BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9152

Length=1236
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   508   6e-177   Nicotiana tomentosiformis
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  501   4e-174   Nicotiana tabacum [American tobacco]
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   498   2e-173   Nicotiana tomentosiformis
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  498   2e-173   Nicotiana tabacum [American tobacco]
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   498   4e-173   Nicotiana sylvestris
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               497   8e-173   Eucalyptus grandis [rose gum]
ref|NP_001289823.1|  aquaporin PIP2-1-like                              494   7e-172   Solanum lycopersicum
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   491   2e-170   Nicotiana tomentosiformis
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   489   1e-169   Nicotiana sylvestris
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        488   3e-169   Solanum tuberosum [potatoes]
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        487   6e-169   Solanum tuberosum [potatoes]
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   486   2e-168   Sesamum indicum [beniseed]
ref|XP_012082352.1|  PREDICTED: aquaporin PIP2-4-like                   484   7e-168   Jatropha curcas
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             481   8e-167   Populus trichocarpa [western balsam poplar]
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   480   3e-166   
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               479   5e-166   Populus euphratica
ref|XP_012064821.1|  PREDICTED: aquaporin PIP2-4                        479   6e-166   Jatropha curcas
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         479   9e-166   Ricinus communis
gb|AAO39007.1|  plasma intrinsic protein 2,1                            479   1e-165   Juglans regia
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   478   2e-165   Solanum tuberosum [potatoes]
gb|AAO39008.1|  plasma intrinsic protein 2,2                            478   2e-165   Juglans regia
gb|AEQ20672.1|  PIP2;1                                                  478   3e-165   Karelinia caspia
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               478   3e-165   Eucalyptus grandis [rose gum]
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                478   3e-165   Theobroma cacao [chocolate]
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             478   4e-165   Citrus clementina [clementine]
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         477   7e-165   Ricinus communis
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             476   1e-164   Populus trichocarpa [western balsam poplar]
ref|NP_001274308.1|  aquaporin PIP2-1-like                              476   1e-164   Solanum lycopersicum
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   475   2e-164   
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          475   3e-164   Gossypium arboreum [tree cotton]
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                475   4e-164   Populus trichocarpa x Populus deltoides
gb|AAB18227.1|  MipC                                                    475   4e-164   Mesembryanthemum crystallinum
gb|AFH36337.1|  aquaporin PIP2;2                                        474   5e-164   Quercus petraea [durmast oak]
gb|ACU87558.1|  PIP protein                                             474   5e-164   Gossypium hirsutum [American cotton]
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             474   1e-163   Populus trichocarpa [western balsam poplar]
gb|AEQ29857.1|  aquaporin PIP2                                          473   1e-163   Malus prunifolia
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   474   1e-163   Phoenix dactylifera
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   473   2e-163   Tarenaya hassleriana [spider flower]
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        473   2e-163   Malus domestica [apple tree]
emb|CDP06739.1|  unnamed protein product                                473   2e-163   Coffea canephora [robusta coffee]
gb|KHG08488.1|  putative aquaporin PIP2-2                               473   2e-163   Gossypium arboreum [tree cotton]
gb|ACX37450.1|  plasma membrane intrinsic protein                       473   3e-163   Hevea brasiliensis [jebe]
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   473   3e-163   Populus euphratica
gb|KJB21561.1|  hypothetical protein B456_004G001400                    472   4e-163   Gossypium raimondii
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   472   5e-163   Populus euphratica
gb|ABB88840.1|  aquaporin                                               472   5e-163   Stevia rebaudiana
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   471   8e-163   Eucalyptus grandis [rose gum]
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   471   8e-163   Populus euphratica
gb|AIA83104.1|  putative aquaporin PIP2                                 471   9e-163   Citrus sinensis x Citrus trifoliata [Carrizo citrange]
gb|AAV80229.1|  aquaporin 2                                             471   1e-162   Aegiceras corniculatum
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          471   1e-162   Gossypium arboreum [tree cotton]
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  471   1e-162   Mimosa pudica [sensitive-plant]
emb|CAH60724.1|  putative plasma membrane intrinsic protein             471   1e-162   Populus tremula x Populus tremuloides
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   471   2e-162   Eucalyptus grandis [rose gum]
gb|KJB26182.1|  hypothetical protein B456_004G229000                    470   2e-162   Gossypium raimondii
gb|ABK60195.2|  PIP2 protein                                            470   3e-162   Gossypium hirsutum [American cotton]
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     472   6e-162   Eucalyptus grandis [rose gum]
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   469   7e-162   Phoenix dactylifera
gb|KJB56128.1|  hypothetical protein B456_009G107200                    469   1e-161   Gossypium raimondii
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               469   1e-161   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC17529.1|  aquaporin 2                                             468   2e-161   Samanea saman [cow-tamarind]
gb|KJB11821.1|  hypothetical protein B456_002G2484001                   468   2e-161   Gossypium raimondii
gb|AIA83106.1|  putative aquaporin PIP2                                 468   2e-161   Citrus trifoliata [hardy orange]
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             468   2e-161   Elaeis guineensis
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        468   2e-161   Cucumis melo [Oriental melon]
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               468   2e-161   Pyrus x bretschneideri [bai li]
ref|XP_012093253.1|  PREDICTED: probable aquaporin PIP2-5               468   2e-161   Jatropha curcas
gb|KHG00060.1|  putative aquaporin PIP2-2                               468   3e-161   Gossypium arboreum [tree cotton]
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                467   5e-161   Erythranthe guttata [common monkey flower]
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             467   5e-161   Phaseolus vulgaris [French bean]
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        467   7e-161   Phoenix dactylifera
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              466   8e-161   
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   466   9e-161   Nelumbo nucifera [Indian lotus]
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   466   1e-160   Setaria italica
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               465   2e-160   
gb|AAW80918.1|  putative plasma membrane intrinsic protein              465   2e-160   Astragalus membranaceus
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             465   3e-160   Phaseolus vulgaris [French bean]
ref|XP_010098191.1|  Aquaporin PIP2-7                                   465   3e-160   Morus notabilis
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  464   4e-160   Pyrus communis
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   464   5e-160   Glycine max [soybeans]
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               464   5e-160   Prunus mume [ume]
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               464   6e-160   Malus domestica [apple tree]
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               464   7e-160   Pyrus x bretschneideri [bai li]
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         464   7e-160   Helianthemum almeriense
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             464   8e-160   Prunus persica
gb|ACZ06859.1|  plasma membrane intrinsic protein                       464   9e-160   Glycine soja [wild soybean]
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             464   1e-159   Phaseolus vulgaris [French bean]
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        464   1e-159   Eucalyptus grandis [rose gum]
gb|AEY75244.1|  plasma membrane intrinsic protein                       463   1e-159   Malus hupehensis
gb|EAY86778.1|  hypothetical protein OsI_08158                          464   1e-159   Oryza sativa Indica Group [Indian rice]
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   463   1e-159   Fragaria vesca subsp. vesca
gb|KJB20285.1|  hypothetical protein B456_003G141600                    464   1e-159   Gossypium raimondii
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               463   2e-159   Populus euphratica
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             463   2e-159   Phaseolus vulgaris [French bean]
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   463   2e-159   Fragaria vesca subsp. vesca
gb|AIG92831.1|  aquaporin PIP2                                          463   2e-159   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   463   2e-159   Fragaria vesca subsp. vesca
gb|ACU24483.1|  unknown                                                 463   2e-159   Glycine max [soybeans]
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               462   2e-159   Camelina sativa [gold-of-pleasure]
ref|NP_001268056.1|  aquaporin PIP2                                     462   3e-159   Vitis vinifera
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        462   3e-159   Pyrus x bretschneideri [bai li]
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    462   3e-159   Pyrus x bretschneideri [bai li]
gb|KJB62459.1|  hypothetical protein B456_009G418100                    462   3e-159   Gossypium raimondii
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    462   4e-159   
ref|XP_003625627.1|  Aquaporin PIP2-1                                   462   4e-159   Medicago truncatula
ref|NP_001047491.1|  Os02g0629200                                       462   5e-159   
gb|AHA84284.1|  prolactin-inducible protein                             462   5e-159   Phaseolus vulgaris [French bean]
ref|NP_001240039.1|  uncharacterized protein LOC100782155               462   6e-159   Glycine max [soybeans]
gb|AEY75242.1|  plasma membrane intrinsic protein                       462   6e-159   Malus hupehensis
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               462   7e-159   Pyrus x bretschneideri [bai li]
gb|KHG29841.1|  putative aquaporin PIP2-2                               462   7e-159   Gossypium arboreum [tree cotton]
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             461   9e-159   Citrus clementina [clementine]
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   461   9e-159   Glycine max [soybeans]
gb|KHN00691.1|  Aquaporin PIP2-2                                        461   9e-159   Glycine soja [wild soybean]
gb|AFK33316.1|  unknown                                                 461   1e-158   Medicago truncatula
gb|ABB13430.2|  plasma membrane intrinsic protein                       461   1e-158   Olea europaea
ref|NP_001105026.1|  aquaporin PIP2-4                                   461   1e-158   Zea mays [maize]
gb|ACG33001.1|  aquaporin PIP2.2                                        461   2e-158   Zea mays [maize]
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   461   2e-158   Glycine max [soybeans]
gb|ABU94631.1|  putative aquaporin PIP2;3                               461   2e-158   Phaseolus vulgaris [French bean]
gb|AGD98708.1|  aquaporin protein 5                                     460   2e-158   Camellia sinensis [black tea]
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         460   2e-158   
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     464   2e-158   Eucalyptus grandis [rose gum]
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        460   2e-158   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001274381.1|  aquaporin PIP2-7-like                              460   2e-158   Cucumis sativus [cucumbers]
gb|AHK05706.1|  plasma membrane intrinsic protein PIP2;3                460   3e-158   Hevea brasiliensis [jebe]
emb|CDX10333.1|  aquaporin                                              460   3e-158   Coffea arabica [arabica coffee]
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  460   3e-158   Pyrus communis
gb|AGD98714.1|  aquaporin protein 11                                    460   3e-158   Camellia sinensis [black tea]
gb|ACU20229.1|  unknown                                                 459   4e-158   Glycine max [soybeans]
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        459   6e-158   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               459   7e-158   Camelina sativa [gold-of-pleasure]
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        459   8e-158   Cucumis melo [Oriental melon]
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               459   8e-158   Elaeis guineensis
ref|NP_001240223.1|  prolactin-inducible protein                        459   9e-158   Glycine max [soybeans]
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               459   9e-158   Camelina sativa [gold-of-pleasure]
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        459   9e-158   Petunia x hybrida [garden petunia]
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               459   9e-158   Populus euphratica
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        459   1e-157   Brassica rapa
gb|KHN38765.1|  Aquaporin PIP2-7                                        459   1e-157   Glycine soja [wild soybean]
gb|KHN05685.1|  Aquaporin PIP2-7                                        458   1e-157   Glycine soja [wild soybean]
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              458   1e-157   Populus trichocarpa [western balsam poplar]
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        458   1e-157   Glycine max [soybeans]
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   458   2e-157   Citrus sinensis [apfelsine]
gb|ABO69705.2|  aquaporin PIP2                                          457   2e-157   Prunus humilis
gb|ADK25057.1|  plasma membrane intrinsic protein                       457   3e-157   Glycine max [soybeans]
gb|AAD31846.1|AF133530_1  water channel protein MipH                    457   3e-157   Mesembryanthemum crystallinum
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               457   3e-157   
emb|CDY56697.1|  BnaCnng31040D                                          457   3e-157   Brassica napus [oilseed rape]
ref|NP_001280185.1|  aquaporin PIP2-2                                   457   3e-157   Prunus mume [ume]
gb|ABK60196.1|  PIP2 protein                                            457   3e-157   Gossypium hirsutum [American cotton]
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             457   4e-157   Eutrema salsugineum [saltwater cress]
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               457   4e-157   Brassica rapa
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          457   4e-157   Sorghum bicolor [broomcorn]
ref|XP_002322877.1|  major intrinsic protein 1                          457   5e-157   Populus trichocarpa [western balsam poplar]
ref|NP_001105639.1|  aquaporin PIP2-7                                   457   5e-157   
gb|AEO13898.1|  aquaporin 7                                             457   5e-157   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             457   5e-157   Eutrema salsugineum [saltwater cress]
gb|AFH36338.1|  aquaporin PIP2;3                                        457   5e-157   Quercus petraea [durmast oak]
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           457   5e-157   Raphanus sativus
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   457   5e-157   Camelina sativa [gold-of-pleasure]
gb|AGG39693.1|  aquaporin protein AQU15                                 457   5e-157   Camellia sinensis [black tea]
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             457   7e-157   
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                456   7e-157   Erythranthe guttata [common monkey flower]
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               456   7e-157   Eucalyptus grandis [rose gum]
gb|AFK47400.1|  unknown                                                 456   7e-157   Lotus japonicus
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   456   8e-157   Citrus sinensis [apfelsine]
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   456   8e-157   Nelumbo nucifera [Indian lotus]
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          456   8e-157   Gossypium arboreum [tree cotton]
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             456   9e-157   Citrus clementina [clementine]
ref|NP_001292671.1|  aquaporin PIP2-2                                   456   9e-157   Cucumis sativus [cucumbers]
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  458   9e-157   Citrus sinensis [apfelsine]
emb|CDX91340.1|  BnaC04g08100D                                          456   1e-156   
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       456   1e-156   Raphanus sativus
gb|ABH09326.1|  putative aquaporin                                      456   1e-156   Vitis vinifera
dbj|BAG06231.1|  plasma membrane intrinsic protein                      456   1e-156   Hordeum vulgare [barley]
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   456   1e-156   Brassica rapa
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2               456   1e-156   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2                        455   2e-156   Fragaria vesca subsp. vesca
gb|AFQ23186.1|  aquaporin PIP2;1                                        456   2e-156   Eustoma exaltatum subsp. russellianum [bluebells]
gb|ACR56613.1|  plasma intrinsic protein 2;3                            455   2e-156   Juglans regia
ref|NP_001237286.1|  PIP2,2                                             456   2e-156   
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     456   2e-156   Lilium hybrid cultivar
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        455   2e-156   
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2                455   2e-156   Populus trichocarpa x Populus deltoides
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          455   2e-156   Sorghum bicolor [broomcorn]
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               455   2e-156   Brassica rapa
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                455   2e-156   Erythranthe guttata [common monkey flower]
gb|ADJ67992.1|  aquaporin                                               455   2e-156   Fragaria x ananassa
dbj|BAE02729.1|  PIP aquaporin                                          455   3e-156   Hordeum vulgare [barley]
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           455   3e-156   Raphanus sativus
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               455   3e-156   Tarenaya hassleriana [spider flower]
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         455   3e-156   Ricinus communis
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        455   3e-156   Brassica rapa
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               454   4e-156   Nicotiana tomentosiformis
emb|CDX91341.1|  BnaC04g08090D                                          454   4e-156   
ref|NP_001105025.1|  aquaporin PIP2-3                                   455   4e-156   Zea mays [maize]
ref|NP_001267922.1|  aquaporin-like                                     454   4e-156   Vitis vinifera
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    454   4e-156   Brassica rapa
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   454   4e-156   Brassica rapa
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             454   4e-156   Phaseolus vulgaris [French bean]
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                   454   5e-156   Cucumis melo [Oriental melon]
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             454   5e-156   Eutrema salsugineum [saltwater cress]
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             454   5e-156   Prunus persica
emb|CAN75442.1|  hypothetical protein VITISV_019657                     454   6e-156   Vitis vinifera
ref|NP_001268058.1|  aquaporin-like                                     454   6e-156   Vitis vinifera
gb|AHG32324.1|  PIP2-3                                                  454   6e-156   Pisum sativum [garden pea]
gb|AAV69744.1|  aquaporin                                               454   6e-156   Vitis vinifera
gb|AAY22203.1|  putative aquaporin                                      454   7e-156   Phaseolus vulgaris [French bean]
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   454   7e-156   Tarenaya hassleriana [spider flower]
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   454   7e-156   Setaria italica
gb|ACU19125.1|  unknown                                                 454   7e-156   Glycine max [soybeans]
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               454   8e-156   Brachypodium distachyon [annual false brome]
dbj|BAA23744.1|  HvPIP2;1                                               454   9e-156   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             454   1e-155   Capsella rubella
gb|AGD98707.1|  aquaporin protein 4                                     454   1e-155   Camellia sinensis [black tea]
gb|AFK47442.1|  unknown                                                 453   1e-155   Medicago truncatula
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   453   1e-155   Nicotiana tomentosiformis
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     453   1e-155   Vitis cinerea var. helleri x Vitis rupestris
emb|CDX67611.1|  BnaA07g16510D                                          453   1e-155   
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             453   1e-155   Eutrema salsugineum [saltwater cress]
gb|AIK66515.1|  putative aquaporin                                      453   1e-155   Vitis vinifera
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5               453   2e-155   
gb|ACU21481.1|  unknown                                                 453   2e-155   Glycine max [soybeans]
dbj|BAG68661.1|  plasma membrane intrinsic protein                      453   2e-155   Tulipa gesneriana
ref|NP_191042.1|  putative aquaporin PIP2-5                             453   2e-155   Arabidopsis thaliana [mouse-ear cress]
gb|ABC69040.1|  aquaporin PIP2-1                                        452   3e-155   Rhododendron catawbiense [Catawba rosebay]
emb|CDY07519.1|  BnaC06g15450D                                          452   3e-155   Brassica napus [oilseed rape]
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               452   3e-155   Prunus mume [ume]
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   452   4e-155   Nicotiana tomentosiformis
emb|CDY46759.1|  BnaA03g17030D                                          452   4e-155   Brassica napus [oilseed rape]
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5               452   4e-155   Tarenaya hassleriana [spider flower]
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   452   4e-155   Camelina sativa [gold-of-pleasure]
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                        452   4e-155   Brachypodium distachyon [annual false brome]
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   452   4e-155   Nicotiana sylvestris
ref|XP_002316367.1|  putative aquaporin family protein                  452   5e-155   Populus trichocarpa [western balsam poplar]
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               452   5e-155   Sesamum indicum [beniseed]
ref|XP_004307390.1|  PREDICTED: aquaporin PIP2-1                        451   6e-155   Fragaria vesca subsp. vesca
emb|CDY13298.1|  BnaC06g14590D                                          451   6e-155   Brassica napus [oilseed rape]
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   451   7e-155   Nicotiana sylvestris
gb|AJT55764.1|  aquaporin plasma intrinsic protein 3                    451   8e-155   Allium sativum
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               451   9e-155   Camelina sativa [gold-of-pleasure]
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   451   9e-155   Camelina sativa [gold-of-pleasure]
gb|ABX83874.1|  plasma membrane intrinsic protein                       451   1e-154   Rhododendron catawbiense [Catawba rosebay]
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          451   1e-154   Cicer arietinum [garbanzo]
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   451   1e-154   Nicotiana tomentosiformis
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          451   1e-154   Solanum tuberosum [potatoes]
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 451   1e-154   Nicotiana tabacum [American tobacco]
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840          451   1e-154   Sorghum bicolor [broomcorn]
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                   451   1e-154   Setaria italica
gb|ABU94630.1|  putative aquaporin PIP2;2                               451   2e-154   Phaseolus vulgaris [French bean]
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        450   2e-154   Camelina sativa [gold-of-pleasure]
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  450   2e-154   Mimosa pudica [sensitive-plant]
ref|NP_001274386.1|  aquaporin PIP2-1-like                              450   2e-154   Cucumis sativus [cucumbers]
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             450   3e-154   Capsella rubella
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               450   3e-154   Camelina sativa [gold-of-pleasure]
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             449   3e-154   Eutrema salsugineum [saltwater cress]
ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   450   3e-154   Nicotiana sylvestris
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             449   3e-154   Arabidopsis lyrata subsp. lyrata
ref|XP_010325989.1|  PREDICTED: aquaporin PIP2-1-like                   449   4e-154   
emb|CAC82712.1|  major intrinsic protein 1                              449   4e-154   Populus tremula x Populus tremuloides
ref|NP_001235204.1|  Pip1 protein                                       449   4e-154   
ref|XP_010107541.1|  Aquaporin PIP2-2                                   449   4e-154   Morus notabilis
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 449   4e-154   Nicotiana tabacum [American tobacco]
gb|ABK93567.1|  unknown                                                 449   5e-154   Populus trichocarpa [western balsam poplar]
ref|NP_001105616.1|  aquaporin PIP2-5                                   449   6e-154   Zea mays [maize]
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   449   6e-154   Cicer arietinum [garbanzo]
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   449   6e-154   Camelina sativa [gold-of-pleasure]
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                    449   6e-154   Arabis alpina [alpine rockcress]
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             449   7e-154   Arabidopsis lyrata subsp. lyrata
ref|XP_009116159.1|  PREDICTED: probable aquaporin PIP2-5               449   7e-154   Brassica rapa
gb|AHG32323.1|  PIP2-2                                                  449   7e-154   Pisum sativum [garden pea]
emb|CAH60723.1|  putative plasma membrane intrinsic protein             448   1e-153   Populus tremula x Populus tremuloides
gb|EPS68613.1|  hypothetical protein M569_06155                         448   1e-153   Genlisea aurea
ref|NP_001292708.1|  aquaporin PIP2-1-like                              448   1e-153   Cucumis sativus [cucumbers]
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        448   1e-153   Citrus sinensis [apfelsine]
ref|XP_003606383.1|  Aquaporin PIP2-7                                   448   2e-153   Medicago truncatula
ref|NP_181254.1|  aquaporin PIP2-2                                      448   2e-153   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85173.1|  unknown                                                 448   2e-153   Medicago truncatula
gb|AJZ72652.1|  aquaporin PIP2;1                                        447   3e-153   
emb|CDX73446.1|  BnaC08g25570D                                          447   3e-153   
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               447   3e-153   
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             447   4e-153   
gb|AAG44947.1|AF290620_1  putative PIP2                                 447   4e-153   
gb|AAF65845.1|AF255795_1  aquaporin 1                                   447   6e-153   
ref|XP_009103935.1|  PREDICTED: probable aquaporin PIP2-5               446   1e-152   
gb|AEC45513.1|  plasma membrane intrinsic protein                       445   1e-152   
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        446   1e-152   
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               446   1e-152   
ref|NP_001275065.1|  major intrinsic protein 2                          445   2e-152   
ref|NP_001289999.1|  aquaporin PIP2-1                                   445   2e-152   
emb|CDP07111.1|  unnamed protein product                                445   2e-152   
ref|XP_006846771.1|  PREDICTED: probable aquaporin PIP2-2               445   2e-152   
ref|NP_190910.1|  aquaporin PIP2-1                                      445   3e-152   
gb|AAL32127.1|  aquaporin                                               445   3e-152   
ref|NP_181255.1|  aquaporin PIP2-3                                      444   4e-152   
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                   444   6e-152   
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                   443   8e-152   
ref|NP_001234625.1|  aquaporin                                          443   1e-151   
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   443   1e-151   
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg                443   1e-151   
ref|NP_001274397.1|  aquaporin PIP2-1-like                              443   1e-151   
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    443   1e-151   
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   443   2e-151   
ref|NP_001105024.1|  aquaporin PIP2-1                                   443   2e-151   
gb|ABH09328.1|  putative aquaporin                                      442   2e-151   
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        442   2e-151   
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5               442   2e-151   
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   442   2e-151   
ref|XP_003597235.1|  Aquaporin PIP2-7                                   442   3e-151   
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    442   3e-151   
emb|CAB45651.1|  putative plasma membrane intrinsic protein             442   3e-151   
ref|XP_010100853.1|  Aquaporin PIP2-1                                   442   3e-151   
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        442   4e-151   
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                   442   4e-151   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   442   5e-151   
ref|NP_200874.1|  putative aquaporin PIP2-4                             441   6e-151   
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   441   7e-151   
gb|AAO86707.1|  aquaporin                                               441   8e-151   
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        441   9e-151   
ref|XP_002876271.1|  PIP2_5/PIP2D                                       441   1e-150   
emb|CDX74984.1|  BnaA05g07300D                                          442   1e-150   
gb|EMT09900.1|  Putative aquaporin PIP2-2                               442   1e-150   
gb|KJB73580.1|  hypothetical protein B456_011G239500                    441   1e-150   
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 440   1e-150   
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             441   1e-150   
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  440   2e-150   
ref|XP_003580150.1|  PREDICTED: aquaporin PIP2-5                        440   2e-150   
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             440   2e-150   
ref|XP_007205689.1|  hypothetical protein PRUPE_ppa009689mg             438   7e-150   
ref|NP_001059545.1|  Os07g0448800                                       439   9e-150   
ref|NP_001105638.1|  aquaporin PIP2-2                                   439   9e-150   
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         438   1e-149   
gb|ACG39551.1|  aquaporin PIP2.1                                        438   1e-149   
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          438   1e-149   
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg             438   1e-149   
ref|XP_008367680.1|  PREDICTED: probable aquaporin PIP2-5               438   1e-149   
ref|XP_004956116.1|  PREDICTED: aquaporin PIP2-6-like                   438   2e-149   
ref|XP_010042277.1|  PREDICTED: aquaporin PIP2-1-like                   437   2e-149   
gb|ACF79873.1|  unknown                                                 438   2e-149   
emb|CAB46351.1|  major intrinsic protein 2                              437   2e-149   
gb|ACM50914.1|  aquaporin                                               437   2e-149   
ref|XP_012081802.1|  PREDICTED: probable aquaporin PIP2-8               437   2e-149   
gb|ACG32567.1|  aquaporin PIP2.1                                        437   3e-149   
gb|AHW81492.1|  ECFP-tagged plasma membrane intrinsic protein 2a        446   4e-149   
dbj|BAE06148.1|  PIP aquaporin isoform                                  437   4e-149   
dbj|BAF33069.1|  aquaporin                                              437   4e-149   
ref|XP_007009830.1|  Plasma membrane intrinsic protein 2A               436   4e-149   
ref|NP_001289846.1|  probable aquaporin PIP2-1                          437   4e-149   
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  436   7e-149   
gb|EMS51072.1|  Aquaporin PIP2-5                                        436   1e-148   
ref|NP_001053335.1|  Os04g0521100                                       436   1e-148   
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                   436   1e-148   
gb|ACB87734.1|  aquaporin                                               435   1e-148   
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...    434   3e-148   
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1                434   6e-148   
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790          434   6e-148   
gb|ABN11917.1|  aquaporin                                               433   8e-148   
gb|EAZ03711.1|  hypothetical protein OsI_25843                          433   8e-148   
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830          433   1e-147   
gb|AGD98705.1|  aquaporin                                               432   1e-147   
gb|AAC16545.1|  aquaporin                                               432   2e-147   
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like          432   3e-147   
gb|ABI96814.1|  plasma membrane intrinsic protein                       432   3e-147   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g             432   4e-147   
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780          432   4e-147   
ref|NP_001059542.1|  Os07g0448100                                       431   6e-147   
gb|ADG03686.1|  aquaporin                                               431   6e-147   
gb|ABI96813.1|  plasma membrane intrinsic protein                       431   8e-147   
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                  431   8e-147   
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800          431   1e-146   
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)        431   1e-146   
gb|AGD98712.1|  aquaporin protein 9                                     430   1e-146   
ref|XP_008456476.1|  PREDICTED: probable aquaporin PIP2-5               429   3e-146   
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2                430   4e-146   
ref|XP_002879778.1|  PIP2_6/PIP2E                                       429   5e-146   
ref|NP_001267957.1|  aquaporin PIP2;2                                   428   6e-146   
gb|AFQ23567.1|  aquaporin PIP2;2                                        429   6e-146   
ref|XP_003554376.1|  PREDICTED: aquaporin PIP2-1-like                   429   6e-146   
ref|XP_006411124.1|  hypothetical protein EUTSA_v10017026mg             429   6e-146   
ref|NP_001105027.1|  aquaporin PIP2-6                                   429   7e-146   
gb|ABH09327.1|  putative aquaporin                                      428   1e-145   
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6               428   1e-145   
gb|KFK36804.1|  hypothetical protein AALP_AA4G173500                    428   1e-145   
ref|NP_001288933.1|  probable aquaporin PIP2-6                          428   1e-145   
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     427   2e-145   
ref|XP_006846905.1|  PREDICTED: probable aquaporin PIP2-8               427   2e-145   
ref|XP_009803627.1|  PREDICTED: aquaporin PIP2-7-like                   427   3e-145   
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8               426   3e-145   
dbj|BAF32042.1|  putative aquaporin                                     426   3e-145   
emb|CDY14415.1|  BnaC03g21800D                                          427   4e-145   
ref|XP_010505564.1|  PREDICTED: probable aquaporin PIP2-6               427   4e-145   
gb|AJZ72653.1|  aquaporin PIP2;2                                        426   4e-145   
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg             426   5e-145   
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               426   6e-145   
ref|NP_195236.1|  plasma membrane intrinsic protein 3                   426   7e-145   
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               426   7e-145   
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                   426   7e-145   
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             426   8e-145   
emb|CDY31523.1|  BnaA10g13480D                                          425   9e-145   
gb|KFK36606.1|  hypothetical protein AALP_AA4G145300                    425   1e-144   
ref|XP_003521392.1|  PREDICTED: aquaporin PIP2-7-like                   425   1e-144   
emb|CDX71032.1|  BnaC03g11160D                                          424   2e-144   
gb|AAG02208.1|AF290201_1  plasma membrane intrinsic protein PIP2        425   2e-144   
ref|XP_008670063.1|  PREDICTED: aquaporin PIP2-6-like                   425   2e-144   
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg             424   2e-144   
gb|ACU87555.1|  PIP protein                                             424   3e-144   
gb|KFK34592.1|  hypothetical protein AALP_AA5G165800                    424   3e-144   
ref|XP_009600501.1|  PREDICTED: aquaporin PIP2-7-like                   424   3e-144   
ref|XP_008809438.1|  PREDICTED: probable aquaporin PIP2-6               424   4e-144   
emb|CDX88767.1|  BnaA03g08820D                                          423   5e-144   
dbj|BAF32141.1|  putative aquaporin                                     423   5e-144   
gb|KFK30134.1|  hypothetical protein AALP_AA7G221400                    423   6e-144   
gb|EAZ03714.1|  hypothetical protein OsI_25847                          423   7e-144   
dbj|BAO18631.1|  plasmamembrane intrinsic protein 2;9                   423   8e-144   
dbj|BAK20223.1|  plasma membrane intrinsic protein 2                    423   9e-144   
gb|AAC32107.1|  probable aquaporin                                      423   1e-143   
ref|NP_179277.1|  putative aquaporin PIP2-8                             422   1e-143   
gb|AAB36949.1|  plasma membrane intrinsic protein PIP3                  422   1e-143   
ref|XP_004149911.2|  PREDICTED: probable aquaporin PIP2-5               422   1e-143   
gb|ACB42441.1|  aquaporin PIP2;4                                        422   1e-143   
gb|KJB12139.1|  hypothetical protein B456_002G002500                    422   2e-143   
emb|CDX69112.1|  BnaC01g03410D                                          422   2e-143   
gb|KHF98939.1|  putative aquaporin PIP2-8 -like protein                 422   2e-143   
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    422   2e-143   
ref|XP_006360898.1|  PREDICTED: aquaporin PIP2-7-like                   422   2e-143   
ref|XP_009782764.1|  PREDICTED: aquaporin PIP2-7                        422   2e-143   
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     422   2e-143   
ref|XP_010266854.1|  PREDICTED: probable aquaporin PIP2-8               422   3e-143   
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7                        421   4e-143   
ref|XP_011089904.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    421   4e-143   
gb|AFH36336.1|  aquaporin PIP2;1                                        421   4e-143   
gb|AHZ08398.1|  phosphatidylinosital biphosphate protein                421   4e-143   
gb|ABK22173.1|  unknown                                                 421   5e-143   
gb|ABL76066.1|  aquaporin 2                                             421   5e-143   
gb|ACB42440.1|  aquaporin PIP2;3                                        421   5e-143   
emb|CDY09192.1|  BnaA02g06180D                                          420   6e-143   
gb|ABK24156.1|  unknown                                                 421   6e-143   
ref|XP_010467415.1|  PREDICTED: probable aquaporin PIP2-8               421   6e-143   
gb|ACU87556.1|  PIP protein                                             421   7e-143   
ref|XP_002869108.1|  hypothetical protein ARALYDRAFT_491143             421   7e-143   
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                        421   9e-143   
gb|ACJ85211.1|  unknown                                                 419   1e-142   
ref|NP_001233846.1|  putative PIP-type aquaporin                        420   1e-142   
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6               420   1e-142   
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8               420   1e-142   
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8               420   1e-142   
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg                420   1e-142   
emb|CCI55668.1|  EaPIP2,1                                               420   2e-142   
ref|XP_008807132.1|  PREDICTED: probable aquaporin PIP2-6               420   2e-142   
gb|KJB32662.1|  hypothetical protein B456_005G254400                    419   2e-142   
gb|AAB65787.1|  plasma membrane intrinsic protein                       419   2e-142   
ref|XP_009615212.1|  PREDICTED: aquaporin PIP2-7                        420   2e-142   
ref|XP_009345758.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        420   2e-142   
gb|ABC01884.1|  plasma membrane intrinsic protein PIP2-like protein     419   2e-142   
ref|XP_010107654.1|  Aquaporin PIP2-7                                   419   2e-142   
gb|ABK23750.1|  unknown                                                 419   2e-142   
gb|ACV66986.1|  plasma membrane aquaporin 2                             419   3e-142   
ref|XP_010432340.1|  PREDICTED: aquaporin PIP2-7                        419   3e-142   
gb|AAL49750.1|AF452012_1  aquaporin-like protein                        419   3e-142   
gb|ABK22146.1|  unknown                                                 419   3e-142   
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                        419   3e-142   
gb|AAL33586.1|AF440272_1  aquaporin                                     419   4e-142   
gb|AAG30607.1|AF314656_1  aquaporin                                     419   5e-142   
ref|XP_003563179.1|  PREDICTED: aquaporin PIP2-6                        419   5e-142   
ref|XP_010690355.1|  PREDICTED: aquaporin PIP-type                      418   6e-142   
ref|XP_006284279.1|  hypothetical protein CARUB_v10005443mg             418   8e-142   
dbj|BAD90701.1|  plasma membrane intrinsic protein 2;5                  418   9e-142   
ref|XP_006664814.1|  PREDICTED: probable aquaporin PIP2-6-like          418   1e-141   
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                   417   1e-141   
gb|AAB67869.1|  plasma membrane major intrinsic protein 2               417   1e-141   
ref|XP_010489282.1|  PREDICTED: probable aquaporin PIP2-8               417   1e-141   
ref|XP_011092966.1|  PREDICTED: aquaporin PIP2-7                        417   1e-141   
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6               417   2e-141   
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                     417   2e-141   
ref|XP_002306187.1|  membrane intrinsic family protein                  417   2e-141   
emb|CDX76314.1|  BnaA08g10860D                                          417   2e-141   
gb|ACB71281.1|  plasma membrane intrinsic protein                       417   2e-141   
gb|ACR56615.1|  plasma intrinsic protein 2;5                            417   3e-141   
emb|CDY17511.1|  BnaC03g65520D                                          417   3e-141   
ref|NP_001052292.1|  Os04g0233400                                       416   3e-141   
ref|XP_006846005.1|  PREDICTED: probable aquaporin PIP2-2               416   4e-141   
gb|KDO73275.1|  hypothetical protein CISIN_1g022966mg                   416   4e-141   
ref|XP_006424577.1|  hypothetical protein CICLE_v10028975mg             416   4e-141   
ref|XP_003591905.1|  Aquaporin PIP                                      416   4e-141   
ref|XP_003522619.2|  PREDICTED: aquaporin PIP2-7                        417   4e-141   
ref|XP_006298288.1|  hypothetical protein CARUB_v10014353mg             416   4e-141   
gb|ACN40330.1|  unknown                                                 416   8e-141   
gb|AFB83067.1|  plasma intrinsic protein PIP2.1                         415   8e-141   
gb|KFK36762.1|  hypothetical protein AALP_AA4G166800                    415   8e-141   
gb|ADL16407.1|  aquaporin                                               416   9e-141   
gb|ACE60220.1|  plasma membrane aquaporin                               415   1e-140   
gb|AFQ23181.1|  aquaporin PIP2;2                                        415   1e-140   
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8               415   1e-140   
gb|AFB82643.1|  aquaporin                                               415   1e-140   
ref|XP_010933360.1|  PREDICTED: probable aquaporin PIP2-6               415   1e-140   
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6               415   1e-140   
ref|XP_010516059.1|  PREDICTED: probable aquaporin PIP2-8               414   2e-140   
ref|XP_003604054.1|  Aquaporin PIP22                                    414   2e-140   
gb|ACR56614.1|  plasma intrinsic protein 2;4                            414   2e-140   



