  22   KSSLNLKATELRLGLPGSLSPGREPELCLLSSTKLDEKPLFPLHPSKDLTYTSSQKTVVS  81

Query  604  GNKRGFLDTMEG  639
            GNKRGF D M G
Sbjct  82   GNKRGFADAMNG  93



>emb|CAI77628.1| Aux/IAA protein [Solanum lycopersicum]
Length=308

 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 45/69 (65%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS-SVKASFTGNK  612
            LNLKATELRLGLPGSQSP+R  E     + K DEK LFPL PSKD  FS S K   +GNK
Sbjct  26   LNLKATELRLGLPGSQSPERGEETCPVISTKVDEKLLFPLHPSKDTAFSVSQKTVVSGNK  85

Query  613  RGFLDTMEG  639
            RGF D M+G
Sbjct  86   RGFSDAMDG  94



>ref|XP_010666360.1| PREDICTED: auxin-responsive protein IAA8-like [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 79/124 (64%), Gaps = 3/124 (2%)
 Frame = +1

Query  277  EGQGNGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEKDR--LNLKA  450
            +GQ +G++   +S+ + I    S L+E NY+G SD SS   S+A  V + + R   NLKA
Sbjct  9    DGQSSGTLPFPASSAESILHNNSELREVNYMGYSDCSSSVDSSAISVASGESRSNYNLKA  68

Query  451  TELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI-FSSVKASFTGNKRGFLD  627
            TELRLGLPGSQSP RD EL   ++ K D+KPLFPL P  DG   SS  +  +G+KRGF D
Sbjct  69   TELRLGLPGSQSPGRDTELGPLTSSKLDKKPLFPLYPVSDGTSSSSRISIVSGHKRGFAD  128

Query  628  TMEG  639
             + G
Sbjct  129  AVNG  132



>ref|XP_004490496.1| PREDICTED: auxin-responsive protein IAA9-like [Cicer arietinum]
Length=362

 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 64/130 (49%), Positives = 80/130 (62%), Gaps = 11/130 (8%)
 Frame = +1

Query  277  EGQGNGSVMASSSTL---DCISQTGSALKERNYlglsdsssvdssaasgvVNE-----KD  432
            EG+ N +++ SSST     C++ + S  KE NY+GLS  SS  S  +S  +       K 
Sbjct  12   EGESNVTLLVSSSTTMESVCLNVSKSKPKEFNYMGLSCDSSSSSVESSVPIQSFSDETKS  71

Query  433  RLNLKATELRLGLPGSQSPKRD--LELNGPSTGKFDEKPLFPLLPSK-DGIFSSVKASFT  603
             LNLKATELRLG+PGSQSP+RD   +L   S+ KFDEK LFPL P K D   SS K +  
Sbjct  72   NLNLKATELRLGIPGSQSPERDSSSDLCLRSSTKFDEKTLFPLHPQKDDHHLSSPKVAVL  131

Query  604  GNKRGFLDTM  633
            G+KRGF D M
Sbjct  132  GSKRGFSDAM  141



>ref|XP_010521481.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Tarenaya 
hassleriana]
Length=352

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 86/142 (61%), Gaps = 18/142 (13%)
 Frame = +1

Query  253  MMSPTILG-----EGQGNG---SVMASSSTLDCISQTGSALKERNYlglsdss--svdss  402
            +MSP + G     + Q N    S++ SS+++D      S LKERNY+ LS+SS     ++
Sbjct  2    LMSPPLRGVAEEEKAQSNNNATSLLVSSASMD---NKISELKERNYMSLSESSPGDESNN  58

Query  403  aasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS  582
            +   ++ ++ +++LK TELRLGLPGSQ  +R+     PS    DEKPLFPL P+ D   +
Sbjct  59   SGVSIITDEIKISLKETELRLGLPGSQPLQRE-----PSPSLLDEKPLFPLHPTGDDHCT  113

Query  583  SVKASFTGNKRGFLDTMEGSVT  648
            S+K    GNKRGF D MEG ++
Sbjct  114  SLKNVVFGNKRGFSDAMEGKLS  135



>ref|XP_004509716.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Cicer 
arietinum]
Length=326

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 80/134 (60%), Gaps = 32/134 (24%)
 Frame = +1

Query  256  MSPTIL---GEGQGNGSVMASSS--TLDCISQTGSALKERNYlglsdsssvdssaasgvV  420
            MSP +L    E Q N S +AS+S  +LDC SQ G+ LKERNYLGLSD SSVDSS    + 
Sbjct  1    MSPPLLVTEEERQSNTSTVASASPQSLDCFSQNGAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  421  NEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  597
            +EK + LNLKATELRLGLPGSQSP+RD                 P+         S K  
Sbjct  61   DEKKENLNLKATELRLGLPGSQSPERD-----------------PV---------SQKNV  94

Query  598  FTGNKRGFLDTMEG  639
             +GNKRGF D M+G
Sbjct  95   VSGNKRGFSDAMDG  108



>gb|KEH28135.1| auxin response factor [Medicago truncatula]
Length=272

 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  KDRLNLKATELRLGLPGSQSPKRDL-ELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  603
            K  LNLKATELRLGLPGS SP+RD  +    S+ +FDEKPLFPL P KD      K +  
Sbjct  62   KSNLNLKATELRLGLPGSLSPERDSSDFCLRSSKQFDEKPLFPLHPQKDDHLFESKPAVL  121

