BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig9016

Length=921
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009616023.1|  PREDICTED: uncharacterized protein LOC104108647    266   9e-78   Nicotiana tomentosiformis
ref|XP_009783972.1|  PREDICTED: uncharacterized protein LOC104232454    263   2e-76   Nicotiana sylvestris
ref|XP_006344767.1|  PREDICTED: uncharacterized protein LOC102580046    255   1e-73   Solanum tuberosum [potatoes]
ref|XP_004230310.1|  PREDICTED: uncharacterized protein LOC101249681    249   2e-71   
ref|XP_008246002.1|  PREDICTED: uncharacterized protein LOC103344152    235   1e-66   Prunus mume [ume]
ref|XP_007208429.1|  hypothetical protein PRUPE_ppa000798mg             233   8e-66   Prunus persica
ref|XP_009373286.1|  PREDICTED: uncharacterized protein LOC103962316    232   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_002512512.1|  conserved hypothetical protein                     231   4e-65   
ref|XP_008370375.1|  PREDICTED: uncharacterized protein LOC103433867    230   8e-65   Malus domestica [apple tree]
emb|CDP18254.1|  unnamed protein product                                227   1e-63   Coffea canephora [robusta coffee]
gb|EYU40497.1|  hypothetical protein MIMGU_mgv1a000785mg                225   4e-63   Erythranthe guttata [common monkey flower]
ref|XP_012088889.1|  PREDICTED: uncharacterized protein LOC105647...    225   5e-63   Jatropha curcas
ref|XP_012088883.1|  PREDICTED: uncharacterized protein LOC105647...    225   5e-63   Jatropha curcas
ref|XP_008359849.1|  PREDICTED: uncharacterized protein LOC103423542    223   2e-62   
ref|XP_002282109.1|  PREDICTED: uncharacterized protein LOC100264846    223   2e-62   Vitis vinifera
ref|XP_011092150.1|  PREDICTED: uncharacterized protein LOC105172430    221   2e-61   Sesamum indicum [beniseed]
ref|XP_011466140.1|  PREDICTED: uncharacterized protein LOC101313...    219   8e-61   Fragaria vesca subsp. vesca
ref|XP_004302237.1|  PREDICTED: uncharacterized protein LOC101313...    218   1e-60   Fragaria vesca subsp. vesca
gb|KDO81672.1|  hypothetical protein CISIN_1g0461821mg                  217   1e-60   Citrus sinensis [apfelsine]
ref|XP_006472204.1|  PREDICTED: uncharacterized protein LOC102623618    218   2e-60   Citrus sinensis [apfelsine]
gb|KJB45453.1|  hypothetical protein B456_007G306600                    217   3e-60   Gossypium raimondii
gb|KHG26707.1|  Efr3b                                                   217   5e-60   Gossypium arboreum [tree cotton]
ref|XP_008453377.1|  PREDICTED: uncharacterized protein LOC103494111    216   7e-60   Cucumis melo [Oriental melon]
ref|XP_004144747.1|  PREDICTED: uncharacterized protein LOC101202927    215   1e-59   Cucumis sativus [cucumbers]
gb|KHG26706.1|  Protein EFR3 B                                          214   5e-59   Gossypium arboreum [tree cotton]
ref|XP_007031156.1|  Uncharacterized protein isoform 2                  213   1e-58   
ref|XP_007031155.1|  Uncharacterized protein isoform 1                  213   2e-58   
ref|XP_011023781.1|  PREDICTED: uncharacterized protein LOC105125162    212   2e-58   Populus euphratica
ref|XP_006433539.1|  hypothetical protein CICLE_v10000144mg             210   1e-57   Citrus clementina [clementine]
ref|XP_002318950.2|  hypothetical protein POPTR_0013s00990g             209   2e-57   
ref|XP_010024133.1|  PREDICTED: uncharacterized protein LOC104414673    209   2e-57   Eucalyptus grandis [rose gum]
ref|XP_007145003.1|  hypothetical protein PHAVU_007G201500g             207   1e-56   Phaseolus vulgaris [French bean]
ref|XP_010092978.1|  hypothetical protein L484_018915                   207   1e-56   
ref|XP_006589118.1|  PREDICTED: uncharacterized protein LOC100785...    204   1e-55   
ref|XP_003536043.1|  PREDICTED: uncharacterized protein LOC100785...    204   1e-55   Glycine max [soybeans]
gb|KJB81104.1|  hypothetical protein B456_013G129500                    202   5e-55   Gossypium raimondii
gb|KHG02153.1|  Protein EFR3                                            202   8e-55   Gossypium arboreum [tree cotton]
ref|XP_003555181.1|  PREDICTED: uncharacterized protein LOC100788290    201   2e-54   
ref|XP_004495652.1|  PREDICTED: uncharacterized protein LOC101508...    197   4e-53   
gb|KDO81674.1|  hypothetical protein CISIN_1g0373181mg                  183   4e-53   Citrus sinensis [apfelsine]
gb|KEH43106.1|  cyclin-like protein                                     195   2e-52   Medicago truncatula
emb|CAN82509.1|  hypothetical protein VITISV_012725                     186   1e-48   Vitis vinifera
ref|XP_010267987.1|  PREDICTED: uncharacterized protein LOC104605...    183   5e-48   Nelumbo nucifera [Indian lotus]
ref|XP_010267985.1|  PREDICTED: uncharacterized protein LOC104605...    183   5e-48   Nelumbo nucifera [Indian lotus]
ref|XP_008781114.1|  PREDICTED: protein EFR3 homolog cmp44E-like ...    176   2e-45   
ref|XP_008781115.1|  PREDICTED: uncharacterized protein LOC103700...    176   2e-45   Phoenix dactylifera
ref|XP_010546763.1|  PREDICTED: uncharacterized protein LOC104818746    175   3e-45   Tarenaya hassleriana [spider flower]
ref|XP_010921489.1|  PREDICTED: uncharacterized protein LOC105045026    169   4e-43   Elaeis guineensis
ref|XP_006605812.1|  PREDICTED: uncharacterized protein LOC102659728    158   2e-42   
gb|KHN23161.1|  hypothetical protein glysoja_030221                     160   7e-41   Glycine soja [wild soybean]
ref|XP_007031157.1|  Uncharacterized protein isoform 3                  161   7e-41   
ref|XP_009384434.1|  PREDICTED: uncharacterized protein LOC103971...    159   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009384437.1|  PREDICTED: uncharacterized protein LOC103971...    159   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010938250.1|  PREDICTED: uncharacterized protein LOC105057...    158   3e-39   
ref|XP_010938251.1|  PREDICTED: uncharacterized protein LOC105057...    158   3e-39   Elaeis guineensis
dbj|BAD94525.1|  hypothetical protein                                   149   4e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010674649.1|  PREDICTED: protein EFR3 homolog A                  157   5e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006840435.1|  PREDICTED: uncharacterized protein LOC18430213     156   2e-38   Amborella trichopoda
ref|XP_006287016.1|  hypothetical protein CARUB_v10000164mg             150   8e-37   
dbj|BAC41892.1|  unknown protein                                        149   2e-36   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57285.1|  AT5G26850                                              149   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198037.3|  uncharacterized protein                               149   3e-36   Arabidopsis thaliana [mouse-ear cress]
gb|EAY89716.1|  hypothetical protein OsI_11254                          146   2e-35   Oryza sativa Indica Group [Indian rice]
gb|EAZ26671.1|  hypothetical protein OsJ_10574                          146   2e-35   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008808671.1|  PREDICTED: uncharacterized protein LOC103720...    146   3e-35   Phoenix dactylifera
ref|NP_001049903.1|  Os03g0308200                                       146   3e-35   
ref|XP_008808672.1|  PREDICTED: uncharacterized protein LOC103720...    144   2e-34   Phoenix dactylifera
ref|XP_002872241.1|  hypothetical protein ARALYDRAFT_489516             142   8e-34   
ref|XP_006649970.1|  PREDICTED: uncharacterized protein LOC102701065    140   3e-33   Oryza brachyantha
gb|EMS54754.1|  Protein EFR3-like protein A                             139   6e-33   Triticum urartu
ref|XP_010421541.1|  PREDICTED: uncharacterized protein LOC104706...    139   7e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010455044.1|  PREDICTED: uncharacterized protein LOC104736707    139   9e-33   Camelina sativa [gold-of-pleasure]
ref|XP_003558072.1|  PREDICTED: uncharacterized protein LOC100831...    139   1e-32   Brachypodium distachyon [annual false brome]
ref|XP_010228707.1|  PREDICTED: uncharacterized protein LOC100831...    139   1e-32   Brachypodium distachyon [annual false brome]
ref|XP_010421542.1|  PREDICTED: uncharacterized protein LOC104706...    139   1e-32   Camelina sativa [gold-of-pleasure]
ref|XP_009111721.1|  PREDICTED: protein EFR3 homolog B-like             139   1e-32   Brassica rapa
ref|XP_006394915.1|  hypothetical protein EUTSA_v10003593mg             138   2e-32   Eutrema salsugineum [saltwater cress]
emb|CDY19753.1|  BnaA09g04060D                                          138   2e-32   Brassica napus [oilseed rape]
ref|XP_004984608.1|  PREDICTED: uncharacterized protein LOC101782956    138   2e-32   Setaria italica
gb|EMT28557.1|  Protein EFR3-like protein                               137   4e-32   
ref|XP_010493940.1|  PREDICTED: protein EFR3 homolog B-like isofo...    137   4e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010493942.1|  PREDICTED: protein EFR3 homolog B-like isofo...    137   4e-32   Camelina sativa [gold-of-pleasure]
ref|NP_001170324.1|  hypothetical protein                               133   7e-32   
gb|KHN23226.1|  hypothetical protein glysoja_046386                     132   1e-31   Glycine soja [wild soybean]
ref|XP_006394914.1|  hypothetical protein EUTSA_v10003593mg             135   2e-31   Eutrema salsugineum [saltwater cress]
ref|XP_002465372.1|  hypothetical protein SORBIDRAFT_01g037420          135   2e-31   Sorghum bicolor [broomcorn]
emb|CDX87029.1|  BnaC09g03440D                                          133   8e-31   
ref|XP_008646153.1|  PREDICTED: uncharacterized protein LOC100384...    132   2e-30   
ref|XP_008646145.1|  PREDICTED: uncharacterized protein LOC100384...    132   2e-30   Zea mays [maize]
gb|KHN23227.1|  Protein EFR3 like cmp44E                                132   2e-30   Glycine soja [wild soybean]
gb|AAB61061.1|  Hypothetical protein F2P16.24                           127   8e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CDX88246.1|  BnaA06g28370D                                          127   1e-28   
emb|CDX80597.1|  BnaC07g28470D                                          105   2e-21   
ref|XP_002968494.1|  hypothetical protein SELMODRAFT_90004            85.5    6e-15   
gb|AFW84298.1|  hypothetical protein ZEAMMB73_469985                  85.1    7e-15   
gb|ACN33230.1|  unknown                                               85.1    8e-15   Zea mays [maize]
ref|XP_002456786.1|  hypothetical protein SORBIDRAFT_03g042720        84.7    1e-14   
gb|AFW84299.1|  hypothetical protein ZEAMMB73_469985                  83.6    2e-14   
ref|XP_007225374.1|  hypothetical protein PRUPE_ppa000810mg           82.8    4e-14   Prunus persica
ref|XP_004970911.1|  PREDICTED: uncharacterized protein LOC101769...  81.6    9e-14   Setaria italica
ref|XP_004970908.1|  PREDICTED: uncharacterized protein LOC101769...  81.6    1e-13   
ref|XP_002975992.1|  hypothetical protein SELMODRAFT_443103           81.3    1e-13   
ref|XP_008222533.1|  PREDICTED: uncharacterized protein LOC103322398  80.5    2e-13   Prunus mume [ume]
emb|CDM85315.1|  unnamed protein product                              79.3    6e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010097526.1|  hypothetical protein L484_024737                 79.0    7e-13   
ref|XP_006858684.1|  PREDICTED: uncharacterized protein LOC18448561   79.0    8e-13   Amborella trichopoda
ref|XP_009363645.1|  PREDICTED: uncharacterized protein LOC103953608  77.4    2e-12   Pyrus x bretschneideri [bai li]
gb|AAX94774.1|  cyclin-related protein 1                              73.6    3e-11   Cucumis sativus [cucumbers]
ref|XP_006352099.1|  PREDICTED: uncharacterized protein LOC102584...  73.9    4e-11   Solanum tuberosum [potatoes]
ref|XP_006352098.1|  PREDICTED: uncharacterized protein LOC102584...  73.9    4e-11   Solanum tuberosum [potatoes]
ref|NP_001045092.1|  Os01g0898300                                     73.6    4e-11   
gb|EEE55815.1|  hypothetical protein OsJ_04415                        73.6    5e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564842.1|  PREDICTED: uncharacterized protein LOC100842...  73.2    5e-11   Brachypodium distachyon [annual false brome]
ref|XP_008369216.1|  PREDICTED: uncharacterized protein LOC103432787  73.2    6e-11   
ref|XP_010069300.1|  PREDICTED: protein EFR3 homolog B isoform X1     72.8    8e-11   Eucalyptus grandis [rose gum]
gb|KCW57602.1|  hypothetical protein EUGRSUZ_H00374                   72.8    9e-11   Eucalyptus grandis [rose gum]
gb|KCW57606.1|  hypothetical protein EUGRSUZ_H00374                   72.4    9e-11   Eucalyptus grandis [rose gum]
ref|XP_010232688.1|  PREDICTED: uncharacterized protein LOC100842...  72.4    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_010232687.1|  PREDICTED: uncharacterized protein LOC100842...  72.4    1e-10   Brachypodium distachyon [annual false brome]
ref|XP_010069302.1|  PREDICTED: uncharacterized protein LOC104456...  72.4    1e-10   Eucalyptus grandis [rose gum]
ref|XP_004140882.1|  PREDICTED: uncharacterized protein LOC101203...  72.0    1e-10   Cucumis sativus [cucumbers]
gb|KEH30318.1|  cyclin-like protein                                   72.0    1e-10   Medicago truncatula
ref|XP_011656551.1|  PREDICTED: uncharacterized protein LOC101203...  72.0    1e-10   Cucumis sativus [cucumbers]
ref|XP_009625862.1|  PREDICTED: protein EFR3 homolog isoform X1       71.2    2e-10   
ref|XP_006645172.1|  PREDICTED: uncharacterized protein LOC102710074  70.5    5e-10   Oryza brachyantha
ref|XP_008445731.1|  PREDICTED: uncharacterized protein LOC103488...  70.5    5e-10   Cucumis melo [Oriental melon]
ref|XP_010241507.1|  PREDICTED: uncharacterized protein LOC104586...  70.5    5e-10   Nelumbo nucifera [Indian lotus]
ref|XP_008445732.1|  PREDICTED: uncharacterized protein LOC103488...  70.1    6e-10   Cucumis melo [Oriental melon]
ref|XP_007131956.1|  hypothetical protein PHAVU_011G054800g           70.1    6e-10   Phaseolus vulgaris [French bean]
ref|XP_009784839.1|  PREDICTED: uncharacterized protein LOC104233...  70.1    7e-10   Nicotiana sylvestris
ref|XP_004309822.1|  PREDICTED: uncharacterized protein LOC101313...  70.1    7e-10   Fragaria vesca subsp. vesca
ref|XP_009784840.1|  PREDICTED: uncharacterized protein LOC104233...  69.7    7e-10   Nicotiana sylvestris
ref|XP_011457274.1|  PREDICTED: uncharacterized protein LOC101313...  69.7    8e-10   Fragaria vesca subsp. vesca
ref|XP_011457275.1|  PREDICTED: uncharacterized protein LOC101313...  69.7    8e-10   Fragaria vesca subsp. vesca
ref|XP_006597228.1|  PREDICTED: uncharacterized protein LOC100811...  69.7    9e-10   Glycine max [soybeans]
gb|KHN33312.1|  Protein EFR3 like B                                   69.7    9e-10   Glycine soja [wild soybean]
ref|XP_006597231.1|  PREDICTED: uncharacterized protein LOC100811...  69.3    1e-09   Glycine max [soybeans]
ref|XP_006597230.1|  PREDICTED: uncharacterized protein LOC100811...  69.3    1e-09   Glycine max [soybeans]
gb|EMS60662.1|  Protein EFR3-like protein                             68.9    1e-09   Triticum urartu
gb|EMT06694.1|  Putative mitochondrial protein                        69.3    1e-09   
ref|XP_001770437.1|  predicted protein                                68.9    1e-09   
emb|CDP16550.1|  unnamed protein product                              68.6    2e-09   Coffea canephora [robusta coffee]
gb|KHN06209.1|  Protein EFR3 like B                                   68.6    2e-09   Glycine soja [wild soybean]
ref|XP_003539042.1|  PREDICTED: uncharacterized protein LOC100817...  68.2    2e-09   Glycine max [soybeans]
ref|XP_006590941.1|  PREDICTED: uncharacterized protein LOC100817...  68.2    3e-09   Glycine max [soybeans]
ref|XP_004250744.1|  PREDICTED: uncharacterized protein LOC101250...  67.8    3e-09   Solanum lycopersicum
ref|XP_010313082.1|  PREDICTED: uncharacterized protein LOC101250...  67.8    3e-09   Solanum lycopersicum
ref|XP_010313083.1|  PREDICTED: uncharacterized protein LOC101250...  67.4    4e-09   
ref|XP_010313084.1|  PREDICTED: uncharacterized protein LOC101250...  67.4    4e-09   Solanum lycopersicum
gb|KJB71804.1|  hypothetical protein B456_011G143200                  67.4    5e-09   Gossypium raimondii
gb|KJB71808.1|  hypothetical protein B456_011G143200                  67.4    5e-09   Gossypium raimondii
gb|KJB71809.1|  hypothetical protein B456_011G143200                  67.4    5e-09   Gossypium raimondii
gb|KJB71812.1|  hypothetical protein B456_011G143200                  67.4    5e-09   Gossypium raimondii
ref|XP_009393518.1|  PREDICTED: uncharacterized protein LOC103979184  67.0    7e-09   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002264735.1|  PREDICTED: uncharacterized protein LOC100264...  67.0    7e-09   Vitis vinifera
ref|XP_010650558.1|  PREDICTED: uncharacterized protein LOC100264...  66.6    9e-09   Vitis vinifera
gb|KHN30101.1|  Protein EFR3 like B                                   66.6    1e-08   Glycine soja [wild soybean]
gb|KEH39475.1|  cyclin-like protein                                   66.2    1e-08   Medicago truncatula
ref|XP_002533049.1|  conserved hypothetical protein                   66.2    1e-08   Ricinus communis
ref|XP_003597513.1|  EFR3-like protein                                66.2    1e-08   
ref|XP_004507331.1|  PREDICTED: uncharacterized protein LOC101496...  66.2    1e-08   Cicer arietinum [garbanzo]
ref|XP_006595062.1|  PREDICTED: uncharacterized protein LOC100806...  65.9    1e-08   Glycine max [soybeans]
ref|XP_006595061.1|  PREDICTED: uncharacterized protein LOC100806...  65.9    2e-08   Glycine max [soybeans]
ref|XP_007033975.1|  ARM repeat superfamily protein isoform 5         65.9    2e-08   
ref|XP_007033971.1|  ARM repeat superfamily protein isoform 1         65.9    2e-08   
ref|XP_010241506.1|  PREDICTED: uncharacterized protein LOC104586...  65.5    2e-08   Nelumbo nucifera [Indian lotus]
ref|XP_007033976.1|  ARM repeat superfamily protein isoform 6         65.5    2e-08   
ref|XP_006478683.1|  PREDICTED: uncharacterized protein LOC102614...  63.9    6e-08   Citrus sinensis [apfelsine]
ref|XP_004486921.1|  PREDICTED: uncharacterized protein LOC101509...  63.9    6e-08   Cicer arietinum [garbanzo]
ref|XP_008799995.1|  PREDICTED: uncharacterized protein LOC103714...  63.9    6e-08   Phoenix dactylifera
ref|XP_010672160.1|  PREDICTED: uncharacterized protein LOC104888...  63.9    6e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004486920.1|  PREDICTED: uncharacterized protein LOC101509...  63.9    7e-08   Cicer arietinum [garbanzo]
ref|XP_008800011.1|  PREDICTED: uncharacterized protein LOC103714...  63.9    7e-08   Phoenix dactylifera
ref|XP_006443049.1|  hypothetical protein CICLE_v100186801mg          63.9    7e-08   
ref|XP_006478686.1|  PREDICTED: uncharacterized protein LOC102614...  63.9    7e-08   
ref|XP_010672158.1|  PREDICTED: uncharacterized protein LOC104888...  63.9    7e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010672159.1|  PREDICTED: uncharacterized protein LOC104888...  63.9    7e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_563755.1|  ARM repeat superfamily protein                      63.9    7e-08   Arabidopsis thaliana [mouse-ear cress]
gb|AAF80120.1|AC024174_2  Contains similarity to an unknown prote...  63.9    7e-08   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001154308.1|  ARM repeat superfamily protein                   63.9    8e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118564.1|  PREDICTED: protein EFR3 homolog                  63.5    1e-07   Brassica rapa
ref|XP_006303899.1|  hypothetical protein CARUB_v10008206mg           63.5    1e-07   Capsella rubella
ref|XP_006838291.1|  PREDICTED: uncharacterized protein LOC18428932   63.2    1e-07   Amborella trichopoda
ref|XP_007150426.1|  hypothetical protein PHAVU_005G152600g           62.8    2e-07   Phaseolus vulgaris [French bean]
ref|XP_008790620.1|  PREDICTED: uncharacterized protein LOC103707...  62.8    2e-07   
emb|CDY09999.1|  BnaC08g44520D                                        62.4    2e-07   Brassica napus [oilseed rape]
ref|XP_010485557.1|  PREDICTED: uncharacterized protein LOC104763859  62.4    2e-07   Camelina sativa [gold-of-pleasure]
gb|KHN25286.1|  Protein EFR3 like B                                   62.4    3e-07   Glycine soja [wild soybean]
emb|CDY06190.1|  BnaA09g50130D                                        62.0    3e-07   
ref|XP_011026411.1|  PREDICTED: uncharacterized protein LOC105127...  62.0    3e-07   Populus euphratica
ref|XP_011026408.1|  PREDICTED: uncharacterized protein LOC105127...  62.0    3e-07   Populus euphratica
ref|XP_006592150.1|  PREDICTED: uncharacterized protein LOC100799...  61.6    4e-07   
gb|ACN31508.1|  unknown                                               57.0    5e-07   Zea mays [maize]
ref|XP_002309810.1|  hypothetical protein POPTR_0007s02020g           61.2    5e-07   
ref|XP_010522187.1|  PREDICTED: uncharacterized protein LOC104800...  61.2    5e-07   Tarenaya hassleriana [spider flower]
ref|XP_010522184.1|  PREDICTED: uncharacterized protein LOC104800...  61.2    6e-07   Tarenaya hassleriana [spider flower]
ref|XP_010522186.1|  PREDICTED: uncharacterized protein LOC104800...  61.2    6e-07   Tarenaya hassleriana [spider flower]
ref|XP_008790621.1|  PREDICTED: uncharacterized protein LOC103707...  60.8    7e-07   Phoenix dactylifera
ref|XP_008790619.1|  PREDICTED: uncharacterized protein LOC103707...  60.8    7e-07   
ref|XP_008790616.1|  PREDICTED: uncharacterized protein LOC103707...  60.8    7e-07   
gb|KDO47318.1|  hypothetical protein CISIN_1g001882mg                 60.8    8e-07   Citrus sinensis [apfelsine]
gb|KDO47320.1|  hypothetical protein CISIN_1g001882mg                 60.8    8e-07   Citrus sinensis [apfelsine]
gb|KJB37959.1|  hypothetical protein B456_006G228200                  60.5    9e-07   Gossypium raimondii
gb|KJB37958.1|  hypothetical protein B456_006G228200                  60.5    9e-07   Gossypium raimondii
ref|XP_010557094.1|  PREDICTED: uncharacterized protein LOC104826...  60.5    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_010457707.1|  PREDICTED: uncharacterized protein LOC104739144  60.5    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006489936.1|  PREDICTED: uncharacterized protein LOC102624456  60.5    1e-06   Citrus sinensis [apfelsine]
ref|XP_010475319.1|  PREDICTED: uncharacterized protein LOC104754751  60.5    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010557096.1|  PREDICTED: uncharacterized protein LOC104826...  60.5    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_010557097.1|  PREDICTED: uncharacterized protein LOC104826...  60.1    1e-06   Tarenaya hassleriana [spider flower]
ref|XP_010653791.1|  PREDICTED: uncharacterized protein LOC100255...  60.1    1e-06   Vitis vinifera
ref|XP_009412884.1|  PREDICTED: uncharacterized protein LOC103994280  59.3    2e-06   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006421414.1|  hypothetical protein CICLE_v10006843mg           59.3    2e-06   
ref|XP_010930207.1|  PREDICTED: uncharacterized protein LOC105051451  59.3    2e-06   Elaeis guineensis
gb|KHG30683.1|  Protein EFR3 cmp44E                                   58.9    3e-06   Gossypium arboreum [tree cotton]
ref|XP_012066154.1|  PREDICTED: uncharacterized protein LOC105629221  58.9    3e-06   Jatropha curcas
gb|KCW90195.1|  hypothetical protein EUGRSUZ_A02368                   57.8    8e-06   Eucalyptus grandis [rose gum]
ref|XP_010057221.1|  PREDICTED: uncharacterized protein LOC104445...  57.8    8e-06   Eucalyptus grandis [rose gum]
ref|XP_010057214.1|  PREDICTED: uncharacterized protein LOC104445...  57.4    9e-06   Eucalyptus grandis [rose gum]
ref|XP_010653792.1|  PREDICTED: uncharacterized protein LOC100255...  57.4    9e-06   Vitis vinifera
ref|XP_002277870.1|  PREDICTED: uncharacterized protein LOC100255...  57.4    9e-06   Vitis vinifera
ref|XP_006350206.1|  PREDICTED: protein EFR3 homolog B-like isofo...  57.4    1e-05   
ref|XP_006350204.1|  PREDICTED: protein EFR3 homolog B-like isofo...  57.0    1e-05   Solanum tuberosum [potatoes]
ref|XP_006350205.1|  PREDICTED: protein EFR3 homolog B-like isofo...  57.0    1e-05   
emb|CBI29857.3|  unnamed protein product                              57.0    1e-05   Vitis vinifera
ref|XP_004236620.1|  PREDICTED: protein EFR3 homolog B isoform X2     57.0    1e-05   Solanum lycopersicum
gb|EYU20743.1|  hypothetical protein MIMGU_mgv1a000711mg              56.2    2e-05   Erythranthe guttata [common monkey flower]
ref|XP_010666756.1|  PREDICTED: uncharacterized protein LOC104883885  55.8    3e-05   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006417969.1|  hypothetical protein EUTSA_v10006704mg           55.8    3e-05   
emb|CDY54108.1|  BnaC04g53870D                                        54.7    3e-05   Brassica napus [oilseed rape]
ref|XP_009610949.1|  PREDICTED: protein EFR3 homolog B isoform X4     55.5    4e-05   Nicotiana tomentosiformis
ref|XP_010907682.1|  PREDICTED: uncharacterized protein LOC105034...  55.1    5e-05   Elaeis guineensis
ref|XP_010907681.1|  PREDICTED: uncharacterized protein LOC105034...  55.1    5e-05   Elaeis guineensis
ref|XP_009355500.1|  PREDICTED: uncharacterized protein LOC103946512  55.1    6e-05   Pyrus x bretschneideri [bai li]
ref|XP_010907683.1|  PREDICTED: uncharacterized protein LOC105034...  55.1    6e-05   Elaeis guineensis
ref|XP_008798151.1|  PREDICTED: uncharacterized protein LOC103713119  54.7    7e-05   Phoenix dactylifera
ref|XP_007028781.1|  Uncharacterized protein isoform 1                54.7    7e-05   
ref|XP_009379627.1|  PREDICTED: uncharacterized protein LOC103968...  54.7    8e-05   
ref|XP_009379628.1|  PREDICTED: uncharacterized protein LOC103968...  54.3    9e-05   Pyrus x bretschneideri [bai li]
emb|CDY63789.1|  BnaA08g31700D                                        54.3    1e-04   Brassica napus [oilseed rape]
gb|KJB81105.1|  hypothetical protein B456_013G129500                  54.3    1e-04   Gossypium raimondii
gb|KJB81106.1|  hypothetical protein B456_013G129500                  53.9    1e-04   Gossypium raimondii
ref|XP_011048039.1|  PREDICTED: uncharacterized protein LOC105142218  53.9    1e-04   Populus euphratica
ref|XP_009119100.1|  PREDICTED: uncharacterized protein LOC103844080  53.9    1e-04   Brassica rapa
ref|XP_010319193.1|  PREDICTED: protein EFR3 homolog B isoform X3     53.5    2e-04   Solanum lycopersicum
ref|XP_009111018.1|  PREDICTED: protein EFR3 homolog isoform X3       53.5    2e-04   Brassica rapa
ref|XP_009111017.1|  PREDICTED: protein EFR3 homolog isoform X2       53.5    2e-04   Brassica rapa
ref|XP_009111016.1|  PREDICTED: protein EFR3 homolog isoform X1       53.5    2e-04   Brassica rapa
ref|XP_002892313.1|  predicted protein                                53.5    2e-04   
emb|CDX86545.1|  BnaC08g01580D                                        53.1    2e-04   
ref|XP_010319191.1|  PREDICTED: protein EFR3 homolog B isoform X1     53.1    2e-04   Solanum lycopersicum
ref|XP_010319194.1|  PREDICTED: uncharacterized protein LOC101246...  53.1    2e-04   Solanum lycopersicum
ref|XP_008387298.1|  PREDICTED: uncharacterized protein LOC103449...  52.4    2e-04   
ref|XP_008387296.1|  PREDICTED: uncharacterized protein LOC103449...  52.4    3e-04   
ref|XP_008350294.1|  PREDICTED: uncharacterized protein LOC103413615  52.4    4e-04   
emb|CDY47707.1|  BnaA10g03960D                                        51.2    8e-04   Brassica napus [oilseed rape]
ref|XP_007218911.1|  hypothetical protein PRUPE_ppa000649mg           51.2    8e-04   
gb|KHG10001.1|  hypothetical protein F383_03012                       51.2    0.001   Gossypium arboreum [tree cotton]



>ref|XP_009616023.1| PREDICTED: uncharacterized protein LOC104108647 [Nicotiana tomentosiformis]
Length=993

 Score =   266 bits (681),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 132/203 (65%), Positives = 158/203 (78%), Gaps = 5/203 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E DD+ K++SE FTPDDTF+F LQSMVDMDH+Q+  HSR+SPS+DGDF  NS  EDDK+
Sbjct  792  VEADDIFKQLSEDFTPDDTFIFCLQSMVDMDHVQIGSHSRDSPSFDGDFSPNSFVEDDKV  851

Query  741  SESSVTDMTRFMPT---SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMAS  571
            SESS+ D+ RF+P    SPSPS + +V+IGQLLESALEVAGQVAG+ VSTSPLPY  +A 
Sbjct  852  SESSIADIARFIPKIPMSPSPSMTHVVSIGQLLESALEVAGQVAGSSVSTSPLPYDTIAG  911

Query  570  QCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVP  391
            QCE+LGTDTRKKLSNWLAHEN    AA  +  PA P NG     K ++ED T  +G  + 
Sbjct  912  QCESLGTDTRKKLSNWLAHENRCANAAG-MAYPAFPTNGPSAVAKILEEDGTF-RGPPLS  969

Query  390  REPWLAIWLPPASPFDNFLRAAR  322
            +EPWLA+ LPPASPFDNFLRAAR
Sbjct  970  KEPWLALRLPPASPFDNFLRAAR  992



>ref|XP_009783972.1| PREDICTED: uncharacterized protein LOC104232454 [Nicotiana sylvestris]
Length=991

 Score =   263 bits (671),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 158/203 (78%), Gaps = 5/203 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E DD+ K++SE FTPDDTF+F LQSMVDMDH Q+  HSR+SPS+DGDF  NS  EDDK+
Sbjct  790  VEADDIFKQLSEDFTPDDTFIFCLQSMVDMDHAQIGSHSRDSPSFDGDFSPNSFVEDDKV  849

Query  741  SESSVTDMTRFMPT---SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMAS  571
            SESS+ D+ RF+P    SPSPS + +V+IGQLLESALEVAGQVAG+ VSTSPLPY  +A 
Sbjct  850  SESSIADIARFIPKIPMSPSPSMTHVVSIGQLLESALEVAGQVAGSSVSTSPLPYDTIAG  909

Query  570  QCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVP  391
            QCE+LGTDTRKKLSNWLAHEN  T AA  +  PA P NG     K ++E+  + +G  + 
Sbjct  910  QCESLGTDTRKKLSNWLAHENRCTNAAG-MAYPAFPTNGPSAVAKILEEEGPV-RGPPLS  967

Query  390  REPWLAIWLPPASPFDNFLRAAR  322
            +EPWLA+ LPPASPFDNFLRAAR
Sbjct  968  KEPWLALRLPPASPFDNFLRAAR  990



>ref|XP_006344767.1| PREDICTED: uncharacterized protein LOC102580046 [Solanum tuberosum]
Length=993

 Score =   255 bits (651),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 156/203 (77%), Gaps = 5/203 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E DD+ K++SE FTPDDTF+F L+SMV MDH+Q+  HSR+SPS+D +   NS  EDDK+
Sbjct  792  VEADDIFKQLSEDFTPDDTFIFYLKSMVGMDHVQIGSHSRDSPSFDEECYPNSFVEDDKV  851

Query  741  SESSVTDMTRF---MPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMAS  571
            SESS+ D+TRF   +P SPSPS S +V+IGQLLESALEVAGQVAG+ VSTSPLPY  + S
Sbjct  852  SESSIADITRFVPRIPMSPSPSMSHVVSIGQLLESALEVAGQVAGSSVSTSPLPYDTITS  911

Query  570  QCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVP  391
            QCE+LGTD+RKKLSNWLAHENH +KAA  ++ PA P NG     K + ED    +G  + 
Sbjct  912  QCESLGTDSRKKLSNWLAHENHCSKAAG-MVYPAFPANGPSALAKILQEDGP-AKGPPLS  969

Query  390  REPWLAIWLPPASPFDNFLRAAR  322
             E WLA+ LPPASPFDNFLRAAR
Sbjct  970  NESWLALRLPPASPFDNFLRAAR  992



>ref|XP_004230310.1| PREDICTED: uncharacterized protein LOC101249681 [Solanum lycopersicum]
Length=988

 Score =   249 bits (635),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 155/203 (76%), Gaps = 5/203 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E DD+ K++SE FTPDDTF+F L+SMV MDH+Q+  HSR+SPS+D +   +S  ED K+
Sbjct  787  VEADDIFKQLSEDFTPDDTFIFYLKSMVGMDHVQIGSHSRDSPSFDEECYPSSFVEDYKV  846

Query  741  SESSVTDMTRF---MPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMAS  571
            SESS+ D+TRF   +P SPSPS S +V+IGQLLESALEVAGQVAG+ VSTSPLPY  + S
Sbjct  847  SESSIADITRFVPRIPMSPSPSMSHVVSIGQLLESALEVAGQVAGSSVSTSPLPYDTITS  906

Query  570  QCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVP  391
            QCE+LGTD+RKKLSNWLAHENH +KAA  ++ PA P NG     K + ED    +G  + 
Sbjct  907  QCESLGTDSRKKLSNWLAHENHCSKAAG-MVYPACPANGPSALAKILQEDGP-AKGPPLS  964

Query  390  REPWLAIWLPPASPFDNFLRAAR  322
             E WLA+ LPPASPFDNFLRAAR
Sbjct  965  NESWLALRLPPASPFDNFLRAAR  987



>ref|XP_008246002.1| PREDICTED: uncharacterized protein LOC103344152 [Prunus mume]
Length=999

 Score =   235 bits (599),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 150/200 (75%), Gaps = 3/200 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E +D+  ++SE FTPDD F+FG +SM++ D  Q+  HS++S S+DG+FLTNSS EDD  
Sbjct  800  MEAEDVRNQLSESFTPDDAFMFGPESMLEFDQNQMAGHSKDSLSFDGEFLTNSSVEDDAT  859

Query  741  SESSVTDMTRFMPTSPSPSS-SRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV D++RF+P  PS +S + +++IGQL+ESALEVAGQVAGT +STSPLPY  MASQC
Sbjct  860  SEASVADLSRFIPRMPSSTSIAHVISIGQLMESALEVAGQVAGTSISTSPLPYNTMASQC  919

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E+LGT TRKKLSNWLAHENH +       L A P +G    +K I E     QG  +P++
Sbjct  920  ESLGTGTRKKLSNWLAHENHQSSVRDKSFL-AFPADGRTALEKIISETGP-TQGHALPQD  977

Query  384  PWLAIWLPPASPFDNFLRAA  325
            PWLA+ LPPASPFDNFL+AA
Sbjct  978  PWLAVRLPPASPFDNFLKAA  997



>ref|XP_007208429.1| hypothetical protein PRUPE_ppa000798mg [Prunus persica]
 gb|EMJ09628.1| hypothetical protein PRUPE_ppa000798mg [Prunus persica]
Length=1000

 Score =   233 bits (593),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 115/200 (58%), Positives = 148/200 (74%), Gaps = 3/200 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E +D+  ++SE FTPDD F+FG +SM++ D  ++  HS+ S S+DG+FLTNSS EDD  
Sbjct  801  MEAEDVRNQLSESFTPDDAFMFGPESMLEFDQNRMAGHSKYSLSFDGEFLTNSSVEDDAT  860

Query  741  SESSVTDMTRFMPTSPSPSS-SRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV D++RF+P  PS +S + +++IGQL+ESALEVAGQVAGT +STSPLPY  MASQC
Sbjct  861  SEASVADLSRFIPRMPSSTSIAHVISIGQLMESALEVAGQVAGTSISTSPLPYNTMASQC  920

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LGT TRKKLSNWLAHENH +       L A P +G    +K I E     QG  +P++
Sbjct  921  EALGTGTRKKLSNWLAHENHQSSVRDKSFL-AFPADGRTALEKIISETGP-TQGAALPQD  978

Query  384  PWLAIWLPPASPFDNFLRAA  325
            PWLA+ LPPASPFDNFL+AA
Sbjct  979  PWLAVRLPPASPFDNFLKAA  998



>ref|XP_009373286.1| PREDICTED: uncharacterized protein LOC103962316 [Pyrus x bretschneideri]
Length=997

 Score =   232 bits (591),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/201 (59%), Positives = 149/201 (74%), Gaps = 5/201 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            ++ +D+ K++SE FTPDD F+FG QSM+D D  Q+  HS+ES S+DG+F TNSS EDD  
Sbjct  798  MKAEDVAKQLSESFTPDDVFMFGPQSMLDFDQNQMPGHSKES-SFDGEFPTNSSEEDDAT  856

Query  741  SESSVTDMTRFMPTSPSPSSS--RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQ  568
            SE+SV D++RF+P  P+ SS    +++IGQL+ESALEVAGQVAGT VSTSPLPY  MASQ
Sbjct  857  SEASVADLSRFIPRMPTSSSVPPHVISIGQLMESALEVAGQVAGTAVSTSPLPYNTMASQ  916

Query  567  CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPR  388
            CE LGT TRKKLSNWLAHEN Y  + +D + PA P +G  TA + I  D     G    +
Sbjct  917  CEALGTGTRKKLSNWLAHEN-YQSSVSDRIFPAFPADG-RTALQKITSDIGPAHGAASAQ  974

Query  387  EPWLAIWLPPASPFDNFLRAA  325
            +PWLA+ LPPASPFDNFL+AA
Sbjct  975  DPWLAMRLPPASPFDNFLKAA  995



>ref|XP_002512512.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49964.1| conserved hypothetical protein [Ricinus communis]
Length=972

 Score =   231 bits (588),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 117/200 (59%), Positives = 146/200 (73%), Gaps = 3/200 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE +DL +++SE FTPDD F+F  +S+ D+DH Q++ HS+ES S+D D  T S AEDD +
Sbjct  773  LEENDLARQLSEPFTPDDAFVFAPRSLFDLDHSQMVSHSKESLSFDEDIPTGSLAEDDAV  832

Query  741  SESSVTDMTRFMPTSPS-PSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV DM+RF+P  PS PS S +++IGQLLESALEVAGQVAG  +STSPLPY  MA QC
Sbjct  833  SEASVADMSRFIPKMPSSPSVSHVISIGQLLESALEVAGQVAGASISTSPLPYDTMAKQC  892

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LG  TRKKLSNWL+HE HYT+  AD  LPA+P NG    +K I  +  +    + P  
Sbjct  893  EDLGKGTRKKLSNWLSHEYHYTR-GADKFLPAVPANGCPELEK-IMSNVDIGHATIKPTG  950

Query  384  PWLAIWLPPASPFDNFLRAA  325
            P LA+ LPPASPFDNFL+AA
Sbjct  951  PCLAMRLPPASPFDNFLKAA  970



>ref|XP_008370375.1| PREDICTED: uncharacterized protein LOC103433867 [Malus domestica]
Length=997

 Score =   230 bits (586),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 118/201 (59%), Positives = 147/201 (73%), Gaps = 5/201 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            ++ +D+  ++SE FTPDD F+FG QSM+D D  Q+ VHS+ES S+DG+F TNSS EDD  
Sbjct  798  MKAEDVANQLSESFTPDDAFMFGPQSMLDCDQNQMPVHSKES-SFDGEFPTNSSVEDDVT  856

Query  741  SESSVTDMTRFMPTSPSPSS--SRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQ  568
            SE+SV D++RF+P  P+ SS    +++IGQL+ESA EVAGQVAGT VSTSPLPY  MASQ
Sbjct  857  SEASVADLSRFIPRVPTSSSIPPHVISIGQLIESAFEVAGQVAGTAVSTSPLPYNTMASQ  916

Query  567  CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPR  388
            CE LGT TRKKLSNWLAHENH + +  D L PA P +G    +K I  D     G    +
Sbjct  917  CEALGTGTRKKLSNWLAHENHQS-SVRDRLFPAFPADGRAALQK-ITSDIGPAHGAASAQ  974

Query  387  EPWLAIWLPPASPFDNFLRAA  325
            +PWLA+ LPPASPFDNFL+AA
Sbjct  975  DPWLAMRLPPASPFDNFLKAA  995



>emb|CDP18254.1| unnamed protein product [Coffea canephora]
Length=1034

 Score =   227 bits (579),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 119/203 (59%), Positives = 146/203 (72%), Gaps = 9/203 (4%)
 Frame = -1

Query  921   LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
             LE +DL+ ++SE FTPDD  +FG    +D DH+  +  S+ESPS+DG+F  N  +EDD I
Sbjct  837   LEEEDLINQLSEAFTPDDVLMFG---PLDFDHVHGVPFSKESPSFDGEFPANVLSEDDII  893

Query  741   SESSVTDMTRFM--PTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQ  568
             SESSV D++RF+  P SP PS S +V+IGQLLESALEVAGQVAGT VSTSPLPY  MASQ
Sbjct  894   SESSVVDISRFIKTPMSPCPSMSHVVSIGQLLESALEVAGQVAGTSVSTSPLPYHTMASQ  953