>ref|XP_009624885.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=291

 Score =   508 bits (1307),  Expect = 6e-177, Method: Compositional matrix adjust.
 Identities = 262/286 (92%), Positives = 275/286 (96%), Gaps = 2/286 (1%)
 Frame = +1

Query  85   KMAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            +MAKD E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  8    QMAKDTEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  66

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQTDP+ KG ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  67   GYKSQTDPDHKG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  125

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRA+MYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTF
Sbjct  126  VSLVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYSSGTGLGAEIIGTF  185

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  186  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  245

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            GKDKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSNA
Sbjct  246  GKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  291



>tpg|DAA64673.1| TPA_exp: aquaporin PIP2 1 [Nicotiana tabacum]
Length=291

 Score =   501 bits (1289),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 257/286 (90%), Positives = 273/286 (95%), Gaps = 2/286 (1%)
 Frame = +1

Query  85   KMAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            +MAKD E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  8    QMAKDTEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  66

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ DP+  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  67   GYKSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  125

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRA+MYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGY+ GTGLGAEIIGTF
Sbjct  126  VSLVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYNTGTGLGAEIIGTF  185

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  186  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  245

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            GK+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSNA
Sbjct  246  GKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  291



>ref|XP_009619670.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=283

 Score =   498 bits (1283),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 256/285 (90%), Positives = 272/285 (95%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTD +  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDTDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA+MYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFV
Sbjct  119  SLVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANMLNDGYSTGTGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVFAATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYG
Sbjct  179  LVYTVFAATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            K+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSNA
Sbjct  239  KEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  283



>tpg|DAA64674.1| TPA_exp: aquaporin PIP2 2 [Nicotiana tabacum]
Length=283

 Score =   498 bits (1283),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 257/285 (90%), Positives = 272/285 (95%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ DP+  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA+MYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFV
Sbjct  119  SLVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYG
Sbjct  179  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            K+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSNA
Sbjct  239  KEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  283



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score =   498 bits (1281),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 256/285 (90%), Positives = 272/285 (95%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ DP+  G ++CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQIDPDHNG-EQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA+MYM+AQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGY+ GTGLGAEIIGTFV
Sbjct  119  SLVRAIMYMLAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYNTGTGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYG
Sbjct  179  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            K+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSNA
Sbjct  239  KEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  283



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   497 bits (1279),  Expect = 8e-173, Method: Compositional matrix adjust.
 Identities = 253/285 (89%), Positives = 269/285 (94%), Gaps = 1/285 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+EGA    A +DYQDPPPAPL+DPEELGKWSFYRA+IAEFIAT+LFLY+TVLTVIG
Sbjct  1    MGKDLEGAQPPLAARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLTVIG  60

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTDP + G+D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTMNGSD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAVMYMVAQCLGAICGCGLVKAFQ+AYY RYGGGAN L DGYSKG GLGAEI+GTFV
Sbjct  120  SLVRAVMYMVAQCLGAICGCGLVKAFQRAYYTRYGGGANELADGYSKGVGLGAEIVGTFV  179

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  180  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  239

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            KDKAWDDQW+FWVGPF+GAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  240  KDKAWDDQWMFWVGPFIGAAIAAFYHQYILRAGAVKALGSFRSNA  284



>ref|NP_001289823.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18626.1| plasmamembrane intrinsic protein 2;1 [Solanum lycopersicum]
Length=279

 Score =   494 bits (1272),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 255/285 (89%), Positives = 270/285 (95%), Gaps = 6/285 (2%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDMEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ+      TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQSS-----TDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  114

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA+MY+VAQCLGAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFV
Sbjct  115  SLVRAIMYIVAQCLGAICGCGLVKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFV  174

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV+YG
Sbjct  175  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVVYG  234

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSNA
Sbjct  235  HNKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  279



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   491 bits (1263),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 254/286 (89%), Positives = 267/286 (93%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E G  +YA  KDYQDPPPAPLID EELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEYGTDQYAPNKDYQDPPPAPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ+D    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSDTKHNG-DECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            +SL RAVMYM+AQCLGAICGCGLVKAFQK+YYVRYGGGAN L  GYS GTGL AEIIGTF
Sbjct  120  ISLARAVMYMIAQCLGAICGCGLVKAFQKSYYVRYGGGANELATGYSTGTGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            GKDKAWDDQWIFWVGP +GAAIAA+YHQY+LRAGA KALGS+RSNA
Sbjct  240  GKDKAWDDQWIFWVGPLIGAAIAALYHQYILRAGAVKALGSFRSNA  285



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score =   489 bits (1258),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 252/286 (88%), Positives = 267/286 (93%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E G  +YA  KDYQDPPPAPLID EELGKWSFYRAI+AEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEYGTDQYAPNKDYQDPPPAPLIDAEELGKWSFYRAIVAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ+D    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSDTKHNG-DECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            +SL RAVMYM+AQCLGAICGCGLVKAFQK+YYV YGGGAN L  GYS GTGL AEIIGTF
Sbjct  120  ISLARAVMYMIAQCLGAICGCGLVKAFQKSYYVNYGGGANELATGYSTGTGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            GK+KAWDDQWIFWVGPF+GAAIAA+YHQY+LRAGA KALGS+RSNA
Sbjct  240  GKEKAWDDQWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFRSNA  285



>ref|XP_006367007.1| PREDICTED: aquaporin PIP2-1-like isoform X1 [Solanum tuberosum]
Length=287

 Score =   488 bits (1256),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 252/288 (88%), Positives = 268/288 (93%), Gaps = 4/288 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKG---TDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            Y SQ   +  G   TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   YNSQNSTDQCGGNSTDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRA+MY+VAQCLGAICGCGLVK+FQKAYYV+YGGGAN L DGYS GTGLGAEIIG
Sbjct  120  RKVSLVRAIMYIVAQCLGAICGCGLVKSFQKAYYVQYGGGANKLNDGYSTGTGLGAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TF+LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV
Sbjct  180  TFILVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IYG  KAW+DQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSNA
Sbjct  240  IYGHHKAWNDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  287



>ref|XP_006367008.1| PREDICTED: aquaporin PIP2-1-like isoform X2 [Solanum tuberosum]
Length=279

 Score =   487 bits (1253),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 251/285 (88%), Positives = 266/285 (93%), Gaps = 6/285 (2%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E  TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGTEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            Y SQ       TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YNSQNS-----TDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  114

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA+MY+VAQCLGAICGCGLVK+FQKAYYV+YGGGAN L DGYS GTGLGAEIIGTF+
Sbjct  115  SLVRAIMYIVAQCLGAICGCGLVKSFQKAYYVQYGGGANKLNDGYSTGTGLGAEIIGTFI  174

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYG
Sbjct  175  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYG  234

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
              KAW+DQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSNA
Sbjct  235  HHKAWNDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  279



>ref|XP_011094668.1| PREDICTED: aquaporin PIP2-4-like [Sesamum indicum]
Length=281

 Score =   486 bits (1250),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 254/286 (89%), Positives = 269/286 (94%), Gaps = 7/286 (2%)
 Frame = +1

Query  88   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E G TEY A KDYQDPPPAPLIDPEELGKWS YRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEVGGTEYGA-KDYQDPPPAPLIDPEELGKWSLYRAVIAEFIATLLFLYITVLTVI  59

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ+      TDECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  60   GYKSQS-----ATDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  114

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAV+Y++AQCLGAI G GLVKAFQKAYYVRYGGGAN L DGYS GTGL AEIIGTF
Sbjct  115  VSLVRAVLYIIAQCLGAISGVGLVKAFQKAYYVRYGGGANELADGYSTGTGLAAEIIGTF  174

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  175  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  234

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            GKDKAWDDQWIFWVGPF+GAAIAA+YHQY+LRAGAAKALGS+RS++
Sbjct  235  GKDKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGAAKALGSFRSSS  280



>ref|XP_012082352.1| PREDICTED: aquaporin PIP2-4-like [Jatropha curcas]
 gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   484 bits (1247),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 252/285 (88%), Positives = 264/285 (93%), Gaps = 3/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KDVEG    A  KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDVEGGDFQA--KDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVIG  58

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTDP+ K +D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  59   YKSQTDPS-KNSDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  117

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YM AQCLGAICGCGLVKAFQKAYY RYGGGAN L DGYSKGTGLGAEIIGTFV
Sbjct  118  SLVRAILYMAAQCLGAICGCGLVKAFQKAYYTRYGGGANELADGYSKGTGLGAEIIGTFV  177

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  178  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  237

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            KDKAWDDQWIFWVGPF+GAAIAA+YHQY+LRAGA KALGS+RS +
Sbjct  238  KDKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGAVKALGSFRSTS  282



>ref|XP_002313510.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
 gb|EEE87465.1| hypothetical protein POPTR_0009s01940g [Populus trichocarpa]
Length=284

 Score =   481 bits (1239),  Expect = 8e-167, Method: Compositional matrix adjust.
 Identities = 247/285 (87%), Positives = 265/285 (93%), Gaps = 1/285 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKD+E A      KDYQDPPPAPLID EELG+WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVAEHGETVKDYQDPPPAPLIDAEELGQWSFYRALIAEFIATLLFLYVTVLTVIG  60

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTDP+ KG D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPD-KGLDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RAV+YMVAQCLGAICGCGLVKAFQK+YY  YGGGAN LQ+GY+KGTGLGAEIIGTFV
Sbjct  120  SLIRAVLYMVAQCLGAICGCGLVKAFQKSYYNHYGGGANELQEGYNKGTGLGAEIIGTFV  179

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ 
Sbjct  180  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFN  239

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + KAWDD W+FWVGPF+GAAIAA YHQ++LRA A KALGS+RSNA
Sbjct  240  QSKAWDDHWLFWVGPFIGAAIAAFYHQFILRAAAIKALGSFRSNA  284



>ref|XP_006367014.1| PREDICTED: aquaporin PIP2-1-like, partial [Solanum tuberosum]
Length=279

 Score =   480 bits (1236),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 250/280 (89%), Positives = 263/280 (94%), Gaps = 4/280 (1%)
 Frame = +1

Query  112  TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPN  291
            TEYA PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIGYKSQ   +
Sbjct  1    TEYA-PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGYKSQNSTD  59

Query  292  VKG---TDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA  462
              G   TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA
Sbjct  60   QCGGNSTDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRA  119

Query  463  VMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTV  642
            +MY+VAQCLGAICGCGLVK FQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVLVYTV
Sbjct  120  IMYIVAQCLGAICGCGLVKCFQKAYYVKYGGGANMLNDGYSTGTGLGAEIIGTFVLVYTV  179

Query  643  FAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAW  822
            FAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIYG  KAW
Sbjct  180  FAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYGHHKAW  239

Query  823  DDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            +DQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSNA
Sbjct  240  NDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  279



>ref|XP_011044357.1| PREDICTED: probable aquaporin PIP2-4 [Populus euphratica]
Length=284

 Score =   479 bits (1234),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 245/285 (86%), Positives = 265/285 (93%), Gaps = 1/285 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKD+E A      +DYQDPPPAPLID EELG+WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MAKDIEVAEHGETVRDYQDPPPAPLIDAEELGQWSFYRALIAEFIATLLFLYVTVLTVIG  60

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTDP+ KG D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPD-KGLDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RAV+YMVAQCLGAICGCGLVKAFQK++Y  YGGGAN LQ+GY+KGTGLGAEIIGTFV
Sbjct  120  SLIRAVLYMVAQCLGAICGCGLVKAFQKSFYNHYGGGANELQEGYNKGTGLGAEIIGTFV  179

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ 
Sbjct  180  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFN  239

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + KAWDD W+FWVGPF+GAAIAA YHQ++LRA A KALGS+RSNA
Sbjct  240  QSKAWDDHWLFWVGPFIGAAIAAFYHQFILRAAAIKALGSFRSNA  284



>ref|XP_012064821.1| PREDICTED: aquaporin PIP2-4 [Jatropha curcas]
 gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   479 bits (1234),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 253/287 (88%), Positives = 265/287 (92%), Gaps = 3/287 (1%)
 Frame = +1

Query  88   MAKDVEGA--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE A  T   + KDY DPPPAPLID +ELG+WSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEPTGEFSGKDYHDPPPAPLIDMDELGQWSFYRALIAEFIATLLFLYITVLTV  60

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQTDPN K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYKSQTDPN-KNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RA+ YM+AQCLGAICGCGLVKAFQKAYY RYGGGAN L DGY+KGTGLGAEIIGT
Sbjct  120  KVSLIRALGYMIAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYNKGTGLGAEIIGT  179

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y KDKAWDDQWIFWVGPFVGAAIAA YHQY+LRA A KALGS+RSNA
Sbjct  240  YNKDKAWDDQWIFWVGPFVGAAIAAFYHQYILRAAAIKALGSFRSNA  286



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   479 bits (1233),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 253/288 (88%), Positives = 264/288 (92%), Gaps = 5/288 (2%)
 Frame = +1

Query  88   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            M KDVE      E+ A KDY DPPPAPLID EEL KWSFYRAIIAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEVGGHGGEFHA-KDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            VIGYKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   VIGYKSQTDP-AKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  118

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRA+MYM AQCLGAICGCGLVKAFQ+AYY RYGGGAN L DGYS GTGLGAEIIG
Sbjct  119  RKVSLVRAIMYMAAQCLGAICGCGLVKAFQRAYYNRYGGGANELADGYSTGTGLGAEIIG  178

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV
Sbjct  179  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  238

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY K+KAWDDQWIFWVGPF+GAAIAA+YHQYVLRA AAKALGS+RS++
Sbjct  239  IYNKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRASAAKALGSFRSSS  286



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score =   479 bits (1232),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 249/286 (87%), Positives = 265/286 (93%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E A +   + KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEAAGQGGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQTD   KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTD-KAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAV YM AQCLGA+CGCGLVKAFQKAYY +YGGGAN L DGYSKGTGL AEIIGTF
Sbjct  120  VSLVRAVFYMAAQCLGAVCGCGLVKAFQKAYYSKYGGGANELADGYSKGTGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            GKDKAW+DQWIFWVGPF+GAAIAA YHQY+LRAGAAKALGS+RS++
Sbjct  240  GKDKAWNDQWIFWVGPFIGAAIAAFYHQYILRAGAAKALGSFRSSS  285



>ref|XP_006339071.1| PREDICTED: aquaporin PIP2-1-like [Solanum tuberosum]
Length=281

 Score =   478 bits (1231),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 247/286 (86%), Positives = 267/286 (93%), Gaps = 6/286 (2%)
 Frame = +1

Query  88   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E G  +YA  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEYGNDQYAPSKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ+D      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRA+ Y+VAQCLGAICGCGLVK FQKAYYV+YGGGAN L  GY+  TGLGAEIIGTF
Sbjct  116  VSLVRAIFYIVAQCLGAICGCGLVKLFQKAYYVKYGGGANELAVGYNTATGLGAEIIGTF  175

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  235

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            GK+K+WDDQWIFWVGPF+GAAIAA+YHQY+LRAGA+K++ S+RSNA
Sbjct  236  GKNKSWDDQWIFWVGPFIGAAIAALYHQYILRAGASKSINSFRSNA  281



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score =   478 bits (1231),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 249/286 (87%), Positives = 264/286 (92%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E A +   + KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEAAGQGGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQTD   KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTD-KAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAV YM AQCLGA+CGCGLVKAFQKAYY +YGGGAN L DGYSKGTGL AEIIGTF
Sbjct  120  VSLVRAVFYMAAQCLGAVCGCGLVKAFQKAYYSKYGGGANELADGYSKGTGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            GKDKAWDDQWIFWVGPF+GAAIAA YHQY+LRA AAKALGS+RS++
Sbjct  240  GKDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAAKALGSFRSSS  285



>gb|AEQ20672.1| PIP2;1 [Karelinia caspia]
Length=284

 Score =   478 bits (1230),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 251/286 (88%), Positives = 262/286 (92%), Gaps = 3/286 (1%)
 Frame = +1

Query  88   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E G  +Y A KDYQDPPPA L D EEL KWSFYRAIIAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDIEVGGNDYGA-KDYQDPPPAELFDAEELTKWSFYRAIIAEFIATLLFLYVTVLTVI  59

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQTDP    +D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR 
Sbjct  60   GYKSQTDP-ANSSDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARX  118

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL RA MYMVAQCLGAICGCGLVKAFQK YY +YGGGAN L DGYS GTGLGAEI+GTF
Sbjct  119  VSLPRAFMYMVAQCLGAICGCGLVKAFQKTYYTKYGGGANELADGYSNGTGLGAEIVGTF  178

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  179  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  238

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            GKDKAWDDQW+FWVGP +GAAIAA YHQYVLRAGA KALGS+RSNA
Sbjct  239  GKDKAWDDQWLFWVGPMIGAAIAAFYHQYVLRAGAVKALGSFRSNA  284



>ref|XP_010043747.1| PREDICTED: probable aquaporin PIP2-5 [Eucalyptus grandis]
 gb|KCW85738.1| hypothetical protein EUGRSUZ_B02500 [Eucalyptus grandis]
Length=284

 Score =   478 bits (1229),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 245/285 (86%), Positives = 260/285 (91%), Gaps = 1/285 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E        +DYQDPPPAPL+DPEELGKWSFYRA+IAEFIAT+LFLY+TVLTVIG
Sbjct  1    MGKDMESGEPPFGARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLTVIG  60

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ DP + GT EC GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQVDPALNGT-ECDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  119

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAVMYMVAQCLGAICGCGLVKAFQKA Y RYGGGAN L DGYSKG GLGAEIIGTFV
Sbjct  120  SLVRAVMYMVAQCLGAICGCGLVKAFQKARYTRYGGGANELSDGYSKGVGLGAEIIGTFV  179

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV+Y 
Sbjct  180  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVMYN  239

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            KDKAWDDQW+FWVGPF+GAAIAA Y+QY+LRAGA KA GS RSNA
Sbjct  240  KDKAWDDQWMFWVGPFIGAAIAAFYYQYILRAGAVKAFGSSRSNA  284



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score =   478 bits (1229),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 247/285 (87%), Positives = 264/285 (93%), Gaps = 4/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKD+E   ++ A KDY DPPPAPL+D EEL KWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGQFQA-KDYHDPPPAPLVDAEELTKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ D   KG DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQID---KGGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  116

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YM AQCLGAICGCGLVKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGTFV
Sbjct  117  SLVRAILYMAAQCLGAICGCGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGTFV  176

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV+Y 
Sbjct  177  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMYN  236

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            +DK WDDQWIFWVGPF+GAAIAA+YHQY+LRA AAKALGS+RS++
Sbjct  237  QDKPWDDQWIFWVGPFIGAAIAAIYHQYILRAAAAKALGSFRSSS  281



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   478 bits (1229),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 250/291 (86%), Positives = 267/291 (92%), Gaps = 8/291 (3%)
 Frame = +1

Query  88   MAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  249
            M KDVE      G  E++A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLYVT
Sbjct  1    MGKDVEVAEQQGGGGEFSA-KDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVT  59

Query  250  vltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  429
            VLTVIGYKSQTDPN+  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  60   VLTVIGYKSQTDPNLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  118

Query  430  FLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAE  609
            FL RKVSL+RA++YMVAQCLGAICGCG VKAFQK+YY RYGGGAN L DGY+KGTGLGAE
Sbjct  119  FLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAE  178

Query  610  IIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG  789
            IIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG
Sbjct  179  IIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG  238

Query  790  AAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AAVIY K+KAWDDQWIFWVGPF+GA +AA YHQY+LRA A KALGS+RSNA
Sbjct  239  AAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA  289



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   477 bits (1227),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 252/289 (87%), Positives = 267/289 (92%), Gaps = 6/289 (2%)
 Frame = +1

Query  88   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            MAKDVE A     E++A KDY DPPPAPLID +ELGKWSFYRA+IAEFIATLLFLY+TVL
Sbjct  1    MAKDVEVAEATGGEFSA-KDYHDPPPAPLIDVDELGKWSFYRALIAEFIATLLFLYITVL  59

Query  256  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  435
            TVIGYKSQTDP+ K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   TVIGYKSQTDPD-KNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  118

Query  436  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  615
             RKVSL+RA+ YMVAQCLGAICGCGLVKAFQKAYY RYGGGAN L DGY+KGTGLGAEII
Sbjct  119  GRKVSLIRALGYMVAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYNKGTGLGAEII  178

Query  616  GTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA  795
            GTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA
Sbjct  179  GTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA  238

Query  796  VIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            VIY K+KAWDDQWIFWVGPF+GAAIAA YHQY+LRA A KALGS+RSNA
Sbjct  239  VIYNKEKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSNA  287



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   476 bits (1225),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 247/285 (87%), Positives = 262/285 (92%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KDVE   E+ A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDVEVRGEFIA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTD   K +D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTD-TTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAV+YMVAQCLGAICGCGLVKAFQK+YY +YGGGAN L  G+SKGTGLGAEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANELATGFSKGTGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            KDKAWDD WIFWVGPF+GAAIAA+YHQYVLRA A KALGS+RS++
Sbjct  239  KDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>ref|NP_001274308.1| aquaporin PIP2-1-like [Solanum lycopersicum]
 dbj|BAO18628.1| plasmamembrane intrinsic protein 2;5 [Solanum lycopersicum]
Length=281

 Score =   476 bits (1224),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 246/286 (86%), Positives = 266/286 (93%), Gaps = 6/286 (2%)
 Frame = +1

Query  88   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E G  +YA  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEYGNDQYAPSKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ+D      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARK  115

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRA+ Y+VAQCLGAICGCGLVK FQKAYYV+YGGGAN L  GY+  TGLGAEIIGTF
Sbjct  116  VSLVRAIFYIVAQCLGAICGCGLVKLFQKAYYVKYGGGANELAVGYNIATGLGAEIIGTF  175

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  235

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            GK+K+WDDQWIFWVGPF+GAAIAA+YHQY+LRAGA+K++ S+RSNA
Sbjct  236  GKNKSWDDQWIFWVGPFIGAAIAAIYHQYILRAGASKSINSFRSNA  281



>ref|XP_010325988.1| PREDICTED: aquaporin PIP2-1-like [Solanum lycopersicum]
Length=269

 Score =   475 bits (1223),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 244/271 (90%), Positives = 258/271 (95%), Gaps = 5/271 (2%)
 Frame = +1

Query  130  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGTDE  309
            K YQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLY+TVLTVIGYKSQ+      TD+
Sbjct  4    KTYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLTVIGYKSQSS-----TDQ  58

Query  310  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCL  489
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MY+VAQCL
Sbjct  59   CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYIVAQCL  118

Query  490  GAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRN  669
            GAICGCGLVKAFQKAYYV+YGGGAN L DGYS GTGLGAEIIGTFVLVYTVFAATDPKRN
Sbjct  119  GAICGCGLVKAFQKAYYVKYGGGANTLNDGYSTGTGLGAEIIGTFVLVYTVFAATDPKRN  178

Query  670  ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVG  849
            ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV+YG +KAWDDQWIFWVG
Sbjct  179  ARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVVYGHNKAWDDQWIFWVG  238

Query  850  PFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            PF+GAAIAA YHQ++LRAGA KALGS+RSNA
Sbjct  239  PFIGAAIAAFYHQFILRAGAVKALGSFRSNA  269



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
 gb|KJB36605.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
 gb|KJB36607.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=285

 Score =   475 bits (1223),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 244/285 (86%), Positives = 263/285 (92%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKDVE   E+ A KDY DPPPAPL+D EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ DP+ KG+DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA+ YM AQCLGAICGCGLVKAFQK+YY +YGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAIFYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            +DK WDD WIFWVGPF+GAAIAA+YHQ++LRA A KALGS+RS++
Sbjct  239  QDKPWDDHWIFWVGPFIGAAIAAIYHQFILRAAAVKALGSFRSSS  283



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   475 bits (1222),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 245/285 (86%), Positives = 262/285 (92%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E   E+ A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGREFIA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTD   K +D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTD-TTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAV+YMVAQCLGAICGCGLVKAFQK+YY +YGGGAN L  G+SKGTGLGAEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANELATGFSKGTGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            +DKAWDD WIFWVGPF+GAAIAA+YHQYVLRA A KALGS+RS++
Sbjct  239  EDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   475 bits (1222),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 247/288 (86%), Positives = 262/288 (91%), Gaps = 4/288 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            M KDVE A + A   + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEVAEQQAPEFSAKDYHDPPPAPLIDFEELRKWSFYRAVIAEFIATLLFLYITVLT  60