Query  604  GNKRGFLDTM  633
            GNKRGF D M
Sbjct  122  GNKRGFSDAM  131



>ref|XP_003615390.1| Auxin-responsive protein IAA5 [Medicago truncatula]
 gb|AES98348.1| auxin response factor [Medicago truncatula]
Length=347

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 47/70 (67%), Gaps = 1/70 (1%)
 Frame = +1

Query  427  KDRLNLKATELRLGLPGSQSPKRDL-ELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  603
            K  LNLKATELRLGLPGS SP+RD  +    S+ +FDEKPLFPL P KD      K +  
Sbjct  62   KSNLNLKATELRLGLPGSLSPERDSSDFCLRSSKQFDEKPLFPLHPQKDDHLFESKPAVL  121

Query  604  GNKRGFLDTM  633
            GNKRGF D M
Sbjct  122  GNKRGFSDAM  131



>ref|XP_010521482.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Tarenaya 
hassleriana]
Length=352

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 86/142 (61%), Gaps = 18/142 (13%)
 Frame = +1

Query  253  MMSPTILG-----EGQGNG---SVMASSSTLDCISQTGSALKERNYlglsdss--svdss  402
            +MSP + G     + Q N    S++ SS+++D      S LKERNY+ LS+SS     ++
Sbjct  2    LMSPPLRGVAEEEKAQSNNNATSLLVSSASMD---NKISELKERNYMSLSESSPGDESNN  58

Query  403  aasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS  582
            +   ++ ++ +++LK TELRLGLPGSQ  +R+     PS    DEKPLFPL P+ D   +
Sbjct  59   SGVSIITDEIKISLKETELRLGLPGSQPLQRE-----PSPSLLDEKPLFPLHPTGDDHCT  113

Query  583  SVKASFTGNKRGFLDTMEGSVT  648
            S+K    GNKRGF D ++G ++
Sbjct  114  SLKNVVFGNKRGFSDAVQGKLS  135



>ref|XP_010429195.1| PREDICTED: auxin-responsive protein IAA8 [Camelina sativa]
Length=326

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 5/101 (5%)
 Frame = +1

Query  349  LKERNYlglsdsssvdssaasgvVN--EKDRLNLKATELRLGLPGSQSPKRDLELNGPST  522
            LKERNYLGLSD SSVDSS     V   EK  LN KATELRLGLP SQSP+R+ +    S 
Sbjct  20   LKERNYLGLSDCSSVDSSTIHNRVQDGEKSNLNFKATELRLGLPESQSPERETDFGLLSP  79

Query  523  GKFDEKPLFPLLPSKDGIFSSV---KASFTGNKRGFLDTME  636
               DEK LFPLLPSKD   S+    K   +GNKRGF DT +
Sbjct  80   RTPDEKLLFPLLPSKDTAASATIGHKNVVSGNKRGFADTWD  120



>ref|XP_010472259.1| PREDICTED: auxin-responsive protein IAA8-like [Camelina sativa]
Length=326

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 66/101 (65%), Gaps = 5/101 (5%)
 Frame = +1

Query  349  LKERNYlglsdsssvdssaasgvVN--EKDRLNLKATELRLGLPGSQSPKRDLELNGPST  522
            LKERNYLGLSD SSVDSS     V   EK  LN KATELRLGLP SQSP+R+ +    S 
Sbjct  20   LKERNYLGLSDCSSVDSSTIHNRVQDGEKSNLNFKATELRLGLPESQSPERETDFGLLSP  79

Query  523  GKFDEKPLFPLLPSKDGIFSSV---KASFTGNKRGFLDTME  636
               DEK LFPLLPSKD   S+    K   +GNKRGF DT +
Sbjct  80   RTPDEKLLFPLLPSKDIAASATIGHKNVVSGNKRGFADTWD  120



>gb|EPS59988.1| auxin-regulated protein [Genlisea aurea]
Length=317

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 80/144 (56%), Gaps = 28/144 (19%)
 Frame = +1

Query  256  MSPTILGEGQG--NGSVMASSSTLDCISQTGSALKERNYlglsdsssvdssaasgvVNEK  429
            MSP  L  G G  NGSVMA+SS     S     LKE NYLG SD SSVDSSA     + K
Sbjct  1    MSPPCLTAGIGGSNGSVMAASSG----SVNSLVLKEINYLGFSDCSSVDSSALPE--DNK  54

Query  430  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGN  609
              +NLKATELRLGLPGSQSP R            DEK LFPL+PS       V    +GN
Sbjct  55   TTMNLKATELRLGLPGSQSPDR------------DEKQLFPLVPSSQKPVIIV----SGN  98

Query  610  KRGFLDTM----EGSVTTEANWMF  669
            KRGF DT+    E     + +W+F
Sbjct  99   KRGFSDTVDCFTESKCCGDGSWIF  122



>emb|CDY66936.1| BnaC02g47310D [Brassica napus]
Length=276

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 53/85 (62%), Gaps = 10/85 (12%)
 Frame = +1

Query  421  NEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI--FSSVKA  594
            ++K  + LKAT+L LGLPGS+SP RD +L+  S  K DE+P  PL+P KD I  FSS+K 
Sbjct  49   DDKAVIRLKATDLTLGLPGSRSPVRDTDLHLLSYAKLDERPFLPLVPLKDEICPFSSLKN  108

Query  595  SFTGNKRGFLDTMEGSVTTEANWMF  669
              +GNK         SV TE NW F
Sbjct  109  IASGNK--------SSVYTEKNWTF  125



>gb|ADL70561.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=249

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  8    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  66

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  67   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  108



>gb|ADL70565.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=247

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  5    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  63

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  64   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  105