Query  567   CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPG-NGLLTAKKTIDEDSTLQQGVMVP  391
             CE LG+D RKKLSNWL ++ H+ K   D   P  PG  GL   +K   ED  +  G+ +P
Sbjct  954   CEALGSDARKKLSNWLTNDGHFVK--TDTTFPPNPGYYGLSAIRKASSEDGPV-SGLEMP  1010

Query  390   REPWLAIWLPPASPFDNFLRAAR  322
             +E WLA+ LPPASPFDNFLRAAR
Sbjct  1011  KESWLALRLPPASPFDNFLRAAR  1033



>gb|EYU40497.1| hypothetical protein MIMGU_mgv1a000785mg [Erythranthe guttata]
 gb|EYU40498.1| hypothetical protein MIMGU_mgv1a000785mg [Erythranthe guttata]
Length=987

 Score =   225 bits (573),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 147/205 (72%), Gaps = 13/205 (6%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
             E +++ K++SE F PD+ FLFG QSM+DMDHIQ + HS+E+ S+DG+F  NS  EDD +
Sbjct  790  FEAEEIAKQLSEEFLPDEAFLFGPQSMLDMDHIQRVAHSKETLSFDGEFSANSLIEDDAM  849

Query  741  SESSVTDMTRFMP---TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMAS  571
            S SSV D++RF+P    SPSPS S IV+IGQLLESALEVAGQVAG  VSTSPLPY  M +
Sbjct  850  SISSVADISRFIPKIPASPSPSMSHIVSIGQLLESALEVAGQVAGASVSTSPLPYSTMTN  909

Query  570  QCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPG-NGLLTAKKTIDEDSTLQQGVMV  394
            QCE  GTDTRKKLSNWLA +N+ TK    +L+P+ P  NGL      ID+   +  G  V
Sbjct  910  QCEAFGTDTRKKLSNWLAVDNNSTKVNG-MLVPSFPATNGL----SVIDK---ISNGENV  961

Query  393  P-REPWLAIWLPPASPFDNFLRAAR  322
            P    WLA+ LPP SPFDNFLRAAR
Sbjct  962  PAANTWLALRLPPTSPFDNFLRAAR  986



>ref|XP_012088889.1| PREDICTED: uncharacterized protein LOC105647425 isoform X2 [Jatropha 
curcas]
Length=979

 Score =   225 bits (573),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 143/200 (72%), Gaps = 3/200 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E DDLV+++SE FTPDD F+FG   ++D+ H Q++ HS+ES S+D D    S  EDD  
Sbjct  780  VEVDDLVQQLSEPFTPDDAFVFGPHMLLDLGHNQMVSHSKESLSFDEDIPAASLIEDDAT  839

Query  741  SESSVTDMTRFMPTSPS-PSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV DM+RF+P  PS PS S I++IGQLLESALEVAGQVAGT VSTSPLPY  MA QC
Sbjct  840  SETSVADMSRFIPKIPSSPSVSHIISIGQLLESALEVAGQVAGTAVSTSPLPYDTMAKQC  899

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LG  TRKKLSNWL  ENHY+  A+   LPA P +G    +K +  D    +G + P +
Sbjct  900  EDLGKGTRKKLSNWLVQENHYSTGASK-FLPAFPAHGCPALEK-VSHDGGAMEGALKPID  957

Query  384  PWLAIWLPPASPFDNFLRAA  325
            P LA+ LPPASPFDNFL+AA
Sbjct  958  PSLAMRLPPASPFDNFLKAA  977



>ref|XP_012088883.1| PREDICTED: uncharacterized protein LOC105647425 isoform X1 [Jatropha 
curcas]
 ref|XP_012088884.1| PREDICTED: uncharacterized protein LOC105647425 isoform X1 [Jatropha 
curcas]
 ref|XP_012088885.1| PREDICTED: uncharacterized protein LOC105647425 isoform X1 [Jatropha 
curcas]
 ref|XP_012088887.1| PREDICTED: uncharacterized protein LOC105647425 isoform X1 [Jatropha 
curcas]
 ref|XP_012088888.1| PREDICTED: uncharacterized protein LOC105647425 isoform X1 [Jatropha 
curcas]
 gb|KDP23388.1| hypothetical protein JCGZ_23221 [Jatropha curcas]
Length=997

 Score =   225 bits (573),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 143/200 (72%), Gaps = 3/200 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E DDLV+++SE FTPDD F+FG   ++D+ H Q++ HS+ES S+D D    S  EDD  
Sbjct  798  VEVDDLVQQLSEPFTPDDAFVFGPHMLLDLGHNQMVSHSKESLSFDEDIPAASLIEDDAT  857

Query  741  SESSVTDMTRFMPTSPS-PSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV DM+RF+P  PS PS S I++IGQLLESALEVAGQVAGT VSTSPLPY  MA QC
Sbjct  858  SETSVADMSRFIPKIPSSPSVSHIISIGQLLESALEVAGQVAGTAVSTSPLPYDTMAKQC  917

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LG  TRKKLSNWL  ENHY+  A+   LPA P +G    +K +  D    +G + P +
Sbjct  918  EDLGKGTRKKLSNWLVQENHYSTGASK-FLPAFPAHGCPALEK-VSHDGGAMEGALKPID  975

Query  384  PWLAIWLPPASPFDNFLRAA  325
            P LA+ LPPASPFDNFL+AA
Sbjct  976  PSLAMRLPPASPFDNFLKAA  995



>ref|XP_008359849.1| PREDICTED: uncharacterized protein LOC103423542 [Malus domestica]
 ref|XP_008359850.1| PREDICTED: uncharacterized protein LOC103423542 [Malus domestica]
Length=997

 Score =   223 bits (569),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 116/201 (58%), Positives = 147/201 (73%), Gaps = 5/201 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            ++ +D+ K++ E FTPDD F+FG QSM+D D  Q+  HS+ES S+DG+F TNSS EDD  
Sbjct  798  MKGEDVAKQLLESFTPDDIFMFGPQSMLDFDQNQMPGHSKES-SFDGEFPTNSSEEDDAT  856

Query  741  SESSVTDMTRFMPTSPSPSSS--RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQ  568
            SE+SV D++RF+P  P+ SS    +++IGQL+ESALEVAGQVAGT VSTSPLPY  MAS+
Sbjct  857  SEASVADLSRFIPRVPTSSSVPPHVISIGQLMESALEVAGQVAGTAVSTSPLPYNTMASR  916

Query  567  CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPR  388
            CE LGT TRKKLSNWLA+ENH + +  D L PA+P +G    +K I  D     G    +
Sbjct  917  CEALGTGTRKKLSNWLAYENHQS-SVRDRLFPAVPADGRAXLQK-ITSDIGPAHGAASXQ  974

Query  387  EPWLAIWLPPASPFDNFLRAA  325
            +PWLA  LPPASPFDNFL+AA
Sbjct  975  DPWLAXRLPPASPFDNFLKAA  995



>ref|XP_002282109.1| PREDICTED: uncharacterized protein LOC100264846 [Vitis vinifera]
 ref|XP_010659702.1| PREDICTED: uncharacterized protein LOC100264846 [Vitis vinifera]
 emb|CBI39597.3| unnamed protein product [Vitis vinifera]
Length=1002

 Score =   223 bits (569),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 143/200 (72%), Gaps = 3/200 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            L+ D+L K++SE FTPDD  LFG QS+  ++HIQ +   +ES S+DGDF  NS  E+D I
Sbjct  803  LDADELAKQLSETFTPDDALLFGPQSIFGLEHIQTVSLPKESLSFDGDFPPNSLVEEDLI  862

Query  741  SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SESSV D++RF+P  P SPS S +++IGQLLESALEVAGQVAGT VSTSPLPY AMASQC
Sbjct  863  SESSVVDLSRFIPKMPASPSLSHVISIGQLLESALEVAGQVAGTSVSTSPLPYSAMASQC  922

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LG+ TR+KLS+WL HEN YT    D   P  P +G  +A   I  D     G  +  +
Sbjct  923  EALGSGTRRKLSSWLTHENGYT-IGPDKPFPTFPADG-CSAITNITSDGRSVPGGKLSLD  980

Query  384  PWLAIWLPPASPFDNFLRAA  325
            PWLA+ LPPASPFDNFLRAA
Sbjct  981  PWLAMRLPPASPFDNFLRAA  1000



>ref|XP_011092150.1| PREDICTED: uncharacterized protein LOC105172430 [Sesamum indicum]
Length=995

 Score =   221 bits (562),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 143/203 (70%), Gaps = 6/203 (3%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
             E D++ K++SE F PD+ F+FG QS++DMDHIQ   HS+E+ S+DG+F  NS  EDD +
Sbjct  795  FEADEIAKQLSEEFLPDEAFMFGPQSILDMDHIQKAAHSKETQSFDGEFSANSLVEDDAM  854

Query  741  SESSVTDMTRFMP---TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMAS  571
            S SSV D++RF+P    SPSPS S IV+IGQLLESALEVAGQVAG+ +STSPLPY  M +
Sbjct  855  SISSVADISRFIPKVPASPSPSMSHIVSIGQLLESALEVAGQVAGSSISTSPLPYSTMTN  914

Query  570  QCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVP  391
            QCE  GTDTRKKLSNWL  +NH  + A D+  P +   G  +  K    ++ +  G +  
Sbjct  915  QCEAFGTDTRKKLSNWLTSDNHSIQ-ANDMSPPPLRSTGGSSIDKATCSEAAI--GAVPS  971

Query  390  REPWLAIWLPPASPFDNFLRAAR  322
               WLA+ LPPASPFDNFLRAAR
Sbjct  972  SNSWLALRLPPASPFDNFLRAAR  994



>ref|XP_011466140.1| PREDICTED: uncharacterized protein LOC101313033 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=1004

 Score =   219 bits (557),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 143/203 (70%), Gaps = 4/203 (2%)
 Frame = -1

Query  921   LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
             +E + +  ++SE FTPDD F+FG QSM+D D  Q+  HS+E+ S+DG+F TNSS EDD  
Sbjct  800   MEAEVVADQLSESFTPDDAFMFGPQSMLDFDQNQMPGHSKETLSFDGEFPTNSSVEDDAT  859

Query  741   SESSVT-DMTRFMPTSPSPSSS-RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQ  568
             SE SV  D +RF+P  PS SS  +++++GQLLESALEVAGQVAGT VSTSPLPY  M  Q
Sbjct  860   SEVSVVADFSRFIPRMPSSSSVPQVISVGQLLESALEVAGQVAGTSVSTSPLPYNTMTKQ  919

Query  567   CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDS-TLQQGVMVP  391
             CE LGT TRKKLSNWLAHE+H +    D+L P  P  G    +K I+E    + QG    
Sbjct  920   CEALGTGTRKKLSNWLAHEHHQSSTVRDILSPPFPAGGCTALQKLINEPGPGVTQGGTSA  979

Query  390   REPWL-AIWLPPASPFDNFLRAA  325
             ++ WL AI LPPASPFDNFL+AA
Sbjct  980   QDSWLAAIRLPPASPFDNFLKAA  1002



>ref|XP_004302237.1| PREDICTED: uncharacterized protein LOC101313033 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=1003

 Score =   218 bits (556),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 143/203 (70%), Gaps = 4/203 (2%)
 Frame = -1

Query  921   LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
             +E + +  ++SE FTPDD F+FG QSM+D D  Q+  HS+E+ S+DG+F TNSS EDD  
Sbjct  799   MEAEVVADQLSESFTPDDAFMFGPQSMLDFDQNQMPGHSKETLSFDGEFPTNSSVEDDAT  858

Query  741   SESSVT-DMTRFMPTSPSPSSS-RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQ  568
             SE SV  D +RF+P  PS SS  +++++GQLLESALEVAGQVAGT VSTSPLPY  M  Q
Sbjct  859   SEVSVVADFSRFIPRMPSSSSVPQVISVGQLLESALEVAGQVAGTSVSTSPLPYNTMTKQ  918

Query  567   CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDS-TLQQGVMVP  391
             CE LGT TRKKLSNWLAHE+H +    D+L P  P  G    +K I+E    + QG    
Sbjct  919   CEALGTGTRKKLSNWLAHEHHQSSTVRDILSPPFPAGGCTALQKLINEPGPGVTQGGTSA  978

Query  390   REPWL-AIWLPPASPFDNFLRAA  325
             ++ WL AI LPPASPFDNFL+AA
Sbjct  979   QDSWLAAIRLPPASPFDNFLKAA  1001



>gb|KDO81672.1| hypothetical protein CISIN_1g0461821mg, partial [Citrus sinensis]
Length=853

 Score =   217 bits (553),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 144/200 (72%), Gaps = 3/200 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E DDL K++ E FTPDD  +FG QS++ +DH Q++ HS+ES S+D D  TNS  EDD  
Sbjct  654  VEADDLAKQLQEPFTPDDAIMFGPQSILALDHSQMISHSKESLSFDEDIATNSLVEDDAT  713

Query  741  SESSVTDMTRFMPTSPSPS-SSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV +++RF+P  P+PS +S IV+IGQL+ESAL+VAGQVAG+ +STSPLPY  +A  C
Sbjct  714  SEASVANLSRFIPRMPTPSPTSHIVSIGQLMESALKVAGQVAGSTISTSPLPYNTLAGHC  773

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LG+ TR+KLSNWL HENHYT+A  +   PA P +     +K I  D    QG ++P+ 
Sbjct  774  EALGSGTRQKLSNWLIHENHYTRATNN-FSPASPADSYSALEKIISSDEP-GQGSVMPQN  831

Query  384  PWLAIWLPPASPFDNFLRAA  325
               A+ LPPASPFDNFL+AA
Sbjct  832  ACTAMKLPPASPFDNFLKAA  851



>ref|XP_006472204.1| PREDICTED: uncharacterized protein LOC102623618 [Citrus sinensis]
Length=1000

 Score =   218 bits (555),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 144/200 (72%), Gaps = 3/200 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E DDL K++ E FTPDD  +FG QS++ +DH Q++ HS+ES S+D D  TNS  EDD  
Sbjct  801  VEADDLAKQLQEPFTPDDAIMFGPQSILALDHSQMISHSKESLSFDEDIATNSLVEDDAT  860

Query  741  SESSVTDMTRFMPTSPSPS-SSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV +++RF+P  P+PS +S IV+IGQL+ESAL+VAGQVAG+ +STSPLPY  +A  C
Sbjct  861  SEASVANLSRFIPRMPTPSPTSHIVSIGQLMESALKVAGQVAGSTISTSPLPYNTLAGHC  920

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LG+ TR+KLSNWL HENHYT+A  +   PA P +     +K I  D    QG ++P+ 
Sbjct  921  EALGSGTRQKLSNWLIHENHYTRATNN-FSPASPADSYSALEKIISSDEP-GQGSVMPQN  978

Query  384  PWLAIWLPPASPFDNFLRAA  325
               A+ LPPASPFDNFL+AA
Sbjct  979  ACTAMKLPPASPFDNFLKAA  998



>gb|KJB45453.1| hypothetical protein B456_007G306600 [Gossypium raimondii]
 gb|KJB45454.1| hypothetical protein B456_007G306600 [Gossypium raimondii]
Length=1000

 Score =   217 bits (553),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 143/201 (71%), Gaps = 2/201 (1%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE DDL K+++E FTPDD F+FG +S++D+DH Q+  +S+ES S+D D  T+   EDD  
Sbjct  800  LEIDDLTKQLTEPFTPDDAFMFGPRSILDLDHNQMTPYSKESLSFDEDVQTSQLLEDDAR  859

Query  741  SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV D++ F+P +P SPS S ++NIGQLL+SALEVAGQVA T VSTSPLPY  MASQC
Sbjct  860  SEASVLDLSHFIPKAPASPSISNVINIGQLLQSALEVAGQVAATSVSTSPLPYDTMASQC  919

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E  GT TRKKLSNWLAHENH  +AA   +L     +  +   K I   +    G ++  +
Sbjct  920  EAFGTGTRKKLSNWLAHENHQNEAANKTILTTDAADRHVMMLKKISNGNAF-NGAVLQLD  978

Query  384  PWLAIWLPPASPFDNFLRAAR  322
            P L++ LPPASPFDNFL+AAR
Sbjct  979  PCLSMRLPPASPFDNFLKAAR  999



>gb|KHG26707.1| Efr3b [Gossypium arboreum]
Length=1041

 Score =   217 bits (552),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 142/201 (71%), Gaps = 2/201 (1%)
 Frame = -1

Query  921   LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
             LE DDL+K++SE FTPDD F+FG +S++D+DH Q+  +S+ES S+D D  T+   EDD  
Sbjct  841   LEIDDLMKQLSEPFTPDDAFMFGPRSILDLDHNQMTPYSKESLSFDEDVRTSQLLEDDAR  900

Query  741   SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             SE+SV D++ F+P +P SPS S ++NIGQLL+SALEVAGQVA T VSTSPLPY  MASQC
Sbjct  901   SEASVLDLSHFIPKAPASPSISNVINIGQLLQSALEVAGQVAATSVSTSPLPYDTMASQC  960

Query  564   ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
             E  GT TRKKLSNWLAHENH  +AA   +L     +      K I   +    G +   +
Sbjct  961   EAFGTGTRKKLSNWLAHENHQNEAADKTILTTAAADRHTMMLKKISNGNAF-NGAVSQLD  1019

Query  384   PWLAIWLPPASPFDNFLRAAR  322
             P L++ LPPASPFDNFL+AAR
Sbjct  1020  PCLSMRLPPASPFDNFLKAAR  1040



>ref|XP_008453377.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453385.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453393.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
 ref|XP_008453402.1| PREDICTED: uncharacterized protein LOC103494111 [Cucumis melo]
Length=995

 Score =   216 bits (550),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 143/200 (72%), Gaps = 4/200 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            L+  +L K + E FTPDD FL+G +SM+D    Q + HS+ES S+DGD L+N   ED+  
Sbjct  797  LDKSELAKLIFEAFTPDDPFLYGPRSMLDFRKNQSVTHSKESLSFDGD-LSNFLVEDEVT  855

Query  741  SESSVTDMTRFMP-TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV D+ RF+P   PSPS S I+ IGQLLESALEVAGQV GT VSTSPLPY AMASQC
Sbjct  856  SEASVADIARFIPRVPPSPSVSHIMGIGQLLESALEVAGQVVGTSVSTSPLPYNAMASQC  915

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LGT TRKKLSNWLAHEN +T+ AAD   P+ P +G    +K + +   L QGV +  +
Sbjct  916  EALGTGTRKKLSNWLAHENQHTR-AADGYCPSFPVSGHSAVEKIMADGRQL-QGVGLQAD  973

Query  384  PWLAIWLPPASPFDNFLRAA  325
             W+ + LPPASPFDNFL+AA
Sbjct  974  RWMGMRLPPASPFDNFLKAA  993



>ref|XP_004144747.1| PREDICTED: uncharacterized protein LOC101202927 [Cucumis sativus]
 ref|XP_011648868.1| PREDICTED: uncharacterized protein LOC101202927 [Cucumis sativus]
 ref|XP_011648869.1| PREDICTED: uncharacterized protein LOC101202927 [Cucumis sativus]
 gb|KGN61004.1| hypothetical protein Csa_2G034570 [Cucumis sativus]
Length=995

 Score =   215 bits (548),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/200 (58%), Positives = 142/200 (71%), Gaps = 4/200 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            L+  +L K + E FTPDD FL+G +SM+D    Q + HS+ES S+DGD L+N   ED+  
Sbjct  797  LDKSELAKLIFEAFTPDDPFLYGPRSMLDFRKNQSVTHSKESLSFDGD-LSNFLVEDEVT  855

Query  741  SESSVTDMTRFMP-TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV D+ RF+P   PSPS S I+ IGQLLESALEVAGQV GT VSTSPLPY AMASQC
Sbjct  856  SEASVADIARFIPRVPPSPSISHIMGIGQLLESALEVAGQVVGTSVSTSPLPYNAMASQC  915

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LGT TRKKLSNWLAHEN +T+ AAD   P  P +G    +K + +   L QGV +  +
Sbjct  916  EALGTGTRKKLSNWLAHENQHTR-AADGYCPPFPVSGHSAVEKIMADGRQL-QGVGLQAD  973

Query  384  PWLAIWLPPASPFDNFLRAA  325
             W+ + LPPASPFDNFL+AA
Sbjct  974  RWMGMRLPPASPFDNFLKAA  993



>gb|KHG26706.1| Protein EFR3 B [Gossypium arboreum]
Length=1050

 Score =   214 bits (545),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 144/209 (69%), Gaps = 9/209 (4%)
 Frame = -1

Query  921   LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
             LE DDL+K++SE FTPDD F+FG +S++D+DH Q+  +S+ES S+D D  T+   EDD  
Sbjct  841   LEIDDLMKQLSEPFTPDDAFMFGPRSILDLDHNQMTPYSKESLSFDEDVRTSQLLEDDAR  900

Query  741   SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             SE+SV D++ F+P +P SPS S ++NIGQLL+SALEVAGQVA T VSTSPLPY  MASQC
Sbjct  901   SEASVLDLSHFIPKAPASPSISNVINIGQLLQSALEVAGQVAATSVSTSPLPYDTMASQC  960

Query  564   ETLGTDTRKKLSNWLAHENHYTKAA-ADVLLPAIPGNGLLTAKKTIDE-------DSTLQ  409
             E  GT TRKKLSNWLAHENH  +AA   +L  A      +  KK I         +    
Sbjct  961   EAFGTGTRKKLSNWLAHENHQNEAADKTILTTAAADRHTMMLKKVITNSLKCWISNGNAF  1020

Query  408   QGVMVPREPWLAIWLPPASPFDNFLRAAR  322
              G +   +P L++ LPPASPFDNFL+AAR
Sbjct  1021  NGAVSQLDPCLSMRLPPASPFDNFLKAAR  1049



>ref|XP_007031156.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY11658.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=1000

 Score =   213 bits (541),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 145/201 (72%), Gaps = 5/201 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE DDL K++ E FTPDD F+FG +S++D+DH +++  S+ES S+D D  T+S  EDD  
Sbjct  801  LEIDDLTKQLFEPFTPDDAFMFGPRSILDLDHDEMISQSKESLSFDEDVQTSSLLEDDAR  860

Query  741  SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV D++RF+P  P SPS S +++IGQLLESALEVAGQVA T VSTSPLP+  MAS+C
Sbjct  861  SEASVLDLSRFIPKVPASPSISHVISIGQLLESALEVAGQVAATSVSTSPLPFDTMASRC  920

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGL-LTAKKTIDEDSTLQQGVMVPR  388
            E  GT TRKKLSNWLAHENH    AAD  LPA+  +   +T +K   E +    G +   
Sbjct  921  EAFGTGTRKKLSNWLAHENH-QNGAADKFLPAVLADDRHMTLRKITSEGAF--NGPVSRL  977

Query  387  EPWLAIWLPPASPFDNFLRAA  325
            +P LA+ LPPASPFDNFL+AA
Sbjct  978  DPCLAMRLPPASPFDNFLKAA  998



>ref|XP_007031155.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY11657.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1019

 Score =   213 bits (541),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 114/201 (57%), Positives = 145/201 (72%), Gaps = 5/201 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE DDL K++ E FTPDD F+FG +S++D+DH +++  S+ES S+D D  T+S  EDD  
Sbjct  801  LEIDDLTKQLFEPFTPDDAFMFGPRSILDLDHDEMISQSKESLSFDEDVQTSSLLEDDAR  860

Query  741  SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV D++RF+P  P SPS S +++IGQLLESALEVAGQVA T VSTSPLP+  MAS+C
Sbjct  861  SEASVLDLSRFIPKVPASPSISHVISIGQLLESALEVAGQVAATSVSTSPLPFDTMASRC  920

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGL-LTAKKTIDEDSTLQQGVMVPR  388
            E  GT TRKKLSNWLAHENH    AAD  LPA+  +   +T +K   E +    G +   
Sbjct  921  EAFGTGTRKKLSNWLAHENH-QNGAADKFLPAVLADDRHMTLRKITSEGAF--NGPVSRL  977

Query  387  EPWLAIWLPPASPFDNFLRAA  325
            +P LA+ LPPASPFDNFL+AA
Sbjct  978  DPCLAMRLPPASPFDNFLKAA  998



>ref|XP_011023781.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
 ref|XP_011023783.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
 ref|XP_011023784.1| PREDICTED: uncharacterized protein LOC105125162 [Populus euphratica]
Length=994

 Score =   212 bits (540),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/200 (57%), Positives = 142/200 (71%), Gaps = 4/200 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE DDL +++ E FTPDD F++G +S+++ DH Q+  HS+ES S+D D  TNS  +DD  
Sbjct  796  LEVDDLAQQLLEPFTPDDAFMYGPRSILE-DHNQMASHSKESLSFDEDIPTNSLVDDDVT  854

Query  741  SESSVTDMTRFMPTSPS-PSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV D++RF+P  PS PS S +++IGQLLESALEVAGQVAGT VSTSPLPY  MA  C
Sbjct  855  SEASVADLSRFIPKIPSSPSVSHVISIGQLLESALEVAGQVAGTSVSTSPLPYDTMARHC  914

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LGT TRKKLSNWL +E HYT+ A +   PA   NG L   K   +   +++    P  
Sbjct  915  ENLGTGTRKKLSNWLTYETHYTR-ANERHSPAFTANGCLAPWKITSDVGNIKEAAK-PVG  972

Query  384  PWLAIWLPPASPFDNFLRAA  325
            P+LAI LPPASPFDNFL+AA
Sbjct  973  PFLAIRLPPASPFDNFLKAA  992



>ref|XP_006433539.1| hypothetical protein CICLE_v10000144mg [Citrus clementina]
 gb|ESR46779.1| hypothetical protein CICLE_v10000144mg [Citrus clementina]
Length=999

 Score =   210 bits (535),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 144/200 (72%), Gaps = 4/200 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E DDL K++ E FTPDD  +FG QS++ +DH Q++ +S+ES S+D D  TNS  EDD  
Sbjct  801  VEADDLAKQLQEPFTPDDAIMFGPQSILALDHSQMISNSKESLSFDEDIATNSLVEDDAT  860

Query  741  SESSVTDMTRFMPTSPSPS-SSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV +++RF+P  P+PS +S IV+IGQL+ESAL+VAGQVAG+ +STSPLPY  +AS C
Sbjct  861  SEASVANLSRFIPRMPTPSPTSHIVSIGQLMESALKVAGQVAGSTISTSPLPYNTLASHC  920

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LG+ TR+KLSNWL HENHY + A +   PA P +     +K I ++    +G ++P+ 
Sbjct  921  EALGSGTRQKLSNWLIHENHYAR-ATNKFSPASPADSYSALEKIISDEPG--EGSVMPQN  977

Query  384  PWLAIWLPPASPFDNFLRAA  325
               A+ LPP SPFDNFL+AA
Sbjct  978  ACTAMKLPPVSPFDNFLKAA  997



>ref|XP_002318950.2| hypothetical protein POPTR_0013s00990g [Populus trichocarpa]
 gb|EEE94873.2| hypothetical protein POPTR_0013s00990g [Populus trichocarpa]
Length=994

 Score =   209 bits (533),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 141/200 (71%), Gaps = 4/200 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE DDL +++ E FTPDD F++G +S+++ DH Q+  HS+ES S+D D  TNS  +DD  
Sbjct  796  LEVDDLAQQLLEPFTPDDAFMYGPRSILE-DHNQMASHSKESLSFDEDIPTNSLVDDDVT  854

Query  741  SESSVTDMTRFMPTSPS-PSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV D++RF+P  PS PS S +++IGQLLESALEVAGQVAGT VSTSPLPY  MA  C
Sbjct  855  SEASVADLSRFIPKIPSSPSVSHVISIGQLLESALEVAGQVAGTSVSTSPLPYDTMARHC  914

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LGT TRKKLSNWL +E HYT  A +   PA   NG L   K   +   +++    P  
Sbjct  915  ENLGTGTRKKLSNWLTYETHYT-IANERHSPAFTANGCLAPWKITSDVGNIKEAAK-PVG  972

Query  384  PWLAIWLPPASPFDNFLRAA  325
            P+LA+ LPPASPFDNFL+AA
Sbjct  973  PFLAMRLPPASPFDNFLKAA  992



>ref|XP_010024133.1| PREDICTED: uncharacterized protein LOC104414673 [Eucalyptus grandis]
 gb|KCW60561.1| hypothetical protein EUGRSUZ_H03293 [Eucalyptus grandis]
Length=993

 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/199 (57%), Positives = 146/199 (73%), Gaps = 7/199 (4%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            ++ +DL K++SE + P+DTF+FG Q ++D+D  Q++VHS++S S+D +F TNSS EDD +
Sbjct  800  VDGEDLAKQLSEEYKPEDTFVFGPQLILDLDSNQIVVHSKKSLSFDEEFSTNSSVEDDAM  859

Query  741  SESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCE  562
            SE+SV  M+R MP  P+PS S ++ IG+LLE+ALEVAGQVAGT VSTSPLPY  MASQCE
Sbjct  860  SEASVA-MSR-MP--PTPSFSDVIGIGKLLETALEVAGQVAGTTVSTSPLPYNTMASQCE  915

Query  561  TLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREP  382
             LGT  RKKLSNWLA EN   ++AAD   PA  G   +  KK    DS L+  +M+P + 
Sbjct  916  ALGTGPRKKLSNWLAQENSCARSAADHFFPATDGRTAI--KKITGTDSPLRGDIMLP-DR  972

Query  381  WLAIWLPPASPFDNFLRAA  325
             L + LPPASPFDNFLRAA
Sbjct  973  CLTMKLPPASPFDNFLRAA  991



>ref|XP_007145003.1| hypothetical protein PHAVU_007G201500g [Phaseolus vulgaris]
 gb|ESW16997.1| hypothetical protein PHAVU_007G201500g [Phaseolus vulgaris]
Length=999

 Score =   207 bits (527),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 144/200 (72%), Gaps = 11/200 (6%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            L+ D+L   +SE F PD+ F+FG QSM+D +  Q++ HS+ES S+DGDF  NS+ EDD I
Sbjct  808  LDADELASLLSETFKPDEEFVFGPQSMLDQN--QIIFHSQESLSFDGDFPLNSAGEDDTI  865

Query  741  SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV+D++RF+P  P SPS+  +++IGQL+ESALEVAGQVAGT VSTSPLPY  MASQC
Sbjct  866  SEASVSDLSRFIPKMPVSPSAPHVISIGQLMESALEVAGQVAGTAVSTSPLPYNTMASQC  925

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E+LGT  RKKLSNWLA ENHYT+AA    L AI        +K  + D   Q    + R+
Sbjct  926  ESLGTFARKKLSNWLAFENHYTQAADKSFL-AIADVRNSALEKVGNGDGYGQ----LARD  980

Query  384  PWLAIWLPPASPFDNFLRAA  325
            P   + LPPASPFDNFL+AA
Sbjct  981  P---MRLPPASPFDNFLKAA  997



>ref|XP_010092978.1| hypothetical protein L484_018915 [Morus notabilis]
 gb|EXB53031.1| hypothetical protein L484_018915 [Morus notabilis]
Length=1022

 Score =   207 bits (527),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 142/200 (71%), Gaps = 3/200 (2%)
 Frame = -1

Query  921   LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
             LE  D++K++SE FT DD F FG +S +D+DH Q++ HS+ES S+D D  TNS  EDD  
Sbjct  823   LEAGDVLKQLSEPFTADDAFTFGPRSALDLDHDQMVAHSKESLSFDADLPTNSLVEDDAT  882

Query  741   SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             SE SV D++RF+P  + S S S I++IGQLLESALEVAG VAG+ VSTSPLPY AM SQC
Sbjct  883   SEPSVADVSRFIPRMTSSSSGSHIISIGQLLESALEVAGHVAGSSVSTSPLPYNAMTSQC  942

Query  564   ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
             E LGT TRKKLSNWLAHENH  K AAD    A P +   T  K   E    Q  V V ++
Sbjct  943   EALGTGTRKKLSNWLAHENHGNK-AADKFFSAFPADVRKTLHKITSEGGPAQGAVFV-QD  1000

Query  384   PWLAIWLPPASPFDNFLRAA  325
             PWL++ LPPASPFDNFL+AA
Sbjct  1001  PWLSMRLPPASPFDNFLKAA  1020



>ref|XP_006589118.1| PREDICTED: uncharacterized protein LOC100785587 isoform X3 [Glycine 
max]
 gb|KHN16056.1| Protein EFR3 like A [Glycine soja]
Length=996

 Score =   204 bits (519),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 148/207 (71%), Gaps = 24/207 (12%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSA-EDDK  745
            L+ D+L   +SE F PD+ F+FG QSM+D +  Q++ HS+ES S+DGDF +NS+  EDD 
Sbjct  804  LDADELAMLLSEKFKPDEEFVFGPQSMLDQN--QIIFHSQESLSFDGDFPSNSAGGEDDT  861

Query  744  ISESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQ  568
            ISE+SV+D++RF+P  P SPS+ ++++IGQL+ESALEVAGQVAGT +STSPLPY AMASQ
Sbjct  862  ISEASVSDLSRFIPKMPISPSAPQVISIGQLMESALEVAGQVAGTAISTSPLPYNAMASQ  921

Query  567  CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQ---GV-  400
            CE+LGT  RKKLSNWLA ENHY++A         P    L        +S L++   GV 
Sbjct  922  CESLGTCARKKLSNWLAFENHYSQA---------PDKSFLAIADI--RNSALEKVANGVG  970

Query  399  --MVPREPWLAIWLPPASPFDNFLRAA  325
               +PR+P   + LPPASPFDNFL+AA
Sbjct  971  HAQLPRDP---MKLPPASPFDNFLKAA  994



>ref|XP_003536043.1| PREDICTED: uncharacterized protein LOC100785587 isoform X1 [Glycine 
max]
 ref|XP_006589117.1| PREDICTED: uncharacterized protein LOC100785587 isoform X2 [Glycine 
max]
Length=997

 Score =   204 bits (519),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 148/207 (71%), Gaps = 24/207 (12%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSA-EDDK  745
            L+ D+L   +SE F PD+ F+FG QSM+D +  Q++ HS+ES S+DGDF +NS+  EDD 
Sbjct  805  LDADELAMLLSEKFKPDEEFVFGPQSMLDQN--QIIFHSQESLSFDGDFPSNSAGGEDDT  862

Query  744  ISESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQ  568
            ISE+SV+D++RF+P  P SPS+ ++++IGQL+ESALEVAGQVAGT +STSPLPY AMASQ
Sbjct  863  ISEASVSDLSRFIPKMPISPSAPQVISIGQLMESALEVAGQVAGTAISTSPLPYNAMASQ  922

Query  567  CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQ---GV-  400
            CE+LGT  RKKLSNWLA ENHY++A         P    L        +S L++   GV 
Sbjct  923  CESLGTCARKKLSNWLAFENHYSQA---------PDKSFLAIADI--RNSALEKVANGVG  971

Query  399  --MVPREPWLAIWLPPASPFDNFLRAA  325
               +PR+P   + LPPASPFDNFL+AA
Sbjct  972  HAQLPRDP---MKLPPASPFDNFLKAA  995



>gb|KJB81104.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=996

 Score =   202 bits (515),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 136/201 (68%), Gaps = 4/201 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            L  DDL K++ E FTPDD F F  QS+ D+DH Q++ HS+ES S+D D  TNS  E+D  
Sbjct  798  LGMDDLRKQLLEPFTPDDAFTFVPQSIFDLDHHQMITHSKESLSFDEDVQTNSLLEEDAR  857

Query  741  SESSVTDMTRFMP-TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV   +RF P  S SP+ S +++IGQL+ESALEVAGQVA T VSTSPLPY  MASQC
Sbjct  858  SEASVLHHSRFNPKVSASPAISHVISIGQLMESALEVAGQVAATSVSTSPLPYDTMASQC  917

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E  GT TRKKLSNWLAHEN+    AAD LLP +  +      K   E   +  G +   +
Sbjct  918  EAFGTGTRKKLSNWLAHENN-QNGAADKLLPTVMADRRTMLSKISSEG--VFSGAVSWVD  974

Query  384  PWLAIWLPPASPFDNFLRAAR  322
            P LA+ LPPASPFDNFL+ AR
Sbjct  975  PCLAMRLPPASPFDNFLKVAR  995



>gb|KHG02153.1| Protein EFR3 [Gossypium arboreum]
Length=999

 Score =   202 bits (514),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 112/201 (56%), Positives = 136/201 (68%), Gaps = 4/201 (2%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            L  DDL K++ E FTPDD F FG QS+ D+DH Q++ +S+ES S+D D  TNS  E+D  
Sbjct  801  LGMDDLRKQLLEPFTPDDAFTFGPQSIFDLDHHQMITYSKESLSFDEDVQTNSLLEEDAR  860

Query  741  SESSVTDMTRFMP-TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV   +RF P  S SP+ S +++IGQL+ESALEVAGQVA T VSTSPLPY  MASQC
Sbjct  861  SEASVLHHSRFNPKVSASPAISHVISIGQLMESALEVAGQVAATSVSTSPLPYDTMASQC  920

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E  GT TRKKLSNWLA ENH    AAD LLP +  +      K   E   +  G +   +
Sbjct  921  EAFGTGTRKKLSNWLADENH-QNGAADKLLPTVMADRRTMLSKISGEG--VFSGAVSWVD  977

Query  384  PWLAIWLPPASPFDNFLRAAR  322
            P LA+ LPPASPFDNFL+ AR
Sbjct  978  PCLAMRLPPASPFDNFLKVAR  998



>ref|XP_003555181.1| PREDICTED: uncharacterized protein LOC100788290 [Glycine max]
Length=995

 Score =   201 bits (512),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 142/201 (71%), Gaps = 12/201 (6%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            L+  +L   + E F P + F+FG QSM+D +  Q++ HS+ES S+DGDF +NS+ EDD I
Sbjct  803  LDAGELAMLLLEKFKPGEEFVFGPQSMLDQN--QIIFHSQESLSFDGDFPSNSAGEDDTI  860

Query  741  SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV+D++RF+P  P SPS+  +++IGQL+ESALEVAGQVAGT +STSPLPY  MASQC
Sbjct  861  SEASVSDLSRFIPKMPLSPSAPHVISIGQLMESALEVAGQVAGTAISTSPLPYNTMASQC  920

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQG-VMVPR  388
            E+LGT  RKKLSNWLA ENHY++A  D    AI        + +  E  T   G   +PR
Sbjct  921  ESLGTCARKKLSNWLAFENHYSQALDDKSFLAIAD-----IRNSAPEKVTNGGGHAQLPR  975

Query  387  EPWLAIWLPPASPFDNFLRAA  325
            +P   + LPPASPFDNFL+AA
Sbjct  976  DP---MKLPPASPFDNFLKAA  993



>ref|XP_004495652.1| PREDICTED: uncharacterized protein LOC101508441 isoform X1 [Cicer 
arietinum]
 ref|XP_004495653.1| PREDICTED: uncharacterized protein LOC101508441 isoform X2 [Cicer 
arietinum]
 ref|XP_004495654.1| PREDICTED: uncharacterized protein LOC101508441 isoform X3 [Cicer 
arietinum]
 ref|XP_004495655.1| PREDICTED: uncharacterized protein LOC101508441 isoform X4 [Cicer 
arietinum]
Length=994

 Score =   197 bits (501),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/197 (54%), Positives = 136/197 (69%), Gaps = 8/197 (4%)
 Frame = -1

Query  912  DDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISES  733
            D+L   +SE F PD+ F+FG QS++D +  Q+  HS+ES S D DF +NS  EDD ISE+
Sbjct  803  DNLAVLLSETFKPDEDFVFGPQSILDQN--QITFHSQESLSIDEDFPSNSGGEDDAISEA  860

Query  732  SVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETL  556
            SV+D++RF+P  P SP    +++IGQL+ESALEVA  VAGT VSTSPLPY  MASQCE+L
Sbjct  861  SVSDLSRFIPKMPVSPPQPHVISIGQLMESALEVASHVAGTAVSTSPLPYNTMASQCESL  920

Query  555  GTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPWL  376
            GT +RKKLSNWLA ENHYT++     L A   N   + +K   E      G  +PR+   
Sbjct  921  GTFSRKKLSNWLAFENHYTQSPDKSFLTAFARNSNSSVEKVAYEG-----GDALPRDLGH  975

Query  375  AIWLPPASPFDNFLRAA  325
            A+ LPPASPFDNFL+AA
Sbjct  976  AMKLPPASPFDNFLKAA  992



>gb|KDO81674.1| hypothetical protein CISIN_1g0373181mg, partial [Citrus sinensis]
Length=180

 Score =   183 bits (465),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 89/163 (55%), Positives = 120/163 (74%), Gaps = 2/163 (1%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E DDL K++ E FTPDD  +FG QS++ +DH Q++ +S+ES S+D D  TNS  EDD  
Sbjct  1    VEADDLAKQLQEPFTPDDAIMFGPQSILALDHSQMISNSKESLSFDEDIATNSLVEDDAT  60

Query  741  SESSVTDMTRFMPTSPSPS-SSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV +++RF+P  P+PS +S IV+IGQL+ESAL+VAGQVAG+ +STSPLPY  +AS C
Sbjct  61   SEASVANLSRFIPRMPTPSPTSHIVSIGQLMESALKVAGQVAGSTISTSPLPYNTLASHC  120

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKK  436
            E LG+ TR+KLSNWL HENHY + A +   PA P +     +K
Sbjct  121  EALGSGTRQKLSNWLIHENHYAR-ATNKFSPASPADSYSALEK  162



>gb|KEH43106.1| cyclin-like protein [Medicago truncatula]
Length=997

 Score =   195 bits (496),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 139/200 (70%), Gaps = 8/200 (4%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            L+ D+L   +SE F PD+ F+FG QS++D +  Q+  +S+ES S D DF +NS  EDD I
Sbjct  803  LDADNLTVLLSETFKPDEDFVFGPQSILDQN--QMTYYSQESLSVDEDFPSNSGGEDDNI  860

Query  741  SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV+D++RF+P  P SP    +++IGQL+ESALEVA  VAGT VSTSPLPY AMASQC
Sbjct  861  SEASVSDLSRFIPKMPVSPPQPHVISIGQLMESALEVASHVAGTSVSTSPLPYNAMASQC  920

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E+LGT +RKKLSNWLA ENHYT++     L A   N     +K   ED   Q   + PR+
Sbjct  921  ESLGTCSRKKLSNWLAFENHYTQSPDKSFL-AFARNSNAALEKEAYEDGNPQVAAL-PRD  978

Query  384  PWLAIWLPPASPFDNFLRAA  325
            P   + LPPASPFDNFL+AA
Sbjct  979  P---MKLPPASPFDNFLKAA  995



>emb|CAN82509.1| hypothetical protein VITISV_012725 [Vitis vinifera]
Length=1471

 Score =   186 bits (471),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 124/184 (67%), Gaps = 3/184 (2%)
 Frame = -1

Query  915   TDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISE  736
              D+L K++SE FTPDD  LFG QS+  ++HIQ +   +ES S+DGDF  NS  E+D ISE
Sbjct  1256  VDELAKQLSETFTPDDALLFGPQSIFGLEHIQTVSLPKESLSFDGDFPPNSLVEEDLISE  1315

Query  735   SSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
             SSV D++RF+P  P SPS S +++IGQLLESALEVAGQVAGT VSTSPLPY  MASQCE 
Sbjct  1316  SSVVDLSRFIPKMPASPSLSHVISIGQLLESALEVAGQVAGTSVSTSPLPYSTMASQCEA  1375