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            VIGYKSQTDPN    D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYKSQTDPNTNA-DQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL++AV+YMVAQCLGAICG G VKAFQKAYYVRYGGGAN +  GY+KGTGLGAEIIG
Sbjct  120  RKVSLIKAVLYMVAQCLGAICGVGFVKAFQKAYYVRYGGGANEMASGYTKGTGLGAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  180  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY + KAWDD WIFWVGPF+GAAIAA YHQY+LRA A KALGS+RS+A
Sbjct  240  IYNQQKAWDDHWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSSA  287



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   474 bits (1221),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 248/287 (86%), Positives = 265/287 (92%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE A   EY+A KDY DPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAERGEYSA-KDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQTDP +K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDP-LKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RAV+YMVAQCLGAICG GLVKAFQK+ Y RYGGGAN L  GY+KGTGLGAEIIGT
Sbjct  119  KVSLIRAVLYMVAQCLGAICGVGLVKAFQKSLYTRYGGGANELAAGYNKGTGLGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + + KAWDD WIFWVGPFVGAAIAA YHQ++LRA A KALGS+RSNA
Sbjct  239  FNQSKAWDDHWIFWVGPFVGAAIAAFYHQFILRAAAIKALGSFRSNA  285



>gb|ACU87558.1| PIP protein [Gossypium hirsutum]
 gb|KHG24536.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=282

 Score =   474 bits (1221),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 248/286 (87%), Positives = 262/286 (92%), Gaps = 5/286 (2%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KDVE     AA +DY DPPPAPLID EEL +WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MVKDVE----MAAGRDYHDPPPAPLIDSEELTQWSFYRALIAEFIATLLFLYVTVLTVIG  56

Query  268  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            Y+ QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  57   YRVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  116

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAVMYMVAQCLGAICGCGLVK FQK+YY  YGGGAN LQDG++KGTGLGAEIIGTF
Sbjct  117  VSLVRAVMYMVAQCLGAICGCGLVKGFQKSYYNTYGGGANELQDGFNKGTGLGAEIIGTF  176

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  177  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  236

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             KDKAWDDQW+FWVGPF+GAAIAA+YHQY+LRAGA KALGS+RSNA
Sbjct  237  NKDKAWDDQWMFWVGPFIGAAIAAIYHQYILRAGAMKALGSFRSNA  282



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   474 bits (1219),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 244/285 (86%), Positives = 262/285 (92%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E   E++A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTD   K +D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTD-TTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAV+YMVAQCLGAICGCGLVKAFQK+YY +YGGG N L  G+SKGTGLGAEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGCGLVKAFQKSYYTKYGGGVNELATGFSKGTGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            +DKAWDD WIFWVGPF+GAAIAA+YHQYVLRA A KALGS+RS++
Sbjct  239  EDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>gb|AEQ29857.1| aquaporin PIP2 [Malus prunifolia]
Length=281

 Score =   473 bits (1218),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 245/287 (85%), Positives = 267/287 (93%), Gaps = 8/287 (3%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+EGA   E+A+ KDYQDPPP PL D EEL KWSFYRA+IAEF+ATLLFLY+TVLTV
Sbjct  1    MAKDIEGAEHGEFAS-KDYQDPPPTPLFDAEELTKWSFYRAVIAEFVATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQSE-----VDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RAV+Y+VAQCLGAICG GLVKAFQK+YYV+YGGGAN L DGY+KGTGLGAEIIGT
Sbjct  115  KVSLIRAVLYIVAQCLGAICGVGLVKAFQKSYYVKYGGGANELADGYNKGTGLGAEIIGT  174

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVI
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  234

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y KDKAWDDQWIFW+GPF+GAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  235  YNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   474 bits (1219),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 242/286 (85%), Positives = 257/286 (90%), Gaps = 1/286 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E        KDY DPPPAPLID EEL KWS YRA+IAEF+ATLLFLY+TV TVIG
Sbjct  1    MGKDMEAGAAGFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVATVIG  60

Query  268  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            YK Q+DPNV GTD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   YKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  120

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA++YM+AQCLGAICG GLVK FQKAYYVRYGGGAN L  GYSKGTGL AEIIGTF
Sbjct  121  VSLIRALLYMIAQCLGAICGAGLVKGFQKAYYVRYGGGANELSSGYSKGTGLAAEIIGTF  180

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  181  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  240

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             K+KAWDDQWIFWVGPF+GAAIA  YHQ+VLRAGA KALGS+RSNA
Sbjct  241  DKEKAWDDQWIFWVGPFIGAAIATAYHQFVLRAGAVKALGSFRSNA  286



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   473 bits (1218),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 251/288 (87%), Positives = 263/288 (91%), Gaps = 5/288 (2%)
 Frame = +1

Query  88   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKDVE    A E+ A KDY DPPPAPLIDPEEL KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQESAPEFTA-KDYTDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYVTVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            VIGYK Q+D    G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   VIGYKVQSDTKAGG-DDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  118

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRA++YMVAQCLGAICGCGLVKAFQK+YY RYGGGAN L  GY+KGTGLGAEIIG
Sbjct  119  RKVSLVRALLYMVAQCLGAICGCGLVKAFQKSYYNRYGGGANVLASGYNKGTGLGAEIIG  178

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  179  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  238

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY +DKAWDD W+FWVGPF+GA  AAVYHQYVLRA A KALGS+RSNA
Sbjct  239  IYNQDKAWDDHWLFWVGPFIGALAAAVYHQYVLRAAAIKALGSFRSNA  286



>ref|XP_008363507.1| PREDICTED: aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   473 bits (1217),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 244/286 (85%), Positives = 264/286 (92%), Gaps = 6/286 (2%)
 Frame = +1

Query  88   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+EGA     A KDYQDPPP PL D EEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDIEGAEHGEFATKDYQDPPPTPLFDAEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----VDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RAV+Y+VAQCLGAICG GLVKAFQK+YYV+YGGGAN L DGY+KGTGLGAEIIGTF
Sbjct  116  VSLIRAVLYIVAQCLGAICGVGLVKAFQKSYYVKYGGGANELADGYNKGTGLGAEIIGTF  175

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIY  235

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             KDKAWDDQWIFW+GPF+GAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  236  NKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>emb|CDP06739.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   473 bits (1218),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 248/287 (86%), Positives = 263/287 (92%), Gaps = 6/287 (2%)
 Frame = +1

Query  88   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKD+E      E+   KDYQDPPPAPL+DPEEL +WSFYRAIIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEVGGNTHEHYGAKDYQDPPPAPLVDPEELTQWSFYRAIIAEFIATLLFLYITVLT  60

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            VIGYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  61   VIGYKSQSDTKANG-DICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRAV+YMVAQCLGAICGCGLVKAFQ+AYYVRYGGGANGL DGYS GTGLGAEIIG
Sbjct  120  RKVSLVRAVLYMVAQCLGAICGCGLVKAFQRAYYVRYGGGANGLSDGYSTGTGLGAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV
Sbjct  180  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            IYG  KAWDD WIFWVGPF+GAAIAA YHQY+LRAGA KALGS++S+
Sbjct  240  IYG--KAWDDHWIFWVGPFIGAAIAAFYHQYILRAGAVKALGSFKSS  284



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score =   473 bits (1217),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 243/285 (85%), Positives = 257/285 (90%), Gaps = 1/285 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E + E  + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIESSVEQVSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLTVIG  60

Query  268  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            YK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  61   YKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  120

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQ G++KGTGLGAEIIGTF
Sbjct  121  VSLIRAIMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQSGFNKGTGLGAEIIGTF  180

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  181  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  240

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             K+KAWDDQWIFWVGPF+GAAIAA YHQY+LRA A KA GS RSN
Sbjct  241  NKEKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIKAFGSSRSN  285



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   473 bits (1217),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 249/288 (86%), Positives = 261/288 (91%), Gaps = 5/288 (2%)
 Frame = +1

Query  88   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKDVE      E+ A KDY DPPPAPLID EE  +WSFYRAIIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVGGQGGEFQA-KDYNDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            VIGYKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLA
Sbjct  60   VIGYKSQTDP-AKNADPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLA  118

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRA++YM AQCLGAICGCGLVKAFQKAYY RYGGGAN L DGYSKGTGLGAEIIG
Sbjct  119  RKVSLVRAILYMAAQCLGAICGCGLVKAFQKAYYNRYGGGANELADGYSKGTGLGAEIIG  178

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV
Sbjct  179  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAV  238

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY +DKAWDDQWIFWVGPF+GAAIAA YHQY+LRA A KALGS+RS +
Sbjct  239  IYNQDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAVKALGSFRSTS  286



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   473 bits (1216),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 244/285 (86%), Positives = 261/285 (92%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E   E++A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ D   K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQID-TTKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YMVAQCLGAICGCGLVKAFQK+YY  YGGGAN L  G+SKGTGLGAEIIGTFV
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANELATGFSKGTGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            KDKAWDD WIFWVGPF+GAAIAA+YHQYVLRA A KALGS+RS++
Sbjct  239  KDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>gb|KJB21561.1| hypothetical protein B456_004G001400 [Gossypium raimondii]
Length=285

 Score =   472 bits (1215),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 243/285 (85%), Positives = 257/285 (90%), Gaps = 1/285 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E + E  + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIESSVEQGSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLTVIG  60

Query  268  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            YK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  61   YKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  120

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQ G++KGTGLGAEIIGTF
Sbjct  121  VSLIRAIMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQSGFNKGTGLGAEIIGTF  180

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY
Sbjct  181  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIY  240

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             K+KAWDDQWIFWVGPF+GAAIAA YHQY+LRA A KA GS RSN
Sbjct  241  NKEKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIKAFGSSRSN  285



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   472 bits (1215),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 242/284 (85%), Positives = 263/284 (93%), Gaps = 2/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E   E++A KDY DPPPAPLID EE+ +WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTD N  G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDVNKNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YMVAQCLGAICGCGLVKAFQK+YY  YGGGANGL  GYSKG GLGAEIIGTFV
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVKAFQKSYYTSYGGGANGLAIGYSKGNGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            K+KAWDD WIFWVGPF+GAAIAA+YHQ++LRA A K+LGS+RS+
Sbjct  239  KEKAWDDHWIFWVGPFIGAAIAALYHQFILRAAAVKSLGSFRSS  282



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   472 bits (1214),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 245/276 (89%), Positives = 259/276 (94%), Gaps = 1/276 (0%)
 Frame = +1

Query  115  EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNV  294
            E+   KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVIGYKSQTDPN+
Sbjct  7    EHHGGKDYHDPPPAPLIDGEELTKWSFYRAVIAEFIATLLFLYVTVLTVIGYKSQTDPNL  66

Query  295  KGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYM  474
              TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSL+RA++YM
Sbjct  67   N-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYM  125

Query  475  VAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAAT  654
            VAQCLGAICG GLVKAFQ +YY RYGGGAN L DGY+KGTGLG EIIGTFVLVYTVF+AT
Sbjct  126  VAQCLGAICGVGLVKAFQSSYYNRYGGGANELADGYNKGTGLGTEIIGTFVLVYTVFSAT  185

Query  655  DPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQW  834
            DPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWDDQW
Sbjct  186  DPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWDDQW  245

Query  835  IFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IFWVGPF+GAAIAA YHQ+VLRAGA KALGS+RSNA
Sbjct  246  IFWVGPFIGAAIAAFYHQFVLRAGAIKALGSFRSNA  281



>ref|XP_010031998.1| PREDICTED: aquaporin PIP2-7-like [Eucalyptus grandis]
 gb|KCW51390.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=285

 Score =   471 bits (1213),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 253/287 (88%), Positives = 266/287 (93%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE A   E+AA KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEPAEFAA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQTDP +KGTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDPALKGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RAV YMVAQCLGAICGCGLVKAFQKAYY RYGGGAN +Q GYSKGT LGAEIIGT
Sbjct  119  KVSLIRAVSYMVAQCLGAICGCGLVKAFQKAYYTRYGGGANEVQPGYSKGTALGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV+
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVM  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            YG DKAWDDQWIFWVGPF+GAA AA Y+Q+VLRA A KALGS+RSNA
Sbjct  239  YGHDKAWDDQWIFWVGPFLGAAAAAFYYQFVLRAAAIKALGSFRSNA  285



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   471 bits (1213),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 244/285 (86%), Positives = 260/285 (91%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E   E+ A KDY DPPPAPLID EEL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFNA-KDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ D   K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQID-TTKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YMVAQCLGAICGCGLVKAFQK+YY  YGGGAN L  G+SKGTGLGAEIIGTFV
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANELATGFSKGTGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            KDKAWDD WIFWVGPF+GAAIAA+YHQYVLRA A KALGS+RS++
Sbjct  239  KDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   471 bits (1213),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 244/291 (84%), Positives = 261/291 (90%), Gaps = 7/291 (2%)
 Frame = +1

Query  88   MAKDVEGATEYA------APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  249
            M KDVE A +        + KDY DPPPAPLID EELGKWSFYRA+IAEFIATL FLYVT
Sbjct  1    MGKDVEVAEQQGGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLSFLYVT  60

Query  250  vltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  429
            VLT IGYKSQTDP +  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  61   VLTAIGYKSQTDPTLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  119

Query  430  FLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAE  609
            FL RKVSL+RA++YMVAQCLGAICGCG VKAFQK+YY RYGGGAN L DGY+KGTGLGAE
Sbjct  120  FLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLGAE  179

Query  610  IIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG  789
            IIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPI GTGINPARSFG
Sbjct  180  IIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPIIGTGINPARSFG  239

Query  790  AAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AAVIY K+KAWDDQWIFWVGPF+GA +AA YHQY+LRA A KALGS+RSNA
Sbjct  240  AAVIYNKEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA  290



>gb|AAV80229.1| aquaporin 2 [Aegiceras corniculatum]
Length=284

 Score =   471 bits (1212),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 243/285 (85%), Positives = 261/285 (92%), Gaps = 1/285 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKD+E      APKDYQDPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGPGANAPKDYQDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVLTVIG  60

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            Y SQTDP+ K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLA+KV
Sbjct  61   YSSQTDPD-KNPDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTLGLFLAQKV  119

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YM+AQCLGAICGCGLVKAFQK+YY +YGGGAN L DGY+KGTGLGAEIIGTFV
Sbjct  120  SLVRAMLYMMAQCLGAICGCGLVKAFQKSYYTKYGGGANYLHDGYNKGTGLGAEIIGTFV  179

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIYG
Sbjct  180  LVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYG  239

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            K K WDDQWIFW GPF+GA IAA YHQ++LRAGA KALGSYRSNA
Sbjct  240  KKKTWDDQWIFWGGPFIGAPIAAFYHQFILRAGAIKALGSYRSNA  284



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   471 bits (1212),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 241/285 (85%), Positives = 264/285 (93%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKDVE   E+ A KDY DPPPAPL+D +EL +WSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ DP+ KG+ +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGSQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YM AQCLGAICGCGLVKAFQK+YY +YGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAILYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV++ 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMFN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            +DK WDD WIFWVGPF+GAAIAA+YH+Y+LRAGAAKALGS+RS++
Sbjct  239  QDKPWDDHWIFWVGPFIGAAIAAIYHEYILRAGAAKALGSFRSSS  283



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score =   471 bits (1212),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 246/286 (86%), Positives = 262/286 (92%), Gaps = 3/286 (1%)
 Frame = +1

Query  88   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE A    Y+A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAERGSYSA-KDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQTD  V   D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDTTVATGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RA++Y+VAQCLGAICG GLVKAFQKAYY +YGGGAN L DGYS GTGLGAEIIGT
Sbjct  120  KVSLIRAILYIVAQCLGAICGVGLVKAFQKAYYTKYGGGANTLGDGYSVGTGLGAEIIGT  179

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  239

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            + + KAWD  WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RSN
Sbjct  240  FNQQKAWDKHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  285



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   471 bits (1212),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 261/285 (92%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E   E+ A KDY DPPPAPLID EEL +WS YRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFIA-KDYHDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTD   K  D CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTD-TAKNGDVCGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YMVAQCLGAICGCGLVKAFQK+YY +YGGGANGL  G+SKGT LGAEIIGTFV
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVKAFQKSYYTKYGGGANGLASGFSKGTALGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            +DKAWDD WIFWVGPF+GAAIAA+YHQYVLRA A KALGS+RS++
Sbjct  239  EDKAWDDHWIFWVGPFIGAAIAALYHQYVLRAAAVKALGSFRSSS  283



>ref|XP_010046653.1| PREDICTED: aquaporin PIP2-1-like [Eucalyptus grandis]
Length=286

 Score =   471 bits (1211),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 243/287 (85%), Positives = 263/287 (92%), Gaps = 5/287 (2%)
 Frame = +1

Query  88   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+E  G       KDYQDPPPAPL+D EELG+WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDMEVGGGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ + +    D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQVETS---GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  117

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSLVRAV+YMVAQCLGA+CGCGLVK FQKAYY+  GGGANGL +GYS GTGL AEIIGT
Sbjct  118  KVSLVRAVLYMVAQCLGAVCGCGLVKQFQKAYYIEQGGGANGLSEGYSTGTGLAAEIIGT  177

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV+
Sbjct  178  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVM  237

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            YGK KAWD+QWIFWVGPF+GAAIAA YHQY+LRAGAAKALGS+RS++
Sbjct  238  YGKQKAWDEQWIFWVGPFIGAAIAAFYHQYILRAGAAKALGSFRSSS  284



>gb|KJB26182.1| hypothetical protein B456_004G229000 [Gossypium raimondii]
Length=282

 Score =   470 bits (1210),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 248/286 (87%), Positives = 261/286 (91%), Gaps = 5/286 (2%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KDVE A    A +DY DPPPAPLI+ EEL +WSFYRA+IAEFIATLLFLYVTVLTVIG
Sbjct  1    MVKDVETA----AGRDYHDPPPAPLINAEELTQWSFYRALIAEFIATLLFLYVTVLTVIG  56

Query  268  YKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            YK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL RK
Sbjct  57   YKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGRK  116

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAVMYMVAQCLGAICGCGLVK FQK+YY  YGGGAN LQDG++KGTGLGAEIIGTF
Sbjct  117  VSLVRAVMYMVAQCLGAICGCGLVKWFQKSYYNTYGGGANELQDGFNKGTGLGAEIIGTF  176

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  177  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  236

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             KDKAWDDQW+FWVGPF+GAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  237  NKDKAWDDQWMFWVGPFIGAAIAANYHQYILRAGAMKALGSFRSNA  282



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   470 bits (1210),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 241/285 (85%), Positives = 262/285 (92%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKDVE   E+ A KDY DPPPAPL+D +EL +WSFYRAIIAEFIA LLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDAQELTQWSFYRAIIAEFIAALLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ DP+ KG  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YM AQCLGAICGCGLVKAFQK+YY +YGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAILYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV++ 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMFN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            +DK WDD WIFWVGPF+GAAIAA+YHQY+LRAGAAKALGS+RS++
Sbjct  239  QDKPWDDHWIFWVGPFIGAAIAAIYHQYILRAGAAKALGSFRSSS  283



>gb|KCW88815.1| hypothetical protein EUGRSUZ_A01153 [Eucalyptus grandis]
Length=356

 Score =   472 bits (1215),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 244/290 (84%), Positives = 264/290 (91%), Gaps = 5/290 (2%)
 Frame = +1

Query  79   ELKMAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtv  252
            E  MAKD+E  G       KDYQDPPPAPL+D EELG+WSFYRAIIAEFIATLLFLY+TV
Sbjct  68   EAGMAKDMEVGGGHGSFQSKDYQDPPPAPLVDAEELGQWSFYRAIIAEFIATLLFLYITV  127

Query  253  ltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  432
            LTVIGYKSQ + +    D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLF
Sbjct  128  LTVIGYKSQVETS---GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLF  184

Query  433  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  612
            LARKVSLVRAV+YMVAQCLGA+CGCGLVK FQKAYY+  GGGANGL +GYS GTGL AEI
Sbjct  185  LARKVSLVRAVLYMVAQCLGAVCGCGLVKQFQKAYYIEQGGGANGLSEGYSTGTGLAAEI  244

Query  613  IGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA  792
            IGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA
Sbjct  245  IGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA  304

Query  793  AVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AV+YGK KAWD+QWIFWVGPF+GAAIAA YHQY+LRAGAAKALGS+RS++
Sbjct  305  AVMYGKQKAWDEQWIFWVGPFIGAAIAAFYHQYILRAGAAKALGSFRSSS  354



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   469 bits (1207),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 243/286 (85%), Positives = 256/286 (90%), Gaps = 3/286 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            M KDVE A E      KDY DPPPAPLID EEL  WS YRA+IAEFIATLLFLY+TV TV
Sbjct  1    MGKDVEAAAEAGEFTAKDYMDPPPAPLIDVEELTTWSLYRAVIAEFIATLLFLYITVATV  60

Query  262  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            IGYK Q+DPNV GTD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RA++YM+AQCLGAICG GLV+ FQKAYYVRYGGGAN L  GYSKGTGL AEIIG
Sbjct  121  RKVSLIRALLYMIAQCLGAICGAGLVRGFQKAYYVRYGGGANELSSGYSKGTGLAAEIIG  180

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  181  TFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  240

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRS  936
            IY K+KAWDDQWIFWVGPF+GAAIA  YHQYVLRA AAKALGS+RS
Sbjct  241  IYNKEKAWDDQWIFWVGPFIGAAIAEAYHQYVLRASAAKALGSFRS  286



>gb|KJB56128.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=289

 Score =   469 bits (1206),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 244/289 (84%), Positives = 260/289 (90%), Gaps = 4/289 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            M KD+E A ++    + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  259  vIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  435
            VIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  436  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  615
             RKVSL+RA+MYMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQ G++KGTGLGAEII
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQPGFNKGTGLGAEII  180

Query  616  GTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA  795
            GTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAA
Sbjct  181  GTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAA  240

Query  796  VIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            VIY K+KAWDDQWIFWVGPF+GAA AA YHQY+LRA A KALGS+RSNA
Sbjct  241  VIYNKEKAWDDQWIFWVGPFIGAAAAAFYHQYILRAAAIKALGSFRSNA  289



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   469 bits (1206),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 246/289 (85%), Positives = 259/289 (90%), Gaps = 5/289 (2%)
 Frame = +1

Query  88   MAKDVEGAT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKDVE A    EYA  KDY DPPPAPL D EEL KWS YRA IAEFIAT+LFLYVTV T
Sbjct  1    MAKDVEAAAGHGEYAV-KDYTDPPPAPLFDWEELTKWSLYRAAIAEFIATMLFLYVTVAT  59

Query  259  vIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  435
            VIGYK Q+DPNV  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  436  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  615
            ARKVSL+RA++YM+ QCLGAICG GLVK FQKA++VRYGGGAN L DGYSKGTGL AEII
Sbjct  120  ARKVSLIRALLYMIGQCLGAICGVGLVKGFQKAFFVRYGGGANELSDGYSKGTGLAAEII  179

Query  616  GTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA  795
            GTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA
Sbjct  180  GTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA  239

Query  796  VIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            VIY KDKAWDDQWIFWVGP +GAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  240  VIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYILRAGAVKALGSFRSNA  288



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score =   468 bits (1205),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 246/286 (86%), Positives = 262/286 (92%), Gaps = 4/286 (1%)
 Frame = +1

Query  88   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE A    Y+A KDY DPPPAPLID EELGKWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAERGSYSA-KDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQSDTKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RA++YMVAQCLGAICG GLVKAFQKAYY RYGGGAN L DGYS GTGLGAEIIGT
Sbjct  119  KVSLIRAILYMVAQCLGAICGVGLVKAFQKAYYSRYGGGANTLSDGYSTGTGLGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI
Sbjct  179  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            + + KAWDD WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RSN
Sbjct  239  FNQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  284



>gb|KJB11821.1| hypothetical protein B456_002G2484001 [Gossypium raimondii]
Length=285

 Score =   468 bits (1205),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 241/285 (85%), Positives = 262/285 (92%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKDVE   E+ A KDY DPPPAPL+D +EL +WSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVEVGGEFQA-KDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ DP+ KG  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQVDPD-KGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YM AQCLGAICGCGLVKAFQK+YY +YGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAILYMAAQCLGAICGCGLVKAFQKSYYNKYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV++ 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVMFN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            +DK WDD WIFWVGP +GAAIAA+YHQY+LRAGAAKALGS+RS++
Sbjct  239  QDKPWDDHWIFWVGPLIGAAIAAIYHQYILRAGAAKALGSFRSSS  283



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   468 bits (1205),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 244/293 (83%), Positives = 262/293 (89%), Gaps = 9/293 (3%)
 Frame = +1

Query  88   MAKDVEGATEYA--------APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllfly  243
            M KDVE A +          + KDY D PPAPLID +ELGKWSFYRA+IAEFIATLLFLY
Sbjct  1    MGKDVEVAEQQGGGGGGGEFSAKDYHDSPPAPLIDFDELGKWSFYRAVIAEFIATLLFLY  60

Query  244  vtvltvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  423
            VTVLTVIGYKSQTDP +  TD+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF
Sbjct  61   VTVLTVIGYKSQTDPTLN-TDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  119

Query  424  GLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLG  603
            GLFL RKVSL+RA++YMVAQCLGAICGCG VKAFQK+YY RYGGGAN L DGY+KGTGLG
Sbjct  120  GLFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQKSYYNRYGGGANELADGYNKGTGLG  179

Query  604  AEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS  783
            AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS
Sbjct  180  AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS  239

Query  784  FGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            FGAAVIY K+KAWDDQWI WVGPF+GA +AA YHQY+LRA A KALGS+RSNA
Sbjct  240  FGAAVIYNKEKAWDDQWILWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA  292



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   468 bits (1204),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 240/286 (84%), Positives = 256/286 (90%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E   E+ A KDY DPPPAPL+D EEL KWS YRA+IAEFIATLLFLY+TV TVIG
Sbjct  1    MRKDMEAGAEFTA-KDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVATVIG  59

Query  268  YKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            YK Q+DPNV G D  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  60   YKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA++YM+AQCLGAICG GLVKAFQKAYY RYGGG N L  GYSKGTGL AEIIGTF
Sbjct  120  VSLIRALLYMIAQCLGAICGVGLVKAFQKAYYNRYGGGVNELSSGYSKGTGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS G AVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGPAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
              DKAWDDQWIFWVGPF+GAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  240  NNDKAWDDQWIFWVGPFIGAAIAAAYHQYILRAGAIKALGSFRSNA  285



>ref|XP_008463943.1| PREDICTED: aquaporin PIP2-7 [Cucumis melo]
Length=283

 Score =   468 bits (1204),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 247/286 (86%), Positives = 257/286 (90%), Gaps = 4/286 (1%)
 Frame = +1

Query  88   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            M KDVE A +     KDYQDPPPAPLIDPEEL KWS YRA IAEFIATLLFLYVTVLTVI
Sbjct  1    MGKDVEVAEQGEFQSKDYQDPPPAPLIDPEELTKWSLYRAAIAEFIATLLFLYVTVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GY  Q D      D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYSHQRDST---PDPCSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAV+YM+AQC GAICGCGLVKAFQ AYYVRY GGAN L DGY+KGTGLGAEIIGTF
Sbjct  118  VSLVRAVLYMLAQCAGAICGCGLVKAFQSAYYVRYNGGANMLSDGYNKGTGLGAEIIGTF  177

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+
Sbjct  178  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIF  237

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             K+KAWDDQWIFWVGPF+GAAIAA+YHQYVLRAGA KALGS+RSNA
Sbjct  238  NKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRAGAIKALGSFRSNA  283



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   468 bits (1203),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 244/287 (85%), Positives = 264/287 (92%), Gaps = 8/287 (3%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVEGA   E+AA KDY DPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEGAEHGEFAA-KDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RAV+Y++AQCLGAICG GLVKAFQK+YYV+YGGGAN L  GY+KGTGLGAEIIGT
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYVKYGGGANELSAGYNKGTGLGAEIIGT  174

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVI
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVI  234

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y KDKAWDDQWIFW+GPF+GAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  235  YNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>ref|XP_012093253.1| PREDICTED: probable aquaporin PIP2-5 [Jatropha curcas]
 gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score =   468 bits (1204),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 246/284 (87%), Positives = 256/284 (90%), Gaps = 2/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KDV     ++A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MVKDVAEQGSFSA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDP-AKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAVMYMVAQ LGAICG GLVKAFQ AYY RYGGGAN L DGYS G GLGAEIIGTFV
Sbjct  119  SLVRAVMYMVAQSLGAICGVGLVKAFQSAYYKRYGGGANTLADGYSTGVGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY 
Sbjct  179  LVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             DKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  239  HDKAWDDQWIFWVGPFLGAAIAAFYHQFILRAGAVKALGSFRSN  282



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   468 bits (1203),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 246/290 (85%), Positives = 261/290 (90%), Gaps = 6/290 (2%)
 Frame = +1

Query  88   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            M KD+E A     E++A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVL
Sbjct  1    MTKDIETAEQRGGEFSA-KDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVL  59

Query  256  tvIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  432
            TVIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  433  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  612
            + RKVSL+RA+MYMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQ G++KGTGLGAEI
Sbjct  120  VGRKVSLIRALMYMVAQCLGAICGCGLVKAFQKTYYNNYGGGANELQPGFNKGTGLGAEI  179

Query  613  IGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA  792
            IGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGA
Sbjct  180  IGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGA  239

Query  793  AVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AVIY K+KAWDDQWIFWVGPF+GAA AA YHQY+LRA A KALGS+RSNA
Sbjct  240  AVIYNKEKAWDDQWIFWVGPFIGAAAAAFYHQYILRAAAIKALGSFRSNA  289



>gb|EYU34445.1| hypothetical protein MIMGU_mgv1a011350mg [Erythranthe guttata]
Length=284

 Score =   467 bits (1202),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 245/288 (85%), Positives = 263/288 (91%), Gaps = 9/288 (3%)
 Frame = +1

Query  88   MAKDVEG---ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKD+EG   A EY A KDY DPPPAPLID EEL KWS YRA+IAEF ATLLFLY+TVLT
Sbjct  1    MAKDIEGGAAAHEYGA-KDYHDPPPAPLIDSEELTKWSLYRAVIAEFTATLLFLYITVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            VIGYKSQ+       D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   VIGYKSQS-----AADGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  114