>gb|ADL70572.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=252

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  10   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  68

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  69   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  110



>gb|ADL70573.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=253

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  11   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  69

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  70   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  111



>gb|ADL70566.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=251

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  9    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  67

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  68   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  109



>gb|ADC29393.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=253

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  9    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  67

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  68   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  109



>gb|ADL70564.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=252

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  8    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  66

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  67   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  108



>gb|ADL70563.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=250

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  6    TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  64

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  65   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  106



>gb|ADL70567.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=259

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  73

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  74   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  115



>gb|ADL70571.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=262

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  73

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  74   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  115



>gb|ADL70569.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=263

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  73

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  74   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  115



>gb|ADC29390.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=257

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  13   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  71

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  72   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  113



>gb|ADL70570.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=278

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  73

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  74   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  115



>gb|ADL70562.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=226

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 66/98 (67%), Gaps = 3/98 (3%)
 Frame = +1

Query  349  LKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGK  528
            LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    S   
Sbjct  1    LKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLLSPRT  59

Query  529  FDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
             DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  60   PDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  97



>gb|ADC29389.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=221

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 66/98 (67%), Gaps = 3/98 (3%)
 Frame = +1

Query  349  LKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGK  528
            LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    S   
Sbjct  1    LKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLLSPRT  59

Query  529  FDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
             DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  60   PDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  97



>ref|XP_006404728.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 ref|XP_006404729.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 dbj|BAJ33826.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46181.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
 gb|ESQ46182.1| hypothetical protein EUTSA_v10000236mg [Eutrema salsugineum]
Length=334

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 77/132 (58%), Gaps = 12/132 (9%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVN---EKDRLNLKATELRLGLPGSQSPKRDLEL  507
            T   LKERNYLGLSD SSVDSS    VV    EK  LN KATELRLGLP SQSP+R+ + 
Sbjct  15   TPPGLKERNYLGLSDCSSVDSSTIPNVVVPEIEKSNLNFKATELRLGLPESQSPERETDF  74

Query  508  NGPSTGKFDEKPLFPLLPSKD---GIFSSVKASFTGNKRGFLDT------MEGSVTTEAN  660
               S    DEK LFPLLP KD   G  +  K   +GNKRGF DT      ++GSV     
Sbjct  75   GLLSPRTPDEKLLFPLLPCKDHASGATTVHKNVVSGNKRGFSDTWDEFSAVKGSVRPGGI  134

Query  661  WMFTIPKSDSHT  696
             M   PK  S+T
Sbjct  135  NMMLSPKVTSNT  146



>ref|NP_179852.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 ref|NP_001077943.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 sp|Q38826.1|IAA8_ARATH RecName: Full=Auxin-responsive protein IAA8; AltName: Full=Indoleacetic 
acid-induced protein 8 [Arabidopsis thaliana]
 gb|AAG50092.1|AF334714_1 auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAC49049.1| IAA8 [Arabidopsis thaliana]
 gb|AAD15575.1| auxin-regulated protein (IAA8) [Arabidopsis thaliana]
 gb|AAL24387.1| auxin-regulated protein (IAA8) [Arabidopsis thaliana]
 gb|AAL49895.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM20092.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM47990.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AAM65174.1| auxin-regulated protein IAA8 [Arabidopsis thaliana]
 gb|AEC07336.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07338.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=321

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  73

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  74   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  115



>ref|NP_850028.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07337.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=319

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  15   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  73

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  74   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  115



>ref|NP_001189579.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
 gb|AEC07339.1| auxin-responsive protein IAA8 [Arabidopsis thaliana]
Length=338

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGP  516
            T   LKERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    
Sbjct  32   TSPCLKERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLL  90

Query  517  STGKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            S    DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  91   SPRTPDEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  132



>ref|XP_006294567.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27465.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
Length=323

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
 Frame = +1

Query  349  LKERNYlglsdsssvdssaasgvV--NEKDRLNLKATELRLGLPGSQSPKRDLELNGPST  522
            LKERNYLGLSD SSVDSS     V   EK  L  KATELRLGLP SQSP+R+ +    S 
Sbjct  19   LKERNYLGLSDCSSVDSSTIHNRVPDVEKSNLIFKATELRLGLPESQSPERETDFGLLSP  78

Query  523  GKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
               DEK LFPLLPSKD   +++  K   +GNKRGF DT +
Sbjct  79   RTPDEKLLFPLLPSKDTASATIGHKNVVSGNKRGFADTWD  118



>ref|XP_006294565.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 ref|XP_006294566.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27463.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
 gb|EOA27464.1| hypothetical protein CARUB_v10023602mg [Capsella rubella]
Length=330

 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 58/100 (58%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
 Frame = +1

Query  349  LKERNYlglsdsssvdssaasgvV--NEKDRLNLKATELRLGLPGSQSPKRDLELNGPST  522
            LKERNYLGLSD SSVDSS     V   EK  L  KATELRLGLP SQSP+R+ +    S 
Sbjct  19   LKERNYLGLSDCSSVDSSTIHNRVPDVEKSNLIFKATELRLGLPESQSPERETDFGLLSP  78

Query  523  GKFDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
               DEK LFPLLPSKD   +++  K   +GNKRGF DT +
Sbjct  79   RTPDEKLLFPLLPSKDTASATIGHKNVVSGNKRGFADTWD  118



>ref|XP_002878628.1| indoleacetic acid-induced protein 8 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54887.1| indoleacetic acid-induced protein 8 [Arabidopsis lyrata subsp. 
lyrata]
Length=313