Query  558   LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPW  379
             LG+ TR+KLS+WL HEN YT    D   P  P +G  +A   I  D  + + +    +  
Sbjct  1376  LGSGTRRKLSSWLTHENGYT-IGPDKPFPTFPADG-CSAITNITSDGRITRSLAXTLQQN  1433

Query  378   LAIW  367
             L  W
Sbjct  1434  LVSW  1437



>ref|XP_010267987.1| PREDICTED: uncharacterized protein LOC104605067 isoform X2 [Nelumbo 
nucifera]
Length=989

 Score =   183 bits (464),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 136/200 (68%), Gaps = 9/200 (5%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            L+ DDL +++SE FTPDD F+F  QS + + H++ +   +ES   DG+    SS+EDD +
Sbjct  796  LDMDDLARQLSEVFTPDDVFMFAPQSALGLCHLRTICLKKESHP-DGE--PTSSSEDDAL  852

Query  741  SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            S+SS  + T  MP +P SPS S I+++GQL+ESALEVAGQVAGT VSTSPLPY AMASQC
Sbjct  853  SDSS--NRTGVMPRTPTSPSLSHIISVGQLVESALEVAGQVAGTSVSTSPLPYSAMASQC  910

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LGT TRKKLS+WLAHE    +A    +  A P +G    +    E+    QG++   E
Sbjct  911  EALGTGTRKKLSSWLAHETPLPRAGE--VFSAFPSDGQSAIRNITIENGGYVQGIL-STE  967

Query  384  PWLAIWLPPASPFDNFLRAA  325
             W ++ LPPASPFDNFL+AA
Sbjct  968  QWSSMRLPPASPFDNFLKAA  987



>ref|XP_010267985.1| PREDICTED: uncharacterized protein LOC104605067 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267986.1| PREDICTED: uncharacterized protein LOC104605067 isoform X1 [Nelumbo 
nucifera]
Length=1001

 Score =   183 bits (464),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 136/200 (68%), Gaps = 9/200 (5%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            L+ DDL +++SE FTPDD F+F  QS + + H++ +   +ES   DG+    SS+EDD +
Sbjct  808  LDMDDLARQLSEVFTPDDVFMFAPQSALGLCHLRTICLKKESHP-DGE--PTSSSEDDAL  864

Query  741  SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            S+SS  + T  MP +P SPS S I+++GQL+ESALEVAGQVAGT VSTSPLPY AMASQC
Sbjct  865  SDSS--NRTGVMPRTPTSPSLSHIISVGQLVESALEVAGQVAGTSVSTSPLPYSAMASQC  922

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LGT TRKKLS+WLAHE    +A    +  A P +G    +    E+    QG++   E
Sbjct  923  EALGTGTRKKLSSWLAHETPLPRAGE--VFSAFPSDGQSAIRNITIENGGYVQGIL-STE  979

Query  384  PWLAIWLPPASPFDNFLRAA  325
             W ++ LPPASPFDNFL+AA
Sbjct  980  QWSSMRLPPASPFDNFLKAA  999



>ref|XP_008781114.1| PREDICTED: protein EFR3 homolog cmp44E-like isoform X1 [Phoenix 
dactylifera]
Length=1013

 Score =   176 bits (446),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 132/206 (64%), Gaps = 20/206 (10%)
 Frame = -1

Query  921   LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
             LE D L K+++E FTP+D  LFG  + VD   IQ L  S ES S+D +   +S+ + D +
Sbjct  817   LEKDVLAKQLTETFTPEDVPLFGSMTTVDWVSIQALAVSEESLSFDEECSRSSTIDGDVV  876

Query  741   SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             SES  TD+ +F+P  P SP+   ++N+GQLLESAL VAGQVAGT VSTSPLPYGAMASQC
Sbjct  877   SESPATDIHKFIPRMPASPALPDVINVGQLLESALHVAGQVAGTSVSTSPLPYGAMASQC  936

Query  564   ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGN-------GLLTAKKTIDEDSTLQQ  406
             E+LG  TRKKLS+WL           D+    IPGN       G   A +T++     QQ
Sbjct  937   ESLGMGTRKKLSSWLV-------GGHDL----IPGNPAPAYPTGEQLAIRTVNAYGCEQQ  985

Query  405   GVMVPREPWLAIWLPPASPFDNFLRA  328
               ++P EP  A+ LPPASPFDNFL+A
Sbjct  986   A-LIPVEPRPALRLPPASPFDNFLKA  1010



>ref|XP_008781115.1| PREDICTED: uncharacterized protein LOC103700980 isoform X2 [Phoenix 
dactylifera]
Length=993

 Score =   176 bits (446),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/206 (50%), Positives = 132/206 (64%), Gaps = 20/206 (10%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE D L K+++E FTP+D  LFG  + VD   IQ L  S ES S+D +   +S+ + D +
Sbjct  797  LEKDVLAKQLTETFTPEDVPLFGSMTTVDWVSIQALAVSEESLSFDEECSRSSTIDGDVV  856

Query  741  SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SES  TD+ +F+P  P SP+   ++N+GQLLESAL VAGQVAGT VSTSPLPYGAMASQC
Sbjct  857  SESPATDIHKFIPRMPASPALPDVINVGQLLESALHVAGQVAGTSVSTSPLPYGAMASQC  916

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGN-------GLLTAKKTIDEDSTLQQ  406
            E+LG  TRKKLS+WL           D+    IPGN       G   A +T++     QQ
Sbjct  917  ESLGMGTRKKLSSWLV-------GGHDL----IPGNPAPAYPTGEQLAIRTVNAYGCEQQ  965

Query  405  GVMVPREPWLAIWLPPASPFDNFLRA  328
              ++P EP  A+ LPPASPFDNFL+A
Sbjct  966  A-LIPVEPRPALRLPPASPFDNFLKA  990



>ref|XP_010546763.1| PREDICTED: uncharacterized protein LOC104818746 [Tarenaya hassleriana]
Length=989

 Score =   175 bits (444),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 131/202 (65%), Gaps = 11/202 (5%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE   +  E+SE FTPDDTF+FG +S ++ D  Q +  S++S S+D D    S  E+D  
Sbjct  792  LEEAVVSMELSEPFTPDDTFIFGPRSTIESDPNQSI--SKDSLSFDEDIHGGSMVEEDVT  849

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV D++RF+P  SPSPS   ++++GQL+ESALEVAGQV G+ VSTSPLPY AMA++C
Sbjct  850  SELSVADISRFLPKPSPSPSLHHVISVGQLMESALEVAGQVVGSSVSTSPLPYDAMANRC  909

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAA--DVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVP  391
            ET G+ TR+KLSNWLA EN         D L        L    K  D +S   + V +P
Sbjct  910  ETFGSGTRQKLSNWLASENRQINGLGRRDSL------ANLSVLDKVGDAESITGREVGLP  963

Query  390  REPWLAIWLPPASPFDNFLRAA  325
            +E W  + LPPASPFDNFL+AA
Sbjct  964  QEHWSTMRLPPASPFDNFLKAA  985



>ref|XP_010921489.1| PREDICTED: uncharacterized protein LOC105045026 [Elaeis guineensis]
Length=992

 Score =   169 bits (428),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 129/206 (63%), Gaps = 20/206 (10%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE D L K++SE FTP+D  LF  ++ VD   IQ L  S ES S+D +   +S+ + D +
Sbjct  796  LEKDVLAKQLSETFTPEDVPLFSSKTTVDWVSIQALAVSEESLSFDEECSRSSTIDGDVV  855

Query  741  SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SES  TD+ +F+P  P SP+   ++N+GQLLESAL VAGQVAGT VSTSPLPYG MASQC
Sbjct  856  SESPATDIHKFIPRMPASPALPDVINVGQLLESALHVAGQVAGTSVSTSPLPYGTMASQC  915

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGN-------GLLTAKKTIDEDSTLQQ  406
            E+LG  TRKKLS+WL           D+    IPGN       G   A  T++     Q 
Sbjct  916  ESLGMGTRKKLSSWLV-------GGHDL----IPGNPVPTYPMGERLAIPTVNSQGFEQP  964

Query  405  GVMVPREPWLAIWLPPASPFDNFLRA  328
            G ++P EP   + LPPASPFDNFL+A
Sbjct  965  G-LIPVEPRPVLRLPPASPFDNFLKA  989



>ref|XP_006605812.1| PREDICTED: uncharacterized protein LOC102659728 [Glycine max]
Length=264

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 108/150 (72%), Gaps = 8/150 (5%)
 Frame = -1

Query  771  TNSSAEDDKISESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP  595
            +NS+ EDD ISE+SV+D++RF+P  P SPS+  +++IGQL+ESALEVAGQVAGT +STSP
Sbjct  120  SNSAGEDDTISEASVSDLSRFIPKMPLSPSAPHVISIGQLMESALEVAGQVAGTAISTSP  179

Query  594  LPYGAMASQCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDST  415
            LPY  MASQCE+LGT  RKKLSNWLA ENHY++   D    AI       ++K  +    
Sbjct  180  LPYNTMASQCESLGTCVRKKLSNWLAFENHYSQTPDDKSFLAIADIRNSASEKVTNGGGH  239

Query  414  LQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
             Q    +PR+P   + LPPASPFDNFL+AA
Sbjct  240  AQ----LPRDP---MKLPPASPFDNFLKAA  262



>gb|KHN23161.1| hypothetical protein glysoja_030221 [Glycine soja]
Length=577

 Score =   160 bits (404),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 108/150 (72%), Gaps = 8/150 (5%)
 Frame = -1

Query  771  TNSSAEDDKISESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP  595
            +NS+ EDD ISE+SV+D++RF+P  P SPS+  +++IGQL+ESALEVAGQVAGT +STSP
Sbjct  433  SNSAGEDDTISEASVSDLSRFIPKMPLSPSAPHVISIGQLMESALEVAGQVAGTAISTSP  492

Query  594  LPYGAMASQCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDST  415
            LPY  MASQCE+LGT  RKKLSNWLA ENHY++   D    AI       ++K  +    
Sbjct  493  LPYNTMASQCESLGTCVRKKLSNWLAFENHYSQTPDDKSFLAIADIRNSASEKVTNGGGH  552

Query  414  LQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
             Q    +PR+P   + LPPASPFDNFL+AA
Sbjct  553  AQ----LPRDP---MKLPPASPFDNFLKAA  575



>ref|XP_007031157.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
 gb|EOY11659.1| Uncharacterized protein isoform 3, partial [Theobroma cacao]
Length=740

 Score =   161 bits (407),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE DDL K++ E FTPDD F+FG +S++D+DH +++  S+ES S+D D  T+S  EDD  
Sbjct  608  LEIDDLTKQLFEPFTPDDAFMFGPRSILDLDHDEMISQSKESLSFDEDVQTSSLLEDDAR  667

Query  741  SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE+SV D++RF+P  P SPS S +++IGQLLESALEVAGQVA T VSTSPLP+  MAS+C
Sbjct  668  SEASVLDLSRFIPKVPASPSISHVISIGQLLESALEVAGQVAATSVSTSPLPFDTMASRC  727

Query  564  ETLGTDTRKKLSN  526
            E  GT TRKKLSN
Sbjct  728  EAFGTGTRKKLSN  740



>ref|XP_009384434.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384435.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009384436.1| PREDICTED: uncharacterized protein LOC103971984 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=998

 Score =   159 bits (402),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 122/209 (58%), Gaps = 28/209 (13%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E D L K+++  F  +D  LFGL+  VD    Q LV S ES  +D +    SS   D +S
Sbjct  805  EKDVLAKQLAGIFLFEDAPLFGLEPAVDWISGQALVVSEESVPFDEECSRTSSVNGDTVS  864

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            +S VT++  F    P P+   ++++GQLLESAL VAGQVAGT VSTSPLPYG MA QCE 
Sbjct  865  QSPVTEIPGFFSRMPPPAFPSVISVGQLLESALHVAGQVAGTSVSTSPLPYGTMAGQCEA  924

Query  558  LGTDTRKKLSNWL--AHEN---------HYTKAAADVLLPAIPGNGLLTAKKTIDEDSTL  412
            LG  TRKKLS+WL  +HE+         H  +  A   +P +  +GL  A          
Sbjct  925  LGMGTRKKLSSWLVGSHESMSDNPSPSLHMDEQKA---VPKVNSHGLEQAS---------  972

Query  411  QQGVMVPREPWLAIWLPPASPFDNFLRAA  325
                 VP EPWLA+ LPPASPFDNFL+AA
Sbjct  973  -----VPMEPWLALRLPPASPFDNFLKAA  996



>ref|XP_009384437.1| PREDICTED: uncharacterized protein LOC103971984 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=997

 Score =   159 bits (401),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 97/209 (46%), Positives = 122/209 (58%), Gaps = 28/209 (13%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E D L K+++  F  +D  LFGL+  VD    Q LV S ES  +D +    SS   D +S
Sbjct  804  EKDVLAKQLAGIFLFEDAPLFGLEPAVDWISGQALVVSEESVPFDEECSRTSSVNGDTVS  863

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            +S VT++  F    P P+   ++++GQLLESAL VAGQVAGT VSTSPLPYG MA QCE 
Sbjct  864  QSPVTEIPGFFSRMPPPAFPSVISVGQLLESALHVAGQVAGTSVSTSPLPYGTMAGQCEA  923

Query  558  LGTDTRKKLSNWL--AHEN---------HYTKAAADVLLPAIPGNGLLTAKKTIDEDSTL  412
            LG  TRKKLS+WL  +HE+         H  +  A   +P +  +GL  A          
Sbjct  924  LGMGTRKKLSSWLVGSHESMSDNPSPSLHMDEQKA---VPKVNSHGLEQAS---------  971

Query  411  QQGVMVPREPWLAIWLPPASPFDNFLRAA  325
                 VP EPWLA+ LPPASPFDNFL+AA
Sbjct  972  -----VPMEPWLALRLPPASPFDNFLKAA  995



>ref|XP_010938250.1| PREDICTED: uncharacterized protein LOC105057345 isoform X1 [Elaeis 
guineensis]
Length=1003

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 125/209 (60%), Gaps = 24/209 (11%)
 Frame = -1

Query  921   LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
             LE D L K+++E F P+D  LFG   ++D  + Q L  S ES S+D +   +SS EDD +
Sbjct  807   LEKDVLAKQLTETFIPEDVPLFGSNPVLDQVNAQALAVSEESLSFDEECSRSSSIEDDIV  866

Query  741   SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
              E     + +F P  P SP+   ++++GQLLESAL VAGQVAGT VSTSPLPYG MA QC
Sbjct  867   GELPAMVIHKFTPKMPTSPTLPNVISVGQLLESALHVAGQVAGTSVSTSPLPYGTMAGQC  926

Query  564   ETLGTDTRKKLSNWL--AHENHYTKAAADVLLPAIPGN-------GLLTAKKTIDEDSTL  412
             E LG  TRKKLS+WL   H+             +IP N       G  +A +  +  S  
Sbjct  927   EALGMGTRKKLSSWLVGGHD-------------SIPDNPVQIFPIGERSAFRMANAYSFE  973

Query  411   QQGVMVPREPWLAIWLPPASPFDNFLRAA  325
             QQ  +VP EP  A+ LPPASPFDNFL+AA
Sbjct  974   QQA-LVPVEPRPALRLPPASPFDNFLKAA  1001



>ref|XP_010938251.1| PREDICTED: uncharacterized protein LOC105057345 isoform X2 [Elaeis 
guineensis]
Length=993

 Score =   158 bits (399),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 98/209 (47%), Positives = 125/209 (60%), Gaps = 24/209 (11%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE D L K+++E F P+D  LFG   ++D  + Q L  S ES S+D +   +SS EDD +
Sbjct  797  LEKDVLAKQLTETFIPEDVPLFGSNPVLDQVNAQALAVSEESLSFDEECSRSSSIEDDIV  856

Query  741  SESSVTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             E     + +F P  P SP+   ++++GQLLESAL VAGQVAGT VSTSPLPYG MA QC
Sbjct  857  GELPAMVIHKFTPKMPTSPTLPNVISVGQLLESALHVAGQVAGTSVSTSPLPYGTMAGQC  916

Query  564  ETLGTDTRKKLSNWL--AHENHYTKAAADVLLPAIPGN-------GLLTAKKTIDEDSTL  412
            E LG  TRKKLS+WL   H+             +IP N       G  +A +  +  S  
Sbjct  917  EALGMGTRKKLSSWLVGGHD-------------SIPDNPVQIFPIGERSAFRMANAYSFE  963

Query  411  QQGVMVPREPWLAIWLPPASPFDNFLRAA  325
            QQ  +VP EP  A+ LPPASPFDNFL+AA
Sbjct  964  QQA-LVPVEPRPALRLPPASPFDNFLKAA  991



>dbj|BAD94525.1| hypothetical protein [Arabidopsis thaliana]
Length=266

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 127/205 (62%), Gaps = 22/205 (11%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE  D+  ++ E FTPDD F+FG +  ++    Q +  S+ES S+D D    S  ED+  
Sbjct  74   LEEADVKMQILEQFTPDDAFMFGSRPNIEPQPNQSI--SKESLSFDEDIPAGSMVEDEVT  131

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPSPS  ++++IGQL+ESALEVAGQV G+ VSTSPLPY  M ++C
Sbjct  132  SELSV----RFPPRGSPSPSIPQVISIGQLMESALEVAGQVVGSSVSTSPLPYDTMTNRC  187

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGL--LTAKKTIDEDSTL---QQGV  400
            ET GT TR+KLS WLA EN          +  + GN L   +A + + ED  +   + G+
Sbjct  188  ETFGTGTREKLSRWLATENRQ--------MNGLYGNSLEESSALEKVVEDGNIYGRESGM  239

Query  399  MVPREPWLAIWLPPASPFDNFLRAA  325
            +  ++ W  + LPPASPFDNFL+AA
Sbjct  240  L--QDSWSMMRLPPASPFDNFLKAA  262



>ref|XP_010674649.1| PREDICTED: protein EFR3 homolog A [Beta vulgaris subsp. vulgaris]
Length=998

 Score =   157 bits (397),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 91/205 (44%), Positives = 119/205 (58%), Gaps = 20/205 (10%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            ++ ++L+ ++S+ FTPD+ F+F  + + ++DH  ++ H +ESPS DG+   +S  EDD  
Sbjct  783  IKEEELLSQLSDIFTPDEAFIFAPKELRELDHTHIIRHLKESPSLDGELSLSSVVEDDVT  842

Query  741  SESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCE  562
            S  S  ++T       SPS S I++IGQLLESALEVAGQV GT VSTSPL Y  MA QCE
Sbjct  843  SSLSNLNITGQKVVPHSPSDSHIMSIGQLLESALEVAGQVVGTSVSTSPLSYSTMAGQCE  902

Query  561  TLGTDTRKKLSNWLAHENH-------YTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQG  403
             L   TRKKLSNWLA EN        +   AA V  P  P  G +              G
Sbjct  903  ALEAGTRKKLSNWLAQENSSSGEAFAFPSDAATVTYPVSPRAGEV-------------HG  949

Query  402  VMVPREPWLAIWLPPASPFDNFLRA  328
             M   + +  + LPPASPFDNFL A
Sbjct  950  EMGSSDQFNTLRLPPASPFDNFLHA  974



>ref|XP_006840435.1| PREDICTED: uncharacterized protein LOC18430213 [Amborella trichopoda]
 gb|ERN02110.1| hypothetical protein AMTR_s00045p00164850 [Amborella trichopoda]
Length=1003

 Score =   156 bits (394),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 96/213 (45%), Positives = 125/213 (59%), Gaps = 25/213 (12%)
 Frame = -1

Query  921   LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
             ++ + + +E+S  FTP D+FLFG  S+ D  H  +  HS+ES S D D L  S  EDD I
Sbjct  800   MDHESIAQELSNVFTPTDSFLFGPGSVFDSSHNDMSKHSKESLSSDEDILVYSQIEDDLI  859

Query  741   SESSVTDMTRFMPTSPS-PSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             SE+S  ++ R +P  P  PS   I+++GQLLESALE AG VA + VSTSPLPY AMASQC
Sbjct  860   SETSAAELPRLIPKVPVIPSIPHIISVGQLLESALEAAGHVASSSVSTSPLPYSAMASQC  919

Query  564   ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQ--------  409
             E L    R+K+S WL+ E        D+    +P N  L  K+    ++ LQ        
Sbjct  920   EALA---RRKISTWLSPET-----KTDLFPLMLPTNWPLDNKEV--SEAELQKASSGLCS  969

Query  408   -----QGVMVPREPWLAIWLPPASPFDNFLRAA  325
                  +G + P EPW  + LPPASPFDNFLRAA
Sbjct  970   GHCQVEGRLAP-EPWQGLRLPPASPFDNFLRAA  1001



>ref|XP_006287016.1| hypothetical protein CARUB_v10000164mg [Capsella rubella]
 gb|EOA19914.1| hypothetical protein CARUB_v10000164mg [Capsella rubella]
Length=925

 Score =   150 bits (380),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 91/200 (46%), Positives = 123/200 (62%), Gaps = 12/200 (6%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE  D+  ++ E FTPDD F+FG +  V+    Q +  S+ES S+D D    S  ED+  
Sbjct  733  LEEADVKMQLLEPFTPDDAFMFGSRPNVESQPNQSI--SKESLSFDEDIPAGSMVEDEVT  790

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPSPS+ ++++IGQL+ESALEVAG+V G+ +STSPLPY  M ++C
Sbjct  791  SELSV----RFPPRGSPSPSNPQVISIGQLMESALEVAGEVVGSSISTSPLPYDTMTNRC  846

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            ET GT TR+KLS WLA EN         L    P       +K +++D+   +   V ++
Sbjct  847  ETFGTGTRQKLSRWLATENRQMNG----LYRNSPEES-FALEKVVEDDNIYGRESGVLQD  901

Query  384  PWLAIWLPPASPFDNFLRAA  325
             W  + LPPASPFDNFL+AA
Sbjct  902  SWSMMRLPPASPFDNFLKAA  921



>dbj|BAC41892.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ89612.1| At5g26850 [Arabidopsis thaliana]
Length=970

 Score =   149 bits (377),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 127/205 (62%), Gaps = 22/205 (11%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE  D+  ++ E FTPDD F+FG +  ++    Q +  S+ES S+D D    S  ED+  
Sbjct  778  LEEADVKMQILEQFTPDDAFMFGSRPNIEPQPNQSI--SKESLSFDEDIPAGSMVEDEVT  835

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPSPS  ++++IGQL+ESALEVAGQV G+ VSTSPLPY  M ++C
Sbjct  836  SELSV----RFPPRGSPSPSIPQVISIGQLMESALEVAGQVVGSSVSTSPLPYDTMTNRC  891

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGL--LTAKKTIDEDSTL---QQGV  400
            ET GT TR+KLS WLA EN          +  + GN L   +A + + ED  +   + G+
Sbjct  892  ETFGTGTREKLSRWLATENRQ--------MNGLYGNSLEESSALEKVVEDGNIYGRESGM  943

Query  399  MVPREPWLAIWLPPASPFDNFLRAA  325
            +  ++ W  + LPPASPFDNFL+AA
Sbjct  944  L--QDSWSMMRLPPASPFDNFLKAA  966



>dbj|BAH57285.1| AT5G26850 [Arabidopsis thaliana]
Length=896

 Score =   149 bits (376),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 127/205 (62%), Gaps = 22/205 (11%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE  D+  ++ E FTPDD F+FG +  ++    Q +  S+ES S+D D    S  ED+  
Sbjct  704  LEEADVKMQILEQFTPDDAFMFGSRPNIEPQPNQSI--SKESLSFDEDIPAGSMVEDEVT  761

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPSPS  ++++IGQL+ESALEVAGQV G+ VSTSPLPY  M ++C
Sbjct  762  SELSV----RFPPRGSPSPSIPQVISIGQLMESALEVAGQVVGSSVSTSPLPYDTMTNRC  817

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGL--LTAKKTIDEDSTL---QQGV  400
            ET GT TR+KLS WLA EN          +  + GN L   +A + + ED  +   + G+
Sbjct  818  ETFGTGTREKLSRWLATENRQ--------MNGLYGNSLEESSALEKVVEDGNIYGRESGM  869

Query  399  MVPREPWLAIWLPPASPFDNFLRAA  325
            +  ++ W  + LPPASPFDNFL+AA
Sbjct  870  L--QDSWSMMRLPPASPFDNFLKAA  892



>ref|NP_198037.3| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031947.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001031948.2| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001190405.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED93613.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93614.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93615.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
 gb|AED93616.1| uncharacterized protein AT5G26850 [Arabidopsis thaliana]
Length=983

 Score =   149 bits (377),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 94/205 (46%), Positives = 127/205 (62%), Gaps = 22/205 (11%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE  D+  ++ E FTPDD F+FG +  ++    Q +  S+ES S+D D    S  ED+  
Sbjct  791  LEEADVKMQILEQFTPDDAFMFGSRPNIEPQPNQSI--SKESLSFDEDIPAGSMVEDEVT  848

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPSPS  ++++IGQL+ESALEVAGQV G+ VSTSPLPY  M ++C
Sbjct  849  SELSV----RFPPRGSPSPSIPQVISIGQLMESALEVAGQVVGSSVSTSPLPYDTMTNRC  904

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGL--LTAKKTIDEDSTL---QQGV  400
            ET GT TR+KLS WLA EN          +  + GN L   +A + + ED  +   + G+
Sbjct  905  ETFGTGTREKLSRWLATENRQ--------MNGLYGNSLEESSALEKVVEDGNIYGRESGM  956

Query  399  MVPREPWLAIWLPPASPFDNFLRAA  325
            +  ++ W  + LPPASPFDNFL+AA
Sbjct  957  L--QDSWSMMRLPPASPFDNFLKAA  979



>gb|EAY89716.1| hypothetical protein OsI_11254 [Oryza sativa Indica Group]
Length=907

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 119/202 (59%), Gaps = 7/202 (3%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            ++ D LVKE++E FTP++  LFG  S  D  +  V   S ES S+D +  + +S+ D  +
Sbjct  710  MDKDVLVKELTEMFTPEEVPLFGSNSAFDWANFHVQAFSDESLSFDEE-CSRTSSVDGGL  768

Query  741  SESSVTDMTRFMPTSPSPSSS-RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             ES +T+    +  +  P S  R++ +GQLLESAL VAGQVAG  VSTSPLPYG M SQC
Sbjct  769  HESPITNTGSSISKTTMPQSVPRVLGVGQLLESALHVAGQVAGASVSTSPLPYGTMTSQC  828

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LG+ TRKKLS+WL + +  T    D   P++P        K        +  +    E
Sbjct  829  EALGSGTRKKLSSWLVNGHDST---PDNPAPSLPSAQHFIIPKV--NSCGFESSIRTTLE  883

Query  384  PWLAIWLPPASPFDNFLRAARR  319
            P  A+ LPPASPFDNFL+AA R
Sbjct  884  PCSAVKLPPASPFDNFLKAAYR  905



>gb|EAZ26671.1| hypothetical protein OsJ_10574 [Oryza sativa Japonica Group]
Length=963

 Score =   146 bits (369),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 119/202 (59%), Gaps = 7/202 (3%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            ++ D LVKE++E FTP++  LFG  S  D  +  V   S ES S+D +  + +S+ D  +
Sbjct  766  MDKDVLVKELTEMFTPEEVPLFGSNSAFDWANFHVQAFSDESLSFDEE-CSRTSSVDGGL  824

Query  741  SESSVTDMTRFMPTSPSPSSS-RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             ES +T+    +  +  P S  R++ +GQLLESAL VAGQVAG  VSTSPLPYG M SQC
Sbjct  825  HESPITNTGSSISKTTMPQSVPRVLGVGQLLESALHVAGQVAGASVSTSPLPYGTMTSQC  884

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LG+ TRKKLS+WL + +  T    D   P++P        K        +  +    E
Sbjct  885  EALGSGTRKKLSSWLVNGHDST---PDNPAPSLPSAQHFIIPKV--NSCGFESSIRTTLE  939

Query  384  PWLAIWLPPASPFDNFLRAARR  319
            P  A+ LPPASPFDNFL+AA R
Sbjct  940  PCSAVKLPPASPFDNFLKAAYR  961



>ref|XP_008808671.1| PREDICTED: uncharacterized protein LOC103720646 isoform X1 [Phoenix 
dactylifera]
Length=994

 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 90/201 (45%), Positives = 116/201 (58%), Gaps = 6/201 (3%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE D L K+++E F P+D   FG    +D  + + L  S ES S+D +   + S  DD +
Sbjct  798  LEKDVLAKQLTETFIPEDVPFFGSNPALDRVNARALAVSEESLSFDEECSGSLSIVDDVV  857

Query  741  SESSVTDMTRFMPTS-PSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE       +F+P    SP+   IV++GQLLESAL VAGQVAGT VSTSPLPYG MASQC
Sbjct  858  SELPAMVFHKFIPKEFTSPALPNIVSVGQLLESALHVAGQVAGTSVSTSPLPYGTMASQC  917

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LG  TRKKLS+WL  ++    + +D  +P  P    L   K        +Q  +   E
Sbjct  918  EALGMGTRKKLSSWLVADH---DSISDNPMPIFPMGEQLAIPKA--NAYGFEQQALAAME  972

Query  384  PWLAIWLPPASPFDNFLRAAR  322
            P   + LPPAS FD FL+AAR
Sbjct  973  PLPVLRLPPASAFDKFLKAAR  993



>ref|NP_001049903.1| Os03g0308200 [Oryza sativa Japonica Group]
 gb|ABF95547.1| cyclin, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF11817.1| Os03g0308200 [Oryza sativa Japonica Group]
 dbj|BAG93123.1| unnamed protein product [Oryza sativa Japonica Group]
Length=988

 Score =   146 bits (369),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/202 (44%), Positives = 119/202 (59%), Gaps = 7/202 (3%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            ++ D LVKE++E FTP++  LFG  S  D  +  V   S ES S+D +  + +S+ D  +
Sbjct  791  MDKDVLVKELTEMFTPEEVPLFGSNSAFDWANFHVQAFSDESLSFDEE-CSRTSSVDGGL  849

Query  741  SESSVTDMTRFMPTSPSPSSS-RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             ES +T+    +  +  P S  R++ +GQLLESAL VAGQVAG  VSTSPLPYG M SQC
Sbjct  850  HESPITNTGSSISKTTMPQSVPRVLGVGQLLESALHVAGQVAGASVSTSPLPYGTMTSQC  909

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LG+ TRKKLS+WL + +  T    D   P++P        K        +  +    E
Sbjct  910  EALGSGTRKKLSSWLVNGHDST---PDNPAPSLPSAQHFIIPKV--NSCGFESSIRTTLE  964

Query  384  PWLAIWLPPASPFDNFLRAARR  319
            P  A+ LPPASPFDNFL+AA R
Sbjct  965  PCSAVKLPPASPFDNFLKAAYR  986



>ref|XP_008808672.1| PREDICTED: uncharacterized protein LOC103720646 isoform X2 [Phoenix 
dactylifera]
Length=986

 Score =   144 bits (363),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 88/201 (44%), Positives = 116/201 (58%), Gaps = 14/201 (7%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE D L K+++E F P+D   FG    +D  + + L  S ES S+D +   + S  DD +
Sbjct  798  LEKDVLAKQLTETFIPEDVPFFGSNPALDRVNARALAVSEESLSFDEECSGSLSIVDDVV  857

Query  741  SESSVTDMTRFMPTS-PSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE       +F+P    SP+   IV++GQLLESAL VAGQVAGT VSTSPLPYG MASQC
Sbjct  858  SELPAMVFHKFIPKEFTSPALPNIVSVGQLLESALHVAGQVAGTSVSTSPLPYGTMASQC  917

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LG  TRKKLS+WL  ++    + +D  +P  P          + E   + +  +   E
Sbjct  918  EALGMGTRKKLSSWLVADH---DSISDNPMPIFP----------MGEQLAIPKQALAAME  964

Query  384  PWLAIWLPPASPFDNFLRAAR  322
            P   + LPPAS FD FL+AAR
Sbjct  965  PLPVLRLPPASAFDKFLKAAR  985



>ref|XP_002872241.1| hypothetical protein ARALYDRAFT_489516 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48500.1| hypothetical protein ARALYDRAFT_489516 [Arabidopsis lyrata subsp. 
lyrata]
Length=983

 Score =   142 bits (358),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 122/210 (58%), Gaps = 32/210 (15%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE  D+  ++ E F PDD F+FG +  V+    Q +  S+ES S+D D    S  ED+  
Sbjct  791  LEEADVKMQILEPFIPDDAFMFGSRPNVEPQPNQSI--SKESLSFDDDIPAGSMVEDEVT  848

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPSP+  ++++IGQL+ESALEVAGQV G+ VSTSPL Y  M ++C
Sbjct  849  SELSV----RFPPRGSPSPTIPQVISIGQLMESALEVAGQVVGSSVSTSPLSYDTMTNRC  904

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQ----GVM  397
            ET GT TR+KLS WLA EN                NGL   + + +E S L++    G +
Sbjct  905  ETFGTGTRQKLSRWLATENRQM-------------NGLY--RNSSEESSALEKVVEDGNI  949

Query  396  VPRE------PWLAIWLPPASPFDNFLRAA  325
              RE       W  + LPPASPFDNFL+AA
Sbjct  950  YGRESGLLQDSWSMMRLPPASPFDNFLKAA  979



>ref|XP_006649970.1| PREDICTED: uncharacterized protein LOC102701065 [Oryza brachyantha]
Length=984

 Score =   140 bits (354),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 86/202 (43%), Positives = 117/202 (58%), Gaps = 7/202 (3%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            ++ D LVKE++E FTP++  LFG  S +D  +  V   S ES S+D +  + +S+ D  +
Sbjct  787  MDMDVLVKELTEMFTPEEVPLFGSNSALDWANFHVQAFSDESLSFDEE-CSRTSSVDGGL  845

Query  741  SESSVTDM-TRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             ES +T+  +     +   S   ++ +GQLLESAL VAGQVAG  VSTSPLPYG M SQC
Sbjct  846  HESPITNTGSSISKVTLQQSVPHVLGVGQLLESALHVAGQVAGASVSTSPLPYGTMTSQC  905

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            E LG+ TRKKLS+WL + +  T    D   P++P        K        +  +    E
Sbjct  906  EALGSGTRKKLSSWLVNGHDST---PDNPAPSLPSAQHFIIPKV--NSCGFESSIRTTSE  960

Query  384  PWLAIWLPPASPFDNFLRAARR  319
            P   + LPPASPFDNFL+AA R
Sbjct  961  PCSTVKLPPASPFDNFLKAAYR  982



>gb|EMS54754.1| Protein EFR3-like protein A [Triticum urartu]
Length=893

 Score =   139 bits (351),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 88/210 (42%), Positives = 121/210 (58%), Gaps = 24/210 (11%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            ++ D L KE++E FTP++  LFG  S++D  +      S ES S+D +  + +S+ D  +
Sbjct  694  MDKDALAKELTEMFTPEEVPLFGSNSVLDWANFHAQAFSDESLSFDEE-CSRTSSVDGGL  752

Query  741  SESSVTDMTRFMPTSPSPSSS-RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             +S +T+          P S+ R++ +GQLLESAL VAGQVAG+ VSTSPLPYG M SQC
Sbjct  753  HDSPITNTASSTSKITLPYSAPRVLGVGQLLESALHVAGQVAGSSVSTSPLPYGTMTSQC  812

Query  564  ETLGTDTRKKLSNWLAHENHYT--------KAAADVLLPAIPGNGLLTAKKTIDEDSTLQ  409
            E LG+ TRKKLS+WL + +  T         AA   +LP +   G        + + TL 
Sbjct  813  EALGSGTRKKLSSWLVNGHSSTPDNPVPSLPAADHFILPKVNSCGF-------EINRTLS  865

Query  408  QGVMVPREPWLAIWLPPASPFDNFLRAARR  319
                   EP   + LPPASPFDNFL+AA R
Sbjct  866  -------EPCSMVKLPPASPFDNFLKAAYR  888



>ref|XP_010421541.1| PREDICTED: uncharacterized protein LOC104706999 isoform X1 [Camelina 
sativa]
Length=791

 Score =   139 bits (349),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 122/200 (61%), Gaps = 12/200 (6%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE  D+  ++SE FTPDD F+FG +  V+    Q +  S+ES S+D D    S AED+  
Sbjct  599  LEEADVKMQLSEPFTPDDAFMFGSRPNVEPQPNQSI--SKESLSFDEDIPAGSMAEDEVT  656

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPSPS  ++++IGQL+ESALEVAGQV  + VSTSPLPY  M ++C
Sbjct  657  SELSV----RFPPRGSPSPSIPQVISIGQLMESALEVAGQVVVSSVSTSPLPYDTMTNRC  712

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            ET GT TR+KLS WLA EN         L    P       +K +++ +   +   V ++
Sbjct  713  ETFGTGTRQKLSRWLATENRQMNG----LYRNSPEES-YALEKVVEDGNIYGRESGVLQD  767

Query  384  PWLAIWLPPASPFDNFLRAA  325
             W  + LPPASPFDNFL+AA
Sbjct  768  SWSMMRLPPASPFDNFLKAA  787



>ref|XP_010455044.1| PREDICTED: uncharacterized protein LOC104736707 [Camelina sativa]
 ref|XP_010455045.1| PREDICTED: uncharacterized protein LOC104736707 [Camelina sativa]
Length=984

 Score =   139 bits (350),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 122/200 (61%), Gaps = 12/200 (6%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE  D+  ++SE FTPDD F+FG +  V+    Q +  S+ES S+D D    S AED+  
Sbjct  792  LEEADVKMQLSEPFTPDDAFMFGSRPNVEPQPNQSI--SKESLSFDEDIPAGSMAEDEVT  849

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPSPS  ++++IGQL+ESALEVAGQV  + VSTSPLPY  M ++C
Sbjct  850  SELSV----RFPPRGSPSPSIPQVISIGQLMESALEVAGQVVVSSVSTSPLPYDTMTNRC  905

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            ET GT TR+KLS WLA EN         L    P       +K +++ +   +   V ++
Sbjct  906  ETFGTGTRQKLSRWLATENRQMNG----LYRNSPEES-YALEKVVEDGNIYGRESGVLQD  960

Query  384  PWLAIWLPPASPFDNFLRAA  325
             W  + LPPASPFDNFL+AA
Sbjct  961  SWSTMRLPPASPFDNFLKAA  980



>ref|XP_003558072.1| PREDICTED: uncharacterized protein LOC100831072 isoform X2 [Brachypodium 
distachyon]
Length=994

 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 119/206 (58%), Gaps = 16/206 (8%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            ++ D L KE++E FTP++  LFG  S +D  +      S ES S+D +  + +S+ D   
Sbjct  795  MDKDVLTKELTEMFTPEEVPLFGSNSALDWANFNAQAFSDESLSFDEE-CSRTSSVDGGF  853

Query  741  SESSVTDMTRFMPTSPSPSSS-RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             ES  T+    +     P S+ R++ +GQLLESAL VAGQVAG  VSTSPLPYG M SQC
Sbjct  854  HESPATNTASSISKITLPQSAPRVLGVGQLLESALHVAGQVAGASVSTSPLPYGTMTSQC  913

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIP-GNGLLTAKKTIDEDSTLQQGVMVPR  388
            E LG+ TRKKLS+WL + +  T    D  +P +P     +T K           G+ + R
Sbjct  914  EALGSGTRKKLSSWLVNGHEST---PDNPVPNLPAAQNFITPKAN-------SCGLEINR  963

Query  387  ---EPWLAIWLPPASPFDNFLRAARR  319
               EP   + LPPASPFDNFL+AA R
Sbjct  964  TSLEPCSTVKLPPASPFDNFLKAAYR  989



>ref|XP_010228707.1| PREDICTED: uncharacterized protein LOC100831072 isoform X1 [Brachypodium 
distachyon]
Length=995

 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 119/206 (58%), Gaps = 16/206 (8%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            ++ D L KE++E FTP++  LFG  S +D  +      S ES S+D +  + +S+ D   
Sbjct  796  MDKDVLTKELTEMFTPEEVPLFGSNSALDWANFNAQAFSDESLSFDEE-CSRTSSVDGGF  854

Query  741  SESSVTDMTRFMPTSPSPSSS-RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             ES  T+    +     P S+ R++ +GQLLESAL VAGQVAG  VSTSPLPYG M SQC
Sbjct  855  HESPATNTASSISKITLPQSAPRVLGVGQLLESALHVAGQVAGASVSTSPLPYGTMTSQC  914

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIP-GNGLLTAKKTIDEDSTLQQGVMVPR  388
            E LG+ TRKKLS+WL + +  T    D  +P +P     +T K           G+ + R
Sbjct  915  EALGSGTRKKLSSWLVNGHEST---PDNPVPNLPAAQNFITPKAN-------SCGLEINR  964

Query  387  ---EPWLAIWLPPASPFDNFLRAARR  319
               EP   + LPPASPFDNFL+AA R
Sbjct  965  TSLEPCSTVKLPPASPFDNFLKAAYR  990



>ref|XP_010421542.1| PREDICTED: uncharacterized protein LOC104706999 isoform X2 [Camelina 
sativa]
Length=984

 Score =   139 bits (350),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 93/200 (47%), Positives = 122/200 (61%), Gaps = 12/200 (6%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE  D+  ++SE FTPDD F+FG +  V+    Q +  S+ES S+D D    S AED+  
Sbjct  792  LEEADVKMQLSEPFTPDDAFMFGSRPNVEPQPNQSI--SKESLSFDEDIPAGSMAEDEVT  849

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPSPS  ++++IGQL+ESALEVAGQV  + VSTSPLPY  M ++C
Sbjct  850  SELSV----RFPPRGSPSPSIPQVISIGQLMESALEVAGQVVVSSVSTSPLPYDTMTNRC  905

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            ET GT TR+KLS WLA EN         L    P       +K +++ +   +   V ++
Sbjct  906  ETFGTGTRQKLSRWLATENRQMNG----LYRNSPEES-YALEKVVEDGNIYGRESGVLQD  960

Query  384  PWLAIWLPPASPFDNFLRAA  325
             W  + LPPASPFDNFL+AA
Sbjct  961  SWSMMRLPPASPFDNFLKAA  980



>ref|XP_009111721.1| PREDICTED: protein EFR3 homolog B-like [Brassica rapa]
Length=982

 Score =   139 bits (349),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 125/210 (60%), Gaps = 32/210 (15%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            L+  D+  ++SE FTPDD F+FG + +V+    Q +  S+ES S+D D    S  ED+  
Sbjct  790  LQEADVQMQLSEPFTPDDAFMFGSRPIVESGPNQSI--SKESLSFDEDVHAGSMVEDEVT  847

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPS S+ ++++IGQL+ESALEVAGQV  + VSTSPLPY  M ++C
Sbjct  848  SELSV----RFQPRGSPSSSTPQVISIGQLMESALEVAGQVVVSSVSTSPLPYDTMTNRC  903

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQ----GVM  397
            ET GT TR+KLS WLA EN                NGL   + + +E S L++    G +
Sbjct  904  ETFGTGTRQKLSRWLATENRQV-------------NGLY--RNSSEESSALEKVTEDGSI  948

Query  396  VPRE------PWLAIWLPPASPFDNFLRAA  325
              RE       W  + LPPASPFDNFL+AA
Sbjct  949  YGRECGVFQDTWSMMSLPPASPFDNFLKAA  978