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRAV+Y++AQCLGAICGCGLVKAFQK+YYV +GGGAN L  GYSKGTGL AEIIG
Sbjct  115  RKVSLVRAVLYIIAQCLGAICGCGLVKAFQKSYYVEHGGGANELALGYSKGTGLAAEIIG  174

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  175  TFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  234

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IYGKDKAWDDQWIFWVGPF+GAAIAA+YHQY+LRAGA KALGS+RS++
Sbjct  235  IYGKDKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGAVKALGSFRSSS  282



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   467 bits (1201),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 245/285 (86%), Positives = 261/285 (92%), Gaps = 4/285 (1%)
 Frame = +1

Query  88   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAK DVEG +  A  KDY DPPPAPLID +EL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDAKAGG-DLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCLGAICG GLVKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTF
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYTRYGGGANELSEGYSTGVGLGAEIIGTF  177

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  178  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  237

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             K+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RSN
Sbjct  238  NKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  282



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score =   467 bits (1201),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 243/286 (85%), Positives = 255/286 (89%), Gaps = 3/286 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            M KDVE A E      KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV TV
Sbjct  1    MGKDVEAAAEAGEFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVATV  60

Query  262  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            IGYK Q+D NV G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDANVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RA++YM+AQCLGAICG GLVK FQKAYYVRYGGGAN L  GYS+GTGL AEIIG
Sbjct  121  RKVSLIRALLYMIAQCLGAICGAGLVKGFQKAYYVRYGGGANELSSGYSRGTGLAAEIIG  180

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  181  TFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  240

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRS  936
            IY +DKAWDDQWIFWVGPF+GAAIAA YHQYVLRA A KALGSYRS
Sbjct  241  IYNEDKAWDDQWIFWVGPFIGAAIAAAYHQYVLRASAGKALGSYRS  286



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   466 bits (1200),  Expect = 8e-161, Method: Compositional matrix adjust.
 Identities = 246/290 (85%), Positives = 262/290 (90%), Gaps = 6/290 (2%)
 Frame = +1

Query  88   MAKDVE----GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            MAK+VE    G  E++A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYV+VL
Sbjct  1    MAKEVETAEQGGGEFSA-KDYHDPPPAPLIDAEELFKWSFYRALIAEFIATLLFLYVSVL  59

Query  256  tvIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  432
            TVIGYK QTD      D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKVQTDTLKNTVDADCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  433  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  612
            L RKVSL+RA+MYMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQ GY+KGTGLGAEI
Sbjct  120  LGRKVSLIRAIMYMVAQCLGAICGCGLVKAFQKTYYNTYGGGANELQPGYNKGTGLGAEI  179

Query  613  IGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA  792
            IGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA
Sbjct  180  IGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA  239

Query  793  AVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AVIY ++KAWDDQWIFWVGPF+GAAIAA YHQY+LRA A KALGS+RSNA
Sbjct  240  AVIYNREKAWDDQWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSNA  289



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score =   466 bits (1200),  Expect = 9e-161, Method: Compositional matrix adjust.
 Identities = 242/286 (85%), Positives = 261/286 (91%), Gaps = 4/286 (1%)
 Frame = +1

Query  88   MAKDVEGA--TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE +  ++++A KDY DPPPA LIDP+EL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVESSEHSQFSA-KDYHDPPPASLIDPDELSKWSFYRALIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYK QTD +  GTD CGGVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKRQTDSSHNGTD-CGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RAVMY++AQCLGAICG GLVK FQK+YYVRYGGGAN L DGYSKG GL AEIIGT
Sbjct  119  KVSLIRAVMYIIAQCLGAICGVGLVKGFQKSYYVRYGGGANELADGYSKGVGLAAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            + KDKAW D WIFWVGPF+GAAIAA YHQY+LRA A KALGS+RSN
Sbjct  239  FNKDKAWHDHWIFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSN  284



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score =   466 bits (1200),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 242/279 (87%), Positives = 255/279 (91%), Gaps = 1/279 (0%)
 Frame = +1

Query  106  GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTD  285
            G  E+AA KDY DPPPAPLID  ELG WS YRA+IAEFIATLLFLY+TVLTVIGYK QTD
Sbjct  12   GGGEFAA-KDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVLTVIGYKHQTD  70

Query  286  PNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAV  465
            PNV GTD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+
Sbjct  71   PNVAGTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAL  130

Query  466  MYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVF  645
            +Y+VAQCLGAICG GLVKAFQ AY+ RYGGGAN L  GYS+GTGLGAEIIGTFVLVYTVF
Sbjct  131  LYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTVF  190

Query  646  AATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWD  825
            +ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY KDK WD
Sbjct  191  SATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPWD  250

Query  826  DQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            D WIFWVGPF GAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  251  DHWIFWVGPFAGAAIAAFYHQYILRAGAIKALGSFRSNA  289



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   465 bits (1197),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 241/286 (84%), Positives = 261/286 (91%), Gaps = 6/286 (2%)
 Frame = +1

Query  88   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVEGA     A KDY DPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEGAEHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RAV+Y++AQCLGAICG GLVKAFQK+YY++YGGGAN L  GY+KGTGLGAEIIGTF
Sbjct  116  VSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYMKYGGGANELSAGYNKGTGLGAEIIGTF  175

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIY  235

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
              DKAWDDQWIFW+GPF+GAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  236  NXDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>gb|AAW80918.1| putative plasma membrane intrinsic protein [Astragalus membranaceus]
Length=283

 Score =   465 bits (1197),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 246/287 (86%), Positives = 261/287 (91%), Gaps = 8/287 (3%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            M KDVE A   E++A KDY DPPPAPLID  EL  WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MGKDVEVAEHGEFSA-KDYTDPPPAPLIDMAELASWSFYRAIIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ+      TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQS-----ATDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RAVMYMVAQCLGAICG G VKAFQK+YYV++GGGAN L DGY+KGTGL AEIIGT
Sbjct  115  KVSLIRAVMYMVAQCLGAICGVGFVKAFQKSYYVKFGGGANELADGYNKGTGLAAEIIGT  174

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI
Sbjct  175  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  234

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y KDKAWDDQWIFWVGPFVGAAIAA YHQ+VLRA A KALGS+RSNA
Sbjct  235  YNKDKAWDDQWIFWVGPFVGAAIAAFYHQFVLRAAAIKALGSFRSNA  281



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   465 bits (1196),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 245/286 (86%), Positives = 258/286 (90%), Gaps = 4/286 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE  TE  +   KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVE-VTERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKHQSDLKDHG-DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RA+MYMVAQCLGAICG GLVKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGT
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            Y KDK WDD WIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  239  YNKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   465 bits (1196),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 246/287 (86%), Positives = 260/287 (91%), Gaps = 8/287 (3%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE     E+ A KDY DPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLYVT+LTV
Sbjct  1    MAKDVEVVEGGEFQA-KDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYVTILTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ+      TDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQS-----ATDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSLVRAV+Y+VAQCLGAICG GLVKAFQ +YY R+GGGAN L D Y+KG GLGAEIIGT
Sbjct  115  KVSLVRAVLYIVAQCLGAICGTGLVKAFQSSYYNRHGGGANTLADHYNKGVGLGAEIIGT  174

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  234

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y  DKAWDDQWIFWVGPF+GAAIAA YHQY+LRAGA KALGS+RS A
Sbjct  235  YNNDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAGAIKALGSFRSTA  281



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   464 bits (1195),  Expect = 4e-160, Method: Compositional matrix adjust.
 Identities = 243/287 (85%), Positives = 263/287 (92%), Gaps = 8/287 (3%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE A   E+AA KDY DPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEVAEHGEFAA-KDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RAV+Y++AQCLGAICG GLVKAFQK+YYV+YGGGAN L  GY+KGTGLGAEIIGT
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYVKYGGGANELSAGYNKGTGLGAEIIGT  174

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVI
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVI  234

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y KDKAWDDQWIFW+GPF+GAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  235  YNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score =   464 bits (1195),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 243/285 (85%), Positives = 259/285 (91%), Gaps = 5/285 (2%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYK QTD      D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKHQTDH----ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCLGAICG GLVKAFQK+Y+ +YGGGAN L DGYS GTGLGAEIIGTF
Sbjct  117  VSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTF  176

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  236

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             +DK WDD WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RSN
Sbjct  237  NQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  281



>ref|XP_008243934.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=284

 Score =   464 bits (1195),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 243/287 (85%), Positives = 261/287 (91%), Gaps = 7/287 (2%)
 Frame = +1

Query  88   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD E  G     + KDYQDPPPAPLID EELG+WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDSEVGGGHNRFSGKDYQDPPPAPLIDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ+D      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQSD-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSLVRA++YMVAQ LGAICG GLVKAFQKAY+ +YGGGANGL DGYS+GTGL AEIIGT
Sbjct  116  KVSLVRAILYMVAQSLGAICGVGLVKAFQKAYFTKYGGGANGLADGYSQGTGLAAEIIGT  175

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVI
Sbjct  176  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVI  235

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y  DKAWDDQWIFWVGPF+GAAIAA YHQY+LRAGA KALGS+RS++
Sbjct  236  YDNDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAGAVKALGSFRSSS  282



>ref|XP_008387595.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=285

 Score =   464 bits (1194),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 240/284 (85%), Positives = 259/284 (91%), Gaps = 2/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E    Y+A KDYQDPPP PLID EELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDTALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YM AQ LGAICG GLVKAFQ +YY +YGGGAN L DGYS GTGLGAEI+GTFV
Sbjct  119  SLVRAILYMTAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTGTGLGAEIVGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             DKAW+DQWIFWVGPF+GAAIAA+YHQY+LRAGA KALGS+RS+
Sbjct  239  NDKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFRSS  282



>ref|XP_009345759.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
 ref|XP_009345763.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=285

 Score =   464 bits (1194),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 241/284 (85%), Positives = 259/284 (91%), Gaps = 2/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E    Y+A KDYQDPPP PLID EELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YMVAQ LGAICG GLVKAFQ +YY +YGGGAN L DGYS  TGLGAEI+GTFV
Sbjct  119  SLVRAILYMVAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTSTGLGAEIVGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             DKAW+DQWIFWVGPF+GAAIAA+YHQY+LRAGA KALGS+RS+
Sbjct  239  NDKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFRSS  282



>gb|AFB83068.1| plasma intrinsic protein PIP2.2 [Helianthemum almeriense]
Length=281

 Score =   464 bits (1193),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 244/285 (86%), Positives = 261/285 (92%), Gaps = 6/285 (2%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAK+ E A E+ A KDY DPPPAPL D EELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKEAEAAGEFRA-KDYHDPPPAPLFDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ D    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQID----GGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  115

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YMVAQCLGAICGCGLVKAFQK++Y RYGG AN L  GYSKGTGLGAEIIGTFV
Sbjct  116  SLVRAILYMVAQCLGAICGCGLVKAFQKSHYSRYGG-ANELSGGYSKGTGLGAEIIGTFV  174

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  175  LVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  234

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             +KAWDDQWIFWVGPF+GAAIAA Y+QY+LRAGA KAL S+RS++
Sbjct  235  TEKAWDDQWIFWVGPFIGAAIAAFYYQYILRAGAVKALASFRSSS  279



>ref|XP_007207344.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
 gb|EMJ08543.1| hypothetical protein PRUPE_ppa009630mg [Prunus persica]
Length=284

 Score =   464 bits (1193),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 261/287 (91%), Gaps = 7/287 (2%)
 Frame = +1

Query  88   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+E  G     + KDYQDPPPAPLID EELG+WSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDIEVGGGQHRFSGKDYQDPPPAPLIDAEELGQWSFYRAIIAEFIATLLFLYITVLTV  60

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYKSQSE-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSLVRA++YMVAQ LGAICG GLVKAFQ AY+ +YGGGANGL DGYS+GTGL AEIIGT
Sbjct  116  KVSLVRAILYMVAQSLGAICGVGLVKAFQNAYFTKYGGGANGLADGYSQGTGLAAEIIGT  175

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVI
Sbjct  176  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVI  235

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y  DKAWDDQWIFWVGPF+GAAIAA YHQY+LRAGA KALGS+RS++
Sbjct  236  YNNDKAWDDQWIFWVGPFIGAAIAAFYHQYILRAGAVKALGSFRSSS  282



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score =   464 bits (1193),  Expect = 9e-160, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 259/285 (91%), Gaps = 5/285 (2%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDIEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYK QTD      D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKHQTDH----ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCLGAICG GLVKAFQK+Y+ +YGGGAN L DGYS GTGLGAEIIGTF
Sbjct  117  VSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTF  176

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  236

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             +DK WDD WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RSN
Sbjct  237  NQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  281



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   464 bits (1193),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 244/285 (86%), Positives = 260/285 (91%), Gaps = 4/285 (1%)
 Frame = +1

Query  88   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAK D EG +  A  KDY DPPPAPLID +EL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDAEGGSFSA--KDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCLGAICG GLVKAFQKAYY +YGGGAN L DGYS G GLGAEIIGTF
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNKYGGGANELSDGYSTGVGLGAEIIGTF  177

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  178  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  237

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             K+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RSN
Sbjct  238  NKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  282



>ref|XP_010032196.1| PREDICTED: aquaporin PIP2-1 [Eucalyptus grandis]
Length=284

 Score =   464 bits (1193),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 238/270 (88%), Positives = 251/270 (93%), Gaps = 0/270 (0%)
 Frame = +1

Query  130  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGTDE  309
            KDYQDPPPAPLIDP ELGKWSFYRA+IAEFIATLLFLY+TVLTVIGYKSQTD    GTD 
Sbjct  14   KDYQDPPPAPLIDPVELGKWSFYRALIAEFIATLLFLYITVLTVIGYKSQTDDKKPGTDA  73

Query  310  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCL  489
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MYMVAQCL
Sbjct  74   CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMVAQCL  133

Query  490  GAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRN  669
            GAICG GLVK FQK+YY +YGGGAN L +GY    GLGAEIIGTFVLVYTVF+ATDPKR+
Sbjct  134  GAICGVGLVKLFQKSYYEQYGGGANMLAEGYKTRVGLGAEIIGTFVLVYTVFSATDPKRS  193

Query  670  ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVG  849
            ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVG
Sbjct  194  ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVG  253

Query  850  PFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            PF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  254  PFIGAAIAAFYHQFILRAGAVKALGSFRSN  283



>gb|AEY75244.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=281

 Score =   463 bits (1192),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 241/286 (84%), Positives = 261/286 (91%), Gaps = 6/286 (2%)
 Frame = +1

Query  88   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVEGA     A KDY DPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEGAEHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ++      D+CGGVGILGIAWAFGGMIF+LVY TAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----ADQCGGVGILGIAWAFGGMIFVLVYYTAGISGGHINPAVTFGLFLARK  115

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RAV+Y++AQCLGAICG GLVKAFQK+YYV++GGGAN L  GY+KGTGLGAEIIGTF
Sbjct  116  VSLIRAVLYIIAQCLGAICGVGLVKAFQKSYYVKFGGGANELSAGYNKGTGLGAEIIGTF  175

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVIY  235

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             KDKAWDDQWIFW+GPF+GAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  236  NKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  281



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score =   464 bits (1193),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 243/290 (84%), Positives = 258/290 (89%), Gaps = 7/290 (2%)
 Frame = +1

Query  88   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            MAKD+E +     E++A KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASAPEGGEFSA-KDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVA  59

Query  256  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  432
            TVIGYK Q+D  V  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  433  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  612
            LARKVSL+RAV+Y++AQCLGAICG GLVK FQ +YY RYGGGAN L DGYSKGTGLGAEI
Sbjct  120  LARKVSLIRAVLYIIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLGAEI  179

Query  613  IGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA  792
            IGTFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARS GA
Sbjct  180  IGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGA  239

Query  793  AVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AVIY KDKAWDDQWIFWVGP +GAAIAA YHQYVLRA AAK LGSYRSNA
Sbjct  240  AVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSNA  288



>ref|XP_004304428.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   463 bits (1192),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 260/285 (91%), Gaps = 3/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKD+E    +AA KDY DPPP PLIDPEE GKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIE-VGGFAA-KDYHDPPPTPLIDPEEFGKWSFYRAIIAEFIATLLFLYITVLTVIG  58

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ+D  +KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  59   YKSQSD-TLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL RAVMY+VAQ LGAICGC LVK+FQ A Y  YGGGANGL DGY+KGTGL AEIIGTFV
Sbjct  118  SLPRAVMYIVAQSLGAICGCALVKSFQSALYTNYGGGANGLADGYNKGTGLAAEIIGTFV  177

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY 
Sbjct  178  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYN  237

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             +KAWDD WIFWVGPF+GAAIAA+YHQY+LRAGA KALGS+RS++
Sbjct  238  NEKAWDDHWIFWVGPFIGAAIAAMYHQYILRAGAVKALGSFRSSS  282



>gb|KJB20285.1| hypothetical protein B456_003G141600 [Gossypium raimondii]
Length=320

 Score =   464 bits (1195),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 243/293 (83%), Positives = 261/293 (89%), Gaps = 8/293 (3%)
 Frame = +1

Query  85   KMAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyv  246
             M KD+E      G  E++A KDYQDPPPAPLID EEL KWS YRA IAEFIATLLFLYV
Sbjct  29   NMTKDIETTAEQGGGAEFSA-KDYQDPPPAPLIDLEELTKWSLYRAAIAEFIATLLFLYV  87

Query  247  tvltvIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  423
            TVLTVIGYK QTDP     D +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF
Sbjct  88   TVLTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  147

Query  424  GLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLG  603
            GLF+ RKVSL+RA++YMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQDG++KGTGLG
Sbjct  148  GLFVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQKTYYNSYGGGANELQDGFNKGTGLG  207

Query  604  AEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS  783
            AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS
Sbjct  208  AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS  267

Query  784  FGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            FGAAVIY ++KAWDDQWIFWVGPF+GA +AA YHQY+LRA A KALGS+RSNA
Sbjct  268  FGAAVIYNQEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA  320



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   463 bits (1192),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 241/285 (85%), Positives = 258/285 (91%), Gaps = 4/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKDIEVAEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATMLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ D N    D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGN---ADPCNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RAVMYMVAQCLGAICG GLVKAFQK+YY +Y GGAN L DGYS GTGLGAEIIGTF
Sbjct  118  VSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYTKYQGGANILADGYSTGTGLGAEIIGTF  177

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  178  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  237

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
              +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  238  NNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKALGSFRSN  282



>ref|XP_007132257.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
 gb|ESW04251.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
Length=285

 Score =   463 bits (1191),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 243/287 (85%), Positives = 259/287 (90%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE     EYAA KDYQDPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGEYAA-KDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYK QTD NV GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IGYKRQTDANVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RA++Y+VAQC GAICG GL K FQKAYY RYGGGAN + DGY+KGT LGAEIIGT
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNKGTALGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y K+K WDDQWIFWVGP +GAA+AA YHQY+LRA A KALGS+RSNA
Sbjct  239  YNKEKIWDDQWIFWVGPIIGAAVAAFYHQYILRAAAIKALGSFRSNA  285



>ref|XP_004304426.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   463 bits (1191),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 241/285 (85%), Positives = 262/285 (92%), Gaps = 3/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M +D+E    +AA KDYQDPPP PLIDPEE GKWSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGRDIE-VGGFAA-KDYQDPPPTPLIDPEEFGKWSFYRAIIAEFVATLLFLYITVLTVIG  58

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ+D  +KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  59   YKSQSD-TLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL RAV+Y+VAQCLGAICGCGLVK+FQ A Y  YGGGANGL DGYS+GTGL AEIIGTFV
Sbjct  118  SLPRAVLYIVAQCLGAICGCGLVKSFQSALYSNYGGGANGLADGYSEGTGLAAEIIGTFV  177

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  178  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  237

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             +KAWDD WIFWVGPF+GAAIAA+YHQ +LRAGAAKA GS+RS++
Sbjct  238  NEKAWDDHWIFWVGPFIGAAIAALYHQNILRAGAAKASGSFRSSS  282



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   463 bits (1191),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 239/284 (84%), Positives = 259/284 (91%), Gaps = 2/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KDV     ++A KDY DPPPAPLIDP EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MTKDVPEQGSFSA-KDYHDPPPAPLIDPGELAKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKS TDP +   D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSTTDPALNA-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RA+MYMVAQCLGAICG GLVKAF K+ Y RYGGGAN L DGY+KGTGLGAEIIGTFV
Sbjct  119  SLIRAIMYMVAQCLGAICGVGLVKAFNKSLYNRYGGGANSLADGYNKGTGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            K+K WDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RS+
Sbjct  239  KEKIWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKALGSFRSS  282



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   463 bits (1191),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 241/286 (84%), Positives = 259/286 (91%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            M KD+E G     + KDY DPPP PLID EE GKWSFYRAIIAEFIATLLFLY+TVLTVI
Sbjct  1    MGKDIEVGPQGGFSAKDYNDPPPTPLIDAEEFGKWSFYRAIIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ+D  +KG D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSD-TLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL RAV+Y+VAQ LGAICGCGLVK+FQ A Y  YGGGANGL DGYSKGTGL AEIIGTF
Sbjct  120  VSLPRAVLYIVAQSLGAICGCGLVKSFQSALYTNYGGGANGLADGYSKGTGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
              +KAWDD WIFWVGPF+GAAIAA+YHQY+LRAGA KALGS+RS++
Sbjct  240  NNEKAWDDHWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFRSSS  285



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score =   463 bits (1191),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 258/285 (91%), Gaps = 5/285 (2%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYK QTD      D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKHQTDH----ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCL AICG GLVKAFQK+Y+ +YGGGAN L DGYS GTGLGAEIIGTF
Sbjct  117  VSLIRAIMYMVAQCLSAICGVGLVKAFQKSYFNKYGGGANSLADGYSTGTGLGAEIIGTF  176

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  236

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             +DK WDD WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RSN
Sbjct  237  NQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  281



>ref|XP_010456647.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=285

 Score =   462 bits (1190),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 240/287 (84%), Positives = 261/287 (91%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAP--KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD++   E  AP  +DY+DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV+VLTV
Sbjct  1    MAKDLD-VQEGGAPAARDYKDPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  60   IGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSLVR V+Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGT
Sbjct  119  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y K+KAWDDQWIFWVGP +GAA AA+YHQ++LRA A KALGS+RSNA
Sbjct  239  YNKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALGSFRSNA  285



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   462 bits (1190),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 239/285 (84%), Positives = 256/285 (90%), Gaps = 5/285 (2%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KDVE + +  + KDY DPPPAPLIDP+EL +WS YRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MTKDVETSGQEFSNKDYHDPPPAPLIDPDELTQWSLYRAIIAEFIATLLFLYITVLTVIG  60

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ+D     TD CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQSD-----TDPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  115

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA+MYM+AQCLGA+CG GLVKAFQ + Y RYGGGAN L  GY+KG GLGAEIIGTFV
Sbjct  116  SLVRALMYMIAQCLGAVCGVGLVKAFQSSLYNRYGGGANELAGGYNKGVGLGAEIIGTFV  175

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  176  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  235

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             DKAWDD W+FWVGPF+GAAIAA YHQY+LRA A KALGS+RSNA
Sbjct  236  NDKAWDDHWMFWVGPFIGAAIAAFYHQYILRAAAIKALGSFRSNA  280



>ref|XP_009367074.1| PREDICTED: aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=288

 Score =   462 bits (1190),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 244/294 (83%), Positives = 265/294 (90%), Gaps = 15/294 (5%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+EGA   E+A  KDYQDPPP PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDIEGAEHGEFAT-KDYQDPPPTPLFDAEELTKWSFYRAVIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTA-------GISGGHINPAVT  420
            IGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTA        I+GGHINPAVT
Sbjct  60   IGYKSQSE-----VDQCGGVGILGIAWAFGGMIFVLVYCTAPPSCFSMTIAGGHINPAVT  114

Query  421  FGLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGL  600
            FGLFLARKVSL+RAV+Y+VAQCLGAICG GLVKAFQK+YYV+YGGGAN L DGY+KGTGL
Sbjct  115  FGLFLARKVSLIRAVLYIVAQCLGAICGVGLVKAFQKSYYVKYGGGANELADGYNKGTGL  174

Query  601  GAEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPAR  780
            GAEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPAR
Sbjct  175  GAEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPAR  234

Query  781  SFGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            SFGAAVIY KDKAWDDQWIFW+GPF+GAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  235  SFGAAVIYNKDKAWDDQWIFWLGPFIGAAIAAFYHQYILRAGAIKALGSFRSNA  288



>ref|XP_009342858.1| PREDICTED: probable aquaporin PIP2-5 isoform X1 [Pyrus x bretschneideri]
Length=285

 Score =   462 bits (1190),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 241/284 (85%), Positives = 259/284 (91%), Gaps = 2/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E    Y+A KDYQD PP PLID EELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDLPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YMVAQ LGAICG GLVKAFQ +YY +YGGGAN L DGYS GTGLGAEI+GTFV
Sbjct  119  SLVRAILYMVAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTGTGLGAEIVGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             DKAW+DQWIFWVGPF+GAAIAA+YHQY+LRAGA KALGS+RS+
Sbjct  239  NDKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFRSS  282



>gb|KJB62459.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=285

 Score =   462 bits (1189),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 236/285 (83%), Positives = 260/285 (91%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKD+E   E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK+QTDP  KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKTQTDP-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA+ YM AQCLGAICGCGLVKAFQ +YY +YGGGAN L +GYS GTGL AEIIGTFV
Sbjct  119  SLVRAIFYMGAQCLGAICGCGLVKAFQNSYYNQYGGGANSLAEGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+ 
Sbjct  179  LVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            +DK WDD WIFWVGPF+GAAIAA+YHQ++LRA  AKALGS+RS++
Sbjct  239  QDKIWDDHWIFWVGPFIGAAIAAIYHQFILRASGAKALGSFRSSS  283



>ref|XP_009342865.1| PREDICTED: probable aquaporin PIP2-5 isoform X2 [Pyrus x bretschneideri]
Length=285

 Score =   462 bits (1189),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 241/284 (85%), Positives = 259/284 (91%), Gaps = 2/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E    Y+A KDYQD PP PLID EELGKWSFYRAIIAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDIEIGGGYSA-KDYQDLPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDAALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YMVAQ LGAICG GLVKAFQ +YY +YGGGAN L DGYS GTGLGAEI+GTFV
Sbjct  119  SLVRAILYMVAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTGTGLGAEIVGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             DKAW+DQWIFWVGPF+GAAIAA+YHQY+LRAGA KALGS+RS+
Sbjct  239  NDKAWNDQWIFWVGPFIGAAIAALYHQYILRAGAVKALGSFRSS  282



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   462 bits (1189),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 241/286 (84%), Positives = 259/286 (91%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E   +   P KDY DPPPAPL D  ELG+WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEAEPQGGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GY +QTDP   GT+ C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNAQTDPAHNGTN-CDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RAV+YMVAQCLGAICG GLVKAFQK YY RY GGAN L  GYSKGTGLGAEIIGTF
Sbjct  120  VSLIRAVLYMVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
              +KAWDDQWIFWVGPF+GAAIAA+YHQ+VLRA AAKALGS+RS++
Sbjct  240  NNEKAWDDQWIFWVGPFIGAAIAAIYHQFVLRAQAAKALGSFRSSS  285



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   462 bits (1189),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 242/290 (83%), Positives = 257/290 (89%), Gaps = 7/290 (2%)
 Frame = +1

Query  88   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            MAKD+E +     E++A KDY DPPPAPLID EEL KWS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASAPEGGEFSA-KDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVA  59

Query  256  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  432
            TVIGYK Q+D  V  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  433  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  612
            LARKVSL+RAV+Y++AQCLGAICG GLVK FQ +YY RYGGGAN L DGYSKGTGLGAEI
Sbjct  120  LARKVSLIRAVLYIIAQCLGAICGVGLVKGFQSSYYARYGGGANELSDGYSKGTGLGAEI  179

Query  613  IGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA  792
            IGTFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARS G 
Sbjct  180  IGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGT  239

Query  793  AVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AVIY KDKAWDDQWIFWVGP +GAAIAA YHQYVLRA AAK LGSYRSNA
Sbjct  240  AVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSNA  288



>gb|AHA84284.1| prolactin-inducible protein [Phaseolus vulgaris]
Length=285

 Score =   462 bits (1188),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 242/287 (84%), Positives = 259/287 (90%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE     EYAA KDYQDPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGEYAA-KDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYK QTD NV GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IGYKRQTDANVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RA++Y+VAQC GAICG GL K FQKAYY RYGGGAN + DGY+KGT LGAEIIGT
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNKGTALGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPK+NARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  179  FVLVYTVFSATDPKKNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y K+K WDDQWIFWVGP +GAA+AA YHQY+LRA A KALGS+RSNA
Sbjct  239  YNKEKIWDDQWIFWVGPIIGAAVAAFYHQYILRAAAIKALGSFRSNA  285



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   462 bits (1188),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 259/285 (91%), Gaps = 4/285 (1%)
 Frame = +1

Query  88   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAK DVEG +  A  KDY DPPPAPLID EEL +WSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVI  58

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCLGAICG GLVKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTF
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTF  177

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV+Y
Sbjct  178  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVMY  237

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             + KAWDD WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RSN
Sbjct  238  NQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  282



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score =   462 bits (1188),  Expect = 6e-159, Method: Compositional matrix adjust.
 Identities = 241/285 (85%), Positives = 256/285 (90%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E G     + KDYQDPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVGERGSFSAKDYQDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQTDP     D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDPATNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAVMYMVAQ LGAI G  LVKAFQK+YY++YGGGAN L DGYS G GL AEIIGTF
Sbjct  120  VSLVRAVMYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYSTGVGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  240  NKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score =   462 bits (1188),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 241/285 (85%), Positives = 258/285 (91%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E A   + + KDY DPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVAERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQTDP V   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDPAVNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAV+YMVAQ LGAI G  LVKAFQK+YY++YGGGAN L DGYS G GLGAEIIGTF
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYSTGVGLGAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  240  NKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   462 bits (1188),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 244/293 (83%), Positives = 263/293 (90%), Gaps = 10/293 (3%)
 Frame = +1

Query  88   MAKDVE------GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvt  249
            M KD+E      G  E++A KDY DPPPAPLID EEL KWS YRA IAEFIATLLFLYVT
Sbjct  1    MTKDIETTAEQGGGAEFSA-KDYHDPPPAPLIDMEELTKWSLYRAAIAEFIATLLFLYVT  59

Query  250  vltvIGYKSQTDPNVKGTDE--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  423
            VLTVIGYK QTDP VK T++  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF
Sbjct  60   VLTVIGYKVQTDP-VKNTNDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  118