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 57/98 (58%), Positives = 65/98 (66%), Gaps = 4/98 (4%)
 Frame = +1

Query  349  LKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGK  528
            LKERNYLGLSD SSVDSS    V  EK  LN KATELRLGLP S+SP+R+ +    S   
Sbjct  15   LKERNYLGLSDCSSVDSSTIPNV--EKSNLNFKATELRLGLPESESPERETDFGLLSPRT  72

Query  529  FDEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
             DEK LFPLLP KD   ++   K   +GNKRGF DT +
Sbjct  73   LDEKLLFPLLPCKDNTSATTGHKNVVSGNKRGFADTWD  110



>gb|ADL70568.1| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=225

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 65/97 (67%), Gaps = 3/97 (3%)
 Frame = +1

Query  352  KERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKF  531
            KERNYLGLSD SSVDSS    VV  K  LN KATELRLGLP SQSP+R+ +    S    
Sbjct  1    KERNYLGLSDCSSVDSSTIPNVVG-KSNLNFKATELRLGLPESQSPERETDFGLLSPRTP  59

Query  532  DEKPLFPLLPSKDGIFSSV--KASFTGNKRGFLDTME  636
            DEK LFPLLPSKD   ++   K   +GNKRGF DT +
Sbjct  60   DEKLLFPLLPSKDNGSATTGHKNVVSGNKRGFADTWD  96



>ref|XP_006850381.1| PREDICTED: auxin-responsive protein IAA9 [Amborella trichopoda]
 ref|XP_011625576.1| PREDICTED: auxin-responsive protein IAA9 [Amborella trichopoda]
 ref|XP_011625577.1| PREDICTED: auxin-responsive protein IAA9 [Amborella trichopoda]
 ref|XP_011625578.1| PREDICTED: auxin-responsive protein IAA9 [Amborella trichopoda]
 gb|ERN11962.1| hypothetical protein AMTR_s00184p00030540 [Amborella trichopoda]
Length=393

 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 66/100 (66%), Gaps = 4/100 (4%)
 Frame = +1

Query  349  LKERNYlglsdsssvdssaasgvVNEK-DRLNLKATELRLGLPGSQSPKRDLELNGPSTG  525
            L+E NY+GLSD+SS++SS  +  + EK D LNLK TELRLGLPGS+SP RD EL    + 
Sbjct  35   LREHNYMGLSDASSLESSVITCPLEEKEDSLNLKETELRLGLPGSRSPVRDPELCLLPSL  94

Query  526  KFDEKPLFPLLPSKDGIFSSVKAS---FTGNKRGFLDTME  636
            K DEK LFPL P K+            F+GNKRGF D ++
Sbjct  95   KLDEKALFPLAPLKENTSEEKNGRNGIFSGNKRGFSDAID  134



>gb|ADC29391.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=229

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +1

Query  427  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASF  600
            K  LN KATELRLGLP SQSP+R+ +    S    DEK LFPLLPSKD   ++   K   
Sbjct  20   KSNLNFKATELRLGLPESQSPERETDFGLLSPRTPDEKLLFPLLPSKDNGSATTGHKNVV  79

Query  601  TGNKRGFLDTME  636
            +GNKRGF DT +
Sbjct  80   SGNKRGFADTWD  91



>gb|ADC29392.2| indole-3-acetic acid inducible 8 [Arabidopsis thaliana]
Length=224

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 47/72 (65%), Gaps = 2/72 (3%)
 Frame = +1

Query  427  KDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSV--KASF  600
            K  LN KATELRLGLP SQSP+R+ +    S    DEK LFPLLPSKD   ++   K   
Sbjct  20   KSNLNFKATELRLGLPESQSPERETDFGLLSPRTPDEKLLFPLLPSKDNGSATTGHKNVV  79

Query  601  TGNKRGFLDTME  636
            +GNKRGF DT +
Sbjct  80   SGNKRGFADTWD  91



>ref|XP_010417025.1| PREDICTED: auxin-responsive protein IAA8-like [Camelina sativa]
Length=327

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 64/102 (63%), Gaps = 6/102 (6%)
 Frame = +1

Query  349  LKERNYlglsdsssvdssaasgvVNEKDR---LNLKATELRLGLPGSQSPKRDLELNGPS  519
            LK RNY GLSD SSVDSS     V + ++   LN KATELRLGLP SQSP+R+ +    S
Sbjct  20   LKVRNYFGLSDCSSVDSSTIHNRVQDGEKTSNLNFKATELRLGLPESQSPERETDFGLLS  79

Query  520  TGKFDEKPLFPLLPSKDGIFSSV---KASFTGNKRGFLDTME  636
                DEK LFPLLP KD   S+    K   +GNKRGF DT +
Sbjct  80   PRTPDEKLLFPLLPCKDTAASATTEHKNVVSGNKRGFADTWD  121



>emb|CDY25617.1| BnaA04g13090D [Brassica napus]
Length=266

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 62/97 (64%), Gaps = 10/97 (10%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLP-GSQSPKRDLELNG  513
            T   LKERNY+GLSD SSVDSS     V++K  LN KATELRLGLP  SQSP+R+ +   
Sbjct  15   TSPGLKERNYMGLSDCSSVDSSTIPN-VDKKSSLNFKATELRLGLPESSQSPQRETDYRL  73

Query  514  PSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFL  624
             S    DEK LFPLLP KD          +GNKRG+L
Sbjct  74   LSPRTPDEKLLFPLLPCKDHA--------SGNKRGYL  102



>ref|XP_009140376.1| PREDICTED: auxin-responsive protein IAA8 [Brassica rapa]
Length=266