>ref|XP_006394915.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
 gb|ESQ32201.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
Length=983

 Score =   138 bits (348),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 125/210 (60%), Gaps = 34/210 (16%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE  D+  ++SE FTPDD F+FG + +++ +       S+ES S+D D    S AED+  
Sbjct  793  LEEADVQIQLSEPFTPDDAFMFGSRPILEPNQ----SISKESLSFDEDIPAGSMAEDEVT  848

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPSPS  ++++I QL+ESALEVAG+V  + VSTSPLPY  M ++C
Sbjct  849  SELSV----RFRPRLSPSPSIPQVISISQLMESALEVAGEVVVSSVSTSPLPYDTMTNRC  904

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQ----GVM  397
            ET GT TR+KLS WLA EN                NGL   K +++E S L++    G +
Sbjct  905  ETFGTGTRQKLSRWLATENRQM-------------NGLY--KNSLEESSALEKVTEDGSI  949

Query  396  VPRE------PWLAIWLPPASPFDNFLRAA  325
              RE       W  + LPPASPFDNFL+AA
Sbjct  950  YGRESGVLHDSWSMMRLPPASPFDNFLKAA  979



>emb|CDY19753.1| BnaA09g04060D [Brassica napus]
Length=982

 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 95/210 (45%), Positives = 125/210 (60%), Gaps = 32/210 (15%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            L+  D+  ++SE FTPDD F+FG + +V+    Q +  S+ES S+D D    S  ED+  
Sbjct  790  LQEADVQMQLSEPFTPDDAFMFGSRPIVESGPNQSI--SKESLSFDEDVPAGSVVEDEVT  847

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPS S+ ++++IGQL+ESALEVAGQV  + VSTSPLPY  M ++C
Sbjct  848  SELSV----RFQPRGSPSSSTPQVISIGQLMESALEVAGQVVVSSVSTSPLPYDTMTNRC  903

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQ----GVM  397
            ET GT TR+KLS WLA EN                NGL   + + +E S L++    G +
Sbjct  904  ETFGTGTRQKLSRWLATENRQV-------------NGLY--RNSSEESSALEKVTEDGSI  948

Query  396  VPRE------PWLAIWLPPASPFDNFLRAA  325
              RE       W  + LPPASPFDNFL+AA
Sbjct  949  YGRECGVFQDTWSMMSLPPASPFDNFLKAA  978



>ref|XP_004984608.1| PREDICTED: uncharacterized protein LOC101782956 [Setaria italica]
Length=992

 Score =   138 bits (347),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 119/207 (57%), Gaps = 17/207 (8%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E D LVKE++E FTP++  LFG  S +D  +      S ES S+D +  + +S+ D  +
Sbjct  792  MEKDVLVKELTEMFTPEEMPLFGSNSALDWANFNGQAFSDESLSFDEE-CSRTSSVDCGL  850

Query  741  SESSVTDMTRFMPTSPSPSSS-RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             ES +T+    +     P S   ++ +GQLLESAL VAGQVAG  VSTSPLPYG M SQC
Sbjct  851  HESPITNTASSISKITLPQSVPHVLGVGQLLESALHVAGQVAGASVSTSPLPYGTMTSQC  910

Query  564  ETLGTDTRKKLSNWL--AHENHYTKAAADVLLPAIPGNGLLTAKKTID---EDSTLQQGV  400
            E LG  TRKKLS+WL   HE     +  D  +P++P     TA  +I         +   
Sbjct  911  EALGLGTRKKLSSWLVSGHE-----STPDNPMPSLP-----TAHHSIIPKVNSCGFESIH  960

Query  399  MVPREPWLAIWLPPASPFDNFLRAARR  319
             V  EP   + LPPASPFDNFL+AA R
Sbjct  961  RVSSEPCSMVKLPPASPFDNFLKAAYR  987



>gb|EMT28557.1| Protein EFR3-like protein [Aegilops tauschii]
Length=881

 Score =   137 bits (345),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/210 (41%), Positives = 121/210 (58%), Gaps = 24/210 (11%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            ++ D + KE++E FTP++  LFG  S +D  +      S ES S+D +  + +S+ D  +
Sbjct  682  MDKDAVAKELTEMFTPEEVPLFGSNSALDWANFHAQAFSDESLSFDEE-CSRTSSVDGGL  740

Query  741  SESSVTDMTRFMPTSPSPSSS-RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
             +S +T+          P S+ R++ +GQLLESAL VAGQVAG+ VSTSPLPYG M SQC
Sbjct  741  HDSPITNTASSTSKITLPHSAPRVLGVGQLLESALHVAGQVAGSSVSTSPLPYGTMTSQC  800

Query  564  ETLGTDTRKKLSNWLAHENHYT--------KAAADVLLPAIPGNGLLTAKKTIDEDSTLQ  409
            E LG+ TRKKLS+WL + ++ T         AA   +LP +   G       I+  S+  
Sbjct  801  EALGSGTRKKLSSWLVNGHNSTPDNPVPSLPAADHFILPKVNLCGF-----EINRTSS--  853

Query  408  QGVMVPREPWLAIWLPPASPFDNFLRAARR  319
                   EP   + LPPASPFDNFL+AA R
Sbjct  854  -------EPCSMVKLPPASPFDNFLKAAYR  876



>ref|XP_010493940.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Camelina sativa]
 ref|XP_010493941.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Camelina sativa]
Length=986

 Score =   137 bits (345),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 121/200 (61%), Gaps = 12/200 (6%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE  D+  ++ E FTPDD F+FG +  V+    Q +  S+ES S+D D    S AED+  
Sbjct  794  LEEADVKMQLLESFTPDDAFMFGSRPNVEPQPNQSV--SKESLSFDEDIPAGSMAEDEVT  851

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPSPS  ++++IGQL+ESALEVAGQV  + VSTSPLPY  M ++C
Sbjct  852  SELSV----RFPPRGSPSPSIPQVISIGQLMESALEVAGQVVVSSVSTSPLPYDTMTNRC  907

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            ET GT TR+KLS WLA EN         L    P       +K +++ +   +   V ++
Sbjct  908  ETFGTGTRQKLSRWLATENRQMNG----LYRNSPEES-YALEKVVEDGNIYGRESGVLQD  962

Query  384  PWLAIWLPPASPFDNFLRAA  325
             W  + LPPASPFDNFL+AA
Sbjct  963  SWSMMRLPPASPFDNFLKAA  982



>ref|XP_010493942.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Camelina sativa]
Length=984

 Score =   137 bits (345),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 121/200 (61%), Gaps = 12/200 (6%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE  D+  ++ E FTPDD F+FG +  V+    Q +  S+ES S+D D    S AED+  
Sbjct  792  LEEADVKMQLLESFTPDDAFMFGSRPNVEPQPNQSV--SKESLSFDEDIPAGSMAEDEVT  849

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPSPS  ++++IGQL+ESALEVAGQV  + VSTSPLPY  M ++C
Sbjct  850  SELSV----RFPPRGSPSPSIPQVISIGQLMESALEVAGQVVVSSVSTSPLPYDTMTNRC  905

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPRE  385
            ET GT TR+KLS WLA EN         L    P       +K +++ +   +   V ++
Sbjct  906  ETFGTGTRQKLSRWLATENRQMNG----LYRNSPEES-YALEKVVEDGNIYGRESGVLQD  960

Query  384  PWLAIWLPPASPFDNFLRAA  325
             W  + LPPASPFDNFL+AA
Sbjct  961  SWSMMRLPPASPFDNFLKAA  980



>ref|NP_001170324.1| hypothetical protein [Zea mays]
 gb|ACN36608.1| unknown [Zea mays]
Length=418

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 115/199 (58%), Gaps = 11/199 (6%)
 Frame = -1

Query  912  DDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISES  733
            D +VKE++E FTP++  LFG  S +D  +      S ES S+D +  + +S+ D  + ES
Sbjct  225  DVIVKELTELFTPEEMPLFGSNSALDWANFNAQAFSDESLSFDEE-CSRTSSVDCGLHES  283

Query  732  SVTDMTRFMPTSPSPSSS-RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETL  556
             +T+    +     P S   ++ +GQLLESAL VAGQVAG  VSTSPLPYG M SQCE L
Sbjct  284  PITNTASSISKITLPQSVPHVLGVGQLLESALHVAGQVAGASVSTSPLPYGTMTSQCEAL  343

Query  555  GTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPWL  376
            G  TRKKLS+WL + +  T    D  +P++P     TA  +I              E   
Sbjct  344  GLGTRKKLSSWLVNGHESTP---DNPMPSLP-----TAHHSIIPKVN-PATFRTSSESCS  394

Query  375  AIWLPPASPFDNFLRAARR  319
            A+ LPPASPFDNFL+AA R
Sbjct  395  AVKLPPASPFDNFLKAAYR  413



>gb|KHN23226.1| hypothetical protein glysoja_046386, partial [Glycine soja]
Length=440

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 72/149 (48%), Positives = 93/149 (62%), Gaps = 23/149 (15%)
 Frame = -1

Query  909  DLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISESS  730
            +L   + E F PD+ F+FG QSM+D +  Q++ HS+ES S+DG                 
Sbjct  303  ELAMLLLEKFKPDEEFVFGPQSMLDQN--QIIFHSQESLSFDG-----------------  343

Query  729  VTDMTRFMPTSP-SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLG  553
               +   +P  P SPS+  +++IGQL+ESALEV GQVAGT + TSPL Y  MASQCE+LG
Sbjct  344  ---LCVIIPKMPLSPSAPHVISIGQLMESALEVVGQVAGTAIFTSPLSYNTMASQCESLG  400

Query  552  TDTRKKLSNWLAHENHYTKAAADVLLPAI  466
            T  RKKLSNWLA ENHY++A  D    AI
Sbjct  401  TCARKKLSNWLAFENHYSQALDDKSFLAI  429



>ref|XP_006394914.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
 gb|ESQ32200.1| hypothetical protein EUTSA_v10003593mg [Eutrema salsugineum]
Length=976

 Score =   135 bits (340),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 92/202 (46%), Positives = 121/202 (60%), Gaps = 34/202 (17%)
 Frame = -1

Query  897  EMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISESSVTDM  718
            ++SE FTPDD F+FG + +++ +       S+ES S+D D    S AED+  SE SV   
Sbjct  794  QLSEPFTPDDAFMFGSRPILEPNQ----SISKESLSFDEDIPAGSMAEDEVTSELSV---  846

Query  717  TRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTR  541
             RF P  SPSPS  ++++I QL+ESALEVAG+V  + VSTSPLPY  M ++CET GT TR
Sbjct  847  -RFRPRLSPSPSIPQVISISQLMESALEVAGEVVVSSVSTSPLPYDTMTNRCETFGTGTR  905

Query  540  KKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQ----GVMVPRE----  385
            +KLS WLA EN                NGL   K +++E S L++    G +  RE    
Sbjct  906  QKLSRWLATENRQM-------------NGLY--KNSLEESSALEKVTEDGSIYGRESGVL  950

Query  384  --PWLAIWLPPASPFDNFLRAA  325
               W  + LPPASPFDNFL+AA
Sbjct  951  HDSWSMMRLPPASPFDNFLKAA  972



>ref|XP_002465372.1| hypothetical protein SORBIDRAFT_01g037420 [Sorghum bicolor]
 gb|EER92370.1| hypothetical protein SORBIDRAFT_01g037420 [Sorghum bicolor]
Length=981

 Score =   135 bits (339),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 118/209 (56%), Gaps = 31/209 (15%)
 Frame = -1

Query  912  DDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISES  733
            D L KE++E FTP++  LFG  S +D  +      S ES S+D +  + +S+ D  + ES
Sbjct  788  DVLAKELAEMFTPEEMPLFGSNSALDWANFNAQAFSDESLSFDEE-CSRTSSVDCGLHES  846

Query  732  SVTDMTRFMPTSPSPSSS-RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETL  556
             +T+    +     P S   ++ +GQLLESAL VAGQVAG  VSTSPLPYG M SQCE L
Sbjct  847  PITNTASSISKITLPQSVPHVLGVGQLLESALHVAGQVAGASVSTSPLPYGTMTSQCEAL  906

Query  555  GTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPR----  388
            G  TRKKLS+WL + +  T    D  +P++P     TA  +I           +P+    
Sbjct  907  GLGTRKKLSSWLVNGHEST---PDNPMPSLP-----TAHHSI-----------IPKVNPA  947

Query  387  ------EPWLAIWLPPASPFDNFLRAARR  319
                  EP  A+ LPPASPFDNFL+AA R
Sbjct  948  MFRTSSEPCSAVKLPPASPFDNFLKAAYR  976



>emb|CDX87029.1| BnaC09g03440D [Brassica napus]
Length=982

 Score =   133 bits (335),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 93/210 (44%), Positives = 123/210 (59%), Gaps = 32/210 (15%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            L+  D+  ++SE FTPDD F+FG + + +    Q +  S+ES S+D D    S  ED+  
Sbjct  790  LQEADVQMQLSEPFTPDDAFMFGSRLISEPGPNQSI--SKESLSFDEDIPAGSVVEDEVT  847

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE S     RF P  SPS S+ ++++IGQL+ESALEVAGQV  + VSTSPLPY  M ++C
Sbjct  848  SELSC----RFQPRGSPSSSTPQVISIGQLMESALEVAGQVVVSSVSTSPLPYDTMTNRC  903

Query  564  ETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQ----GVM  397
            ET GT TR+KLS WLA EN                NGL   + + +E S L++    G +
Sbjct  904  ETFGTGTRQKLSRWLATENRQV-------------NGLY--RNSSEESSALEKVTEDGSI  948

Query  396  VPRE------PWLAIWLPPASPFDNFLRAA  325
              RE       W  + LPPASPFDNFL+AA
Sbjct  949  YGRECGVFQDTWSMMSLPPASPFDNFLKAA  978



>ref|XP_008646153.1| PREDICTED: uncharacterized protein LOC100384293 isoform X2 [Zea 
mays]
 tpg|DAA45028.1| TPA: hypothetical protein ZEAMMB73_794622 [Zea mays]
Length=982

 Score =   132 bits (333),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 115/199 (58%), Gaps = 11/199 (6%)
 Frame = -1

Query  912  DDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISES  733
            D +VKE++E FTP++  LFG  S +D  +      S ES S+D +  + +S+ D  + ES
Sbjct  789  DVIVKELTELFTPEEMPLFGSNSALDWANFNAQAFSDESLSFDEE-CSRTSSVDCGLHES  847

Query  732  SVTDMTRFMPTSPSPSSS-RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETL  556
             +T+    +     P S   ++ +GQLLESAL VAGQVAG  VSTSPLPYG M SQCE L
Sbjct  848  PITNTASSISKITLPQSVPHVLGVGQLLESALHVAGQVAGASVSTSPLPYGTMTSQCEAL  907

Query  555  GTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPWL  376
            G  TRKKLS+WL + +  T    D  +P++P     TA  +I              E   
Sbjct  908  GLGTRKKLSSWLVNGHEST---PDNPMPSLP-----TAHHSIIPKVN-PATFRTSSESCS  958

Query  375  AIWLPPASPFDNFLRAARR  319
            A+ LPPASPFDNFL+AA R
Sbjct  959  AVKLPPASPFDNFLKAAYR  977



>ref|XP_008646145.1| PREDICTED: uncharacterized protein LOC100384293 isoform X1 [Zea 
mays]
Length=983

 Score =   132 bits (332),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 87/199 (44%), Positives = 115/199 (58%), Gaps = 11/199 (6%)
 Frame = -1

Query  912  DDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISES  733
            D +VKE++E FTP++  LFG  S +D  +      S ES S+D +  + +S+ D  + ES
Sbjct  790  DVIVKELTELFTPEEMPLFGSNSALDWANFNAQAFSDESLSFDEE-CSRTSSVDCGLHES  848

Query  732  SVTDMTRFMPTSPSPSSS-RIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETL  556
             +T+    +     P S   ++ +GQLLESAL VAGQVAG  VSTSPLPYG M SQCE L
Sbjct  849  PITNTASSISKITLPQSVPHVLGVGQLLESALHVAGQVAGASVSTSPLPYGTMTSQCEAL  908

Query  555  GTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPWL  376
            G  TRKKLS+WL + +  T    D  +P++P     TA  +I              E   
Sbjct  909  GLGTRKKLSSWLVNGHEST---PDNPMPSLP-----TAHHSIIPKVN-PATFRTSSESCS  959

Query  375  AIWLPPASPFDNFLRAARR  319
            A+ LPPASPFDNFL+AA R
Sbjct  960  AVKLPPASPFDNFLKAAYR  978



>gb|KHN23227.1| Protein EFR3 like cmp44E [Glycine soja]
Length=896

 Score =   132 bits (331),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 87/124 (70%), Gaps = 9/124 (7%)
 Frame = -1

Query  693  SPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTRKKLSNWLAH  514
            SPS+  +++IGQL+ESALEVAGQVAGT +STSPLPY  MASQCE+LGT  RKKLSNWLA 
Sbjct  779  SPSAPHVISIGQLMESALEVAGQVAGTAISTSPLPYNTMASQCESLGTCARKKLSNWLAF  838

Query  513  ENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQG-VMVPREPWLAIWLPPASPFDNF  337
            ENHY++A  D    AI        + +  E  T   G   +PR+P   + LPPASPFDNF
Sbjct  839  ENHYSQALDDKSFLAIAD-----IRNSAPEKVTNGGGHAQLPRDP---MKLPPASPFDNF  890

Query  336  LRAA  325
            L+AA
Sbjct  891  LKAA  894



>gb|AAB61061.1| Hypothetical protein F2P16.24 [Arabidopsis thaliana]
Length=907

 Score =   127 bits (320),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 73/140 (52%), Positives = 93/140 (66%), Gaps = 7/140 (5%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE  D+  ++ E FTPDD F+FG +  ++    Q +  S+ES S+D D    S  ED+  
Sbjct  752  LEEADVKMQILEQFTPDDAFMFGSRPNIEPQPNQSI--SKESLSFDEDIPAGSMVEDEVT  809

Query  741  SESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
            SE SV    RF P  SPSPS  ++++IGQL+ESALEVAGQV G+ VSTSPLPY  M ++C
Sbjct  810  SELSV----RFPPRGSPSPSIPQVISIGQLMESALEVAGQVVGSSVSTSPLPYDTMTNRC  865

Query  564  ETLGTDTRKKLSNWLAHENH  505
            ET GT TR+KLS WLA EN 
Sbjct  866  ETFGTGTREKLSRWLATENR  885



>emb|CDX88246.1| BnaA06g28370D [Brassica napus]
Length=963

 Score =   127 bits (319),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 90/205 (44%), Positives = 122/205 (60%), Gaps = 25/205 (12%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESP-SYDGDFLTNSSAEDDK  745
            L+  D+  ++SE FTPDD F+FG + M +++  Q +  S+ES  S+D D    S  E++ 
Sbjct  780  LDEADVKMQLSEPFTPDDAFMFGSRPMTELEPNQSI--SKESSLSFDEDVHEGSVVEEEV  837

Query  744  ISESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESALEVA-GQVAGTFVSTSPLPYGAMAS  571
             SE SV    RF P  S SPS  ++++I QL+ESALEVA GQV  + VSTSPLPY  M +
Sbjct  838  TSELSV----RFHPRGSSSPSIPQVISIDQLMESALEVAAGQVVVSSVSTSPLPYDTMTN  893

Query  570  QCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVM-V  394
            +CET GT TR+K+S WLA EN                NGL   + +++E   L++     
Sbjct  894  RCETFGTGTRQKISKWLATENRQV-------------NGLY--RNSLEESCALEKVTEDN  938

Query  393  PREPWLAIWLPPASPFDNFLRAARR  319
             RE W  + LPP SPFDNFL+AA R
Sbjct  939  RRESWSMMSLPPTSPFDNFLKAAGR  963



>emb|CDX80597.1| BnaC07g28470D [Brassica napus]
Length=951

 Score =   105 bits (262),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 114/206 (55%), Gaps = 31/206 (15%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESP-SYDGDFLTNSSAEDDK  745
            LE  D+  ++SE FTPDD F+FG + +V+++    +  S+ES  S+D D    S  ED+ 
Sbjct  765  LEETDVKMQLSEPFTPDDAFMFGSRPIVELEPNNSI--SKESSLSFDEDVNAGSMVEDEV  822

Query  744  ISESSVTDMTRFMPTSPSPSSS--RIVNIGQLLESALEVA-GQVAGTFVSTSPLPYGAMA  574
             S        RF P   S S S  ++++I QL+ESALEVA GQV  + VSTSPLPY  M 
Sbjct  823  TS-------VRFHPGGSSSSPSIPQVISIDQLMESALEVAAGQVVVSSVSTSPLPYDTMT  875

Query  573  SQCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGL---LTAKKTIDEDSTLQQG  403
            + CET GT TR+K+S WLA+E           L  +  N L      +K   ED+  + G
Sbjct  876  NHCETFGTGTRQKISKWLANEKRQ--------LNGLYRNSLEESCALEKVTTEDNRRESG  927

Query  402  VMVPREPWLAIWLPPASPFDNFLRAA  325
            V         + LPP SPFDNFL+AA
Sbjct  928  VQ-------QMSLPPTSPFDNFLKAA  946



>ref|XP_002968494.1| hypothetical protein SELMODRAFT_90004 [Selaginella moellendorffii]
 gb|EFJ30748.1| hypothetical protein SELMODRAFT_90004 [Selaginella moellendorffii]
Length=875

 Score = 85.5 bits (210),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 66/204 (32%), Positives = 102/204 (50%), Gaps = 20/204 (10%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE    + ++ + FTPDDT + G +  ++  +  +     ES S+D       SA++D +
Sbjct  685  LEVHFFLHQLLQKFTPDDTLVLGSKIHLEAFNGHM---GMESMSFDD---VVPSADEDAL  738

Query  741  SESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCE  562
            S  +   +   +   P P  + +  + QLLESALE AGQVA      SP+ Y A+ASQCE
Sbjct  739  SPMASIGLPPLLADVPVPPPAAM-GVNQLLESALEAAGQVASITTPNSPVSYHALASQCE  797

Query  561  TLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAK---KTIDEDSTLQQGVMVP  391
                 TRK +S  +  +++        L P+ P   +   K   K+++E        + P
Sbjct  798  AFVAGTRKNMSIVMRLDSN--------LKPSTPSADVSFRKAFDKSLNESPVFSPPWLTP  849

Query  390  R--EPWLAIWLPPASPFDNFLRAA  325
               E W  + LPPASP+DNFL+AA
Sbjct  850  SADETWPLVKLPPASPYDNFLKAA  873



>gb|AFW84298.1| hypothetical protein ZEAMMB73_469985 [Zea mays]
Length=985

 Score = 85.1 bits (209),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 107/210 (51%), Gaps = 19/210 (9%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E + + +++ + F+ DD+F  G    ++M H   +   ++   +D D + +   +DD I 
Sbjct  785  EVNGIEEQLLQEFSLDDSFPLGAPLFMEMPHSCSMYAEKDEECFDEDTVPSELDDDDIIF  844

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S +SS ++ + QL+ES  E A QVA   V  +P+PY  M SQCE 
Sbjct  845  EHSGSQSDR--KTSGSMASSDVLTVNQLIESVHETARQVANVPVPANPVPYDQMKSQCEA  902

Query  558  LGTDTRKKLSNWLA--HENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQ---QGVM-  397
            L  + ++K+S  L+  H    +  +A V       +GL T + ++  +  LQ   +G M 
Sbjct  903  LVMEKQQKMSVLLSLKHSRTDSHGSAGV-------DGLETNESSLLSEPELQSTRKGRMR  955

Query  396  ----VPREPWLAIWLPPASPFDNFLRAARR  319
                   E   +  LPPASP+D FL+AA R
Sbjct  956  RCDSASSESDCSFRLPPASPYDKFLKAAGR  985



>gb|ACN33230.1| unknown [Zea mays]
Length=796

 Score = 85.1 bits (209),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 66/210 (31%), Positives = 107/210 (51%), Gaps = 19/210 (9%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E + + +++ + F+ DD+F  G    ++M H   +   ++   +D D + +   +DD I 
Sbjct  596  EVNGIEEQLLQEFSLDDSFPLGAPLFMEMPHSCSMYAEKDEECFDEDTVPSELDDDDIIF  655

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S +SS ++ + QL+ES  E A QVA   V  +P+PY  M SQCE 
Sbjct  656  EHSGSQSDR--KTSGSMASSDVLTVNQLIESVHETARQVANVPVPANPVPYDQMKSQCEA  713

Query  558  LGTDTRKKLSNWLA--HENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQ---QGVM-  397
            L  + ++K+S  L+  H    +  +A V       +GL T + ++  +  LQ   +G M 
Sbjct  714  LVMEKQQKMSVLLSLKHSRTDSHGSAGV-------DGLETNESSLLSEPELQSTRKGRMR  766

Query  396  ----VPREPWLAIWLPPASPFDNFLRAARR  319
                   E   +  LPPASP+D FL+AA R
Sbjct  767  RCDSASSESDCSFRLPPASPYDKFLKAAGR  796



>ref|XP_002456786.1| hypothetical protein SORBIDRAFT_03g042720 [Sorghum bicolor]
 gb|EES01906.1| hypothetical protein SORBIDRAFT_03g042720 [Sorghum bicolor]
Length=930

 Score = 84.7 bits (208),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 62/200 (31%), Positives = 105/200 (53%), Gaps = 13/200 (7%)
 Frame = -1

Query  900  KEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFL-TNSSAEDDKISESSVT  724
            +++ + F+ DD+F  G    ++  H  ++   ++   +D D +  +   +DD I E S +
Sbjct  738  EQLLQEFSLDDSFPLGAPLFMETPHSCLVYAEKDEQCFDEDTVPYDLEDDDDIIFEHSGS  797

Query  723  DMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDT  544
               R   TS S +SS ++ + QL+ES  E A QVA   VS +P+PY  M SQCE L  + 
Sbjct  798  QSDR--KTSGSMASSDVLTVNQLMESVHETARQVANVPVSANPVPYDQMKSQCEALVMEK  855

Query  543  RKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVM-----VPREPW  379
            ++K+S  L+ ++  T +     +     +GL T + ++  +  L++G M        E  
Sbjct  856  QQKMSVLLSFKHSRTDSHGSAGV-----DGLETNESSLRSEPELRKGRMRRCDSASSESD  910

Query  378  LAIWLPPASPFDNFLRAARR  319
             +  LPPASP+D FL+AA R
Sbjct  911  CSFRLPPASPYDKFLKAAGR  930



>gb|AFW84299.1| hypothetical protein ZEAMMB73_469985 [Zea mays]
Length=986

 Score = 83.6 bits (205),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 65/204 (32%), Positives = 104/204 (51%), Gaps = 19/204 (9%)
 Frame = -1

Query  900  KEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISESSVTD  721
            +++ + F+ DD+F  G    ++M H   +   ++   +D D + +   +DD I E S + 
Sbjct  792  EQLLQEFSLDDSFPLGAPLFMEMPHSCSMYAEKDEECFDEDTVPSELDDDDIIFEHSGSQ  851

Query  720  MTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTR  541
              R   TS S +SS ++ + QL+ES  E A QVA   V  +P+PY  M SQCE L  + +
Sbjct  852  SDR--KTSGSMASSDVLTVNQLIESVHETARQVANVPVPANPVPYDQMKSQCEALVMEKQ  909

Query  540  KKLSNWLA--HENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQ---QGVM-----VP  391
            +K+S  L+  H    +  +A V       +GL T + ++  +  LQ   +G M       
Sbjct  910  QKMSVLLSLKHSRTDSHGSAGV-------DGLETNESSLLSEPELQSTRKGRMRRCDSAS  962

Query  390  REPWLAIWLPPASPFDNFLRAARR  319
             E   +  LPPASP+D FL+AA R
Sbjct  963  SESDCSFRLPPASPYDKFLKAAGR  986



>ref|XP_007225374.1| hypothetical protein PRUPE_ppa000810mg [Prunus persica]
 gb|EMJ26573.1| hypothetical protein PRUPE_ppa000810mg [Prunus persica]
Length=997

 Score = 82.8 bits (203),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 67/211 (32%), Positives = 104/211 (49%), Gaps = 16/211 (8%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + KE+ +GF+PDD F  G    ++       +   + P +D      S  +D+   
Sbjct  788  ELSSIKKELLQGFSPDDAFPLGAPLFMETPRPCSPLAQIDFPDFDEVMPPGSLTDDEAFP  847

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S ++  I+++ QLL+S LE A QVA   VST+P+PY  M SQCE 
Sbjct  848  EPSGSQSDR--KTSLSINTLDILSVNQLLDSVLETARQVASFPVSTTPIPYDQMKSQCEA  905

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVL-------LPAIPGNGLLTAK-----KTIDEDST  415
            L T  ++K++  L +  H   A A VL        P +P   +  ++     K  ++   
Sbjct  906  LVTGKQQKMA-VLHNFKHQVDAKAIVLSSEFDNTCPTLPTTAIELSEGDLKLKNKEQVRV  964

Query  414  LQQGVMVPRE-PWLAIWLPPASPFDNFLRAA  325
              Q ++  RE    +  LPP+SP+D FL+AA
Sbjct  965  QNQLILCSREIGQHSFKLPPSSPYDKFLKAA  995



>ref|XP_004970911.1| PREDICTED: uncharacterized protein LOC101769911 isoform X4 [Setaria 
italica]
Length=987

 Score = 81.6 bits (200),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 103/203 (51%), Gaps = 16/203 (8%)
 Frame = -1

Query  900  KEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFL-TNSSAEDDKISESSVT  724
            +++ + F+ DD+F  G    ++  H   +   ++   +D D + +     DD I E S +
Sbjct  792  EQLLQEFSLDDSFPLGAPLFMETPHSCSMYAEKDDHCFDEDGVPSELDDADDIIFEHSGS  851

Query  723  DMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDT  544
               R   TS S +SS ++ + QL+ES  E A QVA   VS +P+PY  M SQCE L  + 
Sbjct  852  QSDR--KTSGSMASSDVLTVNQLIESVHETARQVANVPVSANPVPYDQMKSQCEALVMEK  909

Query  543  RKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQ---QGVM-----VPR  388
            ++K+S  L+ ++  T +     +     NGL T + ++  +  LQ   +G M        
Sbjct  910  QQKMSVLLSFKHSRTDSHGSTGV-----NGLETNESSLRSEHELQSTRKGRMRRSDSASS  964

Query  387  EPWLAIWLPPASPFDNFLRAARR  319
            E   +  LPPASP+D FL+AA R
Sbjct  965  ESDCSFRLPPASPYDKFLKAAGR  987



>ref|XP_004970908.1| PREDICTED: uncharacterized protein LOC101769911 isoform X1 [Setaria 
italica]
 ref|XP_004970909.1| PREDICTED: uncharacterized protein LOC101769911 isoform X2 [Setaria 
italica]
 ref|XP_004970910.1| PREDICTED: uncharacterized protein LOC101769911 isoform X3 [Setaria 
italica]
Length=988

 Score = 81.6 bits (200),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 64/203 (32%), Positives = 103/203 (51%), Gaps = 16/203 (8%)
 Frame = -1

Query  900  KEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFL-TNSSAEDDKISESSVT  724
            +++ + F+ DD+F  G    ++  H   +   ++   +D D + +     DD I E S +
Sbjct  793  EQLLQEFSLDDSFPLGAPLFMETPHSCSMYAEKDDHCFDEDGVPSELDDADDIIFEHSGS  852

Query  723  DMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDT  544
               R   TS S +SS ++ + QL+ES  E A QVA   VS +P+PY  M SQCE L  + 
Sbjct  853  QSDR--KTSGSMASSDVLTVNQLIESVHETARQVANVPVSANPVPYDQMKSQCEALVMEK  910

Query  543  RKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQ---QGVM-----VPR  388
            ++K+S  L+ ++  T +     +     NGL T + ++  +  LQ   +G M        
Sbjct  911  QQKMSVLLSFKHSRTDSHGSTGV-----NGLETNESSLRSEHELQSTRKGRMRRSDSASS  965

Query  387  EPWLAIWLPPASPFDNFLRAARR  319
            E   +  LPPASP+D FL+AA R
Sbjct  966  ESDCSFRLPPASPYDKFLKAAGR  988



>ref|XP_002975992.1| hypothetical protein SELMODRAFT_443103 [Selaginella moellendorffii]
 gb|EFJ22897.1| hypothetical protein SELMODRAFT_443103 [Selaginella moellendorffii]
Length=950

 Score = 81.3 bits (199),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 60/194 (31%), Positives = 97/194 (50%), Gaps = 9/194 (5%)
 Frame = -1

Query  900  KEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISESSVTD  721
            +++ + FTPDDT + G +  ++  +  +     ES S+D       SA++D +S  +   
Sbjct  762  EQLLQKFTPDDTLVLGSKIHLEAFNGHM---GMESMSFDD---VVPSADEDALSPMASIG  815

Query  720  MTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTR  541
            +   +   P P  + +  + QLLESALE AGQVA      SP+ Y A+ASQCE     TR
Sbjct  816  LPPLLADVPVPPPAAM-GVNQLLESALEAAGQVASITTPNSPVSYHALASQCEAFVAGTR  874

Query  540  KKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPR--EPWLAIW  367
            K +S  +  +++   +             + +  K+++E        + P   E W  + 
Sbjct  875  KNMSIVMRLDSNLKPSTPSADAKGKWTQAIGSRSKSLNESPVFSPPWLTPSADETWPLVK  934

Query  366  LPPASPFDNFLRAA  325
            LPPASP+DNFL+AA
Sbjct  935  LPPASPYDNFLKAA  948



>ref|XP_008222533.1| PREDICTED: uncharacterized protein LOC103322398 [Prunus mume]
Length=997

 Score = 80.5 bits (197),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 66/211 (31%), Positives = 103/211 (49%), Gaps = 16/211 (8%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + KE+ +GF+PDD F  G    ++       +   + P +D      S  +++   
Sbjct  788  ELSSIKKELLQGFSPDDAFPLGAPLFMETPRPCSPLAQIDFPDFDEVMPPGSLTDEEAFP  847

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S ++  I+++ QLL+S LE A QVA   VST+P+PY  M SQCE 
Sbjct  848  EPSGSQSDR--KTSLSINTLDILSVNQLLDSVLETARQVASFPVSTTPIPYDQMKSQCEA  905

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVL-------LPAIPGNGLLTAK-----KTIDEDST  415
            L T  ++K++  L    H   A A VL        P +P   +  ++     K  ++   
Sbjct  906  LVTGKQQKMA-VLHSFKHQVDAKAIVLSSEFDNTCPTLPTTAMELSEGDLKLKNKEQVRV  964

Query  414  LQQGVMVPRE-PWLAIWLPPASPFDNFLRAA  325
              Q ++  RE    +  LPP+SP+D FL+AA
Sbjct  965  QNQLILCSREIGQHSFKLPPSSPYDKFLKAA  995



>emb|CDM85315.1| unnamed protein product [Triticum aestivum]
Length=960

 Score = 79.3 bits (194),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 63/206 (31%), Positives = 107/206 (52%), Gaps = 15/206 (7%)
 Frame = -1

Query  912  DDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS-E  736
            D + +++ + F+ DD+F  G    ++  H   +   ++   +D D +     +DD I  E
Sbjct  762  DGIEEQLLQEFSLDDSFPLGAPLFMETPHSCSMYAEKDDHCFDEDVIPCEMDDDDDIVFE  821

Query  735  SSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETL  556
             S +   R   TS S +SS ++N+ QL+ES  E A QVA   VST+P+ Y  M SQCE+L
Sbjct  822  HSGSQSDR--KTSGSMASSDVLNVNQLMESVHETARQVANIPVSTNPVSYDQMKSQCESL  879

Query  555  GTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTI--DEDSTLQQGVMVPREP  382
              + ++K+S  ++ ++  T + +     +I  NG  T + +   + +S L +   + R  
Sbjct  880  VMEKQQKMSVLMSFKHSRTDSRS-----SIGENGPETNESSAQSERESHLTRKDYMRRND  934

Query  381  WL-----AIWLPPASPFDNFLRAARR  319
                   +  LPPASP+D FL+AA R
Sbjct  935  STSSDDRSFRLPPASPYDKFLKAAGR  960



>ref|XP_010097526.1| hypothetical protein L484_024737 [Morus notabilis]
 gb|EXB68717.1| hypothetical protein L484_024737 [Morus notabilis]
Length=1447

 Score = 79.0 bits (193),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 62/212 (29%), Positives = 110/212 (52%), Gaps = 16/212 (8%)
 Frame = -1

Query  918   ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
             E   + K+ S+GF+PDD +L G    ++       +   + P  D    T +  +++   
Sbjct  1236  ELSSIKKQFSQGFSPDDAYLLGAPLFMETPRPCSPLAHMDFPDIDEMMPTAALIDEEAFP  1295

Query  738   ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
             E S +   R   TS S ++  I+++ QLLES LE A QVA   VS++P+PY  M +QCE 
Sbjct  1296  EPSGSQSDR--KTSISINTLDILSVNQLLESVLETARQVASFPVSSTPIPYDQMKNQCEA  1353

Query  558   LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGL--LTAK---------KTIDEDST-  415
             L T  ++K+S   + +    + A  ++L ++  +    L+AK         K I+++   
Sbjct  1354  LVTGKQQKMSVLHSFKQQQQQVANAIVLSSVNESKYLPLSAKTKEHTEGDLKLINKEQVR  1413

Query  414   LQQGVMVPREPW--LAIWLPPASPFDNFLRAA  325
             +++ ++V    +   +  LPP+SP+D FL+AA
Sbjct  1414  VKEQLLVCSRGYGQHSFRLPPSSPYDKFLKAA  1445



>ref|XP_006858684.1| PREDICTED: uncharacterized protein LOC18448561 [Amborella trichopoda]
 gb|ERN20151.1| hypothetical protein AMTR_s00066p00085830 [Amborella trichopoda]
Length=1020

 Score = 79.0 bits (193),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 63/216 (29%), Positives = 103/216 (48%), Gaps = 29/216 (13%)
 Frame = -1

Query  921   LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
             +E+  + +++ E F PDD +  G Q  ++         S++   +D    T+   +DD  
Sbjct  815   VESSSIRQQLLEEFAPDDAYPLGSQLFMETPWPYSPSASKDQKPFDEIMSTSFCTDDDAS  874

Query  741   SE---SSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMAS  571
              E   + + D T+        S S ++N+ QL+ES LE A QVA   VS +P+PY  M  
Sbjct  875   LEMFGNQINDSTQL-------SDSEVINVNQLIESVLETARQVASVPVSMTPVPYDQMKE  927

Query  570   QCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPG----NGLLTAKKTIDEDSTLQQ-  406
             QCE L    ++K+S  L +  H      D++L  +P      GL + +K I +  +L++ 
Sbjct  928   QCEALVMGKQQKMS-LLMNGKH----QEDLVLCDLPQYEERKGLSSPQKKIYDTRSLEET  982

Query  405   ---------GVMVPREPWLAIWLPPASPFDNFLRAA  325
                       +    E   +  LPP+SPFD FL+AA
Sbjct  983   DEIRMVVDCSLFCSSEYQQSFRLPPSSPFDKFLKAA  1018



>ref|XP_009363645.1| PREDICTED: uncharacterized protein LOC103953608 [Pyrus x bretschneideri]
 ref|XP_009363646.1| PREDICTED: uncharacterized protein LOC103953608 [Pyrus x bretschneideri]
Length=997

 Score = 77.4 bits (189),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 67/213 (31%), Positives = 104/213 (49%), Gaps = 18/213 (8%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E   + KE+ +GF+PDD+F  G    ++       +   + P +D      S  +D+  
Sbjct  787  VELSSIKKELLQGFSPDDSFPLGAPLFMETPRPCSPLAQIDFPEFDEVMPPGSLTDDEAY  846

Query  741  SESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCE  562
             E S +   R   +S S ++  I+++ QLL+S LE A +VA   VST+P+PY  M SQCE
Sbjct  847  PEPSGSQSDR--KSSLSINTLDILSVNQLLDSVLETAREVASNPVSTTPIPYDQMKSQCE  904

Query  561  TLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDS------------  418
             L T  ++K++   + +   TKA   VLL +   N   T   T  E S            
Sbjct  905  ALVTGKQQKMAVLHSFKQADTKAI--VLLSSESENTCHTLSTTATEFSEGDLKLKNKDHI  962

Query  417  -TLQQGVMVPRE-PWLAIWLPPASPFDNFLRAA  325
                Q ++  RE    +  LPP+SP+D FL+AA
Sbjct  963  RVQNQLLLCSREYGQHSFKLPPSSPYDKFLKAA  995



>gb|AAX94774.1| cyclin-related protein 1 [Cucumis sativus]
Length=489

 Score = 73.6 bits (179),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 102/210 (49%), Gaps = 14/210 (7%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + +++  GF PD+ +  G    ++       +     P YD      +  +D+   
Sbjct  280  ELSSIREQLLHGFLPDEAYPLGAPLFMETPRPCSPLAKLAFPDYDEGMPPAALTDDEAFL  339

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S S+  I+N+ QLLES LE A QVA   VS++P+PY  M SQCE 
Sbjct  340  EPSGSQSDR--KTSLSISNLDILNVNQLLESVLETARQVASFPVSSAPVPYDQMKSQCEA  397

Query  558  LGTDTRKKLSNWLAHENHYTKAA------ADVLLPAIPGNGLLTAKKTI----DEDSTLQ  409
            L +  ++K+S   + ++   + A       + L P +P N +   +  +    +E +  Q
Sbjct  398  LVSCKQQKMSVLHSFKHKKEEKAIVLSSEIETLYPPLPLNTMEIVQGDLKFYNNETNRGQ  457

Query  408  QGVMVPREPW--LAIWLPPASPFDNFLRAA  325
               ++    +   ++ LPP+SP+D FL+AA
Sbjct  458  DQPLLCSHEYGRHSLRLPPSSPYDKFLKAA  487



>ref|XP_006352099.1| PREDICTED: uncharacterized protein LOC102584417 isoform X2 [Solanum 
tuberosum]
Length=999

 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 105/208 (50%), Gaps = 12/208 (6%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ E F PDD +  G+   ++  H    +   E  ++D      S  +++ IS
Sbjct  792  ELPSIRKQLLERFEPDDAYPLGIPLYMETPHPCSPLAQIEFETFDEVMAPPSLIDEETIS  851

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            +++ +   R   TS S +S  I+++ QLLES LE A QVA    S++P+PY  + +QCE 
Sbjct  852  DANGSQSGR--KTSMSINSLDILSVNQLLESVLETARQVASYPTSSTPIPYDQVKNQCEA  909

Query  558  LGTDTRKKLSNWLAHE-NHYTKAAA-----DVLLPAIPGNGLLTAKK---TIDEDSTLQQ  406
            L T  + K+S+  + +    TKA       D   P++P   ++  +    T  E +  Q 
Sbjct  910  LVTGKQHKMSSLQSFKMQQETKALISYNENDRKNPSLPKMDMVLHQDLQLTTVESTHTQN  969

Query  405  GVMVPRE-PWLAIWLPPASPFDNFLRAA  325
             +   RE    +  LPP+SP+D FL+AA
Sbjct  970  SLSCSREYGQQSFRLPPSSPYDKFLKAA  997