Query  424  GLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLG  603
            GLF+ RKVSL+RA++YMVAQCLGAICGCGLVKAFQK YY  YGGGAN LQDG++KGTGLG
Sbjct  119  GLFVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQKTYYNSYGGGANELQDGFNKGTGLG  178

Query  604  AEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS  783
            AEIIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS
Sbjct  179  AEIIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS  238

Query  784  FGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            FGAAVIY ++KAWDDQWIFWVGPF+GA +AA YHQY+LRA A KALGS+RSNA
Sbjct  239  FGAAVIYNQEKAWDDQWIFWVGPFIGAFVAAFYHQYILRAAAIKALGSFRSNA  291



>ref|XP_006428786.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
 gb|ESR42026.1| hypothetical protein CICLE_v10012379mg [Citrus clementina]
Length=287

 Score =   461 bits (1187),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 250/287 (87%), Positives = 265/287 (92%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+E  G  E+ A KDY DPPPAPLID EEL KWSFYRAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDIEVGGQGEFHA-KDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDAN-HGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSLVRAVMYMVAQCLGAICGCGLVKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGT
Sbjct  119  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRA A+KALGS++S++
Sbjct  239  YKKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSS  285



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   461 bits (1187),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 260/285 (91%), Gaps = 4/285 (1%)
 Frame = +1

Query  88   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAK DVEG +  A  KDY DPPPAPLID EEL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCLGA+CG GLVKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTF
Sbjct  118  VSLIRAIMYMVAQCLGAMCGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTF  177

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAV+Y
Sbjct  178  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVMY  237

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             + KAWDDQWIFWVGPF+GAAIAA YHQ++LRA AAKA+GS+RSN
Sbjct  238  NQKKAWDDQWIFWVGPFIGAAIAAFYHQFILRASAAKAVGSFRSN  282



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   461 bits (1186),  Expect = 9e-159, Method: Compositional matrix adjust.
 Identities = 243/285 (85%), Positives = 259/285 (91%), Gaps = 4/285 (1%)
 Frame = +1

Query  88   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAK DVEG +  A  KDY DPPPAPLID EEL +WSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVI  58

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCLGAICG GLVKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTF
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTF  177

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV+Y
Sbjct  178  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVMY  237

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             + KAWDD WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RSN
Sbjct  238  NQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  282



>gb|AFK33316.1| unknown [Medicago truncatula]
Length=287

 Score =   461 bits (1186),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 241/284 (85%), Positives = 257/284 (90%), Gaps = 2/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E   +   P KDY DPPPAPL D  ELG+WSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEAEPQGGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GY +QTDP   GT+ C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNAQTDPAHNGTN-CDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RAV+YMVAQCLGAICG GLVKAFQK YY RY GGAN L  GYSKGTGLGAEIIGTF
Sbjct  120  VSLIRAVLYMVAQCLGAICGVGLVKAFQKGYYNRYKGGANMLSAGYSKGTGLGAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRS  936
              +KAWDDQWIFWVGPF+GAAIAA+YHQ+VLRA AAKALGS+RS
Sbjct  240  NNEKAWDDQWIFWVGPFIGAAIAAIYHQFVLRAQAAKALGSFRS  283



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   461 bits (1186),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 244/289 (84%), Positives = 259/289 (90%), Gaps = 6/289 (2%)
 Frame = +1

Query  88   MAKDVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            M KDVE     A EY+A KDY DPPPAPLID +EL  WSFYRA+IAEF+ATLLFLYVTVL
Sbjct  1    MTKDVESHVEPAEEYSA-KDYHDPPPAPLIDFDELSSWSFYRALIAEFVATLLFLYVTVL  59

Query  256  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  435
            TVIGYKSQ DP   G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL
Sbjct  60   TVIGYKSQIDP-AHGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFL  118

Query  436  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  615
             RKVSL+RAV+YMVAQCLGAICG GLVKAFQK+YY +YGGGAN L  GY+KG GLGAEII
Sbjct  119  GRKVSLIRAVLYMVAQCLGAICGVGLVKAFQKSYYHKYGGGANELAPGYNKGVGLGAEII  178

Query  616  GTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA  795
            GTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA
Sbjct  179  GTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA  238

Query  796  VIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            VIY +DK WDD WIFWVGPFVGA IAA+YHQY+LRAGA KALGS+RSNA
Sbjct  239  VIYNEDKPWDDHWIFWVGPFVGALIAAIYHQYILRAGAIKALGSFRSNA  287



>ref|NP_001105026.1| aquaporin PIP2-4 [Zea mays]
 sp|Q9ATM6.1|PIP24_MAIZE RecName: Full=Aquaporin PIP2-4; AltName: Full=Plasma membrane 
intrinsic protein 2-4; AltName: Full=ZmPIP2-4; AltName: Full=ZmPIP2;4 
[Zea mays]
 gb|AAK26761.1| plasma membrane integral protein ZmPIP2-4 [Zea mays]
 gb|ACN28082.1| unknown [Zea mays]
 gb|AFW72774.1| plasma membrane intrinsic protein2 [Zea mays]
Length=288

 Score =   461 bits (1186),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 244/290 (84%), Positives = 258/290 (89%), Gaps = 7/290 (2%)
 Frame = +1

Query  88   MAKDVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            MAKD+E     A E++A KDY DPPPAPLID EEL +WS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASGPEAGEFSA-KDYTDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVA  59

Query  256  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  432
            TVIGYK QTD +  G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  433  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  612
            LARKVSLVRA++Y++AQCLGAICG GLVK FQ AYYVRYGGGAN L DGYSKGTGL AEI
Sbjct  120  LARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEI  179

Query  613  IGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA  792
            IGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA
Sbjct  180  IGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGA  239

Query  793  AVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AVIY KDKAWDDQWIFWVGP +GAAIAA YHQYVLRA A K LGSYRSNA
Sbjct  240  AVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK-LGSYRSNA  288



>gb|ACG33001.1| aquaporin PIP2.2 [Zea mays]
Length=288

 Score =   461 bits (1185),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 244/290 (84%), Positives = 258/290 (89%), Gaps = 7/290 (2%)
 Frame = +1

Query  88   MAKDVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            MAKD+E     A E++A KDY DPPPAPL+D EEL +WS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASGPEAGEFSA-KDYTDPPPAPLVDAEELTQWSLYRAVIAEFIATLLFLYITVA  59

Query  256  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  432
            TVIGYK QTD +  G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  433  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  612
            LARKVSLVRA++Y+VAQCLGAICG GLVK FQ AYYVRYGGGAN L DGYSKGTGL AEI
Sbjct  120  LARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEI  179

Query  613  IGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA  792
            IGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA
Sbjct  180  IGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGA  239

Query  793  AVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AVIY KDKAWDDQWIFWVGP +GAAIAA YHQYVLRA A K LGSYRSNA
Sbjct  240  AVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK-LGSYRSNA  288



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   461 bits (1185),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 241/285 (85%), Positives = 258/285 (91%), Gaps = 4/285 (1%)
 Frame = +1

Query  88   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAK DVEG +   A KDY DPPPAPLID EEL +WSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKHDVEGGS--FAAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVI  58

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCLGAICG GLVKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTF
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTF  177

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV+Y
Sbjct  178  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVMY  237

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             + KAWDD WIFWVGPF+GAAIAA YHQ++LRA AAKALGS+RSN
Sbjct  238  NQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRASAAKALGSFRSN  282



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score =   461 bits (1185),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 244/286 (85%), Positives = 257/286 (90%), Gaps = 4/286 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE  TE  +   KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVE-VTERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYK Q+D    G D CGGVGILGIAWAFGGMIFILVY TAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKHQSDLKDHG-DACGGVGILGIAWAFGGMIFILVYWTAGISGGHINPAVTFGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RA+MYMVAQCLGAICG GLVKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGT
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVGLVKAFQKSYYNRYGGGANSLADGYSTGTGLGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            Y KDK WDD WIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  239  YNKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score =   460 bits (1184),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 261/287 (91%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+  A +  Y+A KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+T+LTV
Sbjct  1    MAKDMGVAEQGSYSA-KDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ DP VK  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RAVMY+VAQCLGAICG  LVKAFQ+AYY RYGGGAN +  GY+KGT LGAEIIGT
Sbjct  119  KVSLIRAVMYIVAQCLGAICGVALVKAFQRAYYDRYGGGANEVAPGYNKGTALGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI
Sbjct  179  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y + KAWDD WIFWVGPFVGA IAA YHQ++LRA A KALGS+RSNA
Sbjct  239  YNQKKAWDDHWIFWVGPFVGAVIAAFYHQFILRAAAIKALGSFRSNA  285



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score =   460 bits (1184),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 241/285 (85%), Positives = 258/285 (91%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GY  QTD    G + CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNHQTDLKENG-EICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCLGAICG GLVKAFQK+Y+ +YGGGAN L  GYS GTGLGAEIIGTF
Sbjct  120  VSLIRAIMYMVAQCLGAICGVGLVKAFQKSYFNKYGGGANSLAAGYSTGTGLGAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             +DK WDD WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RSN
Sbjct  240  NQDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  284



>gb|KCW51592.1| hypothetical protein EUGRSUZ_J01087 [Eucalyptus grandis]
Length=383

 Score =   464 bits (1194),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 238/270 (88%), Positives = 251/270 (93%), Gaps = 0/270 (0%)
 Frame = +1

Query  130  KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPNVKGTDE  309
            KDYQDPPPAPLIDP ELGKWSFYRA+IAEFIATLLFLY+TVLTVIGYKSQTD    GTD 
Sbjct  113  KDYQDPPPAPLIDPVELGKWSFYRALIAEFIATLLFLYITVLTVIGYKSQTDDKKPGTDA  172

Query  310  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAVMYMVAQCL  489
            CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA+MYMVAQCL
Sbjct  173  CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRAIMYMVAQCL  232

Query  490  GAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVFAATDPKRN  669
            GAICG GLVK FQK+YY +YGGGAN L +GY    GLGAEIIGTFVLVYTVF+ATDPKR+
Sbjct  233  GAICGVGLVKLFQKSYYEQYGGGANMLAEGYKTRVGLGAEIIGTFVLVYTVFSATDPKRS  292

Query  670  ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWDDQWIFWVG  849
            ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY KDKAWDDQWIFWVG
Sbjct  293  ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYNKDKAWDDQWIFWVG  352

Query  850  PFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            PF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  353  PFIGAAIAAFYHQFILRAGAVKALGSFRSN  382



>ref|XP_009413714.1| PREDICTED: aquaporin PIP2-4-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=287

 Score =   460 bits (1184),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 244/288 (85%), Positives = 254/288 (88%), Gaps = 4/288 (1%)
 Frame = +1

Query  88   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD E  G  EY   KDY DPPPAPLID EEL KWS YRA IAEF+AT+LFLYVTV TV
Sbjct  1    MAKDTEVAGRGEYGG-KDYTDPPPAPLIDAEELTKWSLYRAAIAEFVATMLFLYVTVATV  59

Query  262  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            IGYK Q+DPNV   D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLA
Sbjct  60   IGYKHQSDPNVNPADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLA  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRA++YMVAQCLGAICG GLVK FQ+AY+VRYGGGAN L  GYSKGTGL AEIIG
Sbjct  120  RKVSLVRALLYMVAQCLGAICGVGLVKGFQEAYFVRYGGGANELSAGYSKGTGLAAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAV
Sbjct  180  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY +DKAWDDQWIFWVGPFVGAAIAA YHQYVLRA  AKA+GS+ SNA
Sbjct  240  IYNQDKAWDDQWIFWVGPFVGAAIAAAYHQYVLRASGAKAMGSFGSNA  287



>ref|NP_001274381.1| aquaporin PIP2-7-like [Cucumis sativus]
 gb|AHB33480.1| plasma intrinsic protein 2-4 [Cucumis sativus]
 gb|KGN46837.1| hypothetical protein Csa_6G140850 [Cucumis sativus]
Length=283

 Score =   460 bits (1183),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 243/286 (85%), Positives = 256/286 (90%), Gaps = 4/286 (1%)
 Frame = +1

Query  88   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            M KDVE A +     KDYQDPPPAPLIDPEEL KWS YRA IAEFIATLLFLYVTVLTVI
Sbjct  1    MGKDVEVAEQGEFQSKDYQDPPPAPLIDPEELTKWSLYRAAIAEFIATLLFLYVTVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GY   +       D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GY---SHGRATDADPCSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRA++Y++AQC GAICGCGLVKAFQ AYYVRY GGAN L DGY+KGTGLGAEIIGTF
Sbjct  118  VSLVRALLYIIAQCAGAICGCGLVKAFQSAYYVRYNGGANMLSDGYNKGTGLGAEIIGTF  177

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+
Sbjct  178  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIF  237

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             K+KAWDDQWIFWVGPF+GAAIAA+YHQYVLRAGA KALGS+RSNA
Sbjct  238  NKEKAWDDQWIFWVGPFIGAAIAAIYHQYVLRAGAIKALGSFRSNA  283



>gb|AHK05706.1| plasma membrane intrinsic protein PIP2;3 [Hevea brasiliensis]
Length=285

 Score =   460 bits (1183),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 242/284 (85%), Positives = 253/284 (89%), Gaps = 2/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KDV     + A KDY DPPPAPLID  EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MVKDVTEQGSFPA-KDYHDPPPAPLIDAVELTKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTDP  K  D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDP-AKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAVMYMVAQCLGAI G GLVKAFQ ++Y RYGGGAN L  GYSKG GLGAEIIGTFV
Sbjct  119  SLVRAVMYMVAQCLGAIAGVGLVKAFQSSFYKRYGGGANSLAAGYSKGVGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            +DK WDD WIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  239  QDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  282



>emb|CDX10333.1| aquaporin [Coffea arabica]
Length=288

 Score =   460 bits (1183),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 239/287 (83%), Positives = 261/287 (91%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+ G  E+ +   KDY DPPPAPLID EEL KWSF+RAIIAEFIATLLFLY+TVLTV
Sbjct  1    MAKDM-GVAEHGSFTTKDYHDPPPAPLIDLEELTKWSFFRAIIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ D   +G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQIDVAHQG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL RA+ YMVAQC+GAICG GLVKAFQ++YYV YGGGAN LQDGYS GTGL AEIIGT
Sbjct  119  KVSLTRALAYMVAQCVGAICGVGLVKAFQRSYYVTYGGGANQLQDGYSTGTGLAAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKR+ARDSHVP+LAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI
Sbjct  179  FVLVYTVFSATDPKRSARDSHVPILAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RS++
Sbjct  239  YNKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSSS  285



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score =   460 bits (1183),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 257/285 (90%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E A   + + KDY DPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVAERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQTDP V   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDPAVNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAV+YMVAQ LGAI G  LVKAFQK+YY++YGGGAN L DGYS G GL AEIIGTF
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYIKYGGGANSLSDGYSTGVGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  240  NKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score =   460 bits (1183),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 240/289 (83%), Positives = 261/289 (90%), Gaps = 6/289 (2%)
 Frame = +1

Query  88   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            MAK+VE       E++A KDY DPPPAPL+D  EL KWSFYRAIIAEFIATLLFLY+TVL
Sbjct  1    MAKEVEETVVTEQEFSA-KDYHDPPPAPLVDAVELTKWSFYRAIIAEFIATLLFLYITVL  59

Query  256  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  435
            TVIGYKSQTDP +K  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL
Sbjct  60   TVIGYKSQTDP-IKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  118

Query  436  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  615
            ARKVSL+RA++YMVAQC GAICG GLVKAFQ+AYY RYGGGAN +  GY+KGT LGAEII
Sbjct  119  ARKVSLIRALLYMVAQCSGAICGVGLVKAFQRAYYDRYGGGANEVAPGYNKGTALGAEII  178

Query  616  GTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA  795
            GTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAA
Sbjct  179  GTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAA  238

Query  796  VIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            VIY + KAWDD WIFWVGPFVGAAIAA YHQ++LRA A KALGS+RSNA
Sbjct  239  VIYNQKKAWDDHWIFWVGPFVGAAIAAFYHQFILRAAAIKALGSFRSNA  287



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score =   459 bits (1182),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 242/285 (85%), Positives = 258/285 (91%), Gaps = 4/285 (1%)
 Frame = +1

Query  88   MAK-DVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAK DVEG +  A  KDY DPPPAPLID EEL +WS YRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKHDVEGGSFSA--KDYHDPPPAPLIDAEELTQWSLYRALIAEFIATLLFLYITVLTVI  58

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  59   GYKSQSDVKAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCLGAICG GLVKAFQKAYY RYGGGAN L +GYS G GLGAEIIGTF
Sbjct  118  VSLIRAIMYMVAQCLGAICGVGLVKAFQKAYYNRYGGGANELSEGYSTGVGLGAEIIGTF  177

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAV+Y
Sbjct  178  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVVY  237

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             + KAWDD WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RSN
Sbjct  238  NQQKAWDDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSN  282



>ref|XP_009387242.1| PREDICTED: aquaporin PIP2-5 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   459 bits (1181),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 240/286 (84%), Positives = 253/286 (88%), Gaps = 4/286 (1%)
 Frame = +1

Query  88   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE  G  EY   KDY DPPP PL+D EEL KWS YRA IAEF+AT+LFLYVTV TV
Sbjct  1    MAKDVEAGGRGEYGG-KDYSDPPPEPLVDAEELTKWSLYRAAIAEFVATMLFLYVTVATV  59

Query  262  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            IGYK Q+DP V  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   IGYKHQSDPAVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RK+SLVRA++YM+AQCLGAICG GLVK FQ AYYVRYGGGAN L DGYSKGTGL AEIIG
Sbjct  120  RKISLVRALLYMIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  180  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRS  936
            IY KDKAWDDQW+FWVGPF+GAA+AA YHQY+LRA  AKALGS  S
Sbjct  240  IYNKDKAWDDQWMFWVGPFIGAAVAAAYHQYILRASGAKALGSSSS  285



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   459 bits (1181),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 238/287 (83%), Positives = 259/287 (90%), Gaps = 3/287 (1%)
 Frame = +1

Query  88   MAKD--VEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD  V+     AA +DY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV+VLTV
Sbjct  1    MAKDLDVQEGGAPAAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLTV  60

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  61   IGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  119

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSLVR V+Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGT
Sbjct  120  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  179

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y ++KAWDDQWIFWVGP +GAA AA+YHQ++LRA A KALGS+RS+A
Sbjct  240  YNQEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALGSFRSSA  286



>ref|XP_008449253.1| PREDICTED: aquaporin PIP2-2-like isoform X3 [Cucumis melo]
Length=284

 Score =   459 bits (1180),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 240/284 (85%), Positives = 255/284 (90%), Gaps = 3/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M+KD+E      A KDYQDPPPAPLID EEL +WSFYRAIIAEF+ATLLFLYVTVLTVIG
Sbjct  1    MSKDLEAGGF--AVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLTVIG  58

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            Y SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  59   YSSQSDTK-SGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RA++YM AQCLGAICGC LVK+FQKA Y  YGGGAN L DGYS GTGL AEIIGTFV
Sbjct  118  SLIRAILYMAAQCLGAICGCALVKSFQKALYNGYGGGANSLADGYSTGTGLAAEIIGTFV  177

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  178  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  237

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            KDKAWDDQWIFWVGPF+GAAIAA+YHQ VLRAGA KALGS+RS+
Sbjct  238  KDKAWDDQWIFWVGPFIGAAIAAIYHQIVLRAGAVKALGSFRSS  281



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score =   459 bits (1180),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 240/286 (84%), Positives = 252/286 (88%), Gaps = 3/286 (1%)
 Frame = +1

Query  88   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            M KDVE A E      KDY DPPPA LID EE+ KWS YRA+IAEFIATLLFLY+TV TV
Sbjct  1    MGKDVEAAAEGGEFTAKDYTDPPPAALIDAEEMIKWSLYRAVIAEFIATLLFLYITVATV  60

Query  262  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            IGYK Q+DPNV G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRA++YM+AQCLGAICG GLVK FQ+AYY RYGGGAN L  GYSKGTGL AEIIG
Sbjct  121  RKVSLVRALLYMIAQCLGAICGVGLVKGFQRAYYDRYGGGANELSSGYSKGTGLAAEIIG  180

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAV
Sbjct  181  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAV  240

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRS  936
            IY  +KAWDDQWIFWVGPF+GAAIAA YHQYVLRA A KALGS+RS
Sbjct  241  IYNNEKAWDDQWIFWVGPFIGAAIAAAYHQYVLRASAGKALGSFRS  286



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score =   459 bits (1180),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 242/288 (84%), Positives = 256/288 (89%), Gaps = 5/288 (2%)
 Frame = +1

Query  88   MAKDVEGAT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKDVE      EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            +IGYK QTD  V GTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQTDTTVGGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RA++YMVAQC GAICG GL K FQKAYY RYGGGAN + DGY+ GT LGAEIIG
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIG  178

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  179  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  238

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY +DK WDDQWIFWVGP VGAA+AA YHQY+LRA A KALGS+RSNA
Sbjct  239  IYNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFRSNA  286



>ref|XP_010443868.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   459 bits (1180),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 239/288 (83%), Positives = 260/288 (90%), Gaps = 5/288 (2%)
 Frame = +1

Query  88   MAKDVEGATEYAAP---KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKD++   E  AP   +DY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV+VLT
Sbjct  1    MAKDLD-VQEGGAPAPSRDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            VIGYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLA
Sbjct  60   VIGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLA  118

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVR V+Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIG
Sbjct  119  RKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIG  178

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  179  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  238

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY K+KAWDDQWIFWVGP +GAA AA+YHQ++LRA A KALGS+RS+A
Sbjct  239  IYNKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALGSFRSSA  286



>gb|AAL49752.1|AF452014_1 aquaporin-like protein [Petunia x hybrida]
Length=286

 Score =   459 bits (1180),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 239/284 (84%), Positives = 255/284 (90%), Gaps = 2/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAK+V G+      KDYQDPPPAPLIDP EL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKNV-GSEGSFTTKDYQDPPPAPLIDPAELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKS++DP  K  D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSESDP-AKNADPCSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RAVMYMVAQCLGAICG GLVKAFQ AYY RY GGAN L DGYSK  GL AEIIGTFV
Sbjct  119  SLIRAVMYMVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDGYSKSVGLSAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+ 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            +DKAW D WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RS+
Sbjct  239  QDKAWKDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSS  282



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   459 bits (1180),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 240/284 (85%), Positives = 256/284 (90%), Gaps = 4/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E A   + + KDY DPPPAPL D +EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEVAEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ D N    D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGN---ADSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RAVMYMVAQCLGAICG GLVKAFQK+YY RYGGGAN L DG+S GTGLGAEIIGTF
Sbjct  118  VSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYKRYGGGANTLADGFSTGTGLGAEIIGTF  177

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  178  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  237

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRS  936
             +DKAWDD WIFWVGPF GAAIAA YHQ++LRAGA KALGS+RS
Sbjct  238  NQDKAWDDHWIFWVGPFAGAAIAAFYHQFILRAGAVKALGSFRS  281



>ref|XP_009143524.1| PREDICTED: aquaporin PIP2-2 [Brassica rapa]
Length=285

 Score =   459 bits (1180),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 239/285 (84%), Positives = 254/285 (89%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKDVEGA  +AA +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGFAA-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + K WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  239  ESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   459 bits (1180),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 242/288 (84%), Positives = 256/288 (89%), Gaps = 5/288 (2%)
 Frame = +1

Query  88   MAKDVEGAT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKDVE      EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            +IGYK QTD  + GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQTDATLGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RA++YMVAQC GAICG GL K FQKAYY RYGGGAN + DGY+ GT LGAEIIG
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIG  178

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  179  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  238

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY KDK WDDQWIFWVGP VGAA+AA YHQY+LRA A KALGS+RSNA
Sbjct  239  IYNKDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFRSNA  286



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   458 bits (1179),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 242/288 (84%), Positives = 256/288 (89%), Gaps = 5/288 (2%)
 Frame = +1

Query  88   MAKDVEGAT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKDVE      EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            +IGYK QTD  V GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQTDTTVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RA++YMVAQC GAICG GL K FQKAYY RYGGGAN + DGY+ GT LGAEIIG
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIG  178

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  179  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  238

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY +DK WDDQWIFWVGP VGAA+AA YHQY+LRA A KALGS+RSNA
Sbjct  239  IYNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFRSNA  286



>ref|XP_002311092.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
 gb|ABK95655.1| unknown [Populus trichocarpa]
 gb|EEE88459.1| plasma membrane intrinsic protein 1-1 [Populus trichocarpa]
Length=285

 Score =   458 bits (1179),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 255/285 (89%), Gaps = 4/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD E A   + + KDYQDPPPAPLID EEL KWSFYRA+IAEFIAT+LFLY+TVLTVI
Sbjct  1    MAKDTEVAEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATMLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ D N    D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGN---ADPCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RAVMYMVAQC GAICG GLVKAFQK+YY +Y GGAN L DGYS GTGLGAEIIGTF
Sbjct  118  VSLIRAVMYMVAQCAGAICGVGLVKAFQKSYYTKYNGGANVLADGYSTGTGLGAEIIGTF  177

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  178  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  237

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
               KAW DQWIFW GPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  238  NNKKAWHDQWIFWAGPFIGAAIAAFYHQFILRAGAIKALGSFRSN  282



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score =   458 bits (1179),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 241/288 (84%), Positives = 256/288 (89%), Gaps = 5/288 (2%)
 Frame = +1

Query  88   MAKDVEGAT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKDVE      EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            +IGYK QTD  + GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQTDATLGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RA++YMVAQC GAICG GL K FQK+YY RYGGGAN + DGY+ GT LGAEIIG
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTGLAKGFQKSYYNRYGGGANSVADGYNNGTALGAEIIG  178

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  179  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  238

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY KDK WDDQWIFWVGP VGAA+AA YHQY+LRA A KALGS+RSNA
Sbjct  239  IYNKDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFRSNA  286



>ref|XP_006481455.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score =   458 bits (1179),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 247/287 (86%), Positives = 264/287 (92%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+E  G  E+ A KDY DPPPAPLID EEL +WSFYRA IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDIEIGGQGEFHA-KDYHDPPPAPLIDAEELTQWSFYRATIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDAN-HGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSLVRAVMYMVAQCLGAICGCGLVKAFQK+YY RYGGGAN L DGYS GTGLGAEIIGT
Sbjct  119  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGTGLGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y K+KAWDDQWIFWVGPF+GAAIAA YHQ++LRA A+KALGS++S++
Sbjct  239  YSKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSS  285



>gb|ABO69705.2| aquaporin PIP2 [Prunus humilis]
Length=281

 Score =   457 bits (1177),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 243/287 (85%), Positives = 259/287 (90%), Gaps = 8/287 (3%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVEGA   E+AA KDY DPPP P  D EEL KWSFYRA+IAEF+ATLLFLYVTVLTV
Sbjct  1    MAKDVEGAEHGEFAA-KDYHDPPPTPFFDAEELTKWSFYRALIAEFVATLLFLYVTVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ+       D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQSS-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL RAV+Y+VAQ LGAICG GLVKAFQK YY  YGGGAN L  GY+KGTGLGAEIIGT
Sbjct  115  KVSLPRAVLYIVAQSLGAICGVGLVKAFQKTYYEEYGGGANELAAGYNKGTGLGAEIIGT  174

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVI
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  234

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y KDKAWDDQWIFW+GPF+GAAIAA+YHQY+LRAGA KALGS+RSNA
Sbjct  235  YNKDKAWDDQWIFWLGPFIGAAIAALYHQYILRAGAIKALGSFRSNA  281



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score =   457 bits (1177),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 241/288 (84%), Positives = 256/288 (89%), Gaps = 5/288 (2%)
 Frame = +1

Query  88   MAKDVEGAT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKDVE      EY+A KDY DPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEVQEQGGEYSA-KDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            +IGYK QTD  V GTD C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQTDTTVGGTD-CDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  118

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RA++YMVAQC GAICG GL K FQKAYY RYGGGAN + DGY+ GT LGAEIIG
Sbjct  119  RKVSLIRALLYMVAQCAGAICGTGLAKGFQKAYYNRYGGGANSVADGYNNGTALGAEIIG  178

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  179  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  238

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY +DK WDDQWIFWVGP VGAA+AA YHQY+LRA A KALGS++SNA
Sbjct  239  IYNEDKIWDDQWIFWVGPIVGAAVAAFYHQYILRAAAIKALGSFKSNA  286



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score =   457 bits (1177),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 239/287 (83%), Positives = 255/287 (89%), Gaps = 3/287 (1%)
 Frame = +1

Query  88   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD E  G       KDYQDPPP+PL D EEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDFETGGGEVRDVAKDYQDPPPSPLFDMEELTKWSFYRALIAEFIATLLFLYITVLTV  60

Query  262  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            IGYK Q+DP V G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPLVSGADAGCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RK+SL+RA+MYMVAQCLGAICG G VKAFQ AYY +YGGGAN L  GYSKGTGL AEIIG
Sbjct  121  RKLSLIRAIMYMVAQCLGAICGVGFVKAFQSAYYNKYGGGANELSVGYSKGTGLAAEIIG  180

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAV
Sbjct  181  TFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAV  240

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            IY  +KAWDDQWIFWVGPF+GAAIAA+YHQY+LRAG  KALGS+RS+
Sbjct  241  IYNNNKAWDDQWIFWVGPFIGAAIAAIYHQYILRAGFIKALGSFRSS  287



>ref|XP_008365039.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=287

 Score =   457 bits (1177),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 239/285 (84%), Positives = 255/285 (89%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E A   + + KDY DPPPAPLID  EL KWSFYRA+IAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDMEVAERGSFSAKDYHDPPPAPLIDSAELTKWSFYRALIAEFVATLLFLYVTVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQTDP     D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDPATNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAV+YMVAQ LGAI G  LVKAFQK+YY +YGGGAN L DGYS G GL AEIIGTF
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYXKYGGGANSLSDGYSTGVGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  240  NKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>emb|CDY56697.1| BnaCnng31040D [Brassica napus]
Length=287

 Score =   457 bits (1176),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 238/286 (83%), Positives = 254/286 (89%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEGAT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE  + E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYK QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIQTDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRA++YMVAQCLGAICG G VKAFQ +YYVRYGGGAN L DGYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIF  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             + K WDD WIFWVGPFVGAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  240  NESKPWDDHWIFWVGPFVGAAIAAFYHQFVLRASGSKSLGSFRSAA  285



>ref|NP_001280185.1| aquaporin PIP2-2 [Prunus mume]
 dbj|BAE48656.1| aquaporin [Prunus mume]
Length=281