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 62/97 (64%), Gaps = 10/97 (10%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvVNEKDRLNLKATELRLGLP-GSQSPKRDLELNG  513
            T   LKERNY+GLSD SSVDSS     V++K  LN KATELRLGLP  SQSP+R+ +   
Sbjct  15   TSPGLKERNYMGLSDCSSVDSSTIPN-VDKKSSLNFKATELRLGLPESSQSPQRETDFGL  73

Query  514  PSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFL  624
             S    DEK LFPLLP KD          +GNKRG+L
Sbjct  74   LSPRTPDEKLLFPLLPCKDHA--------SGNKRGYL  102



>emb|CDX89499.1| BnaC04g35180D [Brassica napus]
Length=271

 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 61/101 (60%), Gaps = 13/101 (13%)
 Frame = +1

Query  337  TGSALKERNYlglsdsssvdssaasgvV----NEKDRLNLKATELRLGLP-GSQSPKRDL  501
            T + LKERNYLGLSD SS   S+    +    ++K  LN KATELRLGLP  SQSP+R+ 
Sbjct  15   TATCLKERNYLGLSDCSSSVDSSTVPNLVLDTDKKSSLNFKATELRLGLPESSQSPQRET  74

Query  502  ELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKRGFL  624
            +    S    DEK LFPLLP KD          +GNKRG+L
Sbjct  75   DFGLLSPRTPDEKLLFPLLPCKDHA--------SGNKRGYL  107



>emb|CDY37837.1| BnaAnng04980D [Brassica napus]
Length=296

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 49/87 (56%), Gaps = 26/87 (30%)
 Frame = +1

Query  418  VNEKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKAS  597
            +++K  ++LKATEL LGLP  ++               DEKP FPL+PSKD +  S+K  
Sbjct  50   LDDKAAISLKATELTLGLPARET---------------DEKPFFPLVPSKDEV--SLK--  90

Query  598  FTGNKRGFLDTME---GSVTTEANWMF  669
                KRGF D M+    SV TE NWMF
Sbjct  91   ----KRGFSDAMDKSKSSVYTEKNWMF  113



>ref|XP_010463453.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Camelina 
sativa]
Length=304

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 82/171 (48%), Gaps = 56/171 (33%)
 Frame = +1

Query  256  MSPTILGEGQGNGSVMASSSTLDCISQ-TGSALKERNYlglsdsssvdssaasgv-VNEK  429
            MSP    E Q N SV +SS T +CIS+ T  ALKE NYLGLSD SS   S+     + E 
Sbjct  1    MSPE--EELQSNVSVASSSPTSNCISRGTTVALKEHNYLGLSDCSSSVGSSTLSAGLTED  58

Query  430  DR--LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFT  603
            D+  ++LKATEL LGLPGSQ                                   K + +
Sbjct  59   DKASISLKATELTLGLPGSQ-----------------------------------KNNAS  83

Query  604  GNKRGFLDTME------GSVTTEANWMF-------TIPKSDSHTPQSAGQG  717
            GNKRGF DTM+       SV TE NWMF       ++ K D   PQS  +G
Sbjct  84   GNKRGFSDTMDQFAEAKSSVYTEKNWMFPEAAATKSVTKKD--VPQSIPKG  132



>gb|AEI70506.1| auxin-responsive protein [Gossypium hirsutum]
Length=332

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 45/80 (56%), Gaps = 11/80 (14%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LNLK TELRLGLPGS+SP+R L L G      D+   F        + S +K   +G KR
Sbjct  47   LNLKETELRLGLPGSESPERKLSLFGKDLETNDKSNGF--------VGSPLKNLVSGAKR  98

Query  616  GFLDTMEGSVTTEANWMFTI  675
            GF D ++GS     NW+F I
Sbjct  99   GFSDAIDGS---NGNWVFAI  115



>gb|KHG09793.1| Auxin-responsive IAA27 -like protein [Gossypium arboreum]
Length=332

 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 44/80 (55%), Gaps = 11/80 (14%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LNLK TELRLGLPGSQSP+R L L G      D+   F        + S +K   +G KR
Sbjct  47   LNLKETELRLGLPGSQSPERKLSLFGKDLETNDKSNGF--------VGSPLKNLVSGAKR  98

Query  616  GFLDTMEGSVTTEANWMFTI  675
            GF D ++GS      W+F I
Sbjct  99   GFSDAIDGS---NGKWVFAI  115



>gb|AAM76220.1| putative IAA-responsive protein 9 [Gossypium herbaceum]
Length=122

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +1

Query  493  RDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  639
            R+ EL   S+ + DEKPLFPL PS DG  F+S K   +GNKRGF D M+G
Sbjct  1    RNPELCLLSSSQLDEKPLFPLHPSSDGHCFASQKNVVSGNKRGFSDAMDG  50



>gb|AAM76222.1| putative IAA-responsive protein 9 [Gossypium hirsutum]
Length=122

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +1

Query  493  RDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  639
            R+ EL   S+ + DEKPLFPL PS DG  F+S K   +GNKRGF D M+G
Sbjct  1    RNPELCLLSSSQLDEKPLFPLHPSSDGHCFASQKNVVSGNKRGFSDAMDG  50



>gb|AAM76223.1| putative IAA-responsive protein 9 [Gossypium hirsutum]
Length=122

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 34/50 (68%), Gaps = 1/50 (2%)
 Frame = +1