>ref|XP_006352098.1| PREDICTED: uncharacterized protein LOC102584417 isoform X1 [Solanum 
tuberosum]
Length=1000

 Score = 73.9 bits (180),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 63/208 (30%), Positives = 105/208 (50%), Gaps = 12/208 (6%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ E F PDD +  G+   ++  H    +   E  ++D      S  +++ IS
Sbjct  793  ELPSIRKQLLERFEPDDAYPLGIPLYMETPHPCSPLAQIEFETFDEVMAPPSLIDEETIS  852

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            +++ +   R   TS S +S  I+++ QLLES LE A QVA    S++P+PY  + +QCE 
Sbjct  853  DANGSQSGR--KTSMSINSLDILSVNQLLESVLETARQVASYPTSSTPIPYDQVKNQCEA  910

Query  558  LGTDTRKKLSNWLAHE-NHYTKAAA-----DVLLPAIPGNGLLTAKK---TIDEDSTLQQ  406
            L T  + K+S+  + +    TKA       D   P++P   ++  +    T  E +  Q 
Sbjct  911  LVTGKQHKMSSLQSFKMQQETKALISYNENDRKNPSLPKMDMVLHQDLQLTTVESTHTQN  970

Query  405  GVMVPRE-PWLAIWLPPASPFDNFLRAA  325
             +   RE    +  LPP+SP+D FL+AA
Sbjct  971  SLSCSREYGQQSFRLPPSSPYDKFLKAA  998



>ref|NP_001045092.1| Os01g0898300 [Oryza sativa Japonica Group]
 dbj|BAD82352.1| cyclin-like [Oryza sativa Japonica Group]
 dbj|BAD82189.1| cyclin-like [Oryza sativa Japonica Group]
 dbj|BAF07006.1| Os01g0898300 [Oryza sativa Japonica Group]
Length=980

 Score = 73.6 bits (179),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 101/203 (50%), Gaps = 16/203 (8%)
 Frame = -1

Query  900  KEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS-ESSVT  724
            +++ + F+ DD+F       ++  H   +   ++   +D + +     +DD I  E S +
Sbjct  785  EQLLQEFSLDDSFPLSAPLFMETPHSCSMYAEKDDHCFDEEVIPCEMDDDDDIVFEHSGS  844

Query  723  DMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDT  544
               R   TS S +SS ++N+ QL+ES  E A QVA   VS + +PY  M SQCE L  + 
Sbjct  845  QSDR--KTSGSMASSDVLNVNQLIESVHETARQVANAPVSANLVPYDQMKSQCEALVMEK  902

Query  543  RKKLSNWLAHENHYTKAAADVLLPAIPGNGLLT----AKKTIDEDSTLQQGVM----VPR  388
            ++K+S  L+ ++  T +       +   NGL T    A+   +  ST ++ +        
Sbjct  903  QQKMSVLLSFKHSRTDSRG-----STAENGLETNESSARSEPETQSTRKERMRRSDSASS  957

Query  387  EPWLAIWLPPASPFDNFLRAARR  319
            E   +  LPPASP+D F+RAA R
Sbjct  958  ESDRSFRLPPASPYDKFMRAAGR  980



>gb|EEE55815.1| hypothetical protein OsJ_04415 [Oryza sativa Japonica Group]
Length=967

 Score = 73.6 bits (179),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 61/203 (30%), Positives = 101/203 (50%), Gaps = 16/203 (8%)
 Frame = -1

Query  900  KEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS-ESSVT  724
            +++ + F+ DD+F       ++  H   +   ++   +D + +     +DD I  E S +
Sbjct  772  EQLLQEFSLDDSFPLSAPLFMETPHSCSMYAEKDDHCFDEEVIPCEMDDDDDIVFEHSGS  831

Query  723  DMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDT  544
               R   TS S +SS ++N+ QL+ES  E A QVA   VS + +PY  M SQCE L  + 
Sbjct  832  QSDR--KTSGSMASSDVLNVNQLIESVHETARQVANAPVSANLVPYDQMKSQCEALVMEK  889

Query  543  RKKLSNWLAHENHYTKAAADVLLPAIPGNGLLT----AKKTIDEDSTLQQGVM----VPR  388
            ++K+S  L+ ++  T +       +   NGL T    A+   +  ST ++ +        
Sbjct  890  QQKMSVLLSFKHSRTDSRG-----STAENGLETNESSARSEPETQSTRKERMRRSDSASS  944

Query  387  EPWLAIWLPPASPFDNFLRAARR  319
            E   +  LPPASP+D F+RAA R
Sbjct  945  ESDRSFRLPPASPYDKFMRAAGR  967



>ref|XP_003564842.1| PREDICTED: uncharacterized protein LOC100842021 isoform X3 [Brachypodium 
distachyon]
Length=975

 Score = 73.2 bits (178),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 104/203 (51%), Gaps = 13/203 (6%)
 Frame = -1

Query  912  DDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS-E  736
            D + +++ + F+ DD+F  G    ++  H   +   ++   +D + +     +DD I  E
Sbjct  781  DGIEEQLLQEFSLDDSFPLGAPLFMETPHSCSMYAEKDGHFFDEEVIPCEMDDDDDIVFE  840

Query  735  SSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETL  556
             S +   R   TS S +SS ++N+ QL+ES  E A QVA   VST+P+ Y  M SQCE+L
Sbjct  841  HSGSQSDR--RTSGSMTSSDVLNVNQLMESVHETARQVANVPVSTNPVSYDQMKSQCESL  898

Query  555  GTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPWL  376
              + ++K+S  L+ ++  T + +        G    ++ ++  E  + ++  M   +   
Sbjct  899  VMEKQQKMSALLSFKHSRTDSRSST------GETNESSSRSEPELQSTRKDHMRRSDSTS  952

Query  375  A----IWLPPASPFDNFLRAARR  319
            +      LPPASP+D FL+AA R
Sbjct  953  SDDRSFRLPPASPYDKFLKAAGR  975



>ref|XP_008369216.1| PREDICTED: uncharacterized protein LOC103432787 [Malus domestica]
Length=896

 Score = 73.2 bits (178),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 63/213 (30%), Positives = 103/213 (48%), Gaps = 19/213 (9%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            +E   + KE+ +GF+PDD+F  G    ++       +   + P +D      S  +D+  
Sbjct  687  VELSSIKKELLQGFSPDDSFPLGAPLFMETPRPCSPLAQIDFPEFDEVMPPGSLTDDEAY  746

Query  741  SESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCE  562
             E S +   R   +S S ++  I+++ QLL+S LE A +VA   VST+P+PY  M SQCE
Sbjct  747  PEPSGSQSDR--KSSLSINTLDILSVNQLLDSVLETAREVASNPVSTTPIPYDQMKSQCE  804

Query  561  TLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTI-------------DED  421
             L T  ++K++   + +   T A   ++L +   N   T   T              D+ 
Sbjct  805  ALVTGKQQKMAVLHSFKQADTMA---IVLSSESENTCHTLSTTATEFSEGDLKLTNNDQI  861

Query  420  STLQQGVMVPRE-PWLAIWLPPASPFDNFLRAA  325
                Q ++  RE    +  LPP+SP+D FL+AA
Sbjct  862  RVQNQLLLCSREYGQHSFKLPPSSPYDKFLKAA  894



>ref|XP_010069300.1| PREDICTED: protein EFR3 homolog B isoform X1 [Eucalyptus grandis]
 ref|XP_010069301.1| PREDICTED: protein EFR3 homolog B isoform X1 [Eucalyptus grandis]
 gb|KCW57603.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
 gb|KCW57604.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
 gb|KCW57605.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
Length=995

 Score = 72.8 bits (177),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 67/217 (31%), Positives = 100/217 (46%), Gaps = 26/217 (12%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  DL ++  + F+PD+ +  G    ++       +    S ++D         +DD   
Sbjct  784  ELSDLKRQFLQAFSPDEAYPLGAPLFMETPRPCSPLAQLVSQAFDEAMPLVDMTDDDAFL  843

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S S+  I+N+ QLL S LE A QVA   VS+ P+PY  M +QCE 
Sbjct  844  EPSGSQSDR--KTSLSSSAVDIINVNQLLASVLETARQVASLPVSSVPIPYDQMKNQCEA  901

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVL-------LPAIP----------GNGLLTAKKTI  430
            L T  ++K+S   + +N   +A A V+        P  P          GNG L      
Sbjct  902  LVTGKQQKMSVLHSFKNQ-QEAKAIVVSGENENNAPHFPIPSLNMELLEGNGKLHES---  957

Query  429  DEDSTLQQGVMVPRE--PWLAIWLPPASPFDNFLRAA  325
            D+     Q  + P +  P  +  LPP+SP+D FL+AA
Sbjct  958  DQLRRQDQRQLCPCDYGPH-SFRLPPSSPYDKFLKAA  993



>gb|KCW57602.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
Length=1017

 Score = 72.8 bits (177),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 67/217 (31%), Positives = 100/217 (46%), Gaps = 26/217 (12%)
 Frame = -1

Query  918   ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
             E  DL ++  + F+PD+ +  G    ++       +    S ++D         +DD   
Sbjct  806   ELSDLKRQFLQAFSPDEAYPLGAPLFMETPRPCSPLAQLVSQAFDEAMPLVDMTDDDAFL  865

Query  738   ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
             E S +   R   TS S S+  I+N+ QLL S LE A QVA   VS+ P+PY  M +QCE 
Sbjct  866   EPSGSQSDR--KTSLSSSAVDIINVNQLLASVLETARQVASLPVSSVPIPYDQMKNQCEA  923

Query  558   LGTDTRKKLSNWLAHENHYTKAAADVL-------LPAIP----------GNGLLTAKKTI  430
             L T  ++K+S   + +N   +A A V+        P  P          GNG L      
Sbjct  924   LVTGKQQKMSVLHSFKNQ-QEAKAIVVSGENENNAPHFPIPSLNMELLEGNGKLHES---  979

Query  429   DEDSTLQQGVMVPRE--PWLAIWLPPASPFDNFLRAA  325
             D+     Q  + P +  P  +  LPP+SP+D FL+AA
Sbjct  980   DQLRRQDQRQLCPCDYGPH-SFRLPPSSPYDKFLKAA  1015



>gb|KCW57606.1| hypothetical protein EUGRSUZ_H00374 [Eucalyptus grandis]
Length=802

 Score = 72.4 bits (176),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 67/217 (31%), Positives = 100/217 (46%), Gaps = 26/217 (12%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  DL ++  + F+PD+ +  G    ++       +    S ++D         +DD   
Sbjct  591  ELSDLKRQFLQAFSPDEAYPLGAPLFMETPRPCSPLAQLVSQAFDEAMPLVDMTDDDAFL  650

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S S+  I+N+ QLL S LE A QVA   VS+ P+PY  M +QCE 
Sbjct  651  EPSGSQSDR--KTSLSSSAVDIINVNQLLASVLETARQVASLPVSSVPIPYDQMKNQCEA  708

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVL-------LPAIP----------GNGLLTAKKTI  430
            L T  ++K+S   + +N   +A A V+        P  P          GNG L      
Sbjct  709  LVTGKQQKMSVLHSFKNQ-QEAKAIVVSGENENNAPHFPIPSLNMELLEGNGKLHES---  764

Query  429  DEDSTLQQGVMVPRE--PWLAIWLPPASPFDNFLRAA  325
            D+     Q  + P +  P  +  LPP+SP+D FL+AA
Sbjct  765  DQLRRQDQRQLCPCDYGPH-SFRLPPSSPYDKFLKAA  800



>ref|XP_010232688.1| PREDICTED: uncharacterized protein LOC100842021 isoform X2 [Brachypodium 
distachyon]
Length=976

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 103/203 (51%), Gaps = 11/203 (5%)
 Frame = -1

Query  912  DDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS-E  736
            D + +++ + F+ DD+F  G    ++  H   +   ++   +D + +     +DD I  E
Sbjct  780  DGIEEQLLQEFSLDDSFPLGAPLFMETPHSCSMYAEKDGHFFDEEVIPCEMDDDDDIVFE  839

Query  735  SSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETL  556
             S +   R   TS S +SS ++N+ QL+ES  E A QVA   VST+P+ Y  M SQCE+L
Sbjct  840  HSGSQSDR--RTSGSMTSSDVLNVNQLMESVHETARQVANVPVSTNPVSYDQMKSQCESL  897

Query  555  GTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVM----VPR  388
              + ++K+S  L+ ++  T + +         N   ++ ++  E  + ++  M       
Sbjct  898  VMEKQQKMSALLSFKHSRTDSRSST----GETNEACSSSRSEPELQSTRKDHMRRSDSTS  953

Query  387  EPWLAIWLPPASPFDNFLRAARR  319
                +  LPPASP+D FL+AA R
Sbjct  954  SDDRSFRLPPASPYDKFLKAAGR  976



>ref|XP_010232687.1| PREDICTED: uncharacterized protein LOC100842021 isoform X1 [Brachypodium 
distachyon]
Length=977

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 59/203 (29%), Positives = 103/203 (51%), Gaps = 11/203 (5%)
 Frame = -1

Query  912  DDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS-E  736
            D + +++ + F+ DD+F  G    ++  H   +   ++   +D + +     +DD I  E
Sbjct  781  DGIEEQLLQEFSLDDSFPLGAPLFMETPHSCSMYAEKDGHFFDEEVIPCEMDDDDDIVFE  840

Query  735  SSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETL  556
             S +   R   TS S +SS ++N+ QL+ES  E A QVA   VST+P+ Y  M SQCE+L
Sbjct  841  HSGSQSDR--RTSGSMTSSDVLNVNQLMESVHETARQVANVPVSTNPVSYDQMKSQCESL  898

Query  555  GTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVM----VPR  388
              + ++K+S  L+ ++  T + +         N   ++ ++  E  + ++  M       
Sbjct  899  VMEKQQKMSALLSFKHSRTDSRSST----GETNEACSSSRSEPELQSTRKDHMRRSDSTS  954

Query  387  EPWLAIWLPPASPFDNFLRAARR  319
                +  LPPASP+D FL+AA R
Sbjct  955  SDDRSFRLPPASPYDKFLKAAGR  977



>ref|XP_010069302.1| PREDICTED: uncharacterized protein LOC104456246 isoform X2 [Eucalyptus 
grandis]
Length=887

 Score = 72.4 bits (176),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 66/216 (31%), Positives = 97/216 (45%), Gaps = 24/216 (11%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  DL ++  + F+PD+ +  G    ++       +    S ++D         +DD   
Sbjct  676  ELSDLKRQFLQAFSPDEAYPLGAPLFMETPRPCSPLAQLVSQAFDEAMPLVDMTDDDAFL  735

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S S+  I+N+ QLL S LE A QVA   VS+ P+PY  M +QCE 
Sbjct  736  EPSGSQSDR--KTSLSSSAVDIINVNQLLASVLETARQVASLPVSSVPIPYDQMKNQCEA  793

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVL------LPAIP----------GNGLLTAKKTID  427
            L T  ++K+S   + +N     A  V        P  P          GNG L      D
Sbjct  794  LVTGKQQKMSVLHSFKNQQEAKAIVVSGENENNAPHFPIPSLNMELLEGNGKLHES---D  850

Query  426  EDSTLQQGVMVPRE--PWLAIWLPPASPFDNFLRAA  325
            +     Q  + P +  P  +  LPP+SP+D FL+AA
Sbjct  851  QLRRQDQRQLCPCDYGPH-SFRLPPSSPYDKFLKAA  885



>ref|XP_004140882.1| PREDICTED: uncharacterized protein LOC101203725 isoform X2 [Cucumis 
sativus]
Length=955

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 102/210 (49%), Gaps = 14/210 (7%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + +++  GF PD+ +  G    ++       +     P YD      +  +D+   
Sbjct  746  ELSSIREQLLHGFLPDEAYPLGAPLFMETPRPCSPLAKLAFPDYDEGMPPAALTDDEAFL  805

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S S+  I+N+ QLLES LE A QVA   VS++P+PY  M SQCE 
Sbjct  806  EPSGSQSDR--KTSLSISNLDILNVNQLLESVLETARQVASFPVSSAPVPYDQMKSQCEA  863

Query  558  LGTDTRKKLSNWLAHENHYTKAA------ADVLLPAIPGNGLLTAKKTI----DEDSTLQ  409
            L +  ++K+S   + ++   + A       + L P +P N +   +  +    +E +  Q
Sbjct  864  LVSCKQQKMSVLHSFKHKKEEKAIVLSSEIETLYPPLPLNTMEIVQGDLKFYNNETNRGQ  923

Query  408  QGVMVPREPW--LAIWLPPASPFDNFLRAA  325
               ++    +   ++ LPP+SP+D FL+AA
Sbjct  924  DQPLLCSHEYGRHSLRLPPSSPYDKFLKAA  953



>gb|KEH30318.1| cyclin-like protein [Medicago truncatula]
Length=973

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 105/215 (49%), Gaps = 23/215 (11%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++++GF+PDD +  G Q  ++       V   E P +D + + +++  D++  
Sbjct  763  ELSSIKKQLAQGFSPDDAYPMGPQLFMETSRTCSPVAQIEYPDFD-EIVASAALMDEETG  821

Query  738  ---ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQ  568
                 +++D  + +    S ++  I+++ QLLES LE A QVA   +  +P+PY  M +Q
Sbjct  822  PEPSGNLSDCKQLL----SFNNLTILSVNQLLESVLETARQVASFPIPANPVPYDQMKNQ  877

Query  567  CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAI-------PGNGLLTAKKTIDEDSTLQ  409
            CE L +  ++K+S  L    H  +  A VL  AI       P   L  ++  +   S  Q
Sbjct  878  CEALVSGKQQKMS-VLHSFKHQQETRALVLSSAIETKVSPLPIKTLEYSEGDLKLVSQEQ  936

Query  408  QGVMVPREPW-------LAIWLPPASPFDNFLRAA  325
               +    P         ++ LPPASP+D FL+AA
Sbjct  937  LQTLYEVRPCSYDYRQHHSLRLPPASPYDKFLKAA  971



>ref|XP_011656551.1| PREDICTED: uncharacterized protein LOC101203725 isoform X1 [Cucumis 
sativus]
Length=992

 Score = 72.0 bits (175),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 60/210 (29%), Positives = 102/210 (49%), Gaps = 14/210 (7%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + +++  GF PD+ +  G    ++       +     P YD      +  +D+   
Sbjct  783  ELSSIREQLLHGFLPDEAYPLGAPLFMETPRPCSPLAKLAFPDYDEGMPPAALTDDEAFL  842

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S S+  I+N+ QLLES LE A QVA   VS++P+PY  M SQCE 
Sbjct  843  EPSGSQSDR--KTSLSISNLDILNVNQLLESVLETARQVASFPVSSAPVPYDQMKSQCEA  900

Query  558  LGTDTRKKLSNWLAHENHYTKAA------ADVLLPAIPGNGLLTAKKTI----DEDSTLQ  409
            L +  ++K+S   + ++   + A       + L P +P N +   +  +    +E +  Q
Sbjct  901  LVSCKQQKMSVLHSFKHKKEEKAIVLSSEIETLYPPLPLNTMEIVQGDLKFYNNETNRGQ  960

Query  408  QGVMVPREPW--LAIWLPPASPFDNFLRAA  325
               ++    +   ++ LPP+SP+D FL+AA
Sbjct  961  DQPLLCSHEYGRHSLRLPPSSPYDKFLKAA  990



>ref|XP_009625862.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625864.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625865.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009625866.1| PREDICTED: protein EFR3 homolog isoform X1 [Nicotiana tomentosiformis]
Length=993

 Score = 71.2 bits (173),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 63/205 (31%), Positives = 102/205 (50%), Gaps = 15/205 (7%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ E F PDD +  G+   ++  H    +   E  ++D      S  +++ IS
Sbjct  795  ELSSIRKQLLERFEPDDAYPLGIPLYMETPHPCSPLAQIEFETFDEVMAPPSLIDEEAIS  854

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            +++ +   R   TS S +S  I+++ QLLES LE A QVA   +S++P+PY  + +QCE 
Sbjct  855  DANGSQSGR--KTSLSINSLDILSVNQLLESVLESARQVANFPLSSTPIPYDQVKNQCEA  912

Query  558  LGTDTRKKLSNWLAHE-NHYTKA-----AADVLLPAIPGNGLLTAKKTIDEDSTLQQGVM  397
            L T  + K+S   + +    TKA     A D   P++P         T    +  Q  + 
Sbjct  913  LVTGKQHKMSALQSFKMQQETKALLSYNAMDRKSPSLP------KMDTELHQTHSQNSLS  966

Query  396  VPRE-PWLAIWLPPASPFDNFLRAA  325
              RE    +  LPP+SP+D FL+AA
Sbjct  967  CSREYGQQSFRLPPSSPYDKFLKAA  991



>ref|XP_006645172.1| PREDICTED: uncharacterized protein LOC102710074 [Oryza brachyantha]
Length=988

 Score = 70.5 bits (171),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 57/200 (29%), Positives = 99/200 (50%), Gaps = 10/200 (5%)
 Frame = -1

Query  900  KEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS-ESSVT  724
            +++ + F+ DD+F  G    ++  H       ++   +D + +     +DD I  E S +
Sbjct  793  EQLLQEFSLDDSFPLGAPLFMETPHSCSTYAEKDDHCFDEEVIPCEMDDDDDIVFEHSGS  852

Query  723  DMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDT  544
               R   TS S +SS ++N+ QL+ES  E A QVA   VS + +PY  M SQCE L  + 
Sbjct  853  QSDR--KTSGSMASSDVLNVNQLIESVHETARQVANAPVSANLVPYDQMKSQCEALVMEK  910

Query  543  RKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVM-----VPREPW  379
            ++K+S  L+ ++  T +           N   ++ ++  E  ++++  M        E  
Sbjct  911  QQKMSVLLSFKHSRTDSHGSTAENGQETNE--SSARSEPEMQSMRKNRMRRSDSASSESD  968

Query  378  LAIWLPPASPFDNFLRAARR  319
             +  LPPASP+D F++AA R
Sbjct  969  RSFRLPPASPYDKFMKAAGR  988



>ref|XP_008445731.1| PREDICTED: uncharacterized protein LOC103488670 isoform X1 [Cucumis 
melo]
Length=991

 Score = 70.5 bits (171),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 102/215 (47%), Gaps = 24/215 (11%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + +++  GF PD+ +  G    ++       +     P YD      +  +D+   
Sbjct  782  ELSSIREQLLHGFLPDEAYPLGAPLFMETPRPCSPLAKLAFPDYDEGMPPAALTDDEAFL  841

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S S+  I+++ QLLES LE A QVA   VS++P+PY  M SQCE 
Sbjct  842  EPSGSQSDR--KTSLSISNLDILSVNQLLESVLETARQVASFPVSSAPVPYDQMKSQCEA  899

Query  558  LGTDTRKKLSNWLAHENHYTKAA------ADVLLPAIPGNGLLTAK---KTIDEDSTLQQ  406
            L +  ++K+S   + ++   + A       + L P +P N +   +   K  ++++   Q
Sbjct  900  LVSCKQQKMSVLHSFKHKKEEKAIVLSSEIETLYPPLPLNTMEIVQGDLKFYNKETNRGQ  959

Query  405  GVMVPREPWLA--------IWLPPASPFDNFLRAA  325
                  +P L         + LPP+SP+D FL+AA
Sbjct  960  D-----QPLLCSHEYGRHSLRLPPSSPYDKFLKAA  989



>ref|XP_010241507.1| PREDICTED: uncharacterized protein LOC104586087 isoform X2 [Nelumbo 
nucifera]
Length=997

 Score = 70.5 bits (171),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 67/217 (31%), Positives = 96/217 (44%), Gaps = 31/217 (14%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ EGF+PDD    G+   ++            SP    DF     A D+ I 
Sbjct  791  ELSAIKKQLLEGFSPDDACPLGVPLFMETPQ-------PCSPLAQIDF----QAFDEIIP  839

Query  738  ESSVTDMTRFMPTSPSPSSSR---------IVNIGQLLESALEVAGQVAGTFVSTSPLPY  586
             +++TD   F   S S S  +         I+++ QLLES LE A +VA   VST+P+PY
Sbjct  840  PAALTDEEAFPEASGSQSGHKTSVSVNTFDILSVNQLLESVLETAREVASLPVSTTPIPY  899

Query  585  GAMASQCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTI-DEDSTLQ  409
              M +QCE L    +KK+S  L+ +N          +    G      K  + D D T  
Sbjct  900  DQMKNQCEALVIGKQKKMSVLLSFKNQQEDMGIGAEVEK-KGPTFSDMKMELPDVDLTPM  958

Query  408  QGVMVPREPWLAIW---------LPPASPFDNFLRAA  325
                V R+  L            LPP+SP+D FL+AA
Sbjct  959  ALEKVQRQDKLCCLSEQEQHSFRLPPSSPYDKFLKAA  995



>ref|XP_008445732.1| PREDICTED: uncharacterized protein LOC103488670 isoform X2 [Cucumis 
melo]
Length=954

 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 61/215 (28%), Positives = 102/215 (47%), Gaps = 24/215 (11%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + +++  GF PD+ +  G    ++       +     P YD      +  +D+   
Sbjct  745  ELSSIREQLLHGFLPDEAYPLGAPLFMETPRPCSPLAKLAFPDYDEGMPPAALTDDEAFL  804

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S S+  I+++ QLLES LE A QVA   VS++P+PY  M SQCE 
Sbjct  805  EPSGSQSDR--KTSLSISNLDILSVNQLLESVLETARQVASFPVSSAPVPYDQMKSQCEA  862

Query  558  LGTDTRKKLSNWLAHENHYTKAA------ADVLLPAIPGNGLLTAK---KTIDEDSTLQQ  406
            L +  ++K+S   + ++   + A       + L P +P N +   +   K  ++++   Q
Sbjct  863  LVSCKQQKMSVLHSFKHKKEEKAIVLSSEIETLYPPLPLNTMEIVQGDLKFYNKETNRGQ  922

Query  405  GVMVPREPWLA--------IWLPPASPFDNFLRAA  325
                  +P L         + LPP+SP+D FL+AA
Sbjct  923  D-----QPLLCSHEYGRHSLRLPPSSPYDKFLKAA  952



>ref|XP_007131956.1| hypothetical protein PHAVU_011G054800g [Phaseolus vulgaris]
 gb|ESW03950.1| hypothetical protein PHAVU_011G054800g [Phaseolus vulgaris]
Length=986

 Score = 70.1 bits (170),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 63/212 (30%), Positives = 100/212 (47%), Gaps = 17/212 (8%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ +GF+PDD +  G    ++       +   E P +D   + N  A  D+ +
Sbjct  776  ELSTIKKQLVQGFSPDDAYPLGPPLFMETPGQSSPLAQIEFPDFDE--IVNPEALMDEET  833

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
               ++       +S S ++  I+++ QLL+S LE A QVA    S++P+PY  M +QCE 
Sbjct  834  RPELSGSLSDRKSSLSSNNPDILSVNQLLQSVLETARQVASFPTSSTPVPYDQMKNQCEA  893

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVL-------LPAIPGNGLLTAKKTIDEDSTLQQGV  400
            L T  +KK+S  L    H  +  A VL       + ++P   L  ++  +   S  Q   
Sbjct  894  LVTGKQKKMS-VLHSFRHQQETRAIVLSSENELKVSSLPIQTLEYSEDDLKLVSQQQFQA  952

Query  399  MVPREPW-------LAIWLPPASPFDNFLRAA  325
                 P         ++ LPPASPFD FLRAA
Sbjct  953  QYQVRPCSYDFGQQHSLKLPPASPFDKFLRAA  984



>ref|XP_009784839.1| PREDICTED: uncharacterized protein LOC104233189 isoform X1 [Nicotiana 
sylvestris]
Length=836

 Score = 70.1 bits (170),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 62/208 (30%), Positives = 103/208 (50%), Gaps = 12/208 (6%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ E F PDD +  G+   ++  H    +   E  ++D      S  +++ IS
Sbjct  629  ELSSIRKQLLERFEPDDAYPLGIPLYMETPHPCSPLAQIEFETFDEVMAPPSLIDEEAIS  688

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            +++ +   R   TS S +S  I+++ QLLES LE A QV    +S++P+PY  + +QCE 
Sbjct  689  DANGSQSGR--KTSLSINSLDILSVNQLLESVLESARQVVNFPLSSTPIPYDQVKNQCEA  746

Query  558  LGTDTRKKLSNWLAHE-NHYTKA-----AADVLLPAIPGNGLLTAKK---TIDEDSTLQQ  406
            L T  + K+S   + +    TKA     A D   P++P       +     + E +  Q 
Sbjct  747  LVTGKQHKMSALQSFKMQQETKALQSYNAMDRKSPSLPKMDTELHQDLQLAVVESAHSQN  806

Query  405  GVMVPRE-PWLAIWLPPASPFDNFLRAA  325
             +   RE    +  LPP+SP+D FL+AA
Sbjct  807  SLSCSREYGQQSFRLPPSSPYDKFLKAA  834



>ref|XP_004309822.1| PREDICTED: uncharacterized protein LOC101313176 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457272.1| PREDICTED: uncharacterized protein LOC101313176 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011457273.1| PREDICTED: uncharacterized protein LOC101313176 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=998

 Score = 70.1 bits (170),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 102/212 (48%), Gaps = 18/212 (8%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++  GF+PDD F  G    ++       +   +   +D      S  +++   
Sbjct  789  ELSSIKKQLLLGFSPDDAFPLGAPLFMETPRPCSPLAQIDFADFDEVMPPGSLTDEEAFP  848

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S ++  I+N+ QLL+S LE A QVA   VST+P+PY  M SQCE 
Sbjct  849  EPSGSQSER--KTSLSINTLDILNVNQLLDSVLETAQQVASFPVSTTPVPYDQMKSQCEA  906

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGN----GLLTAKKTIDEDSTLQQGVMVP  391
            L T  ++K++  + H   + +    ++L +   N     L  A ++ + DS ++    + 
Sbjct  907  LVTGKQQKMA--VLHSFKHQQETKALVLSSESENKSHASLPMALESSEGDSKVKDEEQIQ  964

Query  390  REPWLAIW----------LPPASPFDNFLRAA  325
             +  L +           LPP+SP+D FL+AA
Sbjct  965  AKNQLLVCSREYGQHSFKLPPSSPYDKFLKAA  996



>ref|XP_009784840.1| PREDICTED: uncharacterized protein LOC104233189 isoform X2 [Nicotiana 
sylvestris]
Length=808

 Score = 69.7 bits (169),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 62/208 (30%), Positives = 103/208 (50%), Gaps = 12/208 (6%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ E F PDD +  G+   ++  H    +   E  ++D      S  +++ IS
Sbjct  601  ELSSIRKQLLERFEPDDAYPLGIPLYMETPHPCSPLAQIEFETFDEVMAPPSLIDEEAIS  660

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            +++ +   R   TS S +S  I+++ QLLES LE A QV    +S++P+PY  + +QCE 
Sbjct  661  DANGSQSGR--KTSLSINSLDILSVNQLLESVLESARQVVNFPLSSTPIPYDQVKNQCEA  718

Query  558  LGTDTRKKLSNWLAHE-NHYTKA-----AADVLLPAIPGNGLLTAKK---TIDEDSTLQQ  406
            L T  + K+S   + +    TKA     A D   P++P       +     + E +  Q 
Sbjct  719  LVTGKQHKMSALQSFKMQQETKALQSYNAMDRKSPSLPKMDTELHQDLQLAVVESAHSQN  778

Query  405  GVMVPRE-PWLAIWLPPASPFDNFLRAA  325
             +   RE    +  LPP+SP+D FL+AA
Sbjct  779  SLSCSREYGQQSFRLPPSSPYDKFLKAA  806



>ref|XP_011457274.1| PREDICTED: uncharacterized protein LOC101313176 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=984

 Score = 69.7 bits (169),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 102/212 (48%), Gaps = 18/212 (8%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++  GF+PDD F  G    ++       +   +   +D      S  +++   
Sbjct  775  ELSSIKKQLLLGFSPDDAFPLGAPLFMETPRPCSPLAQIDFADFDEVMPPGSLTDEEAFP  834

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S ++  I+N+ QLL+S LE A QVA   VST+P+PY  M SQCE 
Sbjct  835  EPSGSQSER--KTSLSINTLDILNVNQLLDSVLETAQQVASFPVSTTPVPYDQMKSQCEA  892

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGN----GLLTAKKTIDEDSTLQQGVMVP  391
            L T  ++K++  + H   + +    ++L +   N     L  A ++ + DS ++    + 
Sbjct  893  LVTGKQQKMA--VLHSFKHQQETKALVLSSESENKSHASLPMALESSEGDSKVKDEEQIQ  950

Query  390  REPWLAIW----------LPPASPFDNFLRAA  325
             +  L +           LPP+SP+D FL+AA
Sbjct  951  AKNQLLVCSREYGQHSFKLPPSSPYDKFLKAA  982



>ref|XP_011457275.1| PREDICTED: uncharacterized protein LOC101313176 isoform X4 [Fragaria 
vesca subsp. vesca]
Length=846

 Score = 69.7 bits (169),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 102/212 (48%), Gaps = 18/212 (8%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++  GF+PDD F  G    ++       +   +   +D      S  +++   
Sbjct  637  ELSSIKKQLLLGFSPDDAFPLGAPLFMETPRPCSPLAQIDFADFDEVMPPGSLTDEEAFP  696

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S ++  I+N+ QLL+S LE A QVA   VST+P+PY  M SQCE 
Sbjct  697  EPSGSQSER--KTSLSINTLDILNVNQLLDSVLETAQQVASFPVSTTPVPYDQMKSQCEA  754

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGN----GLLTAKKTIDEDSTLQQGVMVP  391
            L T  ++K++  + H   + +    ++L +   N     L  A ++ + DS ++    + 
Sbjct  755  LVTGKQQKMA--VLHSFKHQQETKALVLSSESENKSHASLPMALESSEGDSKVKDEEQIQ  812

Query  390  REPWLAIW----------LPPASPFDNFLRAA  325
             +  L +           LPP+SP+D FL+AA
Sbjct  813  AKNQLLVCSREYGQHSFKLPPSSPYDKFLKAA  844



>ref|XP_006597228.1| PREDICTED: uncharacterized protein LOC100811354 isoform X1 [Glycine 
max]
 ref|XP_006597229.1| PREDICTED: uncharacterized protein LOC100811354 isoform X2 [Glycine 
max]
Length=967

 Score = 69.7 bits (169),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 64/214 (30%), Positives = 105/214 (49%), Gaps = 21/214 (10%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   +  ++ +GF+PDD +  G    ++   +   +   E P YD   + +   E++   
Sbjct  757  ELSSVKNQLLQGFSPDDAYPSGPPLFMETPRLCPPLAQIEFPYYDEIMVPDDLIEEETEP  816

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S +   ++N+ QLL+S LE A QVA    S++PLPY  M +QCE 
Sbjct  817  EHSGSQPDR--KTSISANYPDVLNVNQLLDSVLETARQVASFSTSSTPLPYDQMKNQCEA  874

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVL----------LPAIP---GNG---LLTAKKTID  427
            L T  ++K+S  +    H  ++ A +L          LPA      NG   L+T ++   
Sbjct  875  LVTGKQQKMS-VIQSFKHQQESKAIILSSENEVNVSSLPAKALEYSNGDLKLVTQQQFQA  933

Query  426  EDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
            +D    Q     ++   ++ LPP+SP+D FL+AA
Sbjct  934  QDQARHQSHESGQQH--SLRLPPSSPYDKFLKAA  965



>gb|KHN33312.1| Protein EFR3 like B [Glycine soja]
Length=926

 Score = 69.7 bits (169),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 64/214 (30%), Positives = 105/214 (49%), Gaps = 21/214 (10%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   +  ++ +GF+PDD +  G    ++   +   +   E P YD   + +   E++   
Sbjct  716  ELSSVKNQLLQGFSPDDAYPSGPPLFMETPRLCPPLAQIEFPYYDEIMVPDDLMEEETEP  775

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S +   ++N+ QLL+S LE A QVA    S++PLPY  M +QCE 
Sbjct  776  EHSGSQPDR--KTSISANYPDVLNVNQLLDSVLETARQVASFSTSSTPLPYDQMKNQCEA  833

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVL----------LPAIP---GNG---LLTAKKTID  427
            L T  ++K+S  +    H  ++ A +L          LPA      NG   L+T ++   
Sbjct  834  LVTGKQQKMS-VIQSFKHQQESKAIILSSENEVNVSSLPAKALEYSNGDLKLVTQQQFQA  892

Query  426  EDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
            +D    Q     ++   ++ LPP+SP+D FL+AA
Sbjct  893  QDQARHQSHESGQQH--SLRLPPSSPYDKFLKAA  924



>ref|XP_006597231.1| PREDICTED: uncharacterized protein LOC100811354 isoform X4 [Glycine 
max]
 ref|XP_006597232.1| PREDICTED: uncharacterized protein LOC100811354 isoform X5 [Glycine 
max]
Length=815

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 64/214 (30%), Positives = 105/214 (49%), Gaps = 21/214 (10%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   +  ++ +GF+PDD +  G    ++   +   +   E P YD   + +   E++   
Sbjct  605  ELSSVKNQLLQGFSPDDAYPSGPPLFMETPRLCPPLAQIEFPYYDEIMVPDDLIEEETEP  664

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S +   ++N+ QLL+S LE A QVA    S++PLPY  M +QCE 
Sbjct  665  EHSGSQPDR--KTSISANYPDVLNVNQLLDSVLETARQVASFSTSSTPLPYDQMKNQCEA  722

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVL----------LPAIP---GNG---LLTAKKTID  427
            L T  ++K+S  +    H  ++ A +L          LPA      NG   L+T ++   
Sbjct  723  LVTGKQQKMS-VIQSFKHQQESKAIILSSENEVNVSSLPAKALEYSNGDLKLVTQQQFQA  781

Query  426  EDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
            +D    Q     ++   ++ LPP+SP+D FL+AA
Sbjct  782  QDQARHQSHESGQQH--SLRLPPSSPYDKFLKAA  813



>ref|XP_006597230.1| PREDICTED: uncharacterized protein LOC100811354 isoform X3 [Glycine 
max]
Length=859

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 64/214 (30%), Positives = 105/214 (49%), Gaps = 21/214 (10%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   +  ++ +GF+PDD +  G    ++   +   +   E P YD   + +   E++   
Sbjct  649  ELSSVKNQLLQGFSPDDAYPSGPPLFMETPRLCPPLAQIEFPYYDEIMVPDDLIEEETEP  708

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   TS S +   ++N+ QLL+S LE A QVA    S++PLPY  M +QCE 
Sbjct  709  EHSGSQPDR--KTSISANYPDVLNVNQLLDSVLETARQVASFSTSSTPLPYDQMKNQCEA  766

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVL----------LPAIP---GNG---LLTAKKTID  427
            L T  ++K+S  +    H  ++ A +L          LPA      NG   L+T ++   
Sbjct  767  LVTGKQQKMS-VIQSFKHQQESKAIILSSENEVNVSSLPAKALEYSNGDLKLVTQQQFQA  825

Query  426  EDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
            +D    Q     ++   ++ LPP+SP+D FL+AA
Sbjct  826  QDQARHQSHESGQQH--SLRLPPSSPYDKFLKAA  857



>gb|EMS60662.1| Protein EFR3-like protein [Triticum urartu]
Length=912

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 93/199 (47%), Gaps = 35/199 (18%)
 Frame = -1

Query  912  DDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS-E  736
            D + +++ + F+ DD+F  G    ++  H   +   ++   +D D +     +DD I  E
Sbjct  748  DGIEEQLLQEFSLDDSFPLGAPLFMETPHSCSMYAEKDDHCFDEDVIPCEMDDDDDIVFE  807

Query  735  SSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETL  556
             S +   R   TS S +SS ++N+ QL+ES  E A QVA   VST+P+ Y  M SQCE+L
Sbjct  808  HSGSQSDR--KTSGSMASSDVLNVNQLMESVHETARQVANIPVSTNPVSYDQMKSQCESL  865

Query  555  GTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPWL  376
             +   +        E+H T+            + +     T  +D + +           
Sbjct  866  SSAQSEP-------ESHLTR-----------KDYMRRNDSTSSDDRSFR-----------  896

Query  375  AIWLPPASPFDNFLRAARR  319
               LPPASP+D FL+AA R
Sbjct  897  ---LPPASPYDKFLKAAGR  912



>gb|EMT06694.1| Putative mitochondrial protein [Aegilops tauschii]
Length=1112

 Score = 69.3 bits (168),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 93/199 (47%), Gaps = 35/199 (18%)
 Frame = -1

Query  912  DDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS-E  736
            D + +++ + F+ DD+F  G    ++  H   +   ++   +D D +     +DD I  E
Sbjct  748  DGIEEQLLQEFSLDDSFPLGAPLFMETPHSCSMYAEKDDHCFDEDVIPCEMDDDDDIVFE  807

Query  735  SSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETL  556
             S +   R   TS S +SS ++N+ QL+ES  E A QVA   VST+P+ Y  M SQCE+L
Sbjct  808  HSGSQSDR--KTSGSMASSDVLNVNQLMESVHETARQVANIPVSTNPVSYDQMKSQCESL  865

Query  555  GTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPWL  376
             +   +        E+H T+            + +     T  +D + +           
Sbjct  866  SSAQSEP-------ESHLTRK-----------DYMRRNDSTSSDDRSFR-----------  896

Query  375  AIWLPPASPFDNFLRAARR  319
               LPPASP+D FL+AA R
Sbjct  897  ---LPPASPYDKFLKAAGR  912



>ref|XP_001770437.1| predicted protein [Physcomitrella patens]
 gb|EDQ64774.1| predicted protein [Physcomitrella patens]
Length=1107

 Score = 68.9 bits (167),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 58/211 (27%), Positives = 99/211 (47%), Gaps = 17/211 (8%)
 Frame = -1

Query  909   DLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISESS  730
             DL + ++E F P D  +   +   +  + +    S++S S+D   L+N+  ED+  S + 
Sbjct  896   DLKERLTEQFVPADNEILRSRLYSESVNARSAHASQDSMSFDETLLSNAVLEDESTSGTG  955

Query  729   VTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGT  550
              +++   +  + S + ++   + QLL+ A E AGQ   T   + PL Y   A+QCE  G 
Sbjct  956   -SELPPMLRDTASSAPAQAPGVSQLLDLANETAGQAGLTHAPSGPLSYSDTANQCEKFGV  1014

Query  549   DTRKKLSNWLAHENHYTKAAADV---LLPAIPGNGLLTAK-KTIDEDSTLQQGVMVPREP  382
                KK+S  L  ++H    + +       +   NGL + +   IDE    +       + 
Sbjct  1015  GAHKKMSAVLKMDSHGNAPSTNAHPNTKDSYRTNGLESTELDKIDEHQEARHASNSKSQS  1074

Query  381   ------WLA------IWLPPASPFDNFLRAA  325
                   WLA      + LPP+SP+DNFL+AA
Sbjct  1075  PESKPTWLASPNVEDLKLPPSSPYDNFLKAA  1105



>emb|CDP16550.1| unnamed protein product [Coffea canephora]
Length=1009

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 61/219 (28%), Positives = 102/219 (47%), Gaps = 33/219 (15%)
 Frame = -1