 Score =   457 bits (1176),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 259/287 (90%), Gaps = 8/287 (3%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVEGA   E+AA KDY DPPP P  D EEL KWSFYRA+IAEF+ATLLFLY+TVLTV
Sbjct  1    MAKDVEGAEHGEFAA-KDYHDPPPTPFFDAEELTKWSFYRALIAEFVATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ+       D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQSS-----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL RAV+Y++AQ LGAICG GLVKAFQK YY  YGGGAN L  GY+KGTGLGAEIIGT
Sbjct  115  KVSLPRAVLYIIAQSLGAICGVGLVKAFQKTYYEEYGGGANELAAGYNKGTGLGAEIIGT  174

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARSFGAAVI
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSFGAAVI  234

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y KDKAWDDQWIFW+GPF+GAAIAA+YHQY+LRAGA KALGS+RSNA
Sbjct  235  YNKDKAWDDQWIFWLGPFIGAAIAALYHQYILRAGAIKALGSFRSNA  281



>gb|ABK60196.1| PIP2 protein [Gossypium hirsutum]
Length=286

 Score =   457 bits (1176),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 236/285 (83%), Positives = 259/285 (91%), Gaps = 3/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKD+E   E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK+QTDP  KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKTQTDP-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA+ YM AQCLGAICGCGLVKAFQ +YY +YGGGAN L +GYS GTGL AEIIGTFV
Sbjct  119  SLVRAIFYMGAQCLGAICGCGLVKAFQNSYYNQYGGGANSLAEGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVP-VLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            LVYTVF+ATDPKRNARDSH+P VLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+
Sbjct  179  LVYTVFSATDPKRNARDSHIPVVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIF  238

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             +DK WDD WIFWVGPF+GAAIAA+YHQ++LRA  AKALGS+RS+
Sbjct  239  NQDKIWDDHWIFWVGPFIGAAIAAIYHQFILRASGAKALGSFRSS  283



>ref|XP_006403531.1| hypothetical protein EUTSA_v10010603mg [Eutrema salsugineum]
 gb|ESQ44984.1| hypothetical protein EUTSA_v10010603mg [Eutrema salsugineum]
Length=286

 Score =   457 bits (1176),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 235/285 (82%), Positives = 253/285 (89%), Gaps = 1/285 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGEKRSFSGKDYQDPPPEPLFDAAELGKWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTDP +   D+C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTLN-PDQCAGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  119

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            +LVRAVMYMVAQCLGAICG  LVK+FQ AYY RYGGGANGL DGYS GTG+ AEI+GTFV
Sbjct  120  TLVRAVMYMVAQCLGAICGVALVKSFQSAYYTRYGGGANGLADGYSVGTGVAAEIVGTFV  179

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAA+IY 
Sbjct  180  LVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAIIYN  239

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            KD+AWD  WIFWVGPF GAAIAA YHQ+VLRAGA KALGS+RS +
Sbjct  240  KDQAWDHHWIFWVGPFAGAAIAAFYHQFVLRAGAVKALGSFRSQS  284



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score =   457 bits (1176),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 236/286 (83%), Positives = 259/286 (91%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E     A A +DYQDPPPAPL D EELGKWS YRA+IAEF+ATLLFLYV++LTVI
Sbjct  1    MAKDLEVQEGGAMAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLARK
Sbjct  61   GYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVR V+Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGTF
Sbjct  120  VSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYNRYGGGANQLADGYNKGTGLGAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             ++KAWDDQWIFWVGP +GAA AA+YHQ+VLRA   K+LGS+RS+A
Sbjct  240  NQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIKSLGSFRSSA  285



>ref|XP_002452483.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
 gb|EES05459.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
Length=289

 Score =   457 bits (1176),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 240/290 (83%), Positives = 254/290 (88%), Gaps = 6/290 (2%)
 Frame = +1

Query  88   MAKDVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            MAKD+E     A E++A KDY DPPPAPLID  EL +WS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDIEASGPEAGEFSA-KDYTDPPPAPLIDAAELTQWSLYRAVIAEFIATLLFLYITVA  59

Query  256  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  432
            TVIGYK QTD    G D  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQTDATASGPDAACGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  433  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  612
            LARKVSLVRA++Y++AQCLGAICG GLVK FQ AYYVRYGGGAN L DGYSKGTGL AEI
Sbjct  120  LARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAEI  179

Query  613  IGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA  792
            IGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA
Sbjct  180  IGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGA  239

Query  793  AVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AVIY  DKAWDDQWIFWVGP +GAAIAA YHQYVLRA A+K   SYRSNA
Sbjct  240  AVIYNNDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASASKLGSSYRSNA  289



>ref|XP_002322877.1| major intrinsic protein 1 [Populus trichocarpa]
 gb|ABK93143.1| unknown [Populus trichocarpa]
 gb|ABK94547.1| unknown [Populus trichocarpa]
 gb|EEF04638.1| major intrinsic protein 1 [Populus trichocarpa]
Length=285

 Score =   457 bits (1175),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 244/284 (86%), Positives = 265/284 (93%), Gaps = 2/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E   E++A KDY DPPPAPLID EE+ +WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTD N  G DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDVNKNG-DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YMVAQCLGAICGCGLVKAFQK+YY  YGGGANGL +GYSKGTGLGAEIIGTFV
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANGLANGYSKGTGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            K+KAWDD WIFWVGPF+GAAIAA+YHQ++LRA A K+LGS+RS+
Sbjct  239  KEKAWDDHWIFWVGPFIGAAIAALYHQFILRAAAVKSLGSFRSS  282



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   457 bits (1176),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 234/288 (81%), Positives = 255/288 (89%), Gaps = 4/288 (1%)
 Frame = +1

Query  88   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRA++YM+AQC GAICG GL K FQK++Y RYGGG N + DGY+KGT LGAEIIG
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNKGTALGAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG AV
Sbjct  180  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            I+  DKAWDDQWI+WVGPFVGAA+AA+YHQY+LR  A KALGS+RSNA
Sbjct  240  IFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFRSNA  287



>gb|AEO13898.1| aquaporin 7 [Triticum aestivum]
Length=286

 Score =   457 bits (1175),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 235/287 (82%), Positives = 255/287 (89%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+E A +    + KDY DPPPAP++D EEL KWS YRA+IAEF+ATLLFLY+TV TV
Sbjct  1    MAKDIEAAPQGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVATV  60

Query  262  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            IGYK Q+DP V  TD  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLA  120

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RA++Y++AQCLGAICG GLVK FQ +YYVRYGGGAN L  GYSKGTGL AEIIG
Sbjct  121  RKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEIIG  180

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAV
Sbjct  181  TFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAV  240

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            IY KDKAWDDQWIFWVGP +GAAIAA YHQYVLRA AAK LGSYRSN
Sbjct  241  IYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSN  286



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   457 bits (1175),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 236/289 (82%), Positives = 261/289 (90%), Gaps = 8/289 (3%)
 Frame = +1

Query  88   MAKDVE----GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            MAKD+E    GAT   A +DY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLYV++L
Sbjct  1    MAKDLEVQEGGAT---AARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSIL  57

Query  256  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  435
            TVIGYK+QTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  58   TVIGYKAQTDASAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  116

Query  436  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  615
            ARKVSLVR V+Y+VAQCLGAICGCG VKAFQ +YY RYGGGAN L DGY+KGTGLGAEII
Sbjct  117  ARKVSLVRTVLYIVAQCLGAICGCGFVKAFQSSYYTRYGGGANELADGYNKGTGLGAEII  176

Query  616  GTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA  795
            GTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA
Sbjct  177  GTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA  236

Query  796  VIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            VIY ++KAWDDQWIFWVGP +GAA AA+YHQ+VLRA A KALGS+RS+A
Sbjct  237  VIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAAIKALGSFRSSA  285



>gb|AFH36338.1| aquaporin PIP2;3 [Quercus petraea]
Length=286

 Score =   457 bits (1175),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 235/285 (82%), Positives = 254/285 (89%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KDV     + A KDY DPPPAPL DP EL KWSFYRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MTKDVAEHGSFPA-KDYHDPPPAPLFDPVELTKWSFYRALIAEFVATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ DP +KG D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQIDPALKG-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RAV+YMVAQCLGAICG  LVKAFQ AYYV+YGGGAN L DGYS G GLGAEI+GTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVALVKAFQSAYYVKYGGGANSLSDGYSTGVGLGAEIVGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKR ARDSHVPVLAPLPIGFAVF+VHLATIP+TGTGINPARS GAAVIY 
Sbjct  179  LVYTVFSATDPKRKARDSHVPVLAPLPIGFAVFIVHLATIPVTGTGINPARSLGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             D AW D W+FWVGPF+GAA+AA YHQ++LRAGAAKALGS+RSN+
Sbjct  239  NDTAWKDHWLFWVGPFIGAALAAFYHQFILRAGAAKALGSFRSNS  283



>dbj|BAA92261.1| Plasma membrane aquaporin 2c [Raphanus sativus]
Length=283

 Score =   457 bits (1175),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 238/285 (84%), Positives = 252/285 (88%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKDVEGA E    +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLY+TVLTVIG
Sbjct  1    MAKDVEGA-EGVTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK  +D    G DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + K WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  239  ESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|XP_010509371.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   457 bits (1175),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 238/285 (84%), Positives = 253/285 (89%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKDVEGA  Y A +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGYQA-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + K WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  239  ESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>gb|AGG39693.1| aquaporin protein AQU15 [Camellia sinensis]
 gb|AGG39694.1| aquaporin protein AQU16 [Camellia sinensis]
Length=287

 Score =   457 bits (1175),  Expect = 5e-157, Method: Compositional matrix adjust.
 Identities = 238/287 (83%), Positives = 261/287 (91%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+  A +  Y+A KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+T+LTV
Sbjct  1    MAKDMGVAEQGSYSA-KDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ DP VK  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RAVMY+VAQCLGAICG  LVKAFQ +YY  YGGGAN L  GYSKGTGLGAEIIGT
Sbjct  119  KVSLIRAVMYIVAQCLGAICGVALVKAFQSSYYEVYGGGANELSPGYSKGTGLGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI
Sbjct  179  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y ++KAW D W+FWVGPF+GAAIAA YHQ++LRAGA KALGS+RS++
Sbjct  239  YNQEKAWHDHWMFWVGPFIGAAIAAFYHQFILRAGAIKALGSFRSSS  285



>ref|XP_006280883.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
 gb|EOA13781.1| hypothetical protein CARUB_v10026881mg, partial [Capsella rubella]
Length=297

 Score =   457 bits (1175),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 237/287 (83%), Positives = 260/287 (91%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAP--KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD++   E  AP  +DY+DPPPAPL+D EELGKWS YRA+IAEF+ATLLFLYV+VLTV
Sbjct  13   MAKDLD-VQEGGAPAARDYKDPPPAPLLDMEELGKWSLYRAVIAEFVATLLFLYVSVLTV  71

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYK+QTD    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  72   IGYKAQTDATAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLAR  130

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSLVR V+Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN L DGY+KGTGLGAEIIGT
Sbjct  131  KVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEIIGT  190

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI
Sbjct  191  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  250

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y K+KAWDDQWIFWVGP +GAA AA+YHQ++LRA A KAL S+RS+A
Sbjct  251  YNKEKAWDDQWIFWVGPMIGAAAAALYHQFILRAAAIKALNSFRSSA  297



>gb|EYU42155.1| hypothetical protein MIMGU_mgv1a011301mg [Erythranthe guttata]
Length=286

 Score =   456 bits (1174),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 243/287 (85%), Positives = 258/287 (90%), Gaps = 3/287 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE A   A  + KDY DPPPAPL D  EL +WSFYRA+IAEFIATLLFLYVTVLTV
Sbjct  1    MAKDVECADPPAGFSAKDYHDPPPAPLFDCGELTQWSFYRALIAEFIATLLFLYVTVLTV  60

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYK Q+D  V G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   IGYKVQSDA-VHGGDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RAV+YMVAQCLGAICG GLVKAFQK+YYVRYGGGAN L  GY+ G GLGAEIIGT
Sbjct  120  KVSLIRAVLYMVAQCLGAICGVGLVKAFQKSYYVRYGGGANTLAHGYNTGVGLGAEIIGT  179

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            +  DKAWDDQWIFWVGPFVGAAIAA YHQ++LRA A KALGS+RS+A
Sbjct  240  FNNDKAWDDQWIFWVGPFVGAAIAAFYHQFILRAAAIKALGSFRSHA  286



>ref|XP_010037961.1| PREDICTED: probable aquaporin PIP2-2 [Eucalyptus grandis]
 gb|KCW49750.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=289

 Score =   456 bits (1174),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 235/288 (82%), Positives = 259/288 (90%), Gaps = 4/288 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAP---KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKD E   +       KDY+DPPPAPL+D EEL KWSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MAKDDEVVEQQGGEFHGKDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVLT  60

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            VIGY  Q+D    G D+C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYSRQSD-TTHGGDQCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            R+VSLVRA++YMVAQCLGA+CGCGLVKAFQ+AYY RYGGGAN LQ GYSKGTGLGAEIIG
Sbjct  120  RRVSLVRAILYMVAQCLGAVCGCGLVKAFQRAYYKRYGGGANMLQAGYSKGTGLGAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTV +ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  180  TFVLVYTVLSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            +Y K+KAWDDQWIFWVGPF+GAAIAA YHQ+VLRA A KALGS+RS++
Sbjct  240  MYNKEKAWDDQWIFWVGPFIGAAIAAFYHQHVLRAAAIKALGSFRSSS  287



>gb|AFK47400.1| unknown [Lotus japonicus]
Length=287

 Score =   456 bits (1174),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 237/285 (83%), Positives = 258/285 (91%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE A   + + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSSKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYK Q+D    G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKVQSDVK-NGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA++YMVAQCLGAICG GLVKAFQK++Y +YGGGAN L DGYS GTGLGAEIIGTF
Sbjct  120  VSLIRAILYMVAQCLGAICGVGLVKAFQKSHYNKYGGGANSLNDGYSTGTGLGAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+A DSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFGAAVI+
Sbjct  180  VLVYTVFSATDPKRSAGDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGAAVIF  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             + K WDD WIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  240  NQSKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>ref|XP_006481459.1| PREDICTED: aquaporin PIP2-2-like [Citrus sinensis]
Length=287

 Score =   456 bits (1174),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 247/287 (86%), Positives = 263/287 (92%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVE--GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+E  G  E+ A KDY DPPPAPLID EEL +WSFYRA IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDIEVGGQGEFHA-KDYHDPPPAPLIDAEELTQWSFYRATIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDAN-HGGDGCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSLVRAVMYMVAQCLGAICGCGLVKAFQK+YY RYGGGAN L DGYS G GLGAEIIGT
Sbjct  119  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKSYYTRYGGGANELADGYSTGAGLGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI
Sbjct  179  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y KDKAWDDQWIFWVGPF+GAAIAA YHQ++LRA A+KALGS++S++
Sbjct  239  YKKDKAWDDQWIFWVGPFIGAAIAAFYHQFILRASASKALGSFKSSS  285



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score =   456 bits (1174),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 241/285 (85%), Positives = 253/285 (89%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            M KDVE A   + + KDY DPPP PLID  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MGKDVEVAEHGHFSAKDYHDPPPTPLIDAVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GY+SQTD    G D C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYRSQTDQAHNGGD-CEGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RAVMYMVAQCLGAICG GLVK FQKAYY+R GGGAN L  GYSKG GLGAEIIGTF
Sbjct  120  VSLIRAVMYMVAQCLGAICGVGLVKGFQKAYYMRSGGGANSLALGYSKGVGLGAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             KDKAWDD WIFWVGPF GAA+AA+YHQY+LRA A KALGS+RSN
Sbjct  240  NKDKAWDDHWIFWVGPFTGAALAALYHQYILRAAAIKALGSFRSN  284



>gb|KHG06004.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   456 bits (1174),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 234/285 (82%), Positives = 257/285 (90%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAK +E   E+ A KDY DPPPAPL+D +EL KWSFYRA+IAEFIATL FLY+TVLTVIG
Sbjct  1    MAKAIEVGGEFQA-KDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLFFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK+QTD   KG ++CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKTQTDL-AKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA+ YM AQCLGAICGCGLVKAFQ +YY +YGGGAN L +GYS GTGL AEIIGTFV
Sbjct  119  SLVRAIFYMGAQCLGAICGCGLVKAFQNSYYNQYGGGANSLAEGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+ 
Sbjct  179  LVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            +DK WDD WIFWVGPF+GAAIAA+YHQ+VLRA  AKALGS+RS++
Sbjct  239  QDKIWDDHWIFWVGPFIGAAIAAIYHQFVLRASGAKALGSFRSSS  283



>ref|XP_006436425.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
 ref|XP_006485687.1| PREDICTED: probable aquaporin PIP2-5-like [Citrus sinensis]
 gb|ESR49665.1| hypothetical protein CICLE_v10032302mg [Citrus clementina]
Length=287

 Score =   456 bits (1174),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 254/287 (89%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD  G  E+ +   KDY DPPP PL D  EL KWSFYRA+IAEFIATLLFLYVTVLTV
Sbjct  1    MAKD-TGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQTDP  K  D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQTDP-AKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSLVRAVMYMVAQCLGAI G GLVKAFQK+YY RYGGGAN L DGYS G GL AEIIGT
Sbjct  119  KVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI
Sbjct  179  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y KDKAWDDQW+FWVGPF+GAAIAA YHQ++LRAGA KALGS+RS +
Sbjct  239  YNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSQS  285



>ref|NP_001292671.1| aquaporin PIP2-2 [Cucumis sativus]
 gb|AHB33479.1| plasma intrinsic protein 2-3 [Cucumis sativus]
 gb|KGN48149.1| hypothetical protein Csa_6G445140 [Cucumis sativus]
Length=284

 Score =   456 bits (1173),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 238/284 (84%), Positives = 254/284 (89%), Gaps = 3/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M+KD+E      A KDYQDPPPAPLID EEL +WSFYRAIIAEF+ATLLFLYVTVLTVIG
Sbjct  1    MSKDLEAGG--FAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLTVIG  58

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            Y SQ+D    G   CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  59   YSSQSDTK-NGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  117

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL RA++YMVAQCLGAICGC LVK+FQKA Y  +GGGAN L DGYS GTGL AEIIGTFV
Sbjct  118  SLTRAILYMVAQCLGAICGCALVKSFQKALYNEHGGGANSLADGYSTGTGLAAEIIGTFV  177

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ 
Sbjct  178  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFN  237

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            KDK WDDQWIFWVGPF+GAAIAA+YHQ VLRAGA KALGS+RS+
Sbjct  238  KDKPWDDQWIFWVGPFIGAAIAAIYHQVVLRAGAVKALGSFRSS  281



>gb|KDO44716.1| hypothetical protein CISIN_1g0196812mg [Citrus sinensis]
Length=337

 Score =   458 bits (1179),  Expect = 9e-157, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 254/287 (89%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAA--PKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD  G  E+ +   KDY DPPP PL D  EL KWSFYRA+IAEFIATLLFLYVTVLTV
Sbjct  51   MAKD-TGVAEHGSYSAKDYTDPPPEPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTV  109

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQTDP  K  D C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  110  IGYKSQTDP-AKNVDGCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  168

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSLVRAVMYMVAQCLGAI G GLVKAFQK+YY RYGGGAN L DGYS G GL AEIIGT
Sbjct  169  KVSLVRAVMYMVAQCLGAISGVGLVKAFQKSYYTRYGGGANELADGYSTGVGLAAEIIGT  228

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI
Sbjct  229  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  288

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y KDKAWDDQW+FWVGPF+GAAIAA YHQ++LRAGA KALGS+RS +
Sbjct  289  YNKDKAWDDQWLFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSQS  335



>emb|CDX91340.1| BnaC04g08100D [Brassica napus]
Length=285

 Score =   456 bits (1173),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 237/285 (83%), Positives = 254/285 (89%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAK+VEGA  +A+ +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKEVEGAEGFAS-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + K WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  239  ESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>dbj|BAA32778.1| Plasma membrane aquaporin (PAQ2) [Raphanus sativus]
Length=287

 Score =   456 bits (1173),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 237/286 (83%), Positives = 254/286 (89%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEGAT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE  + E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYK +TD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIETDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIF  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             + K WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  240  NESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  285



>gb|ABH09326.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   456 bits (1173),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 240/286 (84%), Positives = 255/286 (89%), Gaps = 5/286 (2%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            M KDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA++YMVAQCLGAICG GLVKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  236

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
              +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RS A
Sbjct  237  NNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSTA  282



>dbj|BAG06231.1| plasma membrane intrinsic protein [Hordeum vulgare]
 dbj|BAK01580.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK01902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   456 bits (1173),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 239/291 (82%), Positives = 256/291 (88%), Gaps = 7/291 (2%)
 Frame = +1

Query  88   MAKD----VEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            MAKD      G  ++AA KDY DPPPAPL+D  EL  WS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDEVMETGGGGDFAA-KDYTDPPPAPLVDAAELASWSLYRAVIAEFIATLLFLYITVA  59

Query  256  tvIGYKSQTDPNVKGTDE--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  429
            TVIGYK QTDP V    +  CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL
Sbjct  60   TVIGYKHQTDPAVNSAADAACGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGL  119

Query  430  FLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAE  609
            FLARKVSLVRA++YMVAQCLGA+CG GLVKAFQ AY+VRYGGGAN L  GYSKGTGL AE
Sbjct  120  FLARKVSLVRALLYMVAQCLGAMCGVGLVKAFQSAYFVRYGGGANTLAAGYSKGTGLAAE  179

Query  610  IIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG  789
            IIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS G
Sbjct  180  IIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLG  239

Query  790  AAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AAVIY KDKAWDDQWIFWVGP +GAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  240  AAVIYNKDKAWDDQWIFWVGPMIGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>ref|XP_009133125.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
Length=285

 Score =   456 bits (1172),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 237/285 (83%), Positives = 253/285 (89%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKDVEGA  +AA +DYQDPPP P  D EEL +WS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGFAA-RDYQDPPPTPFFDAEELTRWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK  +D    G  ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTTAGGV-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            +LVRA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  TLVRALLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + K WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  239  ESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|XP_009381972.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   456 bits (1173),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 249/288 (86%), Positives = 260/288 (90%), Gaps = 4/288 (1%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+E A   EY A KDY DPPPAPL+D EEL KWS YRA IAEFIAT+LFLYVTVLTV
Sbjct  1    MAKDIEVAEQGEYTA-KDYTDPPPAPLVDVEELTKWSLYRAAIAEFIATMLFLYVTVLTV  59

Query  262  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            IGYK Q+DPNV  TD  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   IGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRA +Y+VAQCLGAICG GLVK FQKAY+VRYGGGAN L DGYSKGTGLGAEIIG
Sbjct  120  RKVSLVRAFLYIVAQCLGAICGVGLVKGFQKAYFVRYGGGANELSDGYSKGTGLGAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVFAATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  180  TFVLVYTVFAATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY KDKAWDDQWIFWVGP +GAAIAA YHQYVLRA   KALGS+RS+A
Sbjct  240  IYNKDKAWDDQWIFWVGPAIGAAIAAAYHQYVLRASGVKALGSFRSSA  287



>ref|XP_004291577.1| PREDICTED: aquaporin PIP2-2 [Fragaria vesca subsp. vesca]
Length=281

 Score =   455 bits (1171),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 258/287 (90%), Gaps = 8/287 (3%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVEGA   E+AA KDY DPPP PL D +EL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEGAEHGEFAA-KDYHDPPPTPLFDADELTKWSFYRAVIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ+      TD+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQS-----ATDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RAV+Y+VAQ LGAICG GLVKAFQK  Y  YGGGAN L  GYSKGTGL AEIIGT
Sbjct  115  KVSLLRAVLYIVAQSLGAICGVGLVKAFQKTLYDEYGGGANTLAPGYSKGTGLAAEIIGT  174

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI
Sbjct  175  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  234

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y +DKAWDD W+FW+GPF+GAAIAA YHQ+VLRAGA KALGS+RSNA
Sbjct  235  YNQDKAWDDHWMFWLGPFIGAAIAAFYHQFVLRAGAIKALGSFRSNA  281



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score =   456 bits (1172),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 257/287 (90%), Gaps = 5/287 (2%)
 Frame = +1

Query  88   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAK+VEG +E   Y+A KDY DPPPA   D +EL KWSFYRA+IAEF+ATLLFLY+ VLT
Sbjct  1    MAKEVEGVSEQPEYSA-KDYHDPPPAAFFDLDELTKWSFYRALIAEFVATLLFLYIKVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            VIGYK QTDP+  G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   VIGYKHQTDPDAGGAD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  118

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL RA  YMVAQCLGAICG GLVKAFQ++YY RY GGAN +  GY+KG GL AEIIG
Sbjct  119  RKVSLPRAFFYMVAQCLGAICGVGLVKAFQRSYYHRYEGGANMVAPGYTKGVGLSAEIIG  178

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  179  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  238

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            IYG DKAWDDQWIFWVGPFVGAAIAA+YHQY+LRAGA KALGS+RSN
Sbjct  239  IYGADKAWDDQWIFWVGPFVGAAIAALYHQYILRAGAIKALGSFRSN  285



>gb|ACR56613.1| plasma intrinsic protein 2;3 [Juglans regia]
Length=284

 Score =   455 bits (1171),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 241/287 (84%), Positives = 259/287 (90%), Gaps = 5/287 (2%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            M KDVEGA   EY+A KDYQDPPPAPLIDPEEL KWSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MGKDVEGAEQGEYSA-KDYQDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYITVLTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYK Q+  +    D+C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKVQS--SAPDADDCAGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  117

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RAV+YMVAQCLGAICG GLVK FQK +Y + GGGAN L  GY+KG GLGAEIIGT
Sbjct  118  KVSLIRAVLYMVAQCLGAICGVGLVKGFQKTHYNQNGGGANELAPGYNKGVGLGAEIIGT  177

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI
Sbjct  178  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  237

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y +DKAWDDQWIFWVGPF+GAAIAA YHQ++LRA   KALGS+RSNA
Sbjct  238  YNQDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAEPLKALGSFRSNA  284



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score =   456 bits (1172),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 233/288 (81%), Positives = 254/288 (88%), Gaps = 4/288 (1%)
 Frame = +1

Query  88   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRA++YM+AQC GAICG GL K FQK++Y RYGGG N + DGY+KGT LGAEIIG
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNKGTALGAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFM HLATIP+TGTGINPARSFG AV
Sbjct  180  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMAHLATIPVTGTGINPARSFGPAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            I+  DKAWDDQWI+WVGPFVGAA+AA+YHQY+LR  A KALGS+RSNA
Sbjct  240  IFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFRSNA  287



>gb|AGC24024.1| plasma membrane intrinsic protein 1 [Lilium hybrid cultivar]
Length=288

 Score =   456 bits (1172),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 241/289 (83%), Positives = 258/289 (89%), Gaps = 5/289 (2%)
 Frame = +1

Query  88   MAKDVE---GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKD+E   GA E+ A KDY DPPPAP +   EL KWSFYRA+IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAAGAGEFPA-KDYTDPPPAPFLGIGELTKWSFYRALIAEFVATLLFLYITVAT  59

Query  259  vIGYKSQTDPNVKGTD-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  435
            VIGYK Q+D  +   + +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDTTLGTPNADCEGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  436  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  615
            ARKVSL+RAV+YM+AQCLGAICG GLVK FQKA+YVRYGGGAN L  GYSKGTGL AEII
Sbjct  120  ARKVSLIRAVLYMIAQCLGAICGVGLVKGFQKAFYVRYGGGANELSAGYSKGTGLAAEII  179

Query  616  GTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA  795
            GTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA
Sbjct  180  GTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA  239

Query  796  VIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            VIY K KAWDDQWIFWVGPF+GAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  240  VIYNKSKAWDDQWIFWVGPFIGAAIAAGYHQYILRAGAIKALGSFRSNA  288



>ref|XP_003540176.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
 gb|KHN11201.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   455 bits (1171),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 234/287 (82%), Positives = 254/287 (89%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRA++YM+AQC GAICG GL K FQK+YY RYGGG N + DGY+KGT LGAEIIG
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQKSYYNRYGGGVNTVSDGYNKGTALGAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG AV
Sbjct  180  TFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            I+  DKAWDDQWI+WVGPFVGAA+AA YHQY+LRA A KALGS+RSN
Sbjct  240  IFNNDKAWDDQWIYWVGPFVGAAVAAFYHQYILRAAAIKALGSFRSN  286



>gb|ACU00104.1| plasma membrane intrinsic protein PIP2.2 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   455 bits (1171),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 243/284 (86%), Positives = 264/284 (93%), Gaps = 2/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E   E++A KDY DPPPAPLID EE+ +WSFYRAIIAEF+ATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGEFSA-KDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTD N  G DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQTDVNKNG-DECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YMVAQCLGAICGCGLVKAFQK+YY  YGGGANGL +GYSKGTGLGAEIIGTFV
Sbjct  119  SLVRAILYMVAQCLGAICGCGLVKAFQKSYYTNYGGGANGLANGYSKGTGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            K+KAWDD W+FWVGPF+GAAIAA+YHQ++LRA A K+LGS RS+
Sbjct  239  KEKAWDDHWVFWVGPFIGAAIAALYHQFILRAAAVKSLGSXRSS  282



>ref|XP_002461930.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
 gb|EER98451.1| hypothetical protein SORBIDRAFT_02g010760 [Sorghum bicolor]
Length=290

 Score =   455 bits (1171),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 237/280 (85%), Positives = 251/280 (90%), Gaps = 2/280 (1%)
 Frame = +1

Query  106  GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTD  285
            G  E+AA KDY DPPPAPLID  ELG WS YRA+IAEFIATLLFLY+TV TVIGYK QTD
Sbjct  12   GGGEFAA-KDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVATVIGYKHQTD  70

Query  286  PNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRA  462
                G D  CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSLVRA
Sbjct  71   ATASGADAACGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRA  130

Query  463  VMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTV  642
            ++Y+VAQCLGAICG GLVKAFQ AY+ RYGGGAN L  GYS+GTGLGAEIIGTFVLVYTV
Sbjct  131  LLYIVAQCLGAICGVGLVKAFQSAYFDRYGGGANSLASGYSRGTGLGAEIIGTFVLVYTV  190

Query  643  FAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAW  822
            F+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVIY KDK W
Sbjct  191  FSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVIYNKDKPW  250