Query  493  RDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  639
            R+ EL   S+ + DEKP FPL PS DG  F+S K+  +GNKRGF D M+G
Sbjct  1    RNPELCLLSSSQLDEKPFFPLHPSSDGHCFASQKSVVSGNKRGFSDAMDG  50



>gb|KJB56780.1| hypothetical protein B456_009G135900 [Gossypium raimondii]
Length=268

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 11/80 (14%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LNLK TELRLGLPGS+SP+R L L G      D+   F        + S +K   +G KR
Sbjct  47   LNLKETELRLGLPGSESPERKLSLFGKDLETNDKSNGF--------VGSPLKNLVSGAKR  98

Query  616  GFLDTMEGSVTTEANWMFTI  675
            GF D ++GS      W+F I
Sbjct  99   GFSDAIDGS---NGKWVFAI  115



>gb|KJB56781.1| hypothetical protein B456_009G135900 [Gossypium raimondii]
Length=300

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 11/80 (14%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LNLK TELRLGLPGS+SP+R L L G      D+   F        + S +K   +G KR
Sbjct  47   LNLKETELRLGLPGSESPERKLSLFGKDLETNDKSNGF--------VGSPLKNLVSGAKR  98

Query  616  GFLDTMEGSVTTEANWMFTI  675
            GF D ++GS      W+F I
Sbjct  99   GFSDAIDGS---NGKWVFAI  115



>gb|KJB56779.1| hypothetical protein B456_009G135900 [Gossypium raimondii]
Length=332

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 11/80 (14%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LNLK TELRLGLPGS+SP+R L L G      D+   F        + S +K   +G KR
Sbjct  47   LNLKETELRLGLPGSESPERKLSLFGKDLETNDKSNGF--------VGSPLKNLVSGAKR  98

Query  616  GFLDTMEGSVTTEANWMFTI  675
            GF D ++GS      W+F I
Sbjct  99   GFSDAIDGS---NGKWVFAI  115



>gb|KJB56782.1| hypothetical protein B456_009G135900 [Gossypium raimondii]
Length=324

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 11/80 (14%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LNLK TELRLGLPGS+SP+R L L G      D+   F        + S +K   +G KR
Sbjct  47   LNLKETELRLGLPGSESPERKLSLFGKDLETNDKSNGF--------VGSPLKNLVSGAKR  98

Query  616  GFLDTMEGSVTTEANWMFTI  675
            GF D ++GS      W+F I
Sbjct  99   GFSDAIDGS---NGKWVFAI  115



>ref|XP_007152862.1| hypothetical protein PHAVU_004G166400g [Phaseolus vulgaris]
 gb|ESW24856.1| hypothetical protein PHAVU_004G166400g [Phaseolus vulgaris]
Length=307

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 44/79 (56%), Gaps = 19/79 (24%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LNLKATELRLGLPGS+SP+RD        G  +E+ + PL          VK   +G KR
Sbjct  32   LNLKATELRLGLPGSESPERD--------GGVEERNVHPL--------GMVKNLVSGAKR  75

Query  616  GFLDTMEGSVTTEANWMFT  672
            GF DT++G       W+ +
Sbjct  76   GFSDTIDGG---SGKWLLS  91



>gb|KJB56783.1| hypothetical protein B456_009G135900 [Gossypium raimondii]
Length=388

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 44/80 (55%), Gaps = 11/80 (14%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LNLK TELRLGLPGS+SP+R L L G      D+   F        + S +K   +G KR
Sbjct  47   LNLKETELRLGLPGSESPERKLSLFGKDLETNDKSNGF--------VGSPLKNLVSGAKR  98

Query  616  GFLDTMEGSVTTEANWMFTI  675
            GF D ++GS      W+F I
Sbjct  99   GFSDAIDGS---NGKWVFAI  115



>gb|ACU24212.1| unknown [Glycine max]
Length=152

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 19/79 (24%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LNLKATELRLGLPGS+SP+R+  +        ++K + PL          VK   +G KR
Sbjct  30   LNLKATELRLGLPGSESPEREEGV--------EDKNVHPL--------GMVKCLVSGAKR  73

Query  616  GFLDTMEGSVTTEANWMFT  672
            GF DT++G       W+ +
Sbjct  74   GFSDTIDGG---SGKWLLS  89



>ref|XP_008242568.1| PREDICTED: auxin-responsive protein IAA27 [Prunus mume]
Length=319

 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 48/86 (56%), Gaps = 19/86 (22%)
 Frame = +1

Query  424  EKDR---LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKA  594
            E+DR   LNLKATELRLGLPGS+SP+RD        G  ++K  + +          VK 
Sbjct  27   ERDRGTALNLKATELRLGLPGSESPERD-----GGGGLVEDKTGYSVC--------VVKG  73

Query  595  SFTGNKRGFLDTMEGSVTTEANWMFT  672
              +G KRGF D ++G+      W+F+
Sbjct  74   LVSGAKRGFSDAIDGA---SGKWIFS  96



>ref|NP_001280937.1| auxin-responsive protein IAA27 [Malus domestica]
 gb|ADL36581.1| ARF domain class transcription factor [Malus domestica]
Length=319

 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 45/82 (55%), Gaps = 14/82 (17%)
 Frame = +1

Query  430  DRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPL-FPLLPSKDGIFSSVKASFTG  606
            D LNLKATELRLGLPGSQSP+RD        G  +EK   F +          VK   +G
Sbjct  23   DALNLKATELRLGLPGSQSPERDGGGG--GGGGVEEKATGFSVC--------GVKGLVSG  72