Query  918   ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSS-------  760
             E  ++  ++ EGF+PDD +  G    ++            SP  + DF T +        
Sbjct  801   ELSNIKSQLQEGFSPDDAYPLGAPLFMETP-------CPSSPLAEMDFQTFNEIMAPAGL  853

Query  759   AEDDKISESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGA  580
             A+++   ++S +   R   TS S +S  I+++ QLLES LE A  VA   VS++P+PY  
Sbjct  854   ADEESFPDASGSQSGR--KTSLSVNSLDILSVNQLLESVLETARHVASLPVSSTPIPYDQ  911

Query  579   MASQCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAI--PGNGLLTAKKTID-------  427
             + SQCE L    ++K+   LA ++   +  A  +L        G + + K +D       
Sbjct  912   VKSQCEALVNGKQQKM---LALQSFKVQQEAKAILSECENENKGPVLSNKVLDLSGDIKS  968

Query  426   -EDSTLQQGVMVPREPWL----AIWLPPASPFDNFLRAA  325
                  +Q  + +P         +  LPP+SP+D FL+AA
Sbjct  969   TNSQLIQSRIQLPCAQECVQEQSFRLPPSSPYDKFLKAA  1007



>gb|KHN06209.1| Protein EFR3 like B [Glycine soja]
Length=988

 Score = 68.6 bits (166),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 100/212 (47%), Gaps = 17/212 (8%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ +GF+PDD +  G    ++       +   E P +D      +  +++   
Sbjct  778  ELSSIKKQLVQGFSPDDAYPLGPPLFMETPGKSSPLAQIEFPDFDEIVAPLALMDEETQP  837

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   +S S +S  I+++ QLL+S LE A QVA   +S++P+PY  M +QCE 
Sbjct  838  EPSGSQSDR--KSSLSSNSPDILSVNQLLQSVLETARQVASFPISSTPVPYDQMKNQCEA  895

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDE---DSTL--QQGVMV  394
            L T  ++K+S  L    H  +  A VL             KT+D    D  L  QQ +  
Sbjct  896  LVTGKQQKMS-ILHSFKHQQETRALVLSSENETKVSPLPIKTLDYSEGDLKLVSQQPIQA  954

Query  393  PREPWLAIW---------LPPASPFDNFLRAA  325
              +  L  +         LPPASPFD FL+AA
Sbjct  955  QYQVRLCSYDFGQQHSLKLPPASPFDKFLKAA  986



>ref|XP_003539042.1| PREDICTED: uncharacterized protein LOC100817330 isoform X1 [Glycine 
max]
 ref|XP_006590940.1| PREDICTED: uncharacterized protein LOC100817330 isoform X2 [Glycine 
max]
Length=986

 Score = 68.2 bits (165),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 100/212 (47%), Gaps = 17/212 (8%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ +GF+PDD +  G    ++       +   E P +D      +  +++   
Sbjct  776  ELSSIKKQLVQGFSPDDAYPLGPPLFMETPGKSSPLAQIEFPDFDEIVAPLALMDEETQP  835

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   +S S +S  I+++ QLL+S LE A QVA   +S++P+PY  M +QCE 
Sbjct  836  EPSGSQSDR--KSSLSSNSPDILSVNQLLQSVLETARQVASFPISSTPVPYDQMKNQCEA  893

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDE---DSTL--QQGVMV  394
            L T  ++K+S  L    H  +  A VL             KT+D    D  L  QQ +  
Sbjct  894  LVTGKQQKMS-ILHSFKHQQETRALVLSSENETKVSPLPIKTLDYSEGDLKLVSQQPIQA  952

Query  393  PREPWLAIW---------LPPASPFDNFLRAA  325
              +  L  +         LPPASPFD FL+AA
Sbjct  953  QYQVRLCSYDFGQQHSLKLPPASPFDKFLKAA  984



>ref|XP_006590941.1| PREDICTED: uncharacterized protein LOC100817330 isoform X3 [Glycine 
max]
Length=878

 Score = 68.2 bits (165),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 65/212 (31%), Positives = 100/212 (47%), Gaps = 17/212 (8%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ +GF+PDD +  G    ++       +   E P +D      +  +++   
Sbjct  668  ELSSIKKQLVQGFSPDDAYPLGPPLFMETPGKSSPLAQIEFPDFDEIVAPLALMDEETQP  727

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +   R   +S S +S  I+++ QLL+S LE A QVA   +S++P+PY  M +QCE 
Sbjct  728  EPSGSQSDR--KSSLSSNSPDILSVNQLLQSVLETARQVASFPISSTPVPYDQMKNQCEA  785

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDE---DSTL--QQGVMV  394
            L T  ++K+S  L    H  +  A VL             KT+D    D  L  QQ +  
Sbjct  786  LVTGKQQKMS-ILHSFKHQQETRALVLSSENETKVSPLPIKTLDYSEGDLKLVSQQPIQA  844

Query  393  PREPWLAIW---------LPPASPFDNFLRAA  325
              +  L  +         LPPASPFD FL+AA
Sbjct  845  QYQVRLCSYDFGQQHSLKLPPASPFDKFLKAA  876



>ref|XP_004250744.1| PREDICTED: uncharacterized protein LOC101250362 isoform X2 [Solanum 
lycopersicum]
Length=993

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 102/208 (49%), Gaps = 12/208 (6%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ E F PDD +  G+   ++  H    +   E  ++D      S  +++ IS
Sbjct  786  ELSSIRKQLLERFEPDDAYPLGIPLYMETPHPCSPLAQIEFETFDEVMGPPSLIDEETIS  845

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            +++ +   R   TS S +S  I+++ QLLES LE A QVA     ++P+PY  + +QCE 
Sbjct  846  DANGSQSGR--KTSLSINSLDILSVNQLLESVLETARQVASYPTFSTPIPYDQVKNQCEA  903

Query  558  LGTDTRKKLSNWLAHE-NHYTKAAA-----DVLLPAIPGNGLLTAK--KTIDEDSTLQQG  403
            L T  + K+S   + +    TKA       D   P++P   ++  +  +    DST  Q 
Sbjct  904  LVTGKQHKMSTLQSFKMQQETKALISYNENDRKNPSLPKMDMVLHQDLQLTTVDSTHAQN  963

Query  402  VMVPREPW--LAIWLPPASPFDNFLRAA  325
                   +   +  LPP+SP+D FL+AA
Sbjct  964  SHSCSREYGEQSFRLPPSSPYDKFLKAA  991



>ref|XP_010313082.1| PREDICTED: uncharacterized protein LOC101250362 isoform X1 [Solanum 
lycopersicum]
Length=994

 Score = 67.8 bits (164),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 102/208 (49%), Gaps = 12/208 (6%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ E F PDD +  G+   ++  H    +   E  ++D      S  +++ IS
Sbjct  787  ELSSIRKQLLERFEPDDAYPLGIPLYMETPHPCSPLAQIEFETFDEVMGPPSLIDEETIS  846

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            +++ +   R   TS S +S  I+++ QLLES LE A QVA     ++P+PY  + +QCE 
Sbjct  847  DANGSQSGR--KTSLSINSLDILSVNQLLESVLETARQVASYPTFSTPIPYDQVKNQCEA  904

Query  558  LGTDTRKKLSNWLAHE-NHYTKAAA-----DVLLPAIPGNGLLTAK--KTIDEDSTLQQG  403
            L T  + K+S   + +    TKA       D   P++P   ++  +  +    DST  Q 
Sbjct  905  LVTGKQHKMSTLQSFKMQQETKALISYNENDRKNPSLPKMDMVLHQDLQLTTVDSTHAQN  964

Query  402  VMVPREPW--LAIWLPPASPFDNFLRAA  325
                   +   +  LPP+SP+D FL+AA
Sbjct  965  SHSCSREYGEQSFRLPPSSPYDKFLKAA  992



>ref|XP_010313083.1| PREDICTED: uncharacterized protein LOC101250362 isoform X3 [Solanum 
lycopersicum]
Length=899

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 102/208 (49%), Gaps = 12/208 (6%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ E F PDD +  G+   ++  H    +   E  ++D      S  +++ IS
Sbjct  692  ELSSIRKQLLERFEPDDAYPLGIPLYMETPHPCSPLAQIEFETFDEVMGPPSLIDEETIS  751

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            +++ +   R   TS S +S  I+++ QLLES LE A QVA     ++P+PY  + +QCE 
Sbjct  752  DANGSQSGR--KTSLSINSLDILSVNQLLESVLETARQVASYPTFSTPIPYDQVKNQCEA  809

Query  558  LGTDTRKKLSNWLAHE-NHYTKA-----AADVLLPAIPGNGLLTAK--KTIDEDSTLQQG  403
            L T  + K+S   + +    TKA       D   P++P   ++  +  +    DST  Q 
Sbjct  810  LVTGKQHKMSTLQSFKMQQETKALISYNENDRKNPSLPKMDMVLHQDLQLTTVDSTHAQN  869

Query  402  VMVPREPW--LAIWLPPASPFDNFLRAA  325
                   +   +  LPP+SP+D FL+AA
Sbjct  870  SHSCSREYGEQSFRLPPSSPYDKFLKAA  897



>ref|XP_010313084.1| PREDICTED: uncharacterized protein LOC101250362 isoform X4 [Solanum 
lycopersicum]
Length=886

 Score = 67.4 bits (163),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 61/208 (29%), Positives = 102/208 (49%), Gaps = 12/208 (6%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ E F PDD +  G+   ++  H    +   E  ++D      S  +++ IS
Sbjct  679  ELSSIRKQLLERFEPDDAYPLGIPLYMETPHPCSPLAQIEFETFDEVMGPPSLIDEETIS  738

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            +++ +   R   TS S +S  I+++ QLLES LE A QVA     ++P+PY  + +QCE 
Sbjct  739  DANGSQSGR--KTSLSINSLDILSVNQLLESVLETARQVASYPTFSTPIPYDQVKNQCEA  796

Query  558  LGTDTRKKLSNWLAHE-NHYTKA-----AADVLLPAIPGNGLLTAK--KTIDEDSTLQQG  403
            L T  + K+S   + +    TKA       D   P++P   ++  +  +    DST  Q 
Sbjct  797  LVTGKQHKMSTLQSFKMQQETKALISYNENDRKNPSLPKMDMVLHQDLQLTTVDSTHAQN  856

Query  402  VMVPREPW--LAIWLPPASPFDNFLRAA  325
                   +   +  LPP+SP+D FL+AA
Sbjct  857  SHSCSREYGEQSFRLPPSSPYDKFLKAA  884



>gb|KJB71804.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
 gb|KJB71805.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
 gb|KJB71807.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
 gb|KJB71810.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
 gb|KJB71811.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=974

 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 95/209 (45%), Gaps = 15/209 (7%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ EGF+PDD + FG    ++       +   E  +++      +  +D+   
Sbjct  768  ELSSIKKQILEGFSPDDAYPFGAPLFMETPRPCSPLAQMEFLAFEEIMPLAAITDDEAFP  827

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E + +   R    S S S+  ++++ +LL+S LE A QVA   VS +P+PY  M SQCE 
Sbjct  828  EGNGSQSGR--KASLSLSTLDVLSVNELLDSVLETARQVASFSVSPTPIPYEQMRSQCEA  885

Query  558  LGTDTRKKLSNWLAHE-NHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREP  382
            L    ++K+S  + H   H  +A A           L   K    ED  L     V    
Sbjct  886  LIIGKQQKMS--VIHSFKHQQEAKATFEENGKEVLCLPNVKVEFSEDLKLISNEQVHARG  943

Query  381  WLAIW----------LPPASPFDNFLRAA  325
             LA+           LPP+SP+D FL+AA
Sbjct  944  QLAVCSLEYGQHSFKLPPSSPYDKFLKAA  972



>gb|KJB71808.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=975

 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 95/209 (45%), Gaps = 15/209 (7%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ EGF+PDD + FG    ++       +   E  +++      +  +D+   
Sbjct  769  ELSSIKKQILEGFSPDDAYPFGAPLFMETPRPCSPLAQMEFLAFEEIMPLAAITDDEAFP  828

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E + +   R    S S S+  ++++ +LL+S LE A QVA   VS +P+PY  M SQCE 
Sbjct  829  EGNGSQSGR--KASLSLSTLDVLSVNELLDSVLETARQVASFSVSPTPIPYEQMRSQCEA  886

Query  558  LGTDTRKKLSNWLAHE-NHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREP  382
            L    ++K+S  + H   H  +A A           L   K    ED  L     V    
Sbjct  887  LIIGKQQKMS--VIHSFKHQQEAKATFEENGKEVLCLPNVKVEFSEDLKLISNEQVHARG  944

Query  381  WLAIW----------LPPASPFDNFLRAA  325
             LA+           LPP+SP+D FL+AA
Sbjct  945  QLAVCSLEYGQHSFKLPPSSPYDKFLKAA  973



>gb|KJB71809.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=926

 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 95/209 (45%), Gaps = 15/209 (7%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ EGF+PDD + FG    ++       +   E  +++      +  +D+   
Sbjct  720  ELSSIKKQILEGFSPDDAYPFGAPLFMETPRPCSPLAQMEFLAFEEIMPLAAITDDEAFP  779

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E + +   R    S S S+  ++++ +LL+S LE A QVA   VS +P+PY  M SQCE 
Sbjct  780  EGNGSQSGR--KASLSLSTLDVLSVNELLDSVLETARQVASFSVSPTPIPYEQMRSQCEA  837

Query  558  LGTDTRKKLSNWLAHE-NHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREP  382
            L    ++K+S  + H   H  +A A           L   K    ED  L     V    
Sbjct  838  LIIGKQQKMS--VIHSFKHQQEAKATFEENGKEVLCLPNVKVEFSEDLKLISNEQVHARG  895

Query  381  WLAIW----------LPPASPFDNFLRAA  325
             LA+           LPP+SP+D FL+AA
Sbjct  896  QLAVCSLEYGQHSFKLPPSSPYDKFLKAA  924



>gb|KJB71812.1| hypothetical protein B456_011G143200 [Gossypium raimondii]
Length=759

 Score = 67.4 bits (163),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 61/209 (29%), Positives = 95/209 (45%), Gaps = 15/209 (7%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ EGF+PDD + FG    ++       +   E  +++      +  +D+   
Sbjct  553  ELSSIKKQILEGFSPDDAYPFGAPLFMETPRPCSPLAQMEFLAFEEIMPLAAITDDEAFP  612

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E + +   R    S S S+  ++++ +LL+S LE A QVA   VS +P+PY  M SQCE 
Sbjct  613  EGNGSQSGR--KASLSLSTLDVLSVNELLDSVLETARQVASFSVSPTPIPYEQMRSQCEA  670

Query  558  LGTDTRKKLSNWLAHE-NHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREP  382
            L    ++K+S  + H   H  +A A           L   K    ED  L     V    
Sbjct  671  LIIGKQQKMS--VIHSFKHQQEAKATFEENGKEVLCLPNVKVEFSEDLKLISNEQVHARG  728

Query  381  WLAIW----------LPPASPFDNFLRAA  325
             LA+           LPP+SP+D FL+AA
Sbjct  729  QLAVCSLEYGQHSFKLPPSSPYDKFLKAA  757



>ref|XP_009393518.1| PREDICTED: uncharacterized protein LOC103979184 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009393521.1| PREDICTED: uncharacterized protein LOC103979184 [Musa acuminata 
subsp. malaccensis]
Length=1021

 Score = 67.0 bits (162),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 53/167 (32%), Positives = 82/167 (49%), Gaps = 32/167 (19%)
 Frame = -1

Query  786   DGDFLTNS--SAEDDKISESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGT  613
             DGD L+++  S  D K+SES    M  F           ++++ QL+ES +E A QVA  
Sbjct  872   DGDNLSDAFRSQSDRKMSES----MNNF----------DVLSVNQLIESVIETARQVASL  917

Query  612   FVSTSPLPYGAMASQCETLGTDTRKKLS----------NW-LAHENHYTKAAADVLLPAI  466
               ST P+PY  M SQCE L    ++K+S          +W +  E ++  +      P +
Sbjct  918   PTSTIPVPYDQMKSQCEALVIGKQQKMSVLQSFKHQQVDWRVVPEENFVDSVDAHQTPHL  977

Query  465   PGNGLLTAKKTIDEDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
             P      A  ++DE   +++   +  E   +  LPPASP+D FL+AA
Sbjct  978   P-----EAVLSLDEKEHVRRSNSLSSESEQSFRLPPASPYDKFLKAA  1019



>ref|XP_002264735.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 ref|XP_010650556.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 ref|XP_010650557.1| PREDICTED: uncharacterized protein LOC100264644 isoform X1 [Vitis 
vinifera]
 emb|CBI36655.3| unnamed protein product [Vitis vinifera]
Length=1000

 Score = 67.0 bits (162),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 101/207 (49%), Gaps = 11/207 (5%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ +GF+PDD + FG    ++       +   E   +      ++  +++   
Sbjct  794  ELSGMKKQLLQGFSPDDAYPFGAPLFMETPRPCSPLAQIEFQPFREAIAPDALTDEEAFP  853

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E   +   R   TS S ++  I+++ QLLES LE A QVA   VS++P+PY  M SQCE 
Sbjct  854  EIDGSQSDR--KTSLSINTLDILSVNQLLESVLETARQVASFPVSSTPIPYDQMKSQCEA  911

Query  558  LGTDTRKKLSNWLAHENHYTKAAA-----DVLLPAIPGNGLLTAK-KTIDEDST--LQQG  403
            L T  ++K+S   + +   TKA       +  +P+      L    K ++++      Q 
Sbjct  912  LVTGKQQKMSVLQSFKQQDTKAIVVYGENEQSIPSTKSLDFLEDDLKLVNKEHVRGRDQL  971

Query  402  VMVPRE-PWLAIWLPPASPFDNFLRAA  325
            ++   E    +  LPP+SP+D F++AA
Sbjct  972  LLCSHEYGQQSFRLPPSSPYDKFMKAA  998



>ref|XP_010650558.1| PREDICTED: uncharacterized protein LOC100264644 isoform X2 [Vitis 
vinifera]
Length=892

 Score = 66.6 bits (161),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 101/207 (49%), Gaps = 11/207 (5%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ +GF+PDD + FG    ++       +   E   +      ++  +++   
Sbjct  686  ELSGMKKQLLQGFSPDDAYPFGAPLFMETPRPCSPLAQIEFQPFREAIAPDALTDEEAFP  745

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E   +   R   TS S ++  I+++ QLLES LE A QVA   VS++P+PY  M SQCE 
Sbjct  746  EIDGSQSDR--KTSLSINTLDILSVNQLLESVLETARQVASFPVSSTPIPYDQMKSQCEA  803

Query  558  LGTDTRKKLSNWLAHENHYTKAAA-----DVLLPAIPGNGLLTAK-KTIDEDST--LQQG  403
            L T  ++K+S   + +   TKA       +  +P+      L    K ++++      Q 
Sbjct  804  LVTGKQQKMSVLQSFKQQDTKAIVVYGENEQSIPSTKSLDFLEDDLKLVNKEHVRGRDQL  863

Query  402  VMVPRE-PWLAIWLPPASPFDNFLRAA  325
            ++   E    +  LPP+SP+D F++AA
Sbjct  864  LLCSHEYGQQSFRLPPSSPYDKFMKAA  890



>gb|KHN30101.1| Protein EFR3 like B [Glycine soja]
Length=967

 Score = 66.6 bits (161),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 57/213 (27%), Positives = 101/213 (47%), Gaps = 19/213 (9%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   +  ++ +GF+PDD +  G    ++       +   E P++D   + +   E++   
Sbjct  757  ELSSIKNQLLQGFSPDDAYPSGPPLFMETPRPCSPLAQIEFPNFDEIMVPDDLMEEETGP  816

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +       TS S +   ++N+ QLL+S LE A QVA    S++PLPY  M +QCE 
Sbjct  817  EHSGSQSDH--KTSLSTNYPDVLNVNQLLDSVLETARQVASFSTSSTPLPYDQMKNQCEA  874

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVLLPA--------IPGNGLLTAK---KTIDEDSTL  412
            L T  ++K+S  + H   + + +  ++L +        +P   L  +    K + +    
Sbjct  875  LVTGKQQKMS--VIHSFKHQQESKAIILSSENEVKVSPLPAKALEYSNGDLKLVTQQQFE  932

Query  411  QQGVMVPRE----PWLAIWLPPASPFDNFLRAA  325
             Q  +  R        ++ LPP+SP+D FL+AA
Sbjct  933  AQDQVRHRSHDSGHQHSLRLPPSSPYDKFLKAA  965



>gb|KEH39475.1| cyclin-like protein [Medicago truncatula]
Length=949

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/213 (30%), Positives = 100/213 (47%), Gaps = 20/213 (9%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   +  ++ +GF+PDD +  G    ++       +   E P  D        A DD I 
Sbjct  740  ELSSIKNQLLQGFSPDDAYPSGPPLFMETPRPGSPLAQIEFPDVDEIM-----AADDLID  794

Query  738  ESSVTDMTRFMP---TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQ  568
            E S T+++       TS S +   ++ + QLLES LE A QVA    S++PLPY  M +Q
Sbjct  795  EGSGTELSGSQSDRRTSLSTNRPDVLGVNQLLESVLETARQVASISTSSTPLPYDQMKNQ  854

Query  567  CETLGTDTRKKLSNWLAHENHY-TKA----AADVLLPAIPGNGLLTAK---KTIDEDSTL  412
            CE L T  ++K+    + +N   TKA    + +  +   P   L  +K   K + ++   
Sbjct  855  CEALETGKQQKMLTIRSFKNQQETKAIVLSSENEEVSRQPVKALEYSKGDLKLVTQEQFQ  914

Query  411  QQGVMVPR----EPWLAIWLPPASPFDNFLRAA  325
             Q  +  R        ++ LPP+SP+D FL+AA
Sbjct  915  AQDQIRFRSQDTRKQHSLRLPPSSPYDKFLKAA  947



>ref|XP_002533049.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29339.1| conserved hypothetical protein [Ricinus communis]
Length=988

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 58/199 (29%), Positives = 94/199 (47%), Gaps = 18/199 (9%)
 Frame = -1

Query  882  FTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISESSVTDMTRFMP  703
            F+PDD +  G    +D       +   E  +++      S  +D+ I E++ +   R   
Sbjct  793  FSPDDAYPLGAPLFMDTPRPSSPLAQMEFQAFEEIMPAASLTDDETIIEANGSQSAR--K  850

Query  702  TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTRKKLSNW  523
            TS S ++  I+++  LLES LE A QVA + VS++P+PY  M SQCE L T  ++K+S  
Sbjct  851  TSLSVNTLDILSVNDLLESVLETARQVASSQVSSTPVPYDQMMSQCEALVTGKQQKMS--  908

Query  522  LAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDST---LQQGVMVPREPWLAIW-----  367
            + H +  T+  A V    +   G     + ++   +   L           LA+      
Sbjct  909  MLH-SFKTQHDAKVFPTEVEKRGTSAFNEIVEHSPSELKLNNNDQTKASDQLALCSVEYG  967

Query  366  -----LPPASPFDNFLRAA  325
                 LPP+SP+D FL+AA
Sbjct  968  PSSFKLPPSSPYDKFLKAA  986



>ref|XP_003597513.1| EFR3-like protein [Medicago truncatula]
 gb|AES67764.1| cyclin-like protein [Medicago truncatula]
Length=969

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/213 (30%), Positives = 100/213 (47%), Gaps = 20/213 (9%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   +  ++ +GF+PDD +  G    ++       +   E P  D        A DD I 
Sbjct  760  ELSSIKNQLLQGFSPDDAYPSGPPLFMETPRPGSPLAQIEFPDVDEIM-----AADDLID  814

Query  738  ESSVTDMTRFMP---TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQ  568
            E S T+++       TS S +   ++ + QLLES LE A QVA    S++PLPY  M +Q
Sbjct  815  EGSGTELSGSQSDRRTSLSTNRPDVLGVNQLLESVLETARQVASISTSSTPLPYDQMKNQ  874

Query  567  CETLGTDTRKKLSNWLAHENHY-TKA----AADVLLPAIPGNGLLTAK---KTIDEDSTL  412
            CE L T  ++K+    + +N   TKA    + +  +   P   L  +K   K + ++   
Sbjct  875  CEALETGKQQKMLTIRSFKNQQETKAIVLSSENEEVSRQPVKALEYSKGDLKLVTQEQFQ  934

Query  411  QQGVMVPR----EPWLAIWLPPASPFDNFLRAA  325
             Q  +  R        ++ LPP+SP+D FL+AA
Sbjct  935  AQDQIRFRSQDTRKQHSLRLPPSSPYDKFLKAA  967



>ref|XP_004507331.1| PREDICTED: uncharacterized protein LOC101496023 isoform X1 [Cicer 
arietinum]
 ref|XP_004507332.1| PREDICTED: uncharacterized protein LOC101496023 isoform X2 [Cicer 
arietinum]
Length=987

 Score = 66.2 bits (160),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 63/213 (30%), Positives = 101/213 (47%), Gaps = 19/213 (9%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++++GF+PDD +  G    ++       +   E P +D +     +  D++I 
Sbjct  777  ELSSIKKQLAQGFSPDDAYPLGPPLFMETPRPCSPLAQIEFPDFD-EIEAPVALMDEEIG  835

Query  738  -ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCE  562
             E S   +     +SPS ++  I+++ QLLES LE A QVA   +S + +PY  M +QCE
Sbjct  836  PEPSGIQLD--CKSSPSFNNLTILSVNQLLESVLETARQVASFPISATAVPYDQMKNQCE  893

Query  561  TLGTDTRKKLSNWLAHENHYTKAAADVLLPAI-------PGNGLLTAKKTIDEDSTLQQG  403
             L +  ++K+S  L    H  +  A VL  A        P   L  A+  +   S  Q  
Sbjct  894  ALVSGKQQKMS-VLHSFKHQQETRALVLFSANETKVSPPPIKTLEYAESDLKLVSQEQIP  952

Query  402  VMVPREPW-------LAIWLPPASPFDNFLRAA  325
             +    P         ++ LPPASP+D FL+AA
Sbjct  953  ALYQVRPCSYEYRQQHSLRLPPASPYDKFLKAA  985



>ref|XP_006595062.1| PREDICTED: uncharacterized protein LOC100806860 isoform X3 [Glycine 
max]
Length=813

 Score = 65.9 bits (159),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 62/215 (29%), Positives = 104/215 (48%), Gaps = 23/215 (11%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   +  ++ +GF+PDD +  G    ++       +   E P++D   + +   E++   
Sbjct  603  ELSSIKNQLLQGFSPDDAYPSGPPLFMETPRPCSPLAQIEFPNFDEIMVPDDLMEEETGP  662

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +       TS S +   ++N+ QLL+S LE A QVA    S++PLPY  M +QCE 
Sbjct  663  EHSGSQSDH--KTSLSTNYPDVLNVNQLLDSVLETARQVASFSTSSTPLPYDQMKNQCEA  720

Query  558  LGTDTRKKLSNWLAHE-NHYTKAAADVL----------LPAIP---GNG---LLTAKKTI  430
            L T  ++K+S  + H   H  ++ A +L          LPA      NG   L+T ++  
Sbjct  721  LVTGKQQKMS--VIHSFKHQQESKAIILSSENEVKVSPLPAKALEYSNGDLKLVTQQQFE  778

Query  429  DEDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
             +D    +      +   ++ LPP+SP+D FL+AA
Sbjct  779  VQDQARHRSHDSGHQH--SLRLPPSSPYDKFLKAA  811



>ref|XP_006595061.1| PREDICTED: uncharacterized protein LOC100806860 isoform X2 [Glycine 
max]
 ref|XP_003542058.2| PREDICTED: uncharacterized protein LOC100806860 isoform X1 [Glycine 
max]
Length=965

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 62/215 (29%), Positives = 104/215 (48%), Gaps = 23/215 (11%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   +  ++ +GF+PDD +  G    ++       +   E P++D   + +   E++   
Sbjct  755  ELSSIKNQLLQGFSPDDAYPSGPPLFMETPRPCSPLAQIEFPNFDEIMVPDDLMEEETGP  814

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E S +       TS S +   ++N+ QLL+S LE A QVA    S++PLPY  M +QCE 
Sbjct  815  EHSGSQSDH--KTSLSTNYPDVLNVNQLLDSVLETARQVASFSTSSTPLPYDQMKNQCEA  872

Query  558  LGTDTRKKLSNWLAHE-NHYTKAAADVL----------LPAIP---GNG---LLTAKKTI  430
            L T  ++K+S  + H   H  ++ A +L          LPA      NG   L+T ++  
Sbjct  873  LVTGKQQKMS--VIHSFKHQQESKAIILSSENEVKVSPLPAKALEYSNGDLKLVTQQQFE  930

Query  429  DEDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
             +D    +      +   ++ LPP+SP+D FL+AA
Sbjct  931  VQDQARHRSHDSGHQH--SLRLPPSSPYDKFLKAA  963



>ref|XP_007033975.1| ARM repeat superfamily protein isoform 5 [Theobroma cacao]
 gb|EOY04901.1| ARM repeat superfamily protein isoform 5 [Theobroma cacao]
Length=984

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/207 (27%), Positives = 103/207 (50%), Gaps = 11/207 (5%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ +GF+PDD +  G    ++       +      +++      +  +++   
Sbjct  778  ELSSIQKQLLQGFSPDDAYPLGAPLFMETPRPCSPLAQMGFQAFEEILPLAAMTDEEAFP  837

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E++ +   R   TS S S+  ++++ +LL+S LE A QVA   VS +P+PY  M SQCE 
Sbjct  838  EANGSQSDR--KTSLSISTLDVLSVNELLDSVLETARQVASFSVSPTPIPYDQMKSQCEA  895

Query  558  LGTDTRKKLSNWLAHENHY-TKAAAD------VLLPAIPGNGLLTAKKTIDEDSTLQQGV  400
            L T  ++K+S   + ++   TKA  +      + LP++        K  I E   ++  +
Sbjct  896  LVTGKQQKMSVLHSFKHQQDTKATLEKTEKEVLYLPSVKMEFSEDRKLIIREQGHVRGQL  955

Query  399  MVPREPW--LAIWLPPASPFDNFLRAA  325
             +  + +   +  LPP+SP+D FL+AA
Sbjct  956  ALCSQEFGQHSFRLPPSSPYDKFLKAA  982



>ref|XP_007033971.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033972.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033973.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007033974.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04897.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04898.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04899.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY04900.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=985

 Score = 65.9 bits (159),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/207 (27%), Positives = 103/207 (50%), Gaps = 11/207 (5%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ +GF+PDD +  G    ++       +      +++      +  +++   
Sbjct  779  ELSSIQKQLLQGFSPDDAYPLGAPLFMETPRPCSPLAQMGFQAFEEILPLAAMTDEEAFP  838

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E++ +   R   TS S S+  ++++ +LL+S LE A QVA   VS +P+PY  M SQCE 
Sbjct  839  EANGSQSDR--KTSLSISTLDVLSVNELLDSVLETARQVASFSVSPTPIPYDQMKSQCEA  896

Query  558  LGTDTRKKLSNWLAHENHY-TKAAAD------VLLPAIPGNGLLTAKKTIDEDSTLQQGV  400
            L T  ++K+S   + ++   TKA  +      + LP++        K  I E   ++  +
Sbjct  897  LVTGKQQKMSVLHSFKHQQDTKATLEKTEKEVLYLPSVKMEFSEDRKLIIREQGHVRGQL  956

Query  399  MVPREPW--LAIWLPPASPFDNFLRAA  325
             +  + +   +  LPP+SP+D FL+AA
Sbjct  957  ALCSQEFGQHSFRLPPSSPYDKFLKAA  983



>ref|XP_010241506.1| PREDICTED: uncharacterized protein LOC104586087 isoform X1 [Nelumbo 
nucifera]
Length=998

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 67/218 (31%), Positives = 96/218 (44%), Gaps = 32/218 (15%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ EGF+PDD    G+   ++            SP    DF     A D+ I 
Sbjct  791  ELSAIKKQLLEGFSPDDACPLGVPLFMETPQ-------PCSPLAQIDF----QAFDEIIP  839

Query  738  ESSVTDMTRFMPTSPSPSSSR---------IVNIGQLLES-ALEVAGQVAGTFVSTSPLP  589
             +++TD   F   S S S  +         I+++ QLLES  LE A +VA   VST+P+P
Sbjct  840  PAALTDEEAFPEASGSQSGHKTSVSVNTFDILSVNQLLESQVLETAREVASLPVSTTPIP  899

Query  588  YGAMASQCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTI-DEDSTL  412
            Y  M +QCE L    +KK+S  L+ +N          +    G      K  + D D T 
Sbjct  900  YDQMKNQCEALVIGKQKKMSVLLSFKNQQEDMGIGAEVEK-KGPTFSDMKMELPDVDLTP  958

Query  411  QQGVMVPREPWLAIW---------LPPASPFDNFLRAA  325
                 V R+  L            LPP+SP+D FL+AA
Sbjct  959  MALEKVQRQDKLCCLSEQEQHSFRLPPSSPYDKFLKAA  996



>ref|XP_007033976.1| ARM repeat superfamily protein isoform 6 [Theobroma cacao]
 gb|EOY04902.1| ARM repeat superfamily protein isoform 6 [Theobroma cacao]
Length=780

 Score = 65.5 bits (158),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 55/207 (27%), Positives = 103/207 (50%), Gaps = 11/207 (5%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ +GF+PDD +  G    ++       +      +++      +  +++   
Sbjct  574  ELSSIQKQLLQGFSPDDAYPLGAPLFMETPRPCSPLAQMGFQAFEEILPLAAMTDEEAFP  633

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E++ +   R   TS S S+  ++++ +LL+S LE A QVA   VS +P+PY  M SQCE 
Sbjct  634  EANGSQSDR--KTSLSISTLDVLSVNELLDSVLETARQVASFSVSPTPIPYDQMKSQCEA  691

Query  558  LGTDTRKKLSNWLAHENHY-TKAAAD------VLLPAIPGNGLLTAKKTIDEDSTLQQGV  400
            L T  ++K+S   + ++   TKA  +      + LP++        K  I E   ++  +
Sbjct  692  LVTGKQQKMSVLHSFKHQQDTKATLEKTEKEVLYLPSVKMEFSEDRKLIIREQGHVRGQL  751

Query  399  MVPREPW--LAIWLPPASPFDNFLRAA  325
             +  + +   +  LPP+SP+D FL+AA
Sbjct  752  ALCSQEFGQHSFRLPPSSPYDKFLKAA  778



>ref|XP_006478683.1| PREDICTED: uncharacterized protein LOC102614635 isoform X1 [Citrus 
sinensis]
 ref|XP_006478684.1| PREDICTED: uncharacterized protein LOC102614635 isoform X2 [Citrus 
sinensis]
 ref|XP_006478685.1| PREDICTED: uncharacterized protein LOC102614635 isoform X3 [Citrus 
sinensis]
Length=1000

 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 100/211 (47%), Gaps = 16/211 (8%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  D+ K++  GF+PDD +  G    ++       +   E  ++D      +  +++ + 
Sbjct  791  ELSDMKKQLLLGFSPDDAYPLGGPLFMETPRPCSPLARMEFQAFDEVMPLAALTDEEALP  850

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E + +   R   TS S ++  I+++ +LL+S LE A QVA   V ++P+PY  M SQCE 
Sbjct  851  EPNGSQSDR--KTSLSVNTLDILSVNELLDSVLETARQVASYPVVSTPVPYDQMKSQCEA  908

Query  558  LGTDTRKKLSNWLAHENHYTKAAADV------------LLPAIPGNGLLTAKKTIDEDST  415
            L T  ++K+S   + +      A  V            ++  +   G L    +I+   T
Sbjct  909  LVTGKQQKMSVLQSFKTQQEVKALVVSSEYNQNDPPLPIMEVVVSEGNLRL-PSIERVRT  967

Query  414  LQQGVMVPRE-PWLAIWLPPASPFDNFLRAA  325
              Q  +  +E    +  LPP+SP+D FL+AA
Sbjct  968  KDQLAICSQEYGQYSFRLPPSSPYDKFLKAA  998



>ref|XP_004486921.1| PREDICTED: uncharacterized protein LOC101509978 isoform X2 [Cicer 
arietinum]
Length=792

 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 62/215 (29%), Positives = 101/215 (47%), Gaps = 28/215 (13%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTF-----LFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAE  754
            E   +  ++ +GF+PDD +     LF         H Q+     E P +D        A 
Sbjct  587  ELSSIKNQLLQGFSPDDAYPSGPPLFMETPRQCSPHAQI-----EFPDFDEIM-----AP  636

Query  753  DDKISESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMA  574
            DD + E + +       TS S +   ++ + QLLES LE A QVA    S++ LPY  M 
Sbjct  637  DDMMDEETPSGSQSDRRTSLSINVPDVLGVNQLLESVLETARQVASFSTSSNTLPYDQMK  696

Query  573  SQCETLGTDTRKKLS--NWLAHENHYTKA---AADVLLPAIPGNGLLTAK---KTIDEDS  418
            +QCE L T  ++K+S      H+   TKA   ++++ + + P   L  +K   K + ++ 
Sbjct  697  NQCEALVTGKQQKMSAIQSFKHQEE-TKALILSSEIEVSSQPVKALEYSKGELKLVSQEQ  755

Query  417  TLQQG----VMVPREPWLAIWLPPASPFDNFLRAA  325
               Q     +    +   ++ LPP+SP+D FL+AA
Sbjct  756  FRAQDYTRFLSHDTQQQHSLRLPPSSPYDKFLKAA  790



>ref|XP_008799995.1| PREDICTED: uncharacterized protein LOC103714504 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008800004.1| PREDICTED: uncharacterized protein LOC103714504 isoform X1 [Phoenix 
dactylifera]
Length=1015

 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 94/201 (47%), Gaps = 21/201 (10%)
 Frame = -1

Query  900   KEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAED-DKISESSVT  724
             +++ +GF+PDD F FG+    +  ++      +E  + D +F      ED D ISE+  +
Sbjct  825   EQLLQGFSPDDAFPFGVPLFAETPNLCSPFAQKEFQTLD-EFWPPDVLEDIDPISETCGS  883

Query  723   DMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDT  544
                     S S +   I+ + QL+ES L+ A QVA     T+ +PY  M SQCE L    
Sbjct  884   QSES--RVSESTNDHDILGVNQLMESVLDTARQVADLPFLTTTVPYDKMKSQCEALVMGK  941

Query  543   RKKLSNWLAHENHY--------TKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPR  388
             +KK+S  L+ ++           +   D +LP    +  + + +  D          +  
Sbjct  942   QKKMSVLLSFKHRQEGLETESSKENENDSVLPPESAHCPVESIRCYDS---------IIN  992

Query  387   EPWLAIWLPPASPFDNFLRAA  325
             E   ++ LPP+SP+D FL AA
Sbjct  993   ECEKSVRLPPSSPYDKFLIAA  1013



>ref|XP_010672160.1| PREDICTED: uncharacterized protein LOC104888784 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=894

 Score = 63.9 bits (154),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 67/217 (31%), Positives = 98/217 (45%), Gaps = 30/217 (14%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ +GF+PD+++  G  + + M+  Q       SP    DF +    ED  + 
Sbjct  687  ELSGIKKQLLQGFSPDESYPLG--APLFMETPQPC-----SPLAQLDFQSFDEVEDTTLF  739

Query  738  ESSVTD---MTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQ  568
            + +V D         TS S +S  I+N+ QLLES LE A QVA    STS + Y  +  Q
Sbjct  740  DEAVPDGNGSQSGRKTSTSSNSLDILNVNQLLESVLETAQQVASLPASTSLISYDQVKDQ  799

Query  567  CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKT-------------ID  427
            CE L T   +K+S  L       +A A VL        L TA  T             I 
Sbjct  800  CEALVTGKHQKMS-VLQSFKQQQEAKAIVL---ASDTSLKTAANTDTPMRESEPNLDSIG  855

Query  426  EDSTLQQGVMVP---REPWLAIWLPPASPFDNFLRAA  325
            ++   +   + P      + +  LPPASP+D FL+AA
Sbjct  856  KELIQRHDHLYPCSLEYGYQSFRLPPASPYDKFLKAA  892



>ref|XP_004486920.1| PREDICTED: uncharacterized protein LOC101509978 isoform X1 [Cicer 
arietinum]
Length=944

 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 62/215 (29%), Positives = 101/215 (47%), Gaps = 28/215 (13%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTF-----LFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAE  754
            E   +  ++ +GF+PDD +     LF         H Q+     E P +D        A 
Sbjct  739  ELSSIKNQLLQGFSPDDAYPSGPPLFMETPRQCSPHAQI-----EFPDFDEIM-----AP  788

Query  753  DDKISESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMA  574
            DD + E + +       TS S +   ++ + QLLES LE A QVA    S++ LPY  M 
Sbjct  789  DDMMDEETPSGSQSDRRTSLSINVPDVLGVNQLLESVLETARQVASFSTSSNTLPYDQMK  848

Query  573  SQCETLGTDTRKKLS--NWLAHENHYTKA---AADVLLPAIPGNGLLTAK---KTIDEDS  418
            +QCE L T  ++K+S      H+   TKA   ++++ + + P   L  +K   K + ++ 
Sbjct  849  NQCEALVTGKQQKMSAIQSFKHQEE-TKALILSSEIEVSSQPVKALEYSKGELKLVSQEQ  907

Query  417  TLQQG----VMVPREPWLAIWLPPASPFDNFLRAA  325
               Q     +    +   ++ LPP+SP+D FL+AA
Sbjct  908  FRAQDYTRFLSHDTQQQHSLRLPPSSPYDKFLKAA  942



>ref|XP_008800011.1| PREDICTED: uncharacterized protein LOC103714504 isoform X2 [Phoenix 
dactylifera]
Length=916

 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 57/201 (28%), Positives = 94/201 (47%), Gaps = 21/201 (10%)
 Frame = -1

Query  900  KEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAED-DKISESSVT  724
            +++ +GF+PDD F FG+    +  ++      +E  + D +F      ED D ISE+  +
Sbjct  726  EQLLQGFSPDDAFPFGVPLFAETPNLCSPFAQKEFQTLD-EFWPPDVLEDIDPISETCGS  784

Query  723  DMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDT  544
                    S S +   I+ + QL+ES L+ A QVA     T+ +PY  M SQCE L    
Sbjct  785  QSES--RVSESTNDHDILGVNQLMESVLDTARQVADLPFLTTTVPYDKMKSQCEALVMGK  842

Query  543  RKKLSNWLAHENHY--------TKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPR  388
            +KK+S  L+ ++           +   D +LP    +  + + +  D          +  
Sbjct  843  QKKMSVLLSFKHRQEGLETESSKENENDSVLPPESAHCPVESIRCYDS---------IIN  893

Query  387  EPWLAIWLPPASPFDNFLRAA  325
            E   ++ LPP+SP+D FL AA
Sbjct  894  ECEKSVRLPPSSPYDKFLIAA  914



>ref|XP_006443049.1| hypothetical protein CICLE_v100186801mg, partial [Citrus clementina]
 gb|ESR56289.1| hypothetical protein CICLE_v100186801mg, partial [Citrus clementina]
Length=810

 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 57/213 (27%), Positives = 104/213 (49%), Gaps = 20/213 (9%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  D+ K++  GF+PDD +  G    ++       +   E  ++D      +  +++ + 
Sbjct  601  ELSDMKKQLLLGFSPDDAYPLGGPLFMETPRPCSPLARMEFQAFDEVMPLAALTDEEALP  660