Query  823  DDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            DD WIFWVGPFVGAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  251  DDHWIFWVGPFVGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score =   455 bits (1170),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 234/285 (82%), Positives = 258/285 (91%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKD+E   E  A +DYQDPPPAPL D EELGKWS YRA+IAEF+ATLLFLYV++LTVIG
Sbjct  1    MAKDLE-VQEGRAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK+QTD +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKAQTDASAGGAD-CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVR V+Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN L +GY+KGTGLGAEIIGTFV
Sbjct  119  SLVRTVLYIVAQCLGAICGCGLVKAFQSSYYNRYGGGANQLAEGYNKGTGLGAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVY VFAATDPKR+ARDSH+PVLAPLPIGFA FMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYPVFAATDPKRSARDSHIPVLAPLPIGFAAFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            ++KAWDDQWIFWVGP +GAA AA+YHQ+VLRA   K+LGS+RS+A
Sbjct  239  QEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIKSLGSFRSSA  283



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score =   455 bits (1170),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 239/288 (83%), Positives = 263/288 (91%), Gaps = 9/288 (3%)
 Frame = +1

Query  88   MAKDVEGAT---EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAK+VE A    E+AA KDY DPPPAPLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEVECAEPAAEFAA-KDYHDPPPAPLIDYDELTKWSFYRALIAEFIATLLFLYITVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            VIGYKSQ++      D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLA
Sbjct  60   VIGYKSQSE-----YDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  114

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RAV+YMVAQCLGAICG G VKAFQK++Y ++GGGAN L  GY+KGTGLGAEIIG
Sbjct  115  RKVSLIRAVLYMVAQCLGAICGVGFVKAFQKSHYNKFGGGANTLALGYNKGTGLGAEIIG  174

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  175  TFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  234

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            I+  +KAWDD WIFWVGPF+GAAIAA+YHQ+VLRAGA KALGS+RSNA
Sbjct  235  IFNNEKAWDDHWIFWVGPFIGAAIAAIYHQFVLRAGAIKALGSFRSNA  282



>gb|ADJ67992.1| aquaporin [Fragaria x ananassa]
Length=285

 Score =   455 bits (1171),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 241/286 (84%), Positives = 256/286 (90%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSAKDYHDPPPAPLFDSVELTKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ D ++ G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDADLGG-DACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAVMY+VAQ LGAI G GLVKAFQK+YY +YGGGAN L DGYS G GL AEIIGTF
Sbjct  120  VSLVRAVMYIVAQSLGAIAGVGLVKAFQKSYYTKYGGGANELADGYSTGVGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             K KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSNA
Sbjct  240  DKKKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSNA  285



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score =   455 bits (1170),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 234/287 (82%), Positives = 254/287 (89%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+E A +    + KDY DPPPAP++D EEL KWS YRA+IAEF+ATLLFLY+TV TV
Sbjct  1    MAKDIEAAPQGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVATV  60

Query  262  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            IGYK Q+DP V  TD  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLA  120

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RA++Y++AQCLGAICG GLVK FQ +YYVRYGGGAN L  GYSKGTGL AEIIG
Sbjct  121  RKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEIIG  180

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAV
Sbjct  181  TFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAV  240

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            IY  DKAWDDQWIFWVGP +GAAIAA YHQYVLRA AAK LGSYRSN
Sbjct  241  IYNTDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSN  286



>dbj|BAA92260.1| Plasma membrane aquaporin 2b [Raphanus sativus]
Length=283

 Score =   455 bits (1170),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 236/285 (83%), Positives = 253/285 (89%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAK+VEGA  +A  +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKEVEGAEGFAT-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAV+YMVAQCLGAICG G VKAFQ +YYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + K WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  239  ESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|XP_010554547.1| PREDICTED: probable aquaporin PIP2-5 [Tarenaya hassleriana]
Length=287

 Score =   455 bits (1170),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 237/286 (83%), Positives = 253/286 (88%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKDV     ++  KDY DPPPAPL D  ELGKWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVAEHGSFSG-KDYHDPPPAPLFDATELGKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVK-GTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            Y SQT+  +  G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  60   YNSQTNTTLNPGADQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAVMYMVAQCLGAICG GLVKAFQ +YY RYGGGAN L  GYS G G+GAEIIGTF
Sbjct  120  VSLVRAVMYMVAQCLGAICGVGLVKAFQSSYYTRYGGGANSLASGYSVGVGVGAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIF  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             ++K WDD WIFWVGPF GAAIAA YHQ+VLRA AAKALGS+RS +
Sbjct  240  NQEKPWDDHWIFWVGPFAGAAIAAFYHQFVLRAAAAKALGSFRSQS  285



>ref|XP_002532756.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF29633.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=283

 Score =   455 bits (1170),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 238/285 (84%), Positives = 255/285 (89%), Gaps = 6/285 (2%)
 Frame = +1

Query  88   MAKDVE-GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            M KD+E G     + KDY DPPPAPLID  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MVKDMEVGERGPFSAKDYHDPPPAPLIDAVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ++     +D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQSE-----SDSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  115

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRA+MYMVAQCLGAICG GLVKAFQ ++Y RYGGGAN L D YS G GLGAEIIGTF
Sbjct  116  VSLVRAIMYMVAQCLGAICGVGLVKAFQSSHYKRYGGGANTLDDNYSTGVGLGAEIIGTF  175

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  176  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  235

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             +DKAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  236  NQDKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  280



>ref|XP_009116034.1| PREDICTED: aquaporin PIP2-1 [Brassica rapa]
 gb|AAD39373.1|AF118382_1 plasma membrane intrinsic protein 1 [Brassica napus]
 emb|CDX78177.1| BnaA09g33720D [Brassica napus]
Length=287

 Score =   455 bits (1170),  Expect = 3e-156, Method: Compositional matrix adjust.
 Identities = 237/286 (83%), Positives = 253/286 (88%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEGAT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE  + E    +DYQDPPPAPL DP EL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVSGEGFQTRDYQDPPPAPLFDPAELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYK QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIQTDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRA++YMVAQCLGAICG G VKAFQ +YYVRYGGGAN L DGYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIF  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             + K WDD WIFWVGPFVGAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  240  NESKPWDDHWIFWVGPFVGAAIAAFYHQFVLRASGSKSLGSFRSAA  285



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score =   454 bits (1169),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 238/285 (84%), Positives = 257/285 (90%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KDVE ATE++A KDY DPPPAPLID EEL +WSFYRA IAEFIATLLFLYVTVLTVIG
Sbjct  1    MGKDVEAATEFSA-KDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK Q+D +  G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKHQSDVDANG-DVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RA++YMVAQCLGAICG G VKAFQ AYY RYGGGAN +  G++KG GL AEIIGTFV
Sbjct  119  SLIRALVYMVAQCLGAICGVGFVKAFQSAYYDRYGGGANVMAAGHTKGVGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            +DKAWD+ WIFWVGPF+GA  AA YHQY+LRAGA KALGS+RSNA
Sbjct  239  QDKAWDEHWIFWVGPFIGAFAAAAYHQYILRAGAVKALGSFRSNA  283



>emb|CDX91341.1| BnaC04g08090D [Brassica napus]
Length=285

 Score =   454 bits (1169),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 235/285 (82%), Positives = 254/285 (89%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKDVEGA  +AA +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGFAA-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK  +D    G DECGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RAV+YMVAQCLGAICG G VKAFQ +YYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + K W+D WIFWVGPF+GAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  239  ESKPWNDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|NP_001105025.1| aquaporin PIP2-3 [Zea mays]
 sp|Q9ATM7.1|PIP23_MAIZE RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; AltName: Full=ZmPIP2-3; AltName: Full=ZmPIP2;3 
[Zea mays]
 gb|AAK26760.1| plasma membrane integral protein ZmPIP2-3 [Zea mays]
 gb|ACR38296.1| unknown [Zea mays]
 gb|AFW63074.1| plasma membrane intrinsic protein2 [Zea mays]
Length=289

 Score =   455 bits (1170),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 244/291 (84%), Positives = 257/291 (88%), Gaps = 8/291 (3%)
 Frame = +1

Query  88   MAK-DVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtv  252
            MAK D+E     A E++A KDY DPPPAPLID +EL KWS YRA+IAEFIATLLFLY+TV
Sbjct  1    MAKQDIEASGPEAGEFSA-KDYTDPPPAPLIDADELTKWSLYRAVIAEFIATLLFLYITV  59

Query  253  ltvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  429
             TVIGYK QTD    G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  60   ATVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  119

Query  430  FLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAE  609
            FLARKVSLVRA++Y++AQCLGAICG GLVK FQ AYYVRYGGGAN L DGYSKGTGL AE
Sbjct  120  FLARKVSLVRALLYIIAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAE  179

Query  610  IIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG  789
            IIGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS G
Sbjct  180  IIGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLG  239

Query  790  AAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AAVIY KDKAWDDQWIFWVGP +GAAIAA YHQYVLRA A K LGSYRSNA
Sbjct  240  AAVIYNKDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASATK-LGSYRSNA  289



>ref|NP_001267922.1| aquaporin-like [Vitis vinifera]
 gb|ABN14353.1| aquaporin PIP2;4 [Vitis vinifera]
Length=284

 Score =   454 bits (1169),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 239/286 (84%), Positives = 255/286 (89%), Gaps = 5/286 (2%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            M KDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA++YMVAQCLGAICG GLVKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPK++ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKKSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  236

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
              +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RS A
Sbjct  237  NNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSTA  282



>ref|XP_009120600.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-4 [Brassica 
rapa]
Length=285

 Score =   454 bits (1169),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 235/289 (81%), Positives = 259/289 (90%), Gaps = 8/289 (3%)
 Frame = +1

Query  88   MAKDVE----GATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            MAKD+E    GAT   A +DY DPPPAPL+D EE GKWS YRA+IAEF+ TLLFLYV+VL
Sbjct  1    MAKDLEVQEGGAT---AARDYVDPPPAPLLDMEEFGKWSLYRAVIAEFVXTLLFLYVSVL  57

Query  256  tvIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  435
            TVIGYK+QTD N  G D CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  58   TVIGYKAQTDANAGGVD-CGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  116

Query  436  ARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEII  615
            ARKVSLVR V+Y+VAQCLGAICGCGLVKAFQ +YY RYGGGAN L DGY+KGTGLGAEII
Sbjct  117  ARKVSLVRTVLYIVAQCLGAICGCGLVKAFQSSYYTRYGGGANELADGYNKGTGLGAEII  176

Query  616  GTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAA  795
            GTFVLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARS GAA
Sbjct  177  GTFVLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAA  236

Query  796  VIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            VIY ++KAWDDQWIFWVGP +GAA AA+YHQ+VLRA   K+LGS+RS+A
Sbjct  237  VIYNQEKAWDDQWIFWVGPMIGAAAAALYHQFVLRAAGIKSLGSFRSSA  285



>ref|XP_009133124.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
 gb|AAD39374.1|AF118383_1 plasma membrane intrinsic protein 2 [Brassica napus]
 emb|CDY46758.1| BnaA03g17020D [Brassica napus]
Length=283

 Score =   454 bits (1169),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 237/285 (83%), Positives = 252/285 (88%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKDVEGA E    +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGA-EGVTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK  +D    G D+CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTKAGG-DDCGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLVRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + K WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  239  ESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|XP_007150204.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
 gb|ESW22198.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
Length=287

 Score =   454 bits (1169),  Expect = 4e-156, Method: Compositional matrix adjust.
 Identities = 235/288 (82%), Positives = 255/288 (89%), Gaps = 4/288 (1%)
 Frame = +1

Query  88   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKDVE  TE   Y+A KDY DPPPAPL DP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQPEYSA-KDYHDPPPAPLFDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            +IGYK QTD ++ G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL 
Sbjct  60   IIGYKRQTDTSIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLG  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRA++Y+VAQC GAI G GL KAFQK++Y RYGGGAN + DGY+KGT LGAEIIG
Sbjct  120  RKVSLVRALLYIVAQCAGAISGAGLAKAFQKSFYNRYGGGANTVSDGYNKGTALGAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG AV
Sbjct  180  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGPAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            I+  DKAWDDQWI+WVGPF+GAA+AA YHQY+LRA A KALGS+RSNA
Sbjct  240  IFNNDKAWDDQWIYWVGPFIGAAVAAFYHQYILRAAAIKALGSFRSNA  287



>ref|XP_008446888.1| PREDICTED: aquaporin PIP2-1-like [Cucumis melo]
Length=287

 Score =   454 bits (1169),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 252/284 (89%), Gaps = 0/284 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKD   A    + KDY DPPPAPL D  ELGKWSFYRAIIAEFIATLLFLYVT+LT+IG
Sbjct  1    MAKDDVTAARGFSGKDYHDPPPAPLFDAAELGKWSFYRAIIAEFIATLLFLYVTILTIIG  60

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            Y SQTD N  GT+ C GVGILGIAW+FGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YNSQTDTNKPGTNACDGVGILGIAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  120

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAV YM+AQCLGA+CG GLVKAFQK+YY +YGGGAN L  GYSKGTGLGAEI+GTF+
Sbjct  121  SLVRAVAYMIAQCLGAVCGAGLVKAFQKSYYNKYGGGANQLAHGYSKGTGLGAEIVGTFI  180

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATD KRNARDSHVPVLAPLPIGFAVFMVHLATIPITGT INPARSFG AVI  
Sbjct  181  LVYTVFSATDSKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTSINPARSFGPAVILN  240

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            ++K WDD WIFWVGPFVGAAIAA YHQ++LRAGAAKALGS+RSN
Sbjct  241  REKPWDDHWIFWVGPFVGAAIAAFYHQFILRAGAAKALGSFRSN  284



>ref|XP_006410897.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
 gb|ESQ52350.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
Length=285

 Score =   454 bits (1168),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 236/285 (83%), Positives = 253/285 (89%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKDVEGA  + A +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGAEGFPA-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RAV+YMVAQCLGAICG G VKAFQ +YYVRYGGGAN L +GYS GTGL AEIIGTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVKAFQSSYYVRYGGGANSLAEGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + K WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  239  ESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|XP_007218772.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
 gb|EMJ19971.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
Length=287

 Score =   454 bits (1168),  Expect = 5e-156, Method: Compositional matrix adjust.
 Identities = 239/285 (84%), Positives = 255/285 (89%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQTD  V   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDTTVNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAV+YMVAQ LGAI G  LVKAFQ++YY +YGGGAN L  GYSKG GLGAEIIGTF
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVKAFQESYYTKYGGGANELSQGYSKGVGLGAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             K+KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  240  NKEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>emb|CAN75442.1| hypothetical protein VITISV_019657 [Vitis vinifera]
Length=284

 Score =   454 bits (1168),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 239/285 (84%), Positives = 254/285 (89%), Gaps = 5/285 (2%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            M KDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA++YMVAQCLGAICG GLVKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  236

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
              +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RS 
Sbjct  237  NNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRST  281



>ref|NP_001268058.1| aquaporin-like [Vitis vinifera]
 gb|ABN14352.1| aquaporin PIP2;3 [Vitis vinifera]
 emb|CAN77241.1| hypothetical protein VITISV_029527 [Vitis vinifera]
 gb|AIK66516.1| putative aquaporin [Vitis vinifera]
Length=287

 Score =   454 bits (1168),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 238/286 (83%), Positives = 254/286 (89%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEGATE-YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E A       KDY DPPPAPL+DPEELG WSFYRAIIAEF+ATLLFLYVTVLTVI
Sbjct  1    MAKDIEVAGHGDLTLKDYHDPPPAPLVDPEELGSWSFYRAIIAEFVATLLFLYVTVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYK+QTDP   G +EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKNQTDPYHHG-NECNGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAVMYMVAQC GAICGCGLVK FQ  YY+RYGGGAN L  GYS GTGL AEIIGTF
Sbjct  120  VSLVRAVMYMVAQCGGAICGCGLVKLFQDIYYIRYGGGANELASGYSIGTGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             + KAW D W+FW GPF+GAAIAA YHQ++LRAGA KALGS++S++
Sbjct  240  NQPKAWSDHWVFWAGPFIGAAIAAFYHQFILRAGAVKALGSFKSSS  285



>gb|AHG32324.1| PIP2-3 [Pisum sativum]
Length=287

 Score =   454 bits (1168),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 238/285 (84%), Positives = 257/285 (90%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE A   + + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GY  QTD    G DECGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYSIQTDVKAGG-DECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RAVMYMVAQ LGAICG GLVKAFQK+Y+VRYGGGAN LQ GYS G GLGAEI+GTF
Sbjct  120  VSLIRAVMYMVAQSLGAICGVGLVKAFQKSYFVRYGGGANFLQPGYSTGVGLGAEIVGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS G+AVI 
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGSAVIL  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             +DK W+D WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RS+
Sbjct  240  NQDKIWNDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSS  284



>gb|AAV69744.1| aquaporin [Vitis vinifera]
Length=284

 Score =   454 bits (1168),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 239/285 (84%), Positives = 254/285 (89%), Gaps = 5/285 (2%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            M KDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA++YMVAQCLGAICG GLVKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  236

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
              +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RS 
Sbjct  237  NNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRST  281



>gb|AAY22203.1| putative aquaporin [Phaseolus vulgaris]
Length=285

 Score =   454 bits (1168),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 239/287 (83%), Positives = 255/287 (89%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGAT--EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVE     EYAA KDYQDPPPAPL DPEEL +WSFYRA+IAEFIATLLFLYVTVLT+
Sbjct  1    MAKDVEVQEQGEYAA-KDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLTI  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYK QTD NV GT EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IGYKRQTDANVGGT-ECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RA++Y+VAQC GAICG GL K FQKAYY R GGGAN + DGY+KGT LGAEIIGT
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAKGFQKAYYNRCGGGANSVADGYNKGTALGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            F LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TG GINPARSFGAAVI
Sbjct  179  FALVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGAGINPARSFGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y  +K WDDQWIFWVGP +GAA+AA YHQY+LRA A KALGS+RSNA
Sbjct  239  YNNEKIWDDQWIFWVGPIIGAAVAAFYHQYILRAAAIKALGSFRSNA  285



>ref|XP_010529747.1| PREDICTED: aquaporin PIP2-2-like [Tarenaya hassleriana]
Length=288

 Score =   454 bits (1168),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 238/285 (84%), Positives = 254/285 (89%), Gaps = 3/285 (1%)
 Frame = +1

Query  88   MAKDVEG--ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKDVEG  A E    +DY DPPPA L+D EEL +WSFYRA+IAEFIATLLFLY+TVLTV
Sbjct  1    MAKDVEGGVAGEGFPARDYTDPPPAALVDAEELTRWSFYRAVIAEFIATLLFLYITVLTV  60

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQTD    G D+CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL L R
Sbjct  61   IGYKSQTDTKAGG-DDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLGR  119

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KV+LVRA++YMVAQCLGAICG GLVKAFQ +YY RYGGGAN L DGYSKGTGL AEIIGT
Sbjct  120  KVTLVRALLYMVAQCLGAICGVGLVKAFQSSYYDRYGGGANSLADGYSKGTGLAAEIIGT  179

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVI  239

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRS  936
            Y KDK WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K+LGS+RS
Sbjct  240  YNKDKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRS  284



>ref|XP_004953172.1| PREDICTED: aquaporin PIP2-4-like [Setaria italica]
Length=288

 Score =   454 bits (1168),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 242/290 (83%), Positives = 255/290 (88%), Gaps = 7/290 (2%)
 Frame = +1

Query  88   MAKDVEG----ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            MAKD+E     A E++A KDY DPPPAPLID EEL KWS YRA IAEF+ATLLFLY+TV 
Sbjct  1    MAKDIEASGPEAGEFSA-KDYSDPPPAPLIDAEELTKWSLYRAAIAEFVATLLFLYITVA  59

Query  256  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  432
            TVIGYK QTD    G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  60   TVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  119

Query  433  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  612
            LARKVSLVRAV+Y++AQCLGAICG GLVK FQ AY+VRYGGGAN L  GYSKGTGL AEI
Sbjct  120  LARKVSLVRAVLYIIAQCLGAICGVGLVKGFQSAYFVRYGGGANELSAGYSKGTGLAAEI  179

Query  613  IGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA  792
            IGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA
Sbjct  180  IGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGA  239

Query  793  AVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AVIY  DKAWDDQWIFWVGP +GAAIAA YHQYVLRA AAK LGS+RSNA
Sbjct  240  AVIYNNDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSFRSNA  288



>gb|ACU19125.1| unknown [Glycine max]
Length=287

 Score =   454 bits (1168),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 233/287 (81%), Positives = 253/287 (88%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKDVE  TE   Y+A KDY DPPPAPLIDP+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRA++YM+AQC GAICG GL K FQK+YY RYGGG N + DGY+KGT LGAEIIG
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQKSYYNRYGGGVNTVSDGYNKGTALGAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG AV
Sbjct  180  TFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            I+  DKAWDDQWI+WVGPFVGAA+AA YHQY+ RA A KALGS+RSN
Sbjct  240  IFNNDKAWDDQWIYWVGPFVGAAVAAFYHQYIFRAAAIKALGSFRSN  286



>ref|XP_003563177.1| PREDICTED: probable aquaporin PIP2-1 [Brachypodium distachyon]
Length=290

 Score =   454 bits (1168),  Expect = 8e-156, Method: Compositional matrix adjust.
 Identities = 239/290 (82%), Positives = 254/290 (88%), Gaps = 5/290 (2%)
 Frame = +1

Query  88   MAKD----VEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            MAKD      G  +  A KDY DPPPAPLID  EL  WS YRA+IAEFIATLLFLY+TV 
Sbjct  1    MAKDEVMESGGGHQDFAAKDYTDPPPAPLIDAAELASWSLYRAVIAEFIATLLFLYITVA  60

Query  256  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  432
            TVIGYK QTD +  G D  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLF
Sbjct  61   TVIGYKHQTDVSASGPDAACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLF  120

Query  433  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  612
            LARKVSLVRA++YM+AQCLGA+CG GLVKAFQ AY+VRYGGGAN L  GYSKGTGL AEI
Sbjct  121  LARKVSLVRALLYMIAQCLGAMCGVGLVKAFQSAYFVRYGGGANTLAAGYSKGTGLAAEI  180

Query  613  IGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA  792
            IGTFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GA
Sbjct  181  IGTFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGA  240

Query  793  AVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AVI+ KDKAWDDQWIFWVGP VGAAIAA YHQY+LRAGA KALGS+RSNA
Sbjct  241  AVIFNKDKAWDDQWIFWVGPMVGAAIAAFYHQYILRAGAIKALGSFRSNA  290



>dbj|BAA23744.1| HvPIP2;1 [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   454 bits (1167),  Expect = 9e-156, Method: Compositional matrix adjust.
 Identities = 233/287 (81%), Positives = 253/287 (88%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+E A +    + KDY DPPPAP++D EEL KWS YRA+IAEF+ATLLFLY+TV TV
Sbjct  1    MAKDIEAAPQGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVATV  60

Query  262  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            IGYK Q+DP V  TD  C GVG LGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLA
Sbjct  61   IGYKHQSDPTVNTTDAACSGVGTLGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLA  120

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RA++Y++AQCLGAICG GLVK FQ +YYVRYGGGAN L  GYSKGTGL AEIIG
Sbjct  121  RKVSLIRALLYIIAQCLGAICGVGLVKGFQSSYYVRYGGGANELSAGYSKGTGLAAEIIG  180

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAV
Sbjct  181  TFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAV  240

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            IY  DKAWDDQWIFWVGP +GAAIAA YHQYVLRA AAK LGSYRSN
Sbjct  241  IYNTDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSN  286



>ref|XP_006291622.1| hypothetical protein CARUB_v10017773mg [Capsella rubella]
 gb|EOA24520.1| hypothetical protein CARUB_v10017773mg [Capsella rubella]
Length=286

 Score =   454 bits (1167),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 235/284 (83%), Positives = 251/284 (88%), Gaps = 1/284 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KDV G     + KDYQDPPP PL D  ELGKWSFYRA+IAEF+ATLLFLYVTV+TVIG
Sbjct  1    MMKDVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFVATLLFLYVTVMTVIG  60

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTDP++   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPHLH-PDQCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAVMYMVAQCLGAICG  LVK+FQ  YY RYGGGANGL DGYS GTG+ AEIIGTFV
Sbjct  120  SLVRAVMYMVAQCLGAICGVALVKSFQSGYYNRYGGGANGLSDGYSIGTGVAAEIIGTFV  179

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAA+IY 
Sbjct  180  LVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAIIYN  239

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            KDKAWD  WIFWVGPF GAAIAA YHQ+VLRAGA KALGS+RS 
Sbjct  240  KDKAWDHHWIFWVGPFAGAAIAAFYHQFVLRAGAVKALGSFRSQ  283



>gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis]
Length=287

 Score =   454 bits (1167),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 237/287 (83%), Positives = 260/287 (91%), Gaps = 4/287 (1%)
 Frame = +1

Query  88   MAKDVEGATE--YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD+  A +  Y+A KDYQDPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+T+LTV
Sbjct  1    MAKDMGVAEQGSYSA-KDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILTV  59

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGYKSQ DP VK  D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   IGYKSQVDP-VKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RA +YMVAQCLGAICG  LVKAFQ +YY  YGGGAN L  GYSKGTGLGAEIIGT
Sbjct  119  KVSLIRAGLYMVAQCLGAICGVALVKAFQSSYYEVYGGGANELSPGYSKGTGLGAEIIGT  178

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS GAAVI
Sbjct  179  FVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGAAVI  238

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y ++KAW D W+FWVGPF+GAAIAA YHQ++LRAGA KALGS+RS++
Sbjct  239  YNQEKAWHDHWMFWVGPFIGAAIAAFYHQFILRAGAIKALGSFRSSS  285



>gb|AFK47442.1| unknown [Medicago truncatula]
Length=287

 Score =   453 bits (1166),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 238/285 (84%), Positives = 254/285 (89%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE A   + + KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GY  QTD    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYSIQTDVKAGG-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCLGAI G GLVKAFQ AY+ RYGGGAN L DGYS G GLGAEI+GTF
Sbjct  120  VSLIRAIMYMVAQCLGAIAGVGLVKAFQSAYFDRYGGGANFLHDGYSTGVGLGAEIVGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARS G+AVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSLGSAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             KDK WDD WIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  240  NKDKPWDDHWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   453 bits (1166),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 239/288 (83%), Positives = 256/288 (89%), Gaps = 4/288 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAP---KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            M K+VE A E AA    KDY DPPPAPL+D EEL +WS YRA+IAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVAREQAAEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            VIGYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYKVQSDVKADG-DICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RAV+YMVAQCLGAICG GLVK FQ AYYVRYGGGAN +  G++KG GL AEIIG
Sbjct  120  RKVSLIRAVLYMVAQCLGAICGVGLVKGFQSAYYVRYGGGANVMAPGHTKGVGLAAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  180  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY +DKAWD+ WIFWVGPF+GA  AAVYHQ++LRAGA KALGS+RSNA
Sbjct  240  IYNQDKAWDEHWIFWVGPFIGAFAAAVYHQFILRAGAIKALGSFRSNA  287



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score =   453 bits (1166),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 239/285 (84%), Positives = 254/285 (89%), Gaps = 5/285 (2%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            M KDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA++YMVAQCLGAICG GLVKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYDRYGGGANELSTGYSKGTGLGAEIIGTF  176

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  236

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
              +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RS 
Sbjct  237  NNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKALGSFRST  281



>emb|CDX67611.1| BnaA07g16510D [Brassica napus]
Length=286

 Score =   453 bits (1166),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 232/285 (81%), Positives = 252/285 (88%), Gaps = 1/285 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KDV G     + KDYQDPPP PL D  ELG+WSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKDVAGEKGSFSGKDYQDPPPEPLFDATELGRWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTLN-PDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  119

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            +LVRAVMYMVAQCLGAICG  LVK+FQ +YY RYGGGANGL  GYS GTG+ AEIIGTFV
Sbjct  120  TLVRAVMYMVAQCLGAICGVALVKSFQSSYYTRYGGGANGLTHGYSIGTGVAAEIIGTFV  179

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAA+IY 
Sbjct  180  LVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAIIYN  239

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            KD+AWD  WIFWVGPF GAA+AA YHQ+VLRAGA KALGS+RS +
Sbjct  240  KDQAWDHHWIFWVGPFAGAALAAFYHQFVLRAGAVKALGSFRSQS  284



>ref|XP_006403691.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
 gb|ESQ45144.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
Length=287

 Score =   453 bits (1166),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 234/286 (82%), Positives = 254/286 (89%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEGAT-EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE    E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVPGEGFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   GYKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRA++YMVAQCLGAICG G VKAFQ +YY+RYGGGAN L +GYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVKAFQSSYYIRYGGGANSLAEGYSTGTGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIF  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             + K WDD WIFWVGPF+GAAIAA+YHQ+VLRA  +K+LGS+RS A
Sbjct  240  NESKPWDDHWIFWVGPFIGAAIAAIYHQFVLRASGSKSLGSFRSAA  285



>gb|AIK66515.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   453 bits (1165),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 238/285 (84%), Positives = 254/285 (89%), Gaps = 5/285 (2%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            M KDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MTKDVEVAEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQT     G D CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQT----AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  116

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA++YMVAQCLGAICG GLVKAFQ AYY RYGGGAN L  GYSKGTGLGAEIIGTF
Sbjct  117  VSLIRAILYMVAQCLGAICGVGLVKAFQSAYYNRYGGGANELATGYSKGTGLGAEIIGTF  176

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRSARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  236

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
              +KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RS 
Sbjct  237  NNEKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAIKALGSFRST  281



>ref|XP_008366675.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=281

 Score =   453 bits (1165),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 237/284 (83%), Positives = 255/284 (90%), Gaps = 6/284 (2%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KD+E    Y+A KDYQDPPP PLID EELGKWSFYRAIIAEFIATLLFLY+TVLTVIG
Sbjct  1    MGKDIEVGGGYSA-KDYQDPPPEPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTD  + G D+CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGL LARKV
Sbjct  60   YKSQTDTALNG-DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLLLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRA++YM AQ LGAICG GLVKAFQ +YY +YGGGAN L DGYS GTGLGAEI+GTFV
Sbjct  119  SLVRAILYMTAQSLGAICGVGLVKAFQSSYYTKYGGGANELADGYSTGTGLGAEIVGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             DKAW+DQWIFWVGPF    IAA+YHQY+LRAGA KALGS+RS+
Sbjct  239  NDKAWNDQWIFWVGPF----IAALYHQYILRAGAVKALGSFRSS  278