Query  607  NKRGFLDTMEGSVTTEANWMFT  672
             KRGF D ++G+      W+F+
Sbjct  73   AKRGFSDAIDGA---SGKWVFS  91



>gb|AAM76221.1| putative IAA-responsive protein 9 [Gossypium raimondii]
Length=122

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +1

Query  493  RDLELNGPSTGKFDEKPLFPLLPSKDG-IFSSVKASFTGNKRGFLDTMEG  639
            R+ EL   S+ + DEKP FPL PS DG  F+S K   +GNKRGF D M+G
Sbjct  1    RNPELCLLSSSQLDEKPFFPLHPSSDGHCFASQKNVVSGNKRGFSDAMDG  50



>ref|XP_006833393.1| PREDICTED: auxin-responsive protein IAA27 [Amborella trichopoda]
 ref|XP_011620573.1| PREDICTED: auxin-responsive protein IAA27 [Amborella trichopoda]
 ref|XP_011620574.1| PREDICTED: auxin-responsive protein IAA27 [Amborella trichopoda]
 ref|XP_011620575.1| PREDICTED: auxin-responsive protein IAA27 [Amborella trichopoda]
 gb|ERM98671.1| hypothetical protein AMTR_s00109p00120700 [Amborella trichopoda]
Length=347

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 47/84 (56%), Gaps = 16/84 (19%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKR---DLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTG  606
            LNLK TELRLGLPGS SP R   +L L GP   + +EK +FPL+        S K   +G
Sbjct  45   LNLKETELRLGLPGSGSPDRKKPELCLLGPL--RPEEKGIFPLV--------SPKNVVSG  94

Query  607  NKRGFLDTMEG---SVTTEANWMF  669
             KRG  D ++G    V ++  W F
Sbjct  95   AKRGISDVIDGVKKGVASDGKWAF  118



>gb|AAM76224.1| putative IAA-responsive protein 9 [Gossypioides kirkii]
Length=122

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 1/50 (2%)
 Frame = +1

Query  493  RDLELNGPSTGKFDEKPLFPLLPSKD-GIFSSVKASFTGNKRGFLDTMEG  639
            R+ EL   S+ + DEKPLFPL PS D   F+S K   +GNKRGF D M+G
Sbjct  1    RNPELCLLSSSQLDEKPLFPLHPSSDVHCFASQKNVVSGNKRGFSDAMDG  50



>ref|XP_010062501.1| PREDICTED: auxin-responsive protein IAA27 [Eucalyptus grandis]
 gb|KCW69642.1| hypothetical protein EUGRSUZ_F03050 [Eucalyptus grandis]
Length=342

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 62/127 (49%), Gaps = 27/127 (21%)
 Frame = +1

Query  424  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI----FSSVK  591
            +K  LNL+ TELRLGLPGS SP+R   L  P  GK         L SK G+     S  K
Sbjct  36   KKSALNLRETELRLGLPGSLSPERKQALGVPLFGKD--------LESKSGVLGFALSPSK  87

Query  592  ASFTGNKRGFLDTMEGSVTTEANWMFTIPKSDSH-----------TPQSAGQGNFGSSAG  738
             S +G KR F D ++G     + W+F+     S            +P+S  + + G +A 
Sbjct  88   NSVSGAKRVFCDAIDG---CPSKWVFSASNGKSEVDLAKGGPVLSSPRSGKESDNGVNA-  143

Query  739  IKSNVPQ  759
            ++S VP+
Sbjct  144  LQSCVPK  150



>gb|KCW69643.1| hypothetical protein EUGRSUZ_F03050 [Eucalyptus grandis]
Length=340

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 62/127 (49%), Gaps = 27/127 (21%)
 Frame = +1

Query  424  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI----FSSVK  591
            +K  LNL+ TELRLGLPGS SP+R   L  P  GK         L SK G+     S  K
Sbjct  36   KKSALNLRETELRLGLPGSLSPERKQALGVPLFGKD--------LESKSGVLGFALSPSK  87

Query  592  ASFTGNKRGFLDTMEGSVTTEANWMFTIPKSDSH-----------TPQSAGQGNFGSSAG  738
             S +G KR F D ++G     + W+F+     S            +P+S  + + G +A 
Sbjct  88   NSVSGAKRVFCDAIDG---CPSKWVFSASNGKSEVDLAKGGPVLSSPRSGKESDNGVNA-  143

Query  739  IKSNVPQ  759
            ++S VP+
Sbjct  144  LQSCVPK  150



>gb|KCW69644.1| hypothetical protein EUGRSUZ_F03050 [Eucalyptus grandis]
Length=349

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 62/127 (49%), Gaps = 27/127 (21%)
 Frame = +1

Query  424  EKDRLNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGI----FSSVK  591
            +K  LNL+ TELRLGLPGS SP+R   L  P  GK         L SK G+     S  K
Sbjct  36   KKSALNLRETELRLGLPGSLSPERKQALGVPLFGKD--------LESKSGVLGFALSPSK  87

Query  592  ASFTGNKRGFLDTMEGSVTTEANWMFTIPKSDSH-----------TPQSAGQGNFGSSAG  738
             S +G KR F D ++G     + W+F+     S            +P+S  + + G +A 
Sbjct  88   NSVSGAKRVFCDAIDG---CPSKWVFSASNGKSEVDLAKGGPVLSSPRSGKESDNGVNA-  143

Query  739  IKSNVPQ  759
            ++S VP+
Sbjct  144  LQSCVPK  150



>ref|XP_009352507.1| PREDICTED: auxin-responsive protein IAA27-like [Pyrus x bretschneideri]
Length=318