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E + +   R   TS S ++  I+++ +LL+S LE A QVA   V ++P+PY  M SQCE 
Sbjct  661  EPNGSQSDR--KTSLSVNTLDILSVNELLDSVLETARQVASYPVVSTPVPYDQMKSQCEA  718

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVLL---------PAIPGNGLLTAK-----KTIDED  421
            L T  ++K+S     ++  T+     L+         P +P   ++ ++      +I+  
Sbjct  719  LVTGKQQKMS---VLQSFKTQQEVKALVVSSEYNQNDPPLPIMEVVVSEGNLRLPSIERV  775

Query  420  STLQQGVMVPRE-PWLAIWLPPASPFDNFLRAA  325
             T  Q  +  +E    +  LPP+SP+D FL+AA
Sbjct  776  RTKDQLAICSQEYGQYSFRLPPSSPYDKFLKAA  808



>ref|XP_006478686.1| PREDICTED: uncharacterized protein LOC102614635 isoform X4 [Citrus 
sinensis]
Length=892

 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 57/213 (27%), Positives = 104/213 (49%), Gaps = 20/213 (9%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  D+ K++  GF+PDD +  G    ++       +   E  ++D      +  +++ + 
Sbjct  683  ELSDMKKQLLLGFSPDDAYPLGGPLFMETPRPCSPLARMEFQAFDEVMPLAALTDEEALP  742

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E + +   R   TS S ++  I+++ +LL+S LE A QVA   V ++P+PY  M SQCE 
Sbjct  743  EPNGSQSDR--KTSLSVNTLDILSVNELLDSVLETARQVASYPVVSTPVPYDQMKSQCEA  800

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVLL---------PAIPGNGLLTAKK-----TIDED  421
            L T  ++K+S     ++  T+     L+         P +P   ++ ++      +I+  
Sbjct  801  LVTGKQQKMS---VLQSFKTQQEVKALVVSSEYNQNDPPLPIMEVVVSEGNLRLPSIERV  857

Query  420  STLQQGVMVPRE-PWLAIWLPPASPFDNFLRAA  325
             T  Q  +  +E    +  LPP+SP+D FL+AA
Sbjct  858  RTKDQLAICSQEYGQYSFRLPPSSPYDKFLKAA  890



>ref|XP_010672158.1| PREDICTED: uncharacterized protein LOC104888784 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=1002

 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 67/217 (31%), Positives = 98/217 (45%), Gaps = 30/217 (14%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ +GF+PD+++  G  + + M+  Q       SP    DF +    ED  + 
Sbjct  795  ELSGIKKQLLQGFSPDESYPLG--APLFMETPQPC-----SPLAQLDFQSFDEVEDTTLF  847

Query  738  ESSVTD---MTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQ  568
            + +V D         TS S +S  I+N+ QLLES LE A QVA    STS + Y  +  Q
Sbjct  848  DEAVPDGNGSQSGRKTSTSSNSLDILNVNQLLESVLETAQQVASLPASTSLISYDQVKDQ  907

Query  567  CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKT-------------ID  427
            CE L T   +K+S  L       +A A VL        L TA  T             I 
Sbjct  908  CEALVTGKHQKMS-VLQSFKQQQEAKAIVL---ASDTSLKTAANTDTPMRESEPNLDSIG  963

Query  426  EDSTLQQGVMVP---REPWLAIWLPPASPFDNFLRAA  325
            ++   +   + P      + +  LPPASP+D FL+AA
Sbjct  964  KELIQRHDHLYPCSLEYGYQSFRLPPASPYDKFLKAA  1000



>ref|XP_010672159.1| PREDICTED: uncharacterized protein LOC104888784 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=1001

 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 67/217 (31%), Positives = 98/217 (45%), Gaps = 30/217 (14%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ +GF+PD+++  G  + + M+  Q       SP    DF +    ED  + 
Sbjct  794  ELSGIKKQLLQGFSPDESYPLG--APLFMETPQPC-----SPLAQLDFQSFDEVEDTTLF  846

Query  738  ESSVTD---MTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQ  568
            + +V D         TS S +S  I+N+ QLLES LE A QVA    STS + Y  +  Q
Sbjct  847  DEAVPDGNGSQSGRKTSTSSNSLDILNVNQLLESVLETAQQVASLPASTSLISYDQVKDQ  906

Query  567  CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKT-------------ID  427
            CE L T   +K+S  L       +A A VL        L TA  T             I 
Sbjct  907  CEALVTGKHQKMS-VLQSFKQQQEAKAIVL---ASDTSLKTAANTDTPMRESEPNLDSIG  962

Query  426  EDSTLQQGVMVP---REPWLAIWLPPASPFDNFLRAA  325
            ++   +   + P      + +  LPPASP+D FL+AA
Sbjct  963  KELIQRHDHLYPCSLEYGYQSFRLPPASPYDKFLKAA  999



>ref|NP_563755.1| ARM repeat superfamily protein [Arabidopsis thaliana]
 gb|AEE27923.1| ARM repeat superfamily protein [Arabidopsis thaliana]
Length=982

 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 92/223 (41%), Gaps = 40/223 (18%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  +L KE+   F+ DD    G Q   D       ++  E P+++               
Sbjct  773  EQLNLRKEIQSDFSLDDAHSLGGQLFTDTPGPSSPLNQTELPAFE---------------  817

Query  738  ESSVTDMTRFMPTSPSPSSSR---------------IVNIGQLLESALEVAGQVAGTFVS  604
            E  ++D+  F   SP  S S+               ++++ +LLES  E A QVA   VS
Sbjct  818  EVELSDIAAFEGISPGASGSQSGHRTSLSTNTNPVDVLSVNELLESVSETARQVASLPVS  877

Query  603  TSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTKAAA--------DVLLPAIPGNGLL  448
            + P+PY  M +QCE L T  ++K+S   + +   TKA            LL      G  
Sbjct  878  SIPVPYDQMMNQCEALVTGKQQKMSVLRSFKPQATKAITSEDNEKDEQYLLKETEEAGED  937

Query  447  TAKKTI--DEDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
              K  I  D     Q G      P  +  LPP+SP+D FL+AA
Sbjct  938  DEKAIIVADVQPQGQLGFFSQEVPQNSFRLPPSSPYDKFLKAA  980



>gb|AAF80120.1|AC024174_2 Contains similarity to an unknown protein T11A7.7 gi|2335096 
from Arabidopsis thaliana BAC T11A7 gb|AC002339 and contains 
a tropomyosin PF|00261 domain. ESTs gb|AI995205, gb|N37925, 
gb|F13889, gb|AV523107, gb|AV535948, gb|AV558461, gb|F13888 
come from this gene [Arabidopsis thaliana]
Length=1628

 Score = 63.9 bits (154),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 92/223 (41%), Gaps = 40/223 (18%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  +L KE+   F+ DD    G Q   D       ++  E P+++               
Sbjct  780  EQLNLRKEIQSDFSLDDAHSLGGQLFTDTPGPSSPLNQTELPAFE---------------  824

Query  738  ESSVTDMTRFMPTSPSPSSSR---------------IVNIGQLLESALEVAGQVAGTFVS  604
            E  ++D+  F   SP  S S+               ++++ +LLES  E A QVA   VS
Sbjct  825  EVELSDIAAFEGISPGASGSQSGHRTSLSTNTNPVDVLSVNELLESVSETARQVASLPVS  884

Query  603  TSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTKAAA--------DVLLPAIPGNGLL  448
            + P+PY  M +QCE L T  ++K+S   + +   TKA            LL      G  
Sbjct  885  SIPVPYDQMMNQCEALVTGKQQKMSVLRSFKPQATKAITSEDNEKDEQYLLKETEEAGED  944

Query  447  TAKKTI--DEDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
              K  I  D     Q G      P  +  LPP+SP+D FL+AA
Sbjct  945  DEKAIIVADVQPQGQLGFFSQEVPQNSFRLPPSSPYDKFLKAA  987



>ref|NP_001154308.1| ARM repeat superfamily protein [Arabidopsis thaliana]
 gb|AEE27924.1| ARM repeat superfamily protein [Arabidopsis thaliana]
Length=1003

 Score = 63.9 bits (154),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 63/223 (28%), Positives = 92/223 (41%), Gaps = 40/223 (18%)
 Frame = -1

Query  918   ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
             E  +L KE+   F+ DD    G Q   D       ++  E P+++               
Sbjct  794   EQLNLRKEIQSDFSLDDAHSLGGQLFTDTPGPSSPLNQTELPAFE---------------  838

Query  738   ESSVTDMTRFMPTSPSPSSSR---------------IVNIGQLLESALEVAGQVAGTFVS  604
             E  ++D+  F   SP  S S+               ++++ +LLES  E A QVA   VS
Sbjct  839   EVELSDIAAFEGISPGASGSQSGHRTSLSTNTNPVDVLSVNELLESVSETARQVASLPVS  898

Query  603   TSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTKAAA--------DVLLPAIPGNGLL  448
             + P+PY  M +QCE L T  ++K+S   + +   TKA            LL      G  
Sbjct  899   SIPVPYDQMMNQCEALVTGKQQKMSVLRSFKPQATKAITSEDNEKDEQYLLKETEEAGED  958

Query  447   TAKKTI--DEDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
               K  I  D     Q G      P  +  LPP+SP+D FL+AA
Sbjct  959   DEKAIIVADVQPQGQLGFFSQEVPQNSFRLPPSSPYDKFLKAA  1001



>ref|XP_009118564.1| PREDICTED: protein EFR3 homolog [Brassica rapa]
Length=933

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 61/223 (27%), Positives = 96/223 (43%), Gaps = 42/223 (19%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   L KE+   F+ DD    G    +D       ++  E P+++               
Sbjct  726  EQSSLRKEIQSDFSRDDAHPLGAPMFMDTPGPSSPLNQMELPAFE---------------  770

Query  738  ESSVTDMTRFMPTSPSPSSSR------------IVNIGQLLESALEVAGQVAGTFVSTSP  595
            E+ ++++  F   SP  S S             +++I +LLES  E A QVA   VS+ P
Sbjct  771  EAELSEIAAFEEISPGASGSHRTSLSTNTNPVDVLSINELLESVSETARQVASLPVSSLP  830

Query  594  LPYGAMASQCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDST  415
            +PY  M +QCE L T  ++K+S  L+ +   TKA             L   K+T + D  
Sbjct  831  VPYDQMMNQCEALVTGKQQKMSVLLSFKPQATKAI--TFSEEDEKEELFLLKETEEADED  888

Query  414  LQQGVMV----PREPWLAI---------WLPPASPFDNFLRAA  325
             Q+ + V    P+  + +           LPP+SP+D FL+AA
Sbjct  889  DQKALTVTHVQPQGQYASCSLEVEQNSFRLPPSSPYDKFLKAA  931



>ref|XP_006303899.1| hypothetical protein CARUB_v10008206mg [Capsella rubella]
 gb|EOA36797.1| hypothetical protein CARUB_v10008206mg [Capsella rubella]
Length=980

 Score = 63.5 bits (153),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 62/224 (28%), Positives = 91/224 (41%), Gaps = 41/224 (18%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  +L KE+   F  DD    G Q   D       ++  E P+++               
Sbjct  770  EQSNLRKEIQSDFCRDDAHPLGGQLFTDTPGPSSPLNQLEHPAFE---------------  814

Query  738  ESSVTDMTRFMPTSPSPSSSR---------------IVNIGQLLESALEVAGQVAGTFVS  604
            E  ++++  F   SP  S S+               ++++ +LLES  E A QVA   VS
Sbjct  815  EVELSEIVAFEGVSPGASGSQSGHRTSLSANTNPVDVLSVNELLESVSETARQVASLPVS  874

Query  603  TSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTKAAA---------DVLLPAIPGNGL  451
            + P+PY  M +QCE L T  ++K+S   + +   TKA             LL      G 
Sbjct  875  SIPVPYDQMMNQCEALVTGKQQKMSVLRSFKPQATKAITFSEDDEKEEQFLLKETEEAGE  934

Query  450  LTAKKTI--DEDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
               K  I  D     Q G      P  +  LPP+SP+D FL+AA
Sbjct  935  DDQKAMIVADVQPQGQLGFFSHEVPQNSFRLPPSSPYDKFLKAA  978



>ref|XP_006838291.1| PREDICTED: uncharacterized protein LOC18428932 [Amborella trichopoda]
 gb|ERN00860.1| hypothetical protein AMTR_s00103p00108190 [Amborella trichopoda]
Length=1044

 Score = 63.2 bits (152),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 59/223 (26%), Positives = 95/223 (43%), Gaps = 30/223 (13%)
 Frame = -1

Query  918   ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
             E+  + +E+  GF PDD    G Q  +D      L  S+ES ++  +   + +  D++  
Sbjct  825   ESSTIKRELLCGFAPDDVCPLGAQLFMDTPQHSSLFGSKES-TFLAEVTPSVTLTDEEPF  883

Query  738   ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQCE  562
                  D        PS     ++++ QLLES LE A QV    +S SP +P+  + S+CE
Sbjct  884   LEIFGDQAELEDNLPS-KEPHLLSVNQLLESVLETAHQVGSFRISISPEVPFQELTSRCE  942

Query  561   TLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQ---------  409
              L    ++K+S ++   N Y K    +L  + PG+  +  +     D + Q         
Sbjct  943   ALLMGKQEKMSAFM---NSYQKEEILLLPMSSPGDCEVKLQSAWQLDQSFQENRNPFIDH  999

Query  408   ---------------QGVMVPREPWLAIWLPPASPFDNFLRAA  325
                            Q  M    P     LP +SP+DNFL+AA
Sbjct  1000  DFPLNPYGSACNPASQCSMEYHHPTQFFKLPASSPYDNFLKAA  1042



>ref|XP_007150426.1| hypothetical protein PHAVU_005G152600g [Phaseolus vulgaris]
 ref|XP_007150427.1| hypothetical protein PHAVU_005G152600g [Phaseolus vulgaris]
 gb|ESW22420.1| hypothetical protein PHAVU_005G152600g [Phaseolus vulgaris]
 gb|ESW22421.1| hypothetical protein PHAVU_005G152600g [Phaseolus vulgaris]
Length=980

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 63/219 (29%), Positives = 99/219 (45%), Gaps = 35/219 (16%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYD-----GDFLTNSSAE  754
            E   +  ++ + F+ DD +  G  S ++       +   E PS+D     GD +   +  
Sbjct  774  ELSSIKNQLLQSFSSDDAYPLGPLSFMETSRPCSPLALVEFPSFDEIMIPGDLMGEETGP  833

Query  753  DDKISESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMA  574
            +   S+S          TS S +   ++N+ QLL+S LE + QVA    S+SPLPY  M 
Sbjct  834  EHSGSQSD-------HKTSLSTNYPDVLNVNQLLDSVLETSRQVASFSTSSSPLPYDQMK  886

Query  573  SQCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGL----LTAKKTIDEDSTLQQ  406
             QCE L    ++K+S  +    H  +  A +L     GN +    L AK      S L+ 
Sbjct  887  DQCEALVAGKQQKMS-VIQSLKHRQENNAIIL---SSGNEVTVAPLHAKALEYSPSDLK-  941

Query  405  GVMVPREPWLAI------------WLPPASPFDNFLRAA  325
              +V ++ + A+             LPP+SP+D FLRAA
Sbjct  942  --LVTQQSYQALDHSPDYGLQHSLRLPPSSPYDKFLRAA  978



>ref|XP_008790620.1| PREDICTED: uncharacterized protein LOC103707766 isoform X3 [Phoenix 
dactylifera]
Length=1018

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 58/203 (29%), Positives = 102/203 (50%), Gaps = 19/203 (9%)
 Frame = -1

Query  909   DLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSA---EDDKIS  739
             D+ +++ + F+PDD F  G    ++  H        E  S+D   + ++SA   E++ + 
Sbjct  825   DIKEQLLQEFSPDDAFPLGGPLFMETPHPCSPFEQWECQSFD--MVNDASALSDEENLLL  882

Query  738   ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
             ++  +   R   TS S ++  ++++ QL+ES LE A QV    V+++P+PY  M  QCE 
Sbjct  883   DTCGSQSDR--KTSESINAYDVLSVNQLIESVLETARQVTIVPVTSTPVPYDQMKRQCEA  940

Query  558   LGTDTRKKLSNWLAHENHYTKAAADVL----LPAIP-GNGLLTAKKTIDEDSTLQQGVMV  394
             L    ++K+S  L    H  + + D++    L   P G      K+ I    +   G   
Sbjct  941   LVMGKQQKMS-VLQSFKHQQEGSKDLIEENELVHYPEGETKSIGKEQIWGGDSASSG---  996

Query  393   PREPWLAIWLPPASPFDNFLRAA  325
              +E   ++ LPP+SP+D FL+AA
Sbjct  997   SKE---SLRLPPSSPYDKFLKAA  1016



>emb|CDY09999.1| BnaC08g44520D [Brassica napus]
Length=942

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 61/211 (29%), Positives = 99/211 (47%), Gaps = 18/211 (9%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   L KE+   F+ DD    G    +D       ++  E P+++   L+  +A ++ IS
Sbjct  735  EQSSLRKEIQSDFSRDDAHPLGAPLFMDTPGPSSPLNQIELPAFEEAELSEVAAFEE-IS  793

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
              +       + T+ +P    +++I +LLES  E A QVA   VS+ P+PY  M +QCE 
Sbjct  794  PGASGSHRTSLSTNTNPVD--VLSINELLESVSETARQVASLPVSSLPVPYDQMMNQCEA  851

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMV----P  391
            L T  ++K+S  L+ +   TKA             L   K+T + D   Q+ + V    P
Sbjct  852  LVTGKQQKMSVLLSFKPQATKAI--TFSEEDEKEELFLLKETEETDEDDQKALTVAQVQP  909

Query  390  REPWL---------AIWLPPASPFDNFLRAA  325
            +  +          +  LPP+SP+D FL+AA
Sbjct  910  QGQYAFCSLEVEQNSFRLPPSSPYDKFLKAA  940



>ref|XP_010485557.1| PREDICTED: uncharacterized protein LOC104763859 [Camelina sativa]
Length=979

 Score = 62.4 bits (150),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 63/224 (28%), Positives = 91/224 (41%), Gaps = 41/224 (18%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   L KE+   F  DD    G Q   D       ++  E P+++               
Sbjct  769  EQSILRKEIQSEFCRDDAHPLGGQLFTDTPGPSSPLNQIELPAFE---------------  813

Query  738  ESSVTDMTRFMPTSPSPSSSR---------------IVNIGQLLESALEVAGQVAGTFVS  604
            E  ++++  F   SP  S S+               ++++ +LLES  E A QVA   VS
Sbjct  814  EVELSEIAAFEGISPGASGSQSGHRTSLSANTNPVDVLSVNELLESVSETARQVASLPVS  873

Query  603  TSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTKAAA---------DVLLPAIPGNGL  451
            + P+PY  M +QCE L T  ++K+S   + +   TKA A           LL      G 
Sbjct  874  SIPVPYDQMMNQCEALVTGKQQKMSVLRSFKPEATKAIAFSEDEEKEEQFLLKETEEAGE  933

Query  450  LTAKKTIDEDSTLQQ--GVMVPREPWLAIWLPPASPFDNFLRAA  325
               K  I  D   Q   G      P  +  LPP+SP+D FL+AA
Sbjct  934  DDQKAMIVADVQPQDQLGFFSQEVPQNSFRLPPSSPYDKFLKAA  977



>gb|KHN25286.1| Protein EFR3 like B [Glycine soja]
Length=1015

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 100/212 (47%), Gaps = 17/212 (8%)
 Frame = -1

Query  918   ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
             E   + K++ +GF+PDD +  G    ++       +   E P +D      +  +++   
Sbjct  805   ELSSIKKQLVQGFSPDDAYPLGPPLFMETPGKSSPLAQIEFPDFDEIVAPLALMDEETWP  864

Query  738   ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
             +SS +       +S S +S  I+++ QLL+S LE A QVA   +S++P+ Y  M +QCE 
Sbjct  865   KSSGSQSDH--KSSLSSNSPDILSVNQLLQSVLETARQVASFPISSTPVSYDQMKNQCEA  922

Query  558   LGTDTRKKLSNWLAHENHYTKAAADVL-------LPAIPGNGLLTA----KKTIDEDSTL  412
             L T  ++K+S  L    H  +  A VL       +  +P   L  +    K    E    
Sbjct  923   LVTGKQQKMS-ILHSFKHQQETGAIVLSSENEIKVSPLPIKTLEYSEGDLKLVHHEQFQA  981

Query  411   QQGVMVPREPW---LAIWLPPASPFDNFLRAA  325
             Q  V +    +    ++ LPPASPFD FL+AA
Sbjct  982   QYQVRLCSYDFGQQHSLKLPPASPFDKFLKAA  1013



>emb|CDY06190.1| BnaA09g50130D [Brassica napus]
Length=936

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 50/163 (31%), Positives = 77/163 (47%), Gaps = 27/163 (17%)
 Frame = -1

Query  738  ESSVTDMTRFMPTSPSPSSSR------------IVNIGQLLESALEVAGQVAGTFVSTSP  595
            E+ ++++  F   SP  S S             +++I +LLES  E A QVA   VS+ P
Sbjct  774  EAELSEIAAFEEISPGASGSHRTSLSTNTNPVDVLSINELLESVSETARQVASLPVSSLP  833

Query  594  LPYGAMASQCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDST  415
            +PY  M +QCE L T  ++K+S  L+ +   TKA             L   K+T + D  
Sbjct  834  VPYDQMMNQCEALVTGKQQKMSVLLSFKPQATKAI--TFSEEDEKEELFLLKETEEADED  891

Query  414  LQQGVMV----PREPWLAI---------WLPPASPFDNFLRAA  325
             Q+ + V    P+  + +           LPP+SP+D FL+AA
Sbjct  892  DQKALTVTHVQPQGQYASCSLEVEQNSFRLPPSSPYDKFLKAA  934



>ref|XP_011026411.1| PREDICTED: uncharacterized protein LOC105127024 isoform X2 [Populus 
euphratica]
Length=987

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 99/212 (47%), Gaps = 20/212 (9%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + +++ + F+PDD +  G    +D       +   E  +++         +D+  +
Sbjct  780  ELSGIKQQLLQDFSPDDVYPLGAPLFMDTPRPCSPLARMEFQAFEEIMPAADLTDDETFT  839

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E + +   R   TS S  +  I+++ +LLES LE A QVA + VS++P+PY  M SQCE 
Sbjct  840  ELNGSQSGR--KTSISVHTLDILSVNELLESVLETARQVASSQVSSTPVPYDQMKSQCEA  897

Query  558  LGTDTRKKLSNWLAHENHYTKAAA-------------DVLLPAIPGNGLLTAKKTIDEDS  418
            L T  ++K+S  L    H  +A               DV +  +P   L  A K  D+  
Sbjct  898  LVTGKQQKMS-ILHSFKHQPEAKVFPSTDEKKDTSVHDVKV-ELPQCDLTLATK--DQIR  953

Query  417  TLQQGVMVPREPWL-AIWLPPASPFDNFLRAA  325
               Q  +   E    +  LPP+SP+D FL+AA
Sbjct  954  APDQLALCSLEYGQNSFRLPPSSPYDKFLKAA  985



>ref|XP_011026408.1| PREDICTED: uncharacterized protein LOC105127024 isoform X1 [Populus 
euphratica]
 ref|XP_011026409.1| PREDICTED: uncharacterized protein LOC105127024 isoform X1 [Populus 
euphratica]
 ref|XP_011026410.1| PREDICTED: uncharacterized protein LOC105127024 isoform X1 [Populus 
euphratica]
Length=988

 Score = 62.0 bits (149),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 61/212 (29%), Positives = 99/212 (47%), Gaps = 20/212 (9%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + +++ + F+PDD +  G    +D       +   E  +++         +D+  +
Sbjct  781  ELSGIKQQLLQDFSPDDVYPLGAPLFMDTPRPCSPLARMEFQAFEEIMPAADLTDDETFT  840

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E + +   R   TS S  +  I+++ +LLES LE A QVA + VS++P+PY  M SQCE 
Sbjct  841  ELNGSQSGR--KTSISVHTLDILSVNELLESVLETARQVASSQVSSTPVPYDQMKSQCEA  898

Query  558  LGTDTRKKLSNWLAHENHYTKAAA-------------DVLLPAIPGNGLLTAKKTIDEDS  418
            L T  ++K+S  L    H  +A               DV +  +P   L  A K  D+  
Sbjct  899  LVTGKQQKMS-ILHSFKHQPEAKVFPSTDEKKDTSVHDVKV-ELPQCDLTLATK--DQIR  954

Query  417  TLQQGVMVPREPWL-AIWLPPASPFDNFLRAA  325
               Q  +   E    +  LPP+SP+D FL+AA
Sbjct  955  APDQLALCSLEYGQNSFRLPPSSPYDKFLKAA  986



>ref|XP_006592150.1| PREDICTED: uncharacterized protein LOC100799047 isoform X1 [Glycine 
max]
 ref|XP_006592151.1| PREDICTED: uncharacterized protein LOC100799047 isoform X2 [Glycine 
max]
 ref|XP_006592152.1| PREDICTED: uncharacterized protein LOC100799047 isoform X3 [Glycine 
max]
 ref|XP_006592153.1| PREDICTED: uncharacterized protein LOC100799047 isoform X4 [Glycine 
max]
 ref|XP_006592154.1| PREDICTED: uncharacterized protein LOC100799047 isoform X5 [Glycine 
max]
Length=986

 Score = 61.6 bits (148),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 60/212 (28%), Positives = 100/212 (47%), Gaps = 17/212 (8%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ +GF+PDD +  G    ++       +   E P +D      +  +++   
Sbjct  776  ELSSIKKQLVQGFSPDDAYPLGPPLFMETPGKSSPLAQIEFPDFDEIVAPLALMDEETWP  835

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            +SS +       +S S +S  I+++ QL++S LE A QVA   +S++P+ Y  M +QCE 
Sbjct  836  KSSGSQSDH--KSSLSSNSPDILSVNQLIQSVLETARQVASFPISSTPVSYDQMKNQCEA  893

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVL-------LPAIPGNGLLTA----KKTIDEDSTL  412
            L T  ++K+S  L    H  +  A VL       +  +P   L  +    K    E    
Sbjct  894  LVTGKQQKMS-ILHSFKHQQETGAIVLSSENEIKVSPLPIKTLEYSEGDLKLVHHEQFQA  952

Query  411  QQGVMVPREPW---LAIWLPPASPFDNFLRAA  325
            Q  V +    +    ++ LPPASPFD FL+AA
Sbjct  953  QYQVRLCSYDFGQQHSLKLPPASPFDKFLKAA  984



>gb|ACN31508.1| unknown [Zea mays]
 gb|ACR35148.1| unknown [Zea mays]
Length=83

 Score = 57.0 bits (136),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 47/87 (54%), Gaps = 9/87 (10%)
 Frame = -1

Query  579  MASQCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGV  400
            M SQCE LG  TRKKLS+WL + +  T    D  +P++P     TA  +I          
Sbjct  1    MTSQCEALGLGTRKKLSSWLVNGHEST---PDNPMPSLP-----TAHHSIIPKVN-PATF  51

Query  399  MVPREPWLAIWLPPASPFDNFLRAARR  319
                E   A+ LPPASPFDNFL+AA R
Sbjct  52   RTSSESCSAVKLPPASPFDNFLKAAYR  78



>ref|XP_002309810.1| hypothetical protein POPTR_0007s02020g [Populus trichocarpa]
 gb|EEE90260.1| hypothetical protein POPTR_0007s02020g [Populus trichocarpa]
Length=988

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 57/211 (27%), Positives = 98/211 (46%), Gaps = 18/211 (9%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + +++ + F+PDD +  G    +D       +   E  +++      +  +D+  +
Sbjct  781  ELSGIKQQLLQDFSPDDVYPLGGPLFMDTPRPCSPLARMEFQAFEEIMPAAALTDDETFT  840

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E + +   R   TS S  +  I+++ +LLES LE A QVA + VS++P+PY  M SQCE 
Sbjct  841  ELNGSQSGR--KTSISVHTLDILSVNELLESVLETARQVASSQVSSTPVPYDQMKSQCEA  898

Query  558  LGTDTRKKLSNWLAHENHYTKAAA-------------DVLLPAIPGNGLLTAKKTIDEDS  418
            L T  ++K+S  L    H  +A               DV +  +  +  L  +  I    
Sbjct  899  LVTGKQQKMS-ILHSFKHQPEAKVFPSTDEKKDTSVHDVKVELLQCDLTLATRDQIRAPD  957

Query  417  TLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
             L    +   +   +  LPP+SP+D FL+AA
Sbjct  958  QLALCSLEYGQN--SFRLPPSSPYDKFLKAA  986



>ref|XP_010522187.1| PREDICTED: uncharacterized protein LOC104800896 isoform X3 [Tarenaya 
hassleriana]
Length=897

 Score = 61.2 bits (147),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 75/148 (51%), Gaps = 32/148 (22%)
 Frame = -1

Query  702  TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTRKKLSNW  523
            TS S +++ I+++ +LLES  E A  V  + VS++P+PY  M +QCE L T  ++K+S  
Sbjct  758  TSLSTNTADILSVNELLESVTETARHVVSSRVSSTPIPYDQMMNQCEALVTGKQQKMSVL  817

Query  522  LAHENHYTKAAA----------DVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREP---  382
             + +   TKA +          +VL        LL  K+  ++D  ++   +   EP   
Sbjct  818  QSFKLKETKAISILEEDDDKKEEVL--------LLKGKEAAEDD--MKAMALAQVEPCNQ  867

Query  381  ---------WLAIWLPPASPFDNFLRAA  325
                     + +  LPP+SP+D FL+AA
Sbjct  868  HSACGHEMGYNSFRLPPSSPYDKFLKAA  895



>ref|XP_010522184.1| PREDICTED: uncharacterized protein LOC104800896 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010522185.1| PREDICTED: uncharacterized protein LOC104800896 isoform X1 [Tarenaya 
hassleriana]
Length=996

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/148 (30%), Positives = 75/148 (51%), Gaps = 32/148 (22%)
 Frame = -1

Query  702  TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTRKKLSNW  523
            TS S +++ I+++ +LLES  E A  V  + VS++P+PY  M +QCE L T  ++K+S  
Sbjct  857  TSLSTNTADILSVNELLESVTETARHVVSSRVSSTPIPYDQMMNQCEALVTGKQQKMSVL  916

Query  522  LAHENHYTKAAA----------DVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREP---  382
             + +   TKA +          +VL        LL  K+  ++D  ++   +   EP   
Sbjct  917  QSFKLKETKAISILEEDDDKKEEVL--------LLKGKEAAEDD--MKAMALAQVEPCNQ  966

Query  381  ---------WLAIWLPPASPFDNFLRAA  325
                     + +  LPP+SP+D FL+AA
Sbjct  967  HSACGHEMGYNSFRLPPSSPYDKFLKAA  994



>ref|XP_010522186.1| PREDICTED: uncharacterized protein LOC104800896 isoform X2 [Tarenaya 
hassleriana]
Length=995

 Score = 61.2 bits (147),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 71/138 (51%), Gaps = 13/138 (9%)
 Frame = -1

Query  702  TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTRKKLSNW  523
            TS S +++ I+++ +LLES  E A  V  + VS++P+PY  M +QCE L T  ++K+S  
Sbjct  857  TSLSTNTADILSVNELLESVTETARHVVSSRVSSTPIPYDQMMNQCEALVTGKQQKMSVL  916

Query  522  LAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREP------------W  379
             + +   TKA + +         +L  K    ED  ++   +   EP            +
Sbjct  917  QSFKLKETKAISILEEDDDKKEEVLLLKGEAAEDD-MKAMALAQVEPCNQHSACGHEMGY  975

Query  378  LAIWLPPASPFDNFLRAA  325
             +  LPP+SP+D FL+AA
Sbjct  976  NSFRLPPSSPYDKFLKAA  993



>ref|XP_008790621.1| PREDICTED: uncharacterized protein LOC103707766 isoform X4 [Phoenix 
dactylifera]
Length=913

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 103/207 (50%), Gaps = 19/207 (9%)
 Frame = -1

Query  909  DLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSA---EDDKIS  739
            D+ +++ + F+PDD F  G    ++  H        E  S+D   + ++SA   E++ + 
Sbjct  712  DIKEQLLQEFSPDDAFPLGGPLFMETPHPCSPFEQWECQSFD--MVNDASALSDEENLLL  769

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            ++  +   R   TS S ++  ++++ QL+ES LE A QV    V+++P+PY  M  QCE 
Sbjct  770  DTCGSQSDR--KTSESINAYDVLSVNQLIESVLETARQVTIVPVTSTPVPYDQMKRQCEA  827

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAK---------KTIDEDSTLQQ  406
            L    ++K+S  L    H  + + D L+     N L + K         K+I ++  +  
Sbjct  828  LVMGKQQKMS-VLQSFKHQQEGSKD-LIEENEVNSLDSYKLVHYPEGETKSIGKEQ-IWG  884

Query  405  GVMVPREPWLAIWLPPASPFDNFLRAA  325
            G         ++ LPP+SP+D FL+AA
Sbjct  885  GDSASSGSKESLRLPPSSPYDKFLKAA  911



>ref|XP_008790619.1| PREDICTED: uncharacterized protein LOC103707766 isoform X2 [Phoenix 
dactylifera]
Length=1021

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 103/207 (50%), Gaps = 19/207 (9%)
 Frame = -1

Query  909   DLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSA---EDDKIS  739
             D+ +++ + F+PDD F  G    ++  H        E  S+D   + ++SA   E++ + 
Sbjct  820   DIKEQLLQEFSPDDAFPLGGPLFMETPHPCSPFEQWECQSFD--MVNDASALSDEENLLL  877

Query  738   ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
             ++  +   R   TS S ++  ++++ QL+ES LE A QV    V+++P+PY  M  QCE 
Sbjct  878   DTCGSQSDR--KTSESINAYDVLSVNQLIESVLETARQVTIVPVTSTPVPYDQMKRQCEA  935

Query  558   LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAK---------KTIDEDSTLQQ  406
             L    ++K+S  L    H  + + D L+     N L + K         K+I ++  +  
Sbjct  936   LVMGKQQKMS-VLQSFKHQQEGSKD-LIEENEVNSLDSYKLVHYPEGETKSIGKEQ-IWG  992

Query  405   GVMVPREPWLAIWLPPASPFDNFLRAA  325
             G         ++ LPP+SP+D FL+AA
Sbjct  993   GDSASSGSKESLRLPPSSPYDKFLKAA  1019



>ref|XP_008790616.1| PREDICTED: uncharacterized protein LOC103707766 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008790617.1| PREDICTED: uncharacterized protein LOC103707766 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008790618.1| PREDICTED: uncharacterized protein LOC103707766 isoform X1 [Phoenix 
dactylifera]
Length=1026

 Score = 60.8 bits (146),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 58/207 (28%), Positives = 103/207 (50%), Gaps = 19/207 (9%)
 Frame = -1

Query  909   DLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSA---EDDKIS  739
             D+ +++ + F+PDD F  G    ++  H        E  S+D   + ++SA   E++ + 
Sbjct  825   DIKEQLLQEFSPDDAFPLGGPLFMETPHPCSPFEQWECQSFD--MVNDASALSDEENLLL  882

Query  738   ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
             ++  +   R   TS S ++  ++++ QL+ES LE A QV    V+++P+PY  M  QCE 
Sbjct  883   DTCGSQSDR--KTSESINAYDVLSVNQLIESVLETARQVTIVPVTSTPVPYDQMKRQCEA  940

Query  558   LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAK---------KTIDEDSTLQQ  406
             L    ++K+S  L    H  + + D L+     N L + K         K+I ++  +  
Sbjct  941   LVMGKQQKMS-VLQSFKHQQEGSKD-LIEENEVNSLDSYKLVHYPEGETKSIGKEQ-IWG  997

Query  405   GVMVPREPWLAIWLPPASPFDNFLRAA  325
             G         ++ LPP+SP+D FL+AA
Sbjct  998   GDSASSGSKESLRLPPSSPYDKFLKAA  1024



>gb|KDO47318.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
Length=979

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 56/211 (27%), Positives = 99/211 (47%), Gaps = 16/211 (8%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  D+ K++  GF+PDD +  G    ++       +   E  ++D      +  +++ + 
Sbjct  770  ELSDMKKQLLLGFSPDDAYPLGGPLFMETPRPCSPLARMEFQAFDEVMPLAALTDEEALP  829

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E + +   R   TS S ++  I+++ +LL+S LE A QVA   V ++ +PY  M SQCE 
Sbjct  830  EPNGSQSDR--KTSLSVNTLDILSVNELLDSVLETARQVASYPVVSTTVPYDQMKSQCEA  887

Query  558  LGTDTRKKLSNWLAHENHYTKAAADV------------LLPAIPGNGLLTAKKTIDEDST  415
            L T  ++K+S   + +      A  V            ++  +   G L    +I+   T
Sbjct  888  LVTGKQQKMSVLQSFKTQQEVKALVVSSGYNQNDPPLPIMEVVVSEGNLRL-PSIERVRT  946

Query  414  LQQGVMVPRE-PWLAIWLPPASPFDNFLRAA  325
              Q  +  +E    +  LPP+SP+D FL+AA
Sbjct  947  KDQLAICSQEYGQYSFRLPPSSPYDKFLKAA  977



>gb|KDO47320.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
 gb|KDO47321.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
 gb|KDO47322.1| hypothetical protein CISIN_1g001882mg [Citrus sinensis]
Length=1000

 Score = 60.8 bits (146),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 56/211 (27%), Positives = 99/211 (47%), Gaps = 16/211 (8%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  D+ K++  GF+PDD +  G    ++       +   E  ++D      +  +++ + 
Sbjct  791  ELSDMKKQLLLGFSPDDAYPLGGPLFMETPRPCSPLARMEFQAFDEVMPLAALTDEEALP  850

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E + +   R   TS S ++  I+++ +LL+S LE A QVA   V ++ +PY  M SQCE 
Sbjct  851  EPNGSQSDR--KTSLSVNTLDILSVNELLDSVLETARQVASYPVVSTTVPYDQMKSQCEA  908

Query  558  LGTDTRKKLSNWLAHENHYTKAAADV------------LLPAIPGNGLLTAKKTIDEDST  415
            L T  ++K+S   + +      A  V            ++  +   G L    +I+   T
Sbjct  909  LVTGKQQKMSVLQSFKTQQEVKALVVSSGYNQNDPPLPIMEVVVSEGNLRL-PSIERVRT  967

Query  414  LQQGVMVPRE-PWLAIWLPPASPFDNFLRAA  325
              Q  +  +E    +  LPP+SP+D FL+AA
Sbjct  968  KDQLAICSQEYGQYSFRLPPSSPYDKFLKAA  998



>gb|KJB37959.1| hypothetical protein B456_006G228200 [Gossypium raimondii]
Length=963

 Score = 60.5 bits (145),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 62/208 (30%), Positives = 95/208 (46%), Gaps = 30/208 (14%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ EGF+PDD +  G           V +    SP    +F +      D++ 
Sbjct  767  ELSSIKKQLLEGFSPDDAYSLG-----------VPLSRPCSPLAQMEFQSF-----DEMP  810

Query  738  ESSVTDMTRF----MPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMAS  571
             ++VTD           S S S   +++  +LL+SALE A QV    VS +P+PY  M S
Sbjct  811  LAAVTDEANGSQSGRKASLSISKLDVLSANELLDSALETARQVVSFSVSPAPIPYDQMKS  870

Query  570  QCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQ-----Q  406
            QCE      ++K+S  L H  H  +A+A         N +L       E + +Q     Q
Sbjct  871  QCEASVMGKQQKMS-ILHHFKHQQEASAT---SEEIENEILYLPSEKAESNNVQGHISGQ  926

Query  405  GVMVPREPWL-AIWLPPASPFDNFLRAA  325
              +  +E    +  LPP+SP+D FL+AA
Sbjct  927  IALCSQEHMQHSFRLPPSSPYDKFLKAA  954



>gb|KJB37958.1| hypothetical protein B456_006G228200 [Gossypium raimondii]
Length=920

 Score = 60.5 bits (145),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 62/208 (30%), Positives = 95/208 (46%), Gaps = 30/208 (14%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ EGF+PDD +  G           V +    SP    +F +      D++ 
Sbjct  724  ELSSIKKQLLEGFSPDDAYSLG-----------VPLSRPCSPLAQMEFQSF-----DEMP  767

Query  738  ESSVTDMTRF----MPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMAS  571
             ++VTD           S S S   +++  +LL+SALE A QV    VS +P+PY  M S
Sbjct  768  LAAVTDEANGSQSGRKASLSISKLDVLSANELLDSALETARQVVSFSVSPAPIPYDQMKS  827

Query  570  QCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQ-----Q  406
            QCE      ++K+S  L H  H  +A+A         N +L       E + +Q     Q
Sbjct  828  QCEASVMGKQQKMS-ILHHFKHQQEASAT---SEEIENEILYLPSEKAESNNVQGHISGQ  883

Query  405  GVMVPREPWL-AIWLPPASPFDNFLRAA  325
              +  +E    +  LPP+SP+D FL+AA
Sbjct  884  IALCSQEHMQHSFRLPPSSPYDKFLKAA  911



>ref|XP_010557094.1| PREDICTED: uncharacterized protein LOC104826204 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010557095.1| PREDICTED: uncharacterized protein LOC104826204 isoform X1 [Tarenaya 
hassleriana]
Length=986

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 94/210 (45%), Gaps = 12/210 (6%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  +L K++   F+PDD         +        ++  + P+++   L+ + A ++ + 
Sbjct  775  EASNLRKQILSEFSPDDAHPLAAPLYMGTPEHNSPINQTKFPAFEEVELSTTVAYEETLP  834

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E +     R    S    ++ I+ + +LL+S  E A +VA   VS+ P+PY  M SQCE 
Sbjct  835  EVNGCQSERRTSLSTDTYTADILGVNELLKSVSETARKVASFPVSSIPIPYDQMTSQCEA  894

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPW  379
            L T  ++K+S   + +   TKA + +       + LL  +     D  L+   + P +  
Sbjct  895  LVTGKQQKMSVLQSFKLEETKAISSISEDDEEKDELLLLQGMETADDGLKPMTLAPVDTC  954

Query  378  LA------------IWLPPASPFDNFLRAA  325
                            LPP+SP+D FL+AA
Sbjct  955  NQHSTCKLEAGQNNFRLPPSSPYDKFLKAA  984



>ref|XP_010457707.1| PREDICTED: uncharacterized protein LOC104739144 [Camelina sativa]
Length=979

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 62/224 (28%), Positives = 90/224 (40%), Gaps = 41/224 (18%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   L KE+   F  DD    G Q   D       ++  E P+++               
Sbjct  769  EQSILRKEIQSEFCRDDAHPLGGQLFTDTPGPSSPLNQIELPAFE---------------  813

Query  738  ESSVTDMTRFMPTSPSPSSSR---------------IVNIGQLLESALEVAGQVAGTFVS  604
            E  ++++  F   SP  S S+               ++++ +LLES  E A QVA   VS
Sbjct  814  EVELSEIAAFEGISPGASGSQSGHRTSLSANTNPVDVLSVNELLESVSETARQVASLPVS  873

Query  603  TSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTKAAA---------DVLLPAIPGNGL  451
            + P+PY  M +QCE L T  ++K+S   + +   TKA             LL      G 
Sbjct  874  SIPVPYDQMMNQCEALVTGKQQKMSVLRSFKPEATKAITFSEDEEKEEQFLLKETEEAGE  933

Query  450  LTAKKTIDEDSTLQQ--GVMVPREPWLAIWLPPASPFDNFLRAA  325
               K  I  D   Q   G      P  +  LPP+SP+D FL+AA
Sbjct  934  DDQKAMIVADVQPQDQLGFFSQEVPQNSFRLPPSSPYDKFLKAA  977



>ref|XP_006489936.1| PREDICTED: uncharacterized protein LOC102624456 [Citrus sinensis]
Length=1039

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 96/231 (42%), Gaps = 48/231 (21%)
 Frame = -1

Query  918   ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
             E   + +++   F PDD    G Q M + + I  LV S+ S S   +  T  + +DD  +
Sbjct  822   ELSSMKEQLLSEFLPDDLCPLGAQFMDNPNKI-YLVDSKNSKS-QKEIATLFTIDDDAFN  879

Query  738   ES------SVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAM  577
             +S      S  ++ + +P         ++++ QLLES LE   QV    VST+ +PY  M
Sbjct  880   DSYESQDKSNPELAKEIPC--------LLSVNQLLESVLETTHQVGRISVSTADMPYKEM  931

Query  576   ASQCETLGTDTRKKLSNWLA---------------HENHYTKAAADVLLPAIPGNGLLTA  442
             A  CE L    +KK+S+ ++               HEN       +VL   +    L+  
Sbjct  932   AGHCEALLVGKQKKMSHLMSAQLRQESLINFSITNHENEVN----EVLPSQVDAGSLMVG  987

Query  441   KKTIDED------------STLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
                 DE              T Q        P     LP +SP+DNFL+AA
Sbjct  988   NPFTDERITPNSNKPPVGTVTTQCASEYQHHPQY-FRLPASSPYDNFLKAA  1037



>ref|XP_010475319.1| PREDICTED: uncharacterized protein LOC104754751 [Camelina sativa]
Length=979

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 62/224 (28%), Positives = 90/224 (40%), Gaps = 41/224 (18%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   L KE+   F  DD    G Q   D       ++  E P+++               
Sbjct  769  EQSILRKEIQSEFCRDDAHPLGGQLFTDTPGPSSPLNQIELPAFE---------------  813

Query  738  ESSVTDMTRFMPTSPSPSSSR---------------IVNIGQLLESALEVAGQVAGTFVS  604
            E  ++++  F   SP  S S+               ++++ +LLES  E A QVA   VS
Sbjct  814  EVELSEIAAFEGISPGASGSQSGHRTSLSANTNPVDVLSVNELLESVSETARQVASLPVS  873

Query  603  TSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTKAAA---------DVLLPAIPGNGL  451
            + P+PY  M +QCE L T  ++K+S   + +   TKA             LL      G 
Sbjct  874  SIPVPYDQMMNQCEALVTGKQQKMSVLRSFKPEATKAITFSEDEEKEEQFLLKETEEAGE  933

Query  450  LTAKKTIDEDSTLQQ--GVMVPREPWLAIWLPPASPFDNFLRAA  325
               K  I  D   Q   G      P  +  LPP+SP+D FL+AA
Sbjct  934  DDQKAMIVADVQPQDQLGFFSQEVPQNSFRLPPSSPYDKFLKAA  977



>ref|XP_010557096.1| PREDICTED: uncharacterized protein LOC104826204 isoform X2 [Tarenaya 
hassleriana]
Length=961

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 94/210 (45%), Gaps = 12/210 (6%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  +L K++   F+PDD         +        ++  + P+++   L+ + A ++ + 
Sbjct  750  EASNLRKQILSEFSPDDAHPLAAPLYMGTPEHNSPINQTKFPAFEEVELSTTVAYEETLP  809

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E +     R    S    ++ I+ + +LL+S  E A +VA   VS+ P+PY  M SQCE 
Sbjct  810  EVNGCQSERRTSLSTDTYTADILGVNELLKSVSETARKVASFPVSSIPIPYDQMTSQCEA  869

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPW  379
            L T  ++K+S   + +   TKA + +       + LL  +     D  L+   + P +  
Sbjct  870  LVTGKQQKMSVLQSFKLEETKAISSISEDDEEKDELLLLQGMETADDGLKPMTLAPVDTC  929

Query  378  LA------------IWLPPASPFDNFLRAA  325
                            LPP+SP+D FL+AA
Sbjct  930  NQHSTCKLEAGQNNFRLPPSSPYDKFLKAA  959



>ref|XP_010557097.1| PREDICTED: uncharacterized protein LOC104826204 isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010557099.1| PREDICTED: uncharacterized protein LOC104826204 isoform X3 [Tarenaya 
hassleriana]
Length=887

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 53/210 (25%), Positives = 94/210 (45%), Gaps = 12/210 (6%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  +L K++   F+PDD         +        ++  + P+++   L+ + A ++ + 
Sbjct  676  EASNLRKQILSEFSPDDAHPLAAPLYMGTPEHNSPINQTKFPAFEEVELSTTVAYEETLP  735

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E +     R    S    ++ I+ + +LL+S  E A +VA   VS+ P+PY  M SQCE 
Sbjct  736  EVNGCQSERRTSLSTDTYTADILGVNELLKSVSETARKVASFPVSSIPIPYDQMTSQCEA  795

Query  558  LGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPW  379
            L T  ++K+S   + +   TKA + +       + LL  +     D  L+   + P +  
Sbjct  796  LVTGKQQKMSVLQSFKLEETKAISSISEDDEEKDELLLLQGMETADDGLKPMTLAPVDTC  855

Query  378  LA------------IWLPPASPFDNFLRAA  325
                            LPP+SP+D FL+AA
Sbjct  856  NQHSTCKLEAGQNNFRLPPSSPYDKFLKAA  885



>ref|XP_010653791.1| PREDICTED: uncharacterized protein LOC100255472 isoform X2 [Vitis 
vinifera]
Length=993

 Score = 60.1 bits (144),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 56/206 (27%), Positives = 92/206 (45%), Gaps = 29/206 (14%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E+  L +++   F PDD +L+G Q ++D   +     S ESP         S+ +DD   
Sbjct  807  ESSILREQLVHEFLPDDVYLWGTQMLLDATRLDF--KSNESPEEAAAI---SATDDDAFL  861

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQCE  562
            +  + D         S  +  ++ I QLLES LE A +V    VST+P + Y  M+  CE
Sbjct  862  D--LYDSQTKHDLQLSVQNPNLLGINQLLESVLEKAHEVGRFSVSTAPDVSYKEMSGHCE  919

Query  561  TLGTDTRKKLSNWLAHENHYTKA-------AADVLLPAIPGNGLLTAKKTIDEDSTLQQG  403
             L    ++K+SN ++ +    +        AA++  P I    +  A + +      +  
Sbjct  920  ALLMGKQQKMSNLISTQQKQVRNPFSDQNFAANLHKPPIDPAPIHCATEYLHHPHFFK--  977

Query  402  VMVPREPWLAIWLPPASPFDNFLRAA  325
                        LP +SP+DNFL+AA
Sbjct  978  ------------LPASSPYDNFLKAA  991



>ref|XP_009412884.1| PREDICTED: uncharacterized protein LOC103994280 [Musa acuminata 
subsp. malaccensis]
Length=947

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 64/129 (50%), Gaps = 18/129 (14%)
 Frame = -1

Query  675  IVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTRKKLS----------N  526
            ++++ QL+ES +E A QVA    ST P+PY  M SQCE L    ++K+S          +
Sbjct  823  VLSVNQLIESVIETARQVASLPTSTIPVPYDQMKSQCEALVIGKQQKMSVLQNLKHQQED  882

Query  525  W--LAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPWLAIWLPPAS  352
            W  L  EN         +L   P  GL + +K +     +Q+   V  E   +  LP +S
Sbjct  883  WIVLPEENIVDLVDMQKIL-HYPEEGLESVEKEL-----IQRSNSVLGESEQSFRLPSSS  936

Query  351  PFDNFLRAA  325
            PFD FL+AA
Sbjct  937  PFDKFLKAA  945



>ref|XP_006421414.1| hypothetical protein CICLE_v10006843mg [Citrus clementina]
 gb|ESR34654.1| hypothetical protein CICLE_v10006843mg [Citrus clementina]
Length=1027

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 63/231 (27%), Positives = 96/231 (42%), Gaps = 48/231 (21%)
 Frame = -1

Query  918   ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
             E   + +++   F PDD    G Q M + + I  LV S+ S S   +  T  + +DD  +
Sbjct  810   ELSSMKEQLLSEFLPDDLCPLGAQFMDNPNKI-YLVDSKNSKS-QKEIATLFTIDDDAFN  867

Query  738   ES------SVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAM  577
             +S      S  ++ + +P         ++++ QLLES LE   QV    VST+ +PY  M
Sbjct  868   DSYESQDKSNPELAKEIPC--------LLSVNQLLESVLETTHQVGRISVSTADMPYKEM  919

Query  576   ASQCETLGTDTRKKLSNWLA---------------HENHYTKAAADVLLPAIPGNGLLTA  442
             A  CE L    +KK+S+ ++               HEN       +VL   +    L+  
Sbjct  920   AGHCEALLIGKQKKMSHLMSAQLRQESLINFSITNHENEVN----EVLPSQVDAGSLMVD  975

Query  441   KKTIDED------------STLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
                 DE              T Q        P     LP +SP+DNFL+AA
Sbjct  976   NPLTDERITPNSNKPPVGTVTTQCASEYQHHPQY-FRLPASSPYDNFLKAA  1025



>ref|XP_010930207.1| PREDICTED: uncharacterized protein LOC105051451 [Elaeis guineensis]
Length=1016

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 92/192 (48%), Gaps = 3/192 (2%)
 Frame = -1

Query  900   KEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISESSVTD  721
             +++ +GF+PDD F  G     +  +       +E  ++D  +  +   ++D ISE+  + 
Sbjct  826   EQLLQGFSPDDAFPLGFPLFAETPNPCSPFAQKECQTFDELWPPDVLEDEDPISETCGSR  885

Query  720   MTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTR  541
                 +  S S +   I+ + QL+ES L+ A QVA     T P+PY  M SQCE L    +
Sbjct  886   SECRL--SESTNDHDILGVNQLMESVLDTARQVADLPFLTIPVPYDQMKSQCEALVMGKQ  943

Query  540   KKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPWLAIWLP  361
             +K+S  L+ ++    +  +       G+ +L  ++       +Q       E   ++ LP
Sbjct  944   QKMSVLLSFKHQQEGSEMESSKENEYGS-VLPPERVHYPVENIQCYDSTTSEFENSVRLP  1002

Query  360   PASPFDNFLRAA  325
             P+SP+D FL AA
Sbjct  1003  PSSPYDKFLIAA  1014



>gb|KHG30683.1| Protein EFR3 cmp44E [Gossypium arboreum]
Length=964

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 57/204 (28%), Positives = 90/204 (44%), Gaps = 15/204 (7%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E   + K++ EGF+PDD + FG    ++       +   E  +++      +  +D+   
Sbjct  758  ELSSIKKQILEGFSPDDAYPFGAPLFMETPRPCSPLAQMEFQAFEEIMPLAAITDDEAFP  817

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
            E + +   R    S S S+  ++++ +LL+S LE A QVA   VS +P+PY  M SQCE 
Sbjct  818  EGNGSQSGR--KASLSLSTLDVLSVNELLDSVLETARQVASFSVSPTPIPYEQMRSQCEA  875

Query  558  LGTDTRKKLSNWLAHE-NHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREP  382
            L    ++K+S  + H   H  +A A           L   K    ED  L     V    
Sbjct  876  LIIGKQQKMS--VIHSFKHQQEAKATFEENGKEVLCLPNVKVEFSEDLKLISNEQVHARG  933

Query  381  WLAIW----------LPPASPFDN  340
             LA+           LPP+SP+D 
Sbjct  934  QLALCSLEYGQHSFKLPPSSPYDK  957



>ref|XP_012066154.1| PREDICTED: uncharacterized protein LOC105629221 [Jatropha curcas]
 ref|XP_012066155.1| PREDICTED: uncharacterized protein LOC105629221 [Jatropha curcas]
 ref|XP_012066156.1| PREDICTED: uncharacterized protein LOC105629221 [Jatropha curcas]
 gb|KDP42800.1| hypothetical protein JCGZ_23742 [Jatropha curcas]
Length=982

 Score = 58.9 bits (141),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 67/140 (48%), Gaps = 18/140 (13%)
 Frame = -1

Query  702  TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTRKKLSNW  523
            TS S +   I+++  LLES LE A QVA + +S++P+PY  M +QCE L T  ++K+S  
Sbjct  845  TSLSGNVVDILSVNDLLESVLETARQVASSQLSSTPVPYDQMKNQCEALVTGKQQKMSML  904

Query  522  LAHENHYTKAAADVLLPA---IPGNGLLTAKKTIDE-DSTLQQGVMVPREPWLAIW----  367
             + +N         + P+     G       +   + D  L     V     LAI     
Sbjct  905  QSFKNQNDSK----VFPSEDEKKGTSAFIQNEVFSQSDLILSDNNQVQASDQLAICSVEH  960

Query  366  ------LPPASPFDNFLRAA  325
                  LPP+SP+D FL+AA
Sbjct  961  GQSSFRLPPSSPYDKFLKAA  980



>gb|KCW90195.1| hypothetical protein EUGRSUZ_A02368 [Eucalyptus grandis]
Length=1010

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 97/215 (45%), Gaps = 37/215 (17%)
 Frame = -1

Query  882   FTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISESSVTDMTRFMP  703
             F PDD    G QS  D       + SR S S+D   L     EDD  ++S  +  T+ + 
Sbjct  802   FFPDDVCPLGSQSFTDSPSKIYQLESRMSESHDDPPLL--PVEDDAFADSFESQTTQNL-  858

Query  702   TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQCETLGTDTRKKLSN  526
                +     +++I QLLES LE A QV    VST+P +PY  +A  CE L    ++K+SN
Sbjct  859   EDIAVGGPNLLSIDQLLESVLETAHQVGRLSVSTAPDVPYKEVAQHCEALLIGKQQKMSN  918

Query  525   WLA----HE---NHYTKAAADVL----LPA-------IPGNGLLTAKKTIDEDSTLQQ--  406
              ++    HE   N   +   DV+     PA         GN  L      D ++ +Q+  
Sbjct  919   LMSIQQKHESLRNLTLQKNNDVMTGSHFPAEMGTQNHRVGNPFLDN----DHNANMQKPP  974

Query  405   ----GVMVPRE----PWLAIWLPPASPFDNFLRAA  325
                  ++   E    P     LP +SP+DNFL+AA
Sbjct  975   VGTTALLCSTEYQHNPSF-FRLPASSPYDNFLKAA  1008



>ref|XP_010057221.1| PREDICTED: uncharacterized protein LOC104445096 isoform X2 [Eucalyptus 
grandis]
Length=1036

 Score = 57.8 bits (138),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 97/215 (45%), Gaps = 37/215 (17%)
 Frame = -1

Query  882   FTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISESSVTDMTRFMP  703
             F PDD    G QS  D       + SR S S+D   L     EDD  ++S  +  T+ + 
Sbjct  828   FFPDDVCPLGSQSFTDSPSKIYQLESRMSESHDDPPLL--PVEDDAFADSFESQTTQNL-  884

Query  702   TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQCETLGTDTRKKLSN  526
                +     +++I QLLES LE A QV    VST+P +PY  +A  CE L    ++K+SN
Sbjct  885   EDIAVGGPNLLSIDQLLESVLETAHQVGRLSVSTAPDVPYKEVAQHCEALLIGKQQKMSN  944

Query  525   WLA----HE---NHYTKAAADVL----LPA-------IPGNGLLTAKKTIDEDSTLQQ--  406
              ++    HE   N   +   DV+     PA         GN  L      D ++ +Q+  
Sbjct  945   LMSIQQKHESLRNLTLQKNNDVMTGSHFPAEMGTQNHRVGNPFLDN----DHNANMQKPP  1000

Query  405   ----GVMVPRE----PWLAIWLPPASPFDNFLRAA  325
                  ++   E    P     LP +SP+DNFL+AA
Sbjct  1001  VGTTALLCSTEYQHNPSF-FRLPASSPYDNFLKAA  1034



>ref|XP_010057214.1| PREDICTED: uncharacterized protein LOC104445096 isoform X1 [Eucalyptus 
grandis]
Length=1045

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 97/215 (45%), Gaps = 37/215 (17%)
 Frame = -1

Query  882   FTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISESSVTDMTRFMP  703
             F PDD    G QS  D       + SR S S+D   L     EDD  ++S  +  T+ + 
Sbjct  837   FFPDDVCPLGSQSFTDSPSKIYQLESRMSESHDDPPLL--PVEDDAFADSFESQTTQNL-  893

Query  702   TSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQCETLGTDTRKKLSN  526
                +     +++I QLLES LE A QV    VST+P +PY  +A  CE L    ++K+SN
Sbjct  894   EDIAVGGPNLLSIDQLLESVLETAHQVGRLSVSTAPDVPYKEVAQHCEALLIGKQQKMSN  953

Query  525   WLA----HE---NHYTKAAADVL----LPA-------IPGNGLLTAKKTIDEDSTLQQ--  406
              ++    HE   N   +   DV+     PA         GN  L      D ++ +Q+  
Sbjct  954   LMSIQQKHESLRNLTLQKNNDVMTGSHFPAEMGTQNHRVGNPFLDN----DHNANMQKPP  1009

Query  405   ----GVMVPRE----PWLAIWLPPASPFDNFLRAA  325
                  ++   E    P     LP +SP+DNFL+AA
Sbjct  1010  VGTTALLCSTEYQHNPSF-FRLPASSPYDNFLKAA  1043



>ref|XP_010653792.1| PREDICTED: uncharacterized protein LOC100255472 isoform X3 [Vitis 
vinifera]
Length=882

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 60/217 (28%), Positives = 93/217 (43%), Gaps = 27/217 (12%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E+  L +++   F PDD +L+G Q ++D   +     S ESP         S+ +DD   
Sbjct  672  ESSILREQLVHEFLPDDVYLWGTQMLLDATRLDF--KSNESPEEAAAI---SATDDDAFL  726

Query  738  ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQCE  562
            +  + D         S  +  ++ I QLLES LE A +V    VST+P + Y  M+  CE
Sbjct  727  D--LYDSQTKHDLQLSVQNPNLLGINQLLESVLEKAHEVGRFSVSTAPDVSYKEMSGHCE  784

Query  561  TLGTDTRKKLSNWL------------AHENHYTKA------AADVLLPAIPGNGLLTAKK  436
             L    ++K+SN +            + +NH  +A        DV  P    N      K
Sbjct  785  ALLMGKQQKMSNLISTQQKQVSLMNFSSQNHDDEAKKMITHCYDVRNPFSDQNFAANLHK  844

Query  435  TIDEDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
               + + +         P     LP +SP+DNFL+AA
Sbjct  845  PPIDPAPIHCATEYLHHPHF-FKLPASSPYDNFLKAA  880



>ref|XP_002277870.1| PREDICTED: uncharacterized protein LOC100255472 isoform X1 [Vitis 
vinifera]
Length=1017

 Score = 57.4 bits (137),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 60/217 (28%), Positives = 93/217 (43%), Gaps = 27/217 (12%)
 Frame = -1

Query  918   ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
             E+  L +++   F PDD +L+G Q ++D   +     S ESP         S+ +DD   
Sbjct  807   ESSILREQLVHEFLPDDVYLWGTQMLLDATRLDF--KSNESPEEAAAI---SATDDDAFL  861

Query  738   ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQCE  562
             +  + D         S  +  ++ I QLLES LE A +V    VST+P + Y  M+  CE
Sbjct  862   D--LYDSQTKHDLQLSVQNPNLLGINQLLESVLEKAHEVGRFSVSTAPDVSYKEMSGHCE  919

Query  561   TLGTDTRKKLSNWL------------AHENHYTKA------AADVLLPAIPGNGLLTAKK  436
              L    ++K+SN +            + +NH  +A        DV  P    N      K
Sbjct  920   ALLMGKQQKMSNLISTQQKQVSLMNFSSQNHDDEAKKMITHCYDVRNPFSDQNFAANLHK  979

Query  435   TIDEDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
                + + +         P     LP +SP+DNFL+AA
Sbjct  980   PPIDPAPIHCATEYLHHPHF-FKLPASSPYDNFLKAA  1015



>ref|XP_006350206.1| PREDICTED: protein EFR3 homolog B-like isoform X3 [Solanum tuberosum]
Length=969

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 92/219 (42%), Gaps = 33/219 (15%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE   L +E+ + F+PDD+   G Q   D         +++S S D   + +    D   
Sbjct  764  LEVSALREELLKKFSPDDSDSLGTQFFTDAQQ-----RAQQSNSVDLTSIFDDDGPDLFY  818

Query  741  SESSVTDMTRF-MPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQ  568
            S S   + +   +P         ++++ QLLES LE A QV    VST P   Y  MA  
Sbjct  819  SSSKQNEQSAMEIPN--------LLSVNQLLESVLETAHQVGRISVSTEPEFSYKEMAHH  870

Query  567  CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVM-VP  391
            CE L T  ++K+ N L +  H    A   +  +    G  +A     E+    Q V  V 
Sbjct  871  CEALLTGKQQKMYN-LMNSQHRQDNALIEISESSSDQGEESASDNQVENQLADQKVADVS  929

Query  390  REPWL----------------AIWLPPASPFDNFLRAAR  322
             +P                  +  LP +SP+DNFL+AAR
Sbjct  930  DKPTCETVPSHCGAEYQSNPESFRLPASSPYDNFLKAAR  968



>ref|XP_006350204.1| PREDICTED: protein EFR3 homolog B-like isoform X1 [Solanum tuberosum]
Length=1008

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 92/219 (42%), Gaps = 33/219 (15%)
 Frame = -1

Query  921   LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
             LE   L +E+ + F+PDD+   G Q   D         +++S S D   + +    D   
Sbjct  803   LEVSALREELLKKFSPDDSDSLGTQFFTDAQQ-----RAQQSNSVDLTSIFDDDGPDLFY  857

Query  741   SESSVTDMTRF-MPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQ  568
             S S   + +   +P         ++++ QLLES LE A QV    VST P   Y  MA  
Sbjct  858   SSSKQNEQSAMEIPN--------LLSVNQLLESVLETAHQVGRISVSTEPEFSYKEMAHH  909

Query  567   CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVM-VP  391
             CE L T  ++K+ N L +  H    A   +  +    G  +A     E+    Q V  V 
Sbjct  910   CEALLTGKQQKMYN-LMNSQHRQDNALIEISESSSDQGEESASDNQVENQLADQKVADVS  968

Query  390   REPWL----------------AIWLPPASPFDNFLRAAR  322
              +P                  +  LP +SP+DNFL+AAR
Sbjct  969   DKPTCETVPSHCGAEYQSNPESFRLPASSPYDNFLKAAR  1007



>ref|XP_006350205.1| PREDICTED: protein EFR3 homolog B-like isoform X2 [Solanum tuberosum]
Length=974

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 62/219 (28%), Positives = 92/219 (42%), Gaps = 33/219 (15%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKI  742
            LE   L +E+ + F+PDD+   G Q   D         +++S S D   + +    D   
Sbjct  769  LEVSALREELLKKFSPDDSDSLGTQFFTDAQQ-----RAQQSNSVDLTSIFDDDGPDLFY  823

Query  741  SESSVTDMTRF-MPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQ  568
            S S   + +   +P         ++++ QLLES LE A QV    VST P   Y  MA  
Sbjct  824  SSSKQNEQSAMEIPN--------LLSVNQLLESVLETAHQVGRISVSTEPEFSYKEMAHH  875

Query  567  CETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVM-VP  391
            CE L T  ++K+ N L +  H    A   +  +    G  +A     E+    Q V  V 
Sbjct  876  CEALLTGKQQKMYN-LMNSQHRQDNALIEISESSSDQGEESASDNQVENQLADQKVADVS  934

Query  390  REPWL----------------AIWLPPASPFDNFLRAAR  322
             +P                  +  LP +SP+DNFL+AAR
Sbjct  935  DKPTCETVPSHCGAEYQSNPESFRLPASSPYDNFLKAAR  973



>emb|CBI29857.3| unnamed protein product [Vitis vinifera]
Length=1195

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 60/217 (28%), Positives = 93/217 (43%), Gaps = 27/217 (12%)
 Frame = -1

Query  918   ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
             E+  L +++   F PDD +L+G Q ++D   +     S ESP         S+ +DD   
Sbjct  985   ESSILREQLVHEFLPDDVYLWGTQMLLDATRLDF--KSNESPEEAAAI---SATDDDAFL  1039

Query  738   ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQCE  562
             +  + D         S  +  ++ I QLLES LE A +V    VST+P + Y  M+  CE
Sbjct  1040  D--LYDSQTKHDLQLSVQNPNLLGINQLLESVLEKAHEVGRFSVSTAPDVSYKEMSGHCE  1097

Query  561   TLGTDTRKKLSNWL------------AHENHYTKA------AADVLLPAIPGNGLLTAKK  436
              L    ++K+SN +            + +NH  +A        DV  P    N      K
Sbjct  1098  ALLMGKQQKMSNLISTQQKQVSLMNFSSQNHDDEAKKMITHCYDVRNPFSDQNFAANLHK  1157

Query  435   TIDEDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
                + + +         P     LP +SP+DNFL+AA
Sbjct  1158  PPIDPAPIHCATEYLHHPHF-FKLPASSPYDNFLKAA  1193



>ref|XP_004236620.1| PREDICTED: protein EFR3 homolog B isoform X2 [Solanum lycopersicum]
Length=1008

 Score = 57.0 bits (136),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 64/221 (29%), Positives = 92/221 (42%), Gaps = 37/221 (17%)
 Frame = -1

Query  921   LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQV---LVHSRESPSYDGDFLTNSSAED  751
             LE   L +E+ + F+PDD+   G Q   D         LV        DG  L +SS++ 
Sbjct  803   LEVSALREELLKKFSPDDSDSLGTQFFTDAQQRAQQSNLVDLTSIFDDDGPDLFHSSSKQ  862

Query  750   DKISESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMA  574
             ++ S   + ++               +++ QLLES LE A QV    VST P   Y  MA
Sbjct  863   NEQSAMEIPNL---------------LSVNQLLESVLETAHQVGRMSVSTEPEFSYKEMA  907

Query  573   SQCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVM-  397
               CE L T  ++K+ N L +  H    A   +  +    G  +A     E+    Q V  
Sbjct  908   HHCEALLTGKQQKMYN-LMNSQHRQDNALIGISESSSDQGEESASDNQVENQLADQKVAD  966

Query  396   VPREPWLAI----------------WLPPASPFDNFLRAAR  322
             V  +P   I                 LP +SP+DNFL+AAR
Sbjct  967   VSDKPTREIVPSHCGAEYQSNPESFRLPASSPYDNFLKAAR  1007



>gb|EYU20743.1| hypothetical protein MIMGU_mgv1a000711mg [Erythranthe guttata]
Length=1009

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 65/222 (29%), Positives = 95/222 (43%), Gaps = 46/222 (21%)
 Frame = -1

Query  912   DDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDG--DFLTNSSAEDDKIS  739
             + L+KE    F PDD   FG Q   D       +   ++ S  G  DF    S +D   +
Sbjct  806   EQLLKE----FAPDDLCSFGGQMFNDSPEEAHHMSLEKAVSICGIDDF----SHQDS--N  855

Query  738   ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQCE  562
             ESS    +R     P+     ++++ QLL+S LE A  V    VS +P   Y  MA+ CE
Sbjct  856   ESSFPHNSRLTIEFPN-----LLSVDQLLQSVLETAHHVGRMSVSNAPDASYKEMANHCE  910

Query  561   TLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTID------EDSTLQQGV  400
             TL    ++K+S  +      T      +L   P N   T K+ +       + +T  QG 
Sbjct  911   TLLMGKQQKMSYLIN-----THPRQGSMLTISPQNSYETEKQNLPSHVVGLQKNTTTQGG  965

Query  399   MVPREPW-----------------LAIWLPPASPFDNFLRAA  325
             +VP  P                  L+  LP +SP+DNFL+AA
Sbjct  966   VVPNRPSSGGPTPSQCGAEYQHHPLSFRLPASSPYDNFLKAA  1007



>ref|XP_010666756.1| PREDICTED: uncharacterized protein LOC104883885 [Beta vulgaris 
subsp. vulgaris]
Length=1011

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 64/224 (29%), Positives = 99/224 (44%), Gaps = 50/224 (22%)
 Frame = -1

Query  903   VKE--MSEGFTPDDTFLFGLQ------SMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDD  748
             VKE  +SE F PDD    G Q       + ++D  Q +      P +  D   + S  D+
Sbjct  805   VKEQLLSE-FLPDDVCPLGAQMFESPSKIYELDARQSVCQDETMPLFTLD---DDSLPDN  860

Query  747   KISESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMAS  571
             +  + S+  +           ++ ++++ QLLES L+ A QV    VST+P LPY  MAS
Sbjct  861   QPKQESLLTI----------ENANLLSVNQLLESVLDTAHQVGRFSVSTAPDLPYKEMAS  910

Query  570   QCETLGTDTRKKLSNWLA---HENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGV  400
              CE L    ++K+S+ +     EN ++    ++ L   P     T  +++  +  L   V
Sbjct  911   HCEALLMGKQQKMSHLMTAQRQENLFSFCVQNIDLE--PDK---TVPQSLGGNPFLDDNV  965

Query  399   MVPR---------EPWLA----------IWLPPASPFDNFLRAA  325
             MVP           P L             LP  SP+DNFL+AA
Sbjct  966   MVPTFKALPPAHPAPMLCATEYQQQPQHYKLPALSPYDNFLKAA  1009



>ref|XP_006417969.1| hypothetical protein EUTSA_v10006704mg [Eutrema salsugineum]
 gb|ESQ36322.1| hypothetical protein EUTSA_v10006704mg [Eutrema salsugineum]
Length=965

 Score = 55.8 bits (133),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 59/227 (26%), Positives = 93/227 (41%), Gaps = 47/227 (21%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  +L KE+   F+ DD    G    +D       ++  E P+++               
Sbjct  755  EQSNLRKEIQSDFSRDDAHPLGAPLFMDTPGPGSPLNQIELPAFE---------------  799

Query  738  ESSVTDMTRFMPTSPSPSSSR---------------IVNIGQLLESALEVAGQVAGTFVS  604
            E  ++++  F   SP  S S+               ++++ +LLES  E A QVA   VS
Sbjct  800  EVELSEIAAFEGISPGASGSQSGHRTSLSTNTNPLDVLSVNELLESVSETARQVASLPVS  859

Query  603  TSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDE  424
            + P+PY  M +QCE L T  +KK+S   + +   TKA   +          L   K  +E
Sbjct  860  SIPVPYDQMMNQCEALVTGKQKKMSVLQSFKPQATKA---ITFSEEDEKEELFLLKETEE  916

Query  423  DSTLQQGVMVPRE--------------PWLAIWLPPASPFDNFLRAA  325
             S   +  M+  E                 +  LPP+SP+D FL+AA
Sbjct  917  ASEDDEKAMIVAEVQPQGQFGFCSHEVEHNSFRLPPSSPYDKFLKAA  963



>emb|CDY54108.1| BnaC04g53870D [Brassica napus]
Length=290

 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 58/95 (61%), Gaps = 8/95 (8%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESP-SYDGDFLTNSSAEDDK  745
            LE  D+  ++SE FTPDD F+FG + +V+ +  Q +  S+ES  S+D D    S  ED+ 
Sbjct  190  LEETDVRMQLSEPFTPDDDFMFGSRPIVEPEPNQSI--SKESSLSFDEDVNAGSMVEDEA  247

Query  744  ISESSVTDMTRFMPT-SPSPSSSRIVNIGQLLESA  643
             SE SV    RF P  S SPS  ++++I QL+ESA
Sbjct  248  TSELSV----RFHPRGSSSPSIPQLISIDQLMESA  278



>ref|XP_009610949.1| PREDICTED: protein EFR3 homolog B isoform X4 [Nicotiana tomentosiformis]
Length=1008

 Score = 55.5 bits (132),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/212 (25%), Positives = 91/212 (43%), Gaps = 35/212 (17%)
 Frame = -1

Query  900   KEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSY---DGDFLTNSSAEDDKISESS  730
             +E+ + F+PDD+   G Q + D  H     +S +  S    DG  L+ SS++ ++ S   
Sbjct  810   EELLKEFSPDDSDSLGSQFLADAQHRVQQSNSVDLSSILDDDGPDLSQSSSKQNEQSAME  869

Query  729   VTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQCETLG  553
             + ++               +++ QLLES LE A QV    +S  P   Y  M   CETL 
Sbjct  870   IPNL---------------LSVNQLLESVLETAHQVGRISLSNEPDFSYKEMTHHCETLL  914

Query  552   TDTRKKLSNWLAHENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREP---  382
             T  ++++ N +  ++    A   +   +   +   ++   +      Q+   V ++P   
Sbjct  915   TGKQQRMYNLMNSQHRQDSALIRISQNSSEQDKESSSHNQVKNQLVDQKAANVSQKPSPG  974

Query  381   ---WLA----------IWLPPASPFDNFLRAA  325
                W              LP +SP+DNFL+AA
Sbjct  975   TVDWHCGAQCQSNPETFRLPASSPYDNFLKAA  1006



>ref|XP_010907682.1| PREDICTED: uncharacterized protein LOC105034293 isoform X2 [Elaeis 
guineensis]
Length=1021

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 54/211 (26%), Positives = 95/211 (45%), Gaps = 27/211 (13%)
 Frame = -1

Query  909   DLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSS---AEDDKIS  739
             D+ +++ + F+PDD F  G    ++  H    +   E  S+D   + N +   ++D+ + 
Sbjct  820   DIKEQLLQEFSPDDAFPLGGPLFMETPHPCSPLEQMECQSFD---MVNDAPGLSDDENLP  876

Query  738   ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
               +    +    TS S  +  I+++ QL+ES +E A QV    V+++P+PY  M  QCE 
Sbjct  877   LDTCGSQSD-RKTSESVHACDILSVNQLIESVVETARQVTTLPVASNPVPYDQMKRQCEA  935

Query  558   LGTDTRKKLSNWLAHENHYTKAAADVL------------LPAIPGNGLLT-AKKTIDEDS  418
             L    ++K+S  L    H  +   D +            L   P     +  K+ I    
Sbjct  936   LVMGKQQKMS-VLQSFKHQQEGLKDQIEENEVNSWDCYQLVHCPNEETRSIGKEQIRRCD  994

Query  417   TLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
             ++  G         +  LPP+SP+D FL+AA
Sbjct  995   SVSSG------SEQSFRLPPSSPYDKFLQAA  1019



>ref|XP_010907681.1| PREDICTED: uncharacterized protein LOC105034293 isoform X1 [Elaeis 
guineensis]
Length=1023

 Score = 55.1 bits (131),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 54/211 (26%), Positives = 95/211 (45%), Gaps = 27/211 (13%)
 Frame = -1

Query  909   DLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSS---AEDDKIS  739
             D+ +++ + F+PDD F  G    ++  H    +   E  S+D   + N +   ++D+ + 
Sbjct  822   DIKEQLLQEFSPDDAFPLGGPLFMETPHPCSPLEQMECQSFD---MVNDAPGLSDDENLP  878

Query  738   ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCET  559
               +    +    TS S  +  I+++ QL+ES +E A QV    V+++P+PY  M  QCE 
Sbjct  879   LDTCGSQSD-RKTSESVHACDILSVNQLIESVVETARQVTTLPVASNPVPYDQMKRQCEA  937

Query  558   LGTDTRKKLSNWLAHENHYTKAAADVL------------LPAIPGNGLLT-AKKTIDEDS  418
             L    ++K+S  L    H  +   D +            L   P     +  K+ I    
Sbjct  938   LVMGKQQKMS-VLQSFKHQQEGLKDQIEENEVNSWDCYQLVHCPNEETRSIGKEQIRRCD  996

Query  417   TLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
             ++  G         +  LPP+SP+D FL+AA
Sbjct  997   SVSSG------SEQSFRLPPSSPYDKFLQAA  1021



>ref|XP_009355500.1| PREDICTED: uncharacterized protein LOC103946512 [Pyrus x bretschneideri]
 ref|XP_009355501.1| PREDICTED: uncharacterized protein LOC103946512 [Pyrus x bretschneideri]
Length=1036

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 67/224 (30%), Positives = 95/224 (42%), Gaps = 32/224 (14%)
 Frame = -1

Query  918   ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
             E   + +E+   F PDD    G Q  +D       V SR+S S   D     S +DD   
Sbjct  817   EMSTIREELLSEFLPDDVCPLGAQLCMDAPQKLYQVDSRDSKSMKEDAPI-FSLDDDSFQ  875

Query  738   ES--SVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQ  568
              S  S  +   F     S  S  ++++ QL+ES LE A QV    VS +P +PY  MA  
Sbjct  876   GSFDSQKNNLDF-----SAESHNLLSVSQLIESVLETAHQVGRVSVSNAPDVPYKEMAGH  930

Query  567   CETLGTDTRKKLSNWL------------AHENHYTKA---AADVLL---PAIPGNGLL--  448
             CE L    ++K+SN +            + +NH   A    +D L+       GN  +  
Sbjct  931   CEALLLGKQQKMSNLMSSQPKQEYLMNQSFQNHSDDAKWMTSDFLVGFGSHRSGNPFVDD  990

Query  447   TAKKTIDEDSTLQQGVMVPREPW---LAIWLPPASPFDNFLRAA  325
             TA       S     +M   E      +  LP +SP+DNFL+AA
Sbjct  991   TANSYKPSPSAGHAPMMCVTEYQHHPHSFRLPASSPYDNFLKAA  1034



>ref|XP_010907683.1| PREDICTED: uncharacterized protein LOC105034293 isoform X3 [Elaeis 
guineensis]
Length=1011

 Score = 55.1 bits (131),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 53/208 (25%), Positives = 92/208 (44%), Gaps = 21/208 (10%)
 Frame = -1

Query  909   DLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKISESS  730
             D+ +++ + F+PDD F  G    ++  H    +   E  S+D        ++D+ +   +
Sbjct  810   DIKEQLLQEFSPDDAFPLGGPLFMETPHPCSPLEQMECQSFDMVNDAPGLSDDENLPLDT  869

Query  729   VTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGT  550
                 +    TS S  +  I+++ QL+ES +E A QV    V+++P+PY  M  QCE L  
Sbjct  870   CGSQSD-RKTSESVHACDILSVNQLIESVVETARQVTTLPVASNPVPYDQMKRQCEALVM  928

Query  549   DTRKKLSNWLAHENHYTKAAADVL------------LPAIPGNGLLT-AKKTIDEDSTLQ  409
               ++K+S  L    H  +   D +            L   P     +  K+ I    ++ 
Sbjct  929   GKQQKMS-VLQSFKHQQEGLKDQIEENEVNSWDCYQLVHCPNEETRSIGKEQIRRCDSVS  987

Query  408   QGVMVPREPWLAIWLPPASPFDNFLRAA  325
              G         +  LPP+SP+D FL+AA
Sbjct  988   SG------SEQSFRLPPSSPYDKFLQAA  1009



>ref|XP_008798151.1| PREDICTED: uncharacterized protein LOC103713119 [Phoenix dactylifera]
Length=1043

 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 58/218 (27%), Positives = 98/218 (45%), Gaps = 42/218 (19%)
 Frame = -1

Query  900   KEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNS-SAEDDKISESSVT  724
             K++   F PDD    G Q +             E+P     F +   +++++ I  +S+ 
Sbjct  840   KQLLSDFLPDDVCPLGAQFV-------------EAPGQVPPFGSKKDNSQEEVIPPTSLI  886

Query  723   DMTRFMP-----TSPSPS----SSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMA  574
             D+  F         PSP     +S ++++ QLL++ LE + QV    VST+P +P+  MA
Sbjct  887   DVDIFTEAFEGLVDPSPQLPSDTSNLLSVNQLLDTVLETSLQVGRFSVSTTPDVPFKEMA  946

Query  573   SQCETLGTDTRKKLSNWLA-------------HENHYTKAAADVLLPAIP--GNGLLTAK  439
             S CE L    ++K+S +++             H+    K ++ +L+  +    N  L   
Sbjct  947   SHCEALMMGKQQKMSAFMSAQQKQELLFPDLLHDQGDMKGSSYLLMDQLQKTSNPFLDPN  1006

Query  438   KTIDEDSTLQQGVMVPREPWLAIWLPPASPFDNFLRAA  325
              +   D+ L Q        +    LP +SPFDNFLRAA
Sbjct  1007  SSACGDNILLQNDFQSHPQF---KLPASSPFDNFLRAA  1041



>ref|XP_007028781.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY09283.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=1023

 Score = 54.7 bits (130),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 57/203 (28%), Positives = 87/203 (43%), Gaps = 27/203 (13%)
 Frame = -1

Query  882   FTPDDTFLFGLQSMVDMDH--IQVLVHSRESPSYDGDFLTNSSAEDDKISESSVTDMTRF  709
             F PDD    G+Q  +D  H   QV V   +S   +    +  +    +  E    D +  
Sbjct  829   FLPDDVCPLGVQLPMDAPHKVYQVDVGDNKSIKEEAPIFSTDNYAFPEPFEGQTKDNSEL  888

Query  708   MPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQCETLGTDTRKKL  532
                 P+     ++++ QLLES LE A Q   + +ST P + Y  MA  CE L T  +KK+
Sbjct  889   PVEIPN-----LLDVNQLLESVLETAHQFGRSSISTGPDMSYKEMAHHCEALLTGKQKKM  943

Query  531   SNWLA--------------HENHYTKAAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMV  394
             S+ ++              H ++ TK A  VL      N    +  T+     +      
Sbjct  944   SDLMSAQLRQESLISLSFQHPDNETKQAGPVLEQTGSPNPYKQSVGTL----PMLCATEY  999

Query  393   PREPWLAIWLPPASPFDNFLRAA  325
                P L+  LP +SP+DNFL+AA
Sbjct  1000  QNHP-LSFRLPASSPYDNFLKAA  1021



>ref|XP_009379627.1| PREDICTED: uncharacterized protein LOC103968023 isoform X1 [Pyrus 
x bretschneideri]
Length=1040

 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 95/223 (43%), Gaps = 30/223 (13%)
 Frame = -1

Query  918   ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
             E   + +E+   F PDD    G Q  +D       V SR+S S   D     S +DD   
Sbjct  821   ELSTIREELLSEFLPDDVCPLGAQFCMDAPQKLYQVDSRDSKSMKEDAPI-FSLDDDSFP  879

Query  738   ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQCE  562
              S  +       ++ SP+   ++++ Q +ES LE A QV    VS +P +PY  MA  CE
Sbjct  880   GSFDSQKNNLDFSADSPN---LLSVNQFIESVLETAHQVGRPSVSNAPDVPYKEMARHCE  936

Query  561   TLGTDTRKKLSNWLAH------------ENHYTKAA-------ADVLLPAIPGNGLL--T  445
              L    ++K+SN ++             +NH   A        AD       GN  +  T
Sbjct  937   ALLMGKQQKMSNLMSSQQKQEYLMNQSLQNHNDDAKWITSGFHAD-FGSYRSGNPFVDDT