>gb|ACU21481.1| unknown [Glycine max]
Length=287

 Score =   453 bits (1165),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 232/288 (81%), Positives = 253/288 (88%), Gaps = 4/288 (1%)
 Frame = +1

Query  88   MAKDVEGATE---YAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            MAKDVE  TE   Y+A KDY DPPPAPLI P+EL KWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQGEYSA-KDYHDPPPAPLIHPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            +IGYK Q+D  + G  EC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSLVRA++YM+AQC GAICG GL K FQK++Y RYGGG N + DGY+K T LGAEIIG
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQKSFYNRYGGGVNTVSDGYNKSTALGAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIP+TGTGINPARSFG AV
Sbjct  180  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPVTGTGINPARSFGPAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            I+  DKAWDDQWI+WVGPFVGAA+AA+YHQY+LR  A KALGS+RSNA
Sbjct  240  IFNNDKAWDDQWIYWVGPFVGAAVAAIYHQYILRGSAIKALGSFRSNA  287



>dbj|BAG68661.1| plasma membrane intrinsic protein [Tulipa gesneriana]
Length=288

 Score =   453 bits (1165),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 241/288 (84%), Positives = 253/288 (88%), Gaps = 3/288 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAP--KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            MAKD E A    A   KDY DPPPAP +   EL KWSFYRA+IAEFIATLLFLY+TV TV
Sbjct  1    MAKDPEAAAGAPAFTAKDYTDPPPAPFLGVGELAKWSFYRAVIAEFIATLLFLYITVATV  60

Query  262  IGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            IGYK Q+DPN+   +  C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL + 
Sbjct  61   IGYKHQSDPNLSTPNAGCEGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLVG  120

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RAV YMVAQCLGAICG G VKAFQKA+YVRYGGGAN L  GYSKGTGL AEIIG
Sbjct  121  RKVSLIRAVFYMVAQCLGAICGVGFVKAFQKAFYVRYGGGANELSAGYSKGTGLAAEIIG  180

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  181  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  240

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY KDKAWDDQWIFWVGPF+GAAIAA YHQYVLRAGA KALGS+RSNA
Sbjct  241  IYNKDKAWDDQWIFWVGPFIGAAIAAAYHQYVLRAGAIKALGSFRSNA  288



>ref|NP_191042.1| putative aquaporin PIP2-5 [Arabidopsis thaliana]
 sp|Q9SV31.1|PIP25_ARATH RecName: Full=Probable aquaporin PIP2-5; AltName: Full=Plasma 
membrane intrinsic protein 2-5; Short=AtPIP2;5; AltName: Full=Plasma 
membrane intrinsic protein 2d; Short=PIP2d; Contains: 
RecName: Full=Probable aquaporin PIP2-5, N-terminally processed 
[Arabidopsis thaliana]
 gb|AAK44166.1|AF370351_1 putative aquaporin/MIP protein [Arabidopsis thaliana]
 emb|CAB41102.1| aquaporin/MIP-like protein [Arabidopsis thaliana]
 gb|AAL34155.1| putative aquaporin/MIP protein [Arabidopsis thaliana]
 gb|AAM61408.1| aquaporin/MIP-like protein [Arabidopsis thaliana]
 gb|AAN31817.1| putative aquaporin/plasma membrane intrinsic protein [Arabidopsis 
thaliana]
 gb|AEE79295.1| putative aquaporin PIP2-5 [Arabidopsis thaliana]
Length=286

 Score =   453 bits (1165),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 251/284 (88%), Gaps = 1/284 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEFIATLLFLYVT++TVIG
Sbjct  1    MTKEVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFIATLLFLYVTIMTVIG  60

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPALN-PDQCTGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            +LVRAVMYMVAQCLGAICG  LVKAFQ AY+ RYGGGANGL DGYS GTG+ AEIIGTFV
Sbjct  120  TLVRAVMYMVAQCLGAICGVALVKAFQSAYFTRYGGGANGLSDGYSIGTGVAAEIIGTFV  179

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAA+IY 
Sbjct  180  LVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAIIYN  239

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            KDKAWD  WIFWVGPF GAAIAA YHQ+VLRAGA KALGS+RS 
Sbjct  240  KDKAWDHHWIFWVGPFAGAAIAAFYHQFVLRAGAIKALGSFRSQ  283



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score =   452 bits (1163),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 239/285 (84%), Positives = 255/285 (89%), Gaps = 6/285 (2%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            M+KDVE A + A + KDY DPPPA LID EEL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MSKDVEVAEQPAYSAKDYHDPPPARLIDMEELIKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQT      TD CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTT-----TDPCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  115

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL RAV+YMVAQCLGAICG GLVKAFQK+Y+ RYGGGAN +  GY+KGT LGAEIIGTF
Sbjct  116  VSLFRAVLYMVAQCLGAICGVGLVKAFQKSYFDRYGGGANEVASGYNKGTALGAEIIGTF  175

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY
Sbjct  176  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  235

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
               KAWDDQWIFWVGPF GAAIAA YHQ++LRA A KALGS+RSN
Sbjct  236  NNSKAWDDQWIFWVGPFAGAAIAAFYHQFILRAAAIKALGSFRSN  280



>emb|CDY07519.1| BnaC06g15450D [Brassica napus]
Length=286

 Score =   452 bits (1163),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 232/285 (81%), Positives = 252/285 (88%), Gaps = 1/285 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M KDV G     + KDYQDPPP PL D  ELG+WSFYRA+IAEFIATLLFLYVTV+TVIG
Sbjct  1    MTKDVAGEKGSFSGKDYQDPPPEPLFDATELGRWSFYRALIAEFIATLLFLYVTVMTVIG  60

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  61   YKSQTDPTLY-PDQCAGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  119

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            +LVRAVMYMVAQCLGAICG  LVK+FQ +YY RYGGGANGL  GYS GTG+ AEIIGTFV
Sbjct  120  TLVRAVMYMVAQCLGAICGVALVKSFQSSYYTRYGGGANGLTHGYSIGTGVAAEIIGTFV  179

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAA+IY 
Sbjct  180  LVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAIIYN  239

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            KD+AWD  WIFWVGPF GAA+AA YHQ+VLRAGA KALGS+RS +
Sbjct  240  KDQAWDHHWIFWVGPFAGAALAAFYHQFVLRAGAVKALGSFRSQS  284



>ref|XP_008233329.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=287

 Score =   452 bits (1163),  Expect = 3e-155, Method: Compositional matrix adjust.
 Identities = 239/285 (84%), Positives = 253/285 (89%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE A   + + KDY DPPPAPL D  EL KWSFYRA+IAEFIATLLFLYVTVLTVI
Sbjct  1    MAKDVEVAERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQTD  V   D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTDTAVNA-DACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAV+YMVAQ LGAI G  LVKAFQK+YY +YGGGAN L  GYS G GLGAEIIGTF
Sbjct  120  VSLVRAVLYMVAQSLGAIAGVALVKAFQKSYYTKYGGGANELSQGYSTGVGLGAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             K KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  240  NKKKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  284



>ref|XP_009593453.1| PREDICTED: aquaporin PIP2-2-like [Nicotiana tomentosiformis]
Length=283

 Score =   452 bits (1162),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 233/285 (82%), Positives = 253/285 (89%), Gaps = 4/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAK+V     +   KDYQDPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKNVNSEGSFTT-KDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ+      +D C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQSATT---SDPCAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  116

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RA+MYMVAQCLGAICG GLVKAFQ AYY RY GGAN L DGYS G GL AEIIGTFV
Sbjct  117  SLIRALMYMVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDGYSHGVGLSAEIIGTFV  176

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+ 
Sbjct  177  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFN  236

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + KAW D WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RS++
Sbjct  237  QHKAWKDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSSS  281



>emb|CDY46759.1| BnaA03g17030D [Brassica napus]
Length=285

 Score =   452 bits (1163),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 235/285 (82%), Positives = 252/285 (88%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKD EGA  +A  +DYQDPPPAP  D EEL +WS YRA+IAEF+ATLLFLYVTVLTV+G
Sbjct  1    MAKDAEGAEGFAT-RDYQDPPPAPFFDAEELTRWSLYRAVIAEFVATLLFLYVTVLTVMG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK  +D    G  ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKISSDTAAGGV-ECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            +LVRA++YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  TLVRALLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + K WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  239  ESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|XP_010555818.1| PREDICTED: probable aquaporin PIP2-5 [Tarenaya hassleriana]
Length=287

 Score =   452 bits (1163),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 235/286 (82%), Positives = 253/286 (88%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKDV     ++  KDY DPPPAP+ D  ELGKWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKDVAEQGSFSG-KDYHDPPPAPVFDTAELGKWSFYRAVIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVK-GTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            YKSQTD  +  G D+CGGVGILGIAWAFGGMIFILVYCT GISGGHINPAVTFGL LARK
Sbjct  60   YKSQTDATLNAGADQCGGVGILGIAWAFGGMIFILVYCTGGISGGHINPAVTFGLLLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAVMY+VAQCLGAICG GLVKAFQ +YY RYGGGAN L DGYS G G+GAEIIGTF
Sbjct  120  VSLVRAVMYIVAQCLGAICGVGLVKAFQSSYYSRYGGGANSLADGYSVGVGVGAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKRNARDSHVPVLAPLPIGF+VFMVHLATIPITGTGINPARS GAAVIY
Sbjct  180  VLVYTVFSATDPKRNARDSHVPVLAPLPIGFSVFMVHLATIPITGTGINPARSLGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             ++KAWDD WIFWVGPF GAAIAA YHQ+VLRA AAKA+GS+ S +
Sbjct  240  NQEKAWDDHWIFWVGPFAGAAIAAFYHQFVLRAAAAKAIGSFMSQS  285



>ref|XP_010505294.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   452 bits (1162),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 236/285 (83%), Positives = 252/285 (88%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAK VEGA  Y A +DY+DPPP P  D +EL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKGVEGAEGYQA-RDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGYS GTGL AEIIGTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYSTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + K WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  239  ESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>ref|XP_003575410.1| PREDICTED: aquaporin PIP2-4 [Brachypodium distachyon]
Length=288

 Score =   452 bits (1163),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 238/290 (82%), Positives = 256/290 (88%), Gaps = 7/290 (2%)
 Frame = +1

Query  88   MAKDVEGAT----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvl  255
            MAKD+E +     E++A KDY DPPPAP++D EEL KWS YRA IAEF+ATLLFLY+TV 
Sbjct  1    MAKDIEASAPEGGEFSA-KDYSDPPPAPIVDFEELTKWSLYRAAIAEFVATLLFLYITVA  59

Query  256  tvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  432
            TVIGYK QTD +  G D  CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLF
Sbjct  60   TVIGYKHQTDVSASGPDAACGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLF  119

Query  433  LARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEI  612
            LARKVSLVRAV+Y+VAQCLGAICG GLVK FQ AYYVRYGGGAN L  GYSKGTGL AEI
Sbjct  120  LARKVSLVRAVLYIVAQCLGAICGVGLVKGFQSAYYVRYGGGANELSAGYSKGTGLAAEI  179

Query  613  IGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGA  792
            IGTFVLVYTVF+ATDPKRNARDSH+PVLAPLPIGFAVFMVHLATIPITGTGINPARS GA
Sbjct  180  IGTFVLVYTVFSATDPKRNARDSHIPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGA  239

Query  793  AVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            AVIY  DKAWDDQWIFWVGP +GAAIAA YHQYVLRA AAK LGSYRS++
Sbjct  240  AVIYNTDKAWDDQWIFWVGPLIGAAIAAAYHQYVLRASAAK-LGSYRSSS  288



>ref|XP_009780213.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana sylvestris]
 tpg|DAA64686.1| TPA_exp: aquaporin PIP2 9b [Nicotiana tabacum]
Length=287

 Score =   452 bits (1162),  Expect = 4e-155, Method: Compositional matrix adjust.
 Identities = 238/288 (83%), Positives = 255/288 (89%), Gaps = 4/288 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA---APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            M K+VE ATE     + KDY DPPPAPL+D EEL +WS YRA+IAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVATEQPTEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            VIGYK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYKVQSDVKADG-DICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN +  G++KG GL AEIIG
Sbjct  120  RKVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANVMAPGHTKGVGLAAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  180  TFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY  DKAWD+ WIFWVGPF+GA  AAVYHQ++LRAGA KALGS+RSNA
Sbjct  240  IYNHDKAWDEHWIFWVGPFIGAFAAAVYHQFILRAGAIKALGSFRSNA  287



>ref|XP_002316367.1| putative aquaporin family protein [Populus trichocarpa]
 gb|ABK92446.1| unknown [Populus trichocarpa]
 gb|EEF02538.1| putative aquaporin family protein [Populus trichocarpa]
Length=285

 Score =   452 bits (1162),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 237/284 (83%), Positives = 255/284 (90%), Gaps = 4/284 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD+E A   + + KDY DPPPAPL D +EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDMEVAEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ D +    D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQIDGS---ADSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  117

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RAVMYMVAQCLGAICG GLVKAFQK+YY +YGGGAN L DG+S GTGLGAEIIGTF
Sbjct  118  VSLIRAVMYMVAQCLGAICGVGLVKAFQKSYYKKYGGGANTLADGFSTGTGLGAEIIGTF  177

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  178  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  237

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRS  936
             +DKAWD  WIFWVGPF GAAIAA YHQ++LRAGA KALGS+RS
Sbjct  238  NQDKAWDGHWIFWVGPFAGAAIAAFYHQFILRAGAVKALGSFRS  281



>ref|XP_011077012.1| PREDICTED: probable aquaporin PIP2-5 [Sesamum indicum]
Length=281

 Score =   452 bits (1162),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 238/285 (84%), Positives = 252/285 (88%), Gaps = 6/285 (2%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M K+V     Y A KDY DPPPAPLID EEL KWSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MTKEVAEHGSYGA-KDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ+       D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQS-----AADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  114

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAVMYMVAQCLGAICG GLVKAFQ+++Y RYGGGANGL DGYS G GL AEIIGTFV
Sbjct  115  SLVRAVMYMVAQCLGAICGVGLVKAFQRSHYKRYGGGANGLSDGYSVGVGLAAEIIGTFV  174

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI  
Sbjct  175  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVILN  234

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             D+AW D WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RS +
Sbjct  235  DDEAWHDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSGS  279



>ref|XP_004307390.1| PREDICTED: aquaporin PIP2-1 [Fragaria vesca subsp. vesca]
Length=285

 Score =   451 bits (1161),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 240/285 (84%), Positives = 254/285 (89%), Gaps = 4/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE A   + + KDYQDPPPAPL D  EL KWSFYRA+IAEFIATLLFLY+TVLTVI
Sbjct  1    MAKDVEVAERGSFSAKDYQDPPPAPLFDSVELTKWSFYRAVIAEFIATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQ D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQID---LGGDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  117

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRAVMY+VAQ LGAI G GLVKAFQK+YY +YGGGAN L +GYS G GL AEIIGTF
Sbjct  118  VSLVRAVMYIVAQSLGAIAGVGLVKAFQKSYYTKYGGGANELAEGYSTGVGLAAEIIGTF  177

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  178  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  237

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
             K KAWDDQWIFWVGPF+GAAIAA YHQ++LRAGA KALGS+RSN
Sbjct  238  DKKKAWDDQWIFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSN  282



>emb|CDY13298.1| BnaC06g14590D [Brassica napus]
Length=287

 Score =   451 bits (1161),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 235/286 (82%), Positives = 253/286 (88%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEG-ATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKDVE  A E    +DYQDPPPAPL DPEEL KWSFYRA+IAEF+ATLLFLY+TVLTVI
Sbjct  1    MAKDVEAVAGEGFQSRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
             YK QTD    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARK
Sbjct  61   CYKIQTDSTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSLVRA++YMVAQCLGAICG G V+AFQ +YYVRYGGGAN L DGYS GTGL AEIIGTF
Sbjct  120  VSLVRAILYMVAQCLGAICGVGFVQAFQSSYYVRYGGGANSLADGYSTGTGLAAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+
Sbjct  180  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIF  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
             + K WDD WIFW+GPF+GAAIAAVYHQ+VLRA  +K+LGS+RS A
Sbjct  240  NESKPWDDHWIFWLGPFIGAAIAAVYHQFVLRASGSKSLGSFRSAA  285



>ref|XP_009772697.1| PREDICTED: aquaporin PIP2-2-like [Nicotiana sylvestris]
Length=283

 Score =   451 bits (1161),  Expect = 7e-155, Method: Compositional matrix adjust.
 Identities = 236/285 (83%), Positives = 253/285 (89%), Gaps = 4/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAK+V G+      KDYQDPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKNV-GSEGSFTTKDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQ+      TD C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKSQS---ATATDPCAGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  116

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RAVMYMVAQCLGAICG GLVKAFQ AYY RY GGAN L D YS G GL AEIIGTFV
Sbjct  117  SLIRAVMYMVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDDYSHGVGLSAEIIGTFV  176

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+ 
Sbjct  177  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFN  236

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + KAW D WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RS++
Sbjct  237  QHKAWKDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSSS  281



>gb|AJT55764.1| aquaporin plasma intrinsic protein 3 [Allium sativum]
Length=291

 Score =   451 bits (1161),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 231/279 (83%), Positives = 251/279 (90%), Gaps = 3/279 (1%)
 Frame = +1

Query  112  TEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIGYKSQTDPN  291
            T++ A KDY DPPPAPL D  EL KWS YRA+IAEF+ATLLFLY+TV TVIGY  Q+D  
Sbjct  14   TQFTA-KDYTDPPPAPLFDMGELTKWSLYRAVIAEFVATLLFLYITVATVIGYSHQSDAT  72

Query  292  VKGTDE--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAV  465
            + G  +  C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKVSL+RA+
Sbjct  73   IPGNTDAHCSGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLIRAL  132

Query  466  MYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFVLVYTVF  645
            +YM+AQCLGAICG G VKAFQ AYY +YGGGAN L+DGY+KGTGL AEIIGTFVLVYTVF
Sbjct  133  LYMIAQCLGAICGVGFVKAFQSAYYSKYGGGANSLKDGYNKGTGLAAEIIGTFVLVYTVF  192

Query  646  AATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYGKDKAWD  825
            AATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY KDKAWD
Sbjct  193  AATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYNKDKAWD  252

Query  826  DQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            DQWIFWVGPF+GAAIAA YHQYVLRAGA KALGS+RSNA
Sbjct  253  DQWIFWVGPFIGAAIAAAYHQYVLRAGAVKALGSFRSNA  291



>ref|XP_010516024.1| PREDICTED: probable aquaporin PIP2-5 [Camelina sativa]
Length=286

 Score =   451 bits (1160),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 234/284 (82%), Positives = 250/284 (88%), Gaps = 1/284 (0%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            M K+V G     + KDYQDPPP PL D  ELGKWSFYRA+IAEF+ATLLFLYVTV+TVIG
Sbjct  1    MTKEVVGDKRSFSGKDYQDPPPEPLFDATELGKWSFYRALIAEFVATLLFLYVTVMTVIG  60

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YKSQTDP +   D+C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LARKV
Sbjct  61   YKSQTDPALH-PDQCAGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLARKV  119

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SLVRAVMYMVAQCLGAICG  LVK+FQ  YY RYGGGANGL DGYS GTG+ AEIIGTFV
Sbjct  120  SLVRAVMYMVAQCLGAICGVALVKSFQSGYYNRYGGGANGLSDGYSVGTGVAAEIIGTFV  179

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAA+IY 
Sbjct  180  LVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFIVHLATIPITGTGINPARSLGAAIIYN  239

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSN  939
            KDKAWD  WIFWVGPF GAAIAA YHQ+VLRAGA KALGS+RS 
Sbjct  240  KDKAWDHHWIFWVGPFAGAAIAAFYHQFVLRAGAIKALGSFRSQ  283



>ref|XP_010516975.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   451 bits (1160),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 234/285 (82%), Positives = 252/285 (88%), Gaps = 2/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAKDVEG   + + +DY+DPPP P  D EEL KWS YRA+IAEF+ATLLFLYVTVLTVIG
Sbjct  1    MAKDVEGPEGFQS-RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK Q+D    G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKIQSDTTAGGVD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  118

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RAV+YMVAQCLGAICG G VKAFQ AYYVRYGGGAN L DGY+ GTGL AEIIGTFV
Sbjct  119  SLIRAVLYMVAQCLGAICGVGFVKAFQSAYYVRYGGGANSLADGYNTGTGLAAEIIGTFV  178

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI+ 
Sbjct  179  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIFN  238

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + K WDD WIFWVGPF+GAAIAA YHQ+VLRA  +K+LGS+RS A
Sbjct  239  ESKPWDDHWIFWVGPFIGAAIAAFYHQFVLRASGSKSLGSFRSAA  283



>gb|ABX83874.1| plasma membrane intrinsic protein [Rhododendron catawbiense]
Length=284

 Score =   451 bits (1160),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 234/286 (82%), Positives = 257/286 (90%), Gaps = 5/286 (2%)
 Frame = +1

Query  88   MAKDVEGATEYA-APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAK++  A + + + KDY DPPPAPLIDP+EL KWSFYRA+IAEFI TLLFLY+TVLTVI
Sbjct  1    MAKEMGVAEQGSFSAKDYHDPPPAPLIDPQELVKWSFYRAVIAEFITTLLFLYITVLTVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GYKSQTD      D CGGVGILGIAW+FGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYKSQTD----NADPCGGVGILGIAWSFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  116

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA+MYMVAQCLGAICG  LVKAFQK++Y RYGGGAN L  GYSKGTGL AEIIGTF
Sbjct  117  VSLIRALMYMVAQCLGAICGVALVKAFQKSHYDRYGGGANSLALGYSKGTGLAAEIIGTF  176

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
            VLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVIY
Sbjct  177  VLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIY  236

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
              DKAW+DQW+FWVGPF+GAAIAA YHQ++LRAGA KALGS+RS +
Sbjct  237  NNDKAWNDQWMFWVGPFIGAAIAAFYHQFILRAGAVKALGSFRSGS  282



>ref|XP_004493972.1| PREDICTED: probable aquaporin PIP2-5-like [Cicer arietinum]
Length=287

 Score =   451 bits (1160),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 232/286 (81%), Positives = 253/286 (88%), Gaps = 2/286 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAP-KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvI  264
            MAKD++   + A P KDYQDPPPAPL D  EL +WSFYRA+IAEF+ATLLFLYVTV TVI
Sbjct  1    MAKDIQTEPQTALPNKDYQDPPPAPLFDTSELSQWSFYRALIAEFVATLLFLYVTVATVI  60

Query  265  GYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARK  444
            GY SQTDP   GT  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARK
Sbjct  61   GYNSQTDPAHNGT-ACDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARK  119

Query  445  VSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTF  624
            VSL+RA++YMV QCLGAICG GLVK FQK+YY RY GGAN L +GYSKGTGLGAEIIGTF
Sbjct  120  VSLIRAILYMVVQCLGAICGVGLVKGFQKSYYNRYKGGANMLSNGYSKGTGLGAEIIGTF  179

Query  625  VLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIY  804
             LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVF+VHLATIPITGTGINPARS GAAVIY
Sbjct  180  FLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFVVHLATIPITGTGINPARSLGAAVIY  239

Query  805  GKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
               KAWD  WIFWVGPF+GAAIAA+YHQ+VLRA AAKALGS++S++
Sbjct  240  NNHKAWDHHWIFWVGPFIGAAIAAIYHQFVLRAQAAKALGSFKSSS  285



>ref|XP_009615789.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
Length=287

 Score =   451 bits (1160),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 238/288 (83%), Positives = 255/288 (89%), Gaps = 4/288 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAP---KDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvlt  258
            M+K+VE  +E  A    KDY DPPP PLID EEL KWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MSKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  259  vIGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  438
            VIGYK Q+D    G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   VIGYKHQSDTK-DGGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLA  119

Query  439  RKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIG  618
            RKVSL+RAV+YMV+QCLGAICG GLVKAFQKAYY RYGGG N +  G++KG GLGAEIIG
Sbjct  120  RKVSLIRAVLYMVSQCLGAICGVGLVKAFQKAYYNRYGGGVNVMAGGHNKGVGLGAEIIG  179

Query  619  TFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  798
            TFVLVYTVF+ATDPKR+ARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV
Sbjct  180  TFVLVYTVFSATDPKRSARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAV  239

Query  799  IYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            IY +DKAWD+ WIFWVGPFVGA  AAVYHQY+LRAGA KALGS+RSNA
Sbjct  240  IYNQDKAWDEHWIFWVGPFVGAFAAAVYHQYILRAGALKALGSFRSNA  287



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score =   451 bits (1159),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 236/287 (82%), Positives = 254/287 (89%), Gaps = 3/287 (1%)
 Frame = +1

Query  88   MAKDVEGATEYA--APKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltv  261
            M K+VE  TE    + KDY DPPPAPL+D EEL +WSFYRAIIAEFIATLLFLY+T+LTV
Sbjct  1    MTKEVESVTERGEFSAKDYTDPPPAPLVDFEELTQWSFYRAIIAEFIATLLFLYITILTV  60

Query  262  IGYKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  441
            IGY+ Q D +  G D CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   IGYQHQADVDAGG-DVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  442  KVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGT  621
            KVSL+RAV+YMVAQCLGAICG G VKAFQ AYY RYGGG N +  G++KG GLGAEIIGT
Sbjct  120  KVSLIRAVLYMVAQCLGAICGVGFVKAFQSAYYNRYGGGVNVMAAGHNKGVGLGAEIIGT  179

Query  622  FVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  801
            FVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI
Sbjct  180  FVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVI  239

Query  802  YGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            Y  DKAWD+ WIFWVGPF+GA IAA YHQ+VLRAGA KALGS+RSNA
Sbjct  240  YNGDKAWDEHWIFWVGPFIGAFIAAFYHQFVLRAGAIKALGSFRSNA  286



>tpg|DAA64687.1| TPA_exp: aquaporin PIP2 10 [Nicotiana tabacum]
Length=283

 Score =   451 bits (1159),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 232/285 (81%), Positives = 253/285 (89%), Gaps = 4/285 (1%)
 Frame = +1

Query  88   MAKDVEGATEYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtvltvIG  267
            MAK+V     +   KDYQDPPPAPLIDPEEL +WSFYRA+IAEFIATLLFLY+TVLTVIG
Sbjct  1    MAKNVNSEGSFTT-KDYQDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLTVIG  59

Query  268  YKSQTDPNVKGTDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV  447
            YK+Q+      +D C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV
Sbjct  60   YKNQSATT---SDPCAGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKV  116

Query  448  SLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAEIIGTFV  627
            SL+RA+MYMVAQCLGAICG GLVKAFQ AYY RY GGAN L DGYS G GL AEIIGTFV
Sbjct  117  SLIRALMYMVAQCLGAICGVGLVKAFQSAYYHRYDGGANMLSDGYSHGVGLSAEIIGTFV  176

Query  628  LVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFGAAVIYG  807
            LVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS GAAVI+ 
Sbjct  177  LVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLGAAVIFN  236

Query  808  KDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRSNA  942
            + KAW D WIFWVGPF+GAAIAA YHQ++LRAGAAKALGS+RS++
Sbjct  237  QHKAWKDHWIFWVGPFIGAAIAAFYHQFILRAGAAKALGSFRSSS  281



>ref|XP_002446796.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
 gb|EES11124.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
Length=292

 Score =   451 bits (1160),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 240/291 (82%), Positives = 253/291 (87%), Gaps = 10/291 (3%)
 Frame = +1

Query  88   MAKDVEGAT-------EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyv  246
            MAKD+E A        EY A KDY DPPPAPL+D EEL KWS YRA+IAEF+ATLLFLY+
Sbjct  1    MAKDIEAAAAAHGGGGEYTA-KDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYI  59

Query  247  tvltvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTF  423
            TV TVIGYK QTD +  G D  CGGVGILGIAWAFGGMIFILVYCTAG+SGGHINPAVTF
Sbjct  60   TVATVIGYKHQTDASSSGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTF  119

Query  424  GLFLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLG  603
            GLFLARKVSLVRA++Y+VAQCLGAICG GLVK FQ A+YVRYGGGANGL DGYSKGTGL 
Sbjct  120  GLFLARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAFYVRYGGGANGLSDGYSKGTGLA  179

Query  604  AEIIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS  783
            AEIIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS
Sbjct  180  AEIIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS  239

Query  784  FGAAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRS  936
             GAAVIY  DK WDD WIFWVGPF+GAAIAA YHQYVLRA AAK LGS  S
Sbjct  240  LGAAVIYNNDKTWDDHWIFWVGPFIGAAIAAAYHQYVLRASAAK-LGSSAS  289



>ref|XP_004976254.1| PREDICTED: aquaporin PIP2-5-like [Setaria italica]
Length=290

 Score =   451 bits (1159),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 240/289 (83%), Positives = 251/289 (87%), Gaps = 8/289 (3%)
 Frame = +1

Query  88   MAKDVEGAT-----EYAAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIAtllflyvtv  252
            MAKD+E A      EY A KDY DPPPAPLID EEL KWS YRA+IAEF+ATLLFLY+TV
Sbjct  1    MAKDIEAAAAPEGGEYTA-KDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITV  59

Query  253  ltvIGYKSQTDPNVKGTDE-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  429
             TVIGYK QTD    G D  CGGVGILGIAWAFGGMIFILVYCTAG+SGGHINPAVT GL
Sbjct  60   ATVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTLGL  119

Query  430  FLARKVSLVRAVMYMVAQCLGAICGCGLVKAFQKAYYVRYGGGANGLQDGYSKGTGLGAE  609
            FLARKVSLVRA++Y+VAQCLGAICG GLVK FQ AYYVRYGGGAN L DGYSKGTGL AE
Sbjct  120  FLARKVSLVRALLYIVAQCLGAICGVGLVKGFQSAYYVRYGGGANELSDGYSKGTGLAAE  179

Query  610  IIGTFVLVYTVFAATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSFG  789
            IIGTFVLVYTVF+ATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARS G
Sbjct  180  IIGTFVLVYTVFSATDPKRNARDSHVPVLAPLPIGFAVFMVHLATIPITGTGINPARSLG  239

Query  790  AAVIYGKDKAWDDQWIFWVGPFVGAAIAAVYHQYVLRAGAAKALGSYRS  936
            AAVIY  DKAWDD WIFWVGPF+GAAIAA YHQYVLRA A+K LGS  S
Sbjct  240  AAVIYNNDKAWDDHWIFWVGPFIGAAIAAAYHQYVLRASASK-LGSSAS  287



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3502287554740