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 43/81 (53%), Gaps = 17/81 (21%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSS--VKASFTGN  609
            LNLKATELRLGLPGSQSP+R            D       +  K   FS+  VK   +G 
Sbjct  25   LNLKATELRLGLPGSQSPER------------DSGGGGGGVEEKVAGFSACGVKGLVSGA  72

Query  610  KRGFLDTMEGSVTTEANWMFT  672
            KRGF D ++G+      W+F+
Sbjct  73   KRGFSDAIDGA---SGKWVFS  90



>ref|XP_003637871.1| Auxin-responsive aux/iaa gene family member [Medicago truncatula]
Length=222

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 15/67 (22%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LNLKATELRLGLPGS+SP+RD +L        +EK  + L          + + F+G KR
Sbjct  15   LNLKATELRLGLPGSESPERDNDL-------LEEKNAYSL--------CMLNSLFSGAKR  59

Query  616  GFLDTME  636
            GF D ++
Sbjct  60   GFSDAID  66



>ref|XP_003637872.1| Auxin-responsive aux/iaa gene family member [Medicago truncatula]
 gb|KEH27148.1| auxin response factor [Medicago truncatula]
Length=193

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 15/67 (22%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LNLKATELRLGLPGS+SP+RD +L        +EK  + L          + + F+G KR
Sbjct  15   LNLKATELRLGLPGSESPERDNDL-------LEEKNAYSLCM--------LNSLFSGAKR  59

Query  616  GFLDTME  636
            GF D ++
Sbjct  60   GFSDAID  66



>ref|XP_009624916.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana tomentosiformis]
Length=292

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 38/78 (49%), Gaps = 25/78 (32%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LN KATELRLGLPGS+SPKRD   N       D    FP                +G KR
Sbjct  21   LNFKATELRLGLPGSESPKRD---NSNGVKDLD---FFP----------------SGAKR  58

Query  616  GFLDTMEGSVTTEANWMF  669
            GF DTM G+  T   W F
Sbjct  59   GFCDTMNGNSET---WSF  73



>ref|XP_003534212.1| PREDICTED: auxin-responsive protein IAA27 [Glycine max]
 gb|KHN45622.1| Auxin-responsive protein IAA27 [Glycine soja]
Length=307

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 44/79 (56%), Gaps = 19/79 (24%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LNLKATELRLGLPGS+SP+R+  +        ++K + PL          VK   +G KR
Sbjct  30   LNLKATELRLGLPGSESPEREEGV--------EDKNVHPL--------GMVKCLVSGAKR  73

Query  616  GFLDTMEGSVTTEANWMFT  672
            GF DT++G       W+ +
Sbjct  74   GFSDTIDGG---SGKWLLS  89



>gb|KEH27147.1| auxin response factor [Medicago truncatula]
Length=254

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 15/67 (22%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LNLKATELRLGLPGS+SP+RD +L        +EK  + L          + + F+G KR
Sbjct  15   LNLKATELRLGLPGSESPERDNDL-------LEEKNAYSL--------CMLNSLFSGAKR  59

Query  616  GFLDTME  636
            GF D ++
Sbjct  60   GFSDAID  66



>gb|AFK45766.1| unknown [Medicago truncatula]
Length=254

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 15/67 (22%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            LNLKATELRLGLPGS+SP+RD +L        +EK  + L          + + F+G KR
Sbjct  15   LNLKATELRLGLPGSESPERDNDL-------LEEKNAYSL--------CMLNSLFSGAKR  59

Query  616  GFLDTME  636
            GF D ++
Sbjct  60   GFSDAID  66



>ref|XP_009793769.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana sylvestris]
Length=298

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 42/74 (57%), Gaps = 8/74 (11%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            L LK TELRLGLPGS SP+R  E NG S       P    L  K+ I + +K   +G KR
Sbjct  49   LKLKETELRLGLPGSWSPERKAE-NGVS-------PFGKDLEDKNIIVTPLKVFVSGAKR  100

Query  616  GFLDTMEGSVTTEA  657
            GF DT++ S   +A
Sbjct  101  GFSDTIDSSRKDKA  114



>ref|XP_009617338.1| PREDICTED: auxin-responsive protein IAA27-like [Nicotiana tomentosiformis]
Length=285

 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 42/74 (57%), Gaps = 8/74 (11%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFSSVKASFTGNKR  615
            L LK TELRLGLPGS SP R    NG S    D       L  K+GI + +K   +G KR
Sbjct  36   LKLKETELRLGLPGSWSPARK-AANGVSLFGKD-------LEDKNGIVTPLKIFVSGAKR  87

Query  616  GFLDTMEGSVTTEA  657
            GF DT++ S+  +A
Sbjct  88   GFSDTIDSSMKDKA  101



>ref|XP_002284282.1| PREDICTED: auxin-responsive protein IAA27-like [Vitis vinifera]
Length=343

 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/82 (41%), Positives = 46/82 (56%), Gaps = 14/82 (17%)
 Frame = +1

Query  436  LNLKATELRLGLPGSQSPKRDLELNGPSTGKFDEKPLFPLLPSKDGIFS--SVKASFTGN  609
            LNL+ TELRLGLPGS+SP+R  +L     GK         L  K   +S  S+K   +G 
Sbjct  43   LNLRETELRLGLPGSESPERKPQLGVSLFGKD--------LEDKTNGYSLGSLKGFVSGA  94

Query  610  KRGFLDTMEGSVTTEANWMFTI  675
            KRGF D ++GS      W+F++
Sbjct  95   KRGFSDAIDGS----GKWVFSV  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1483248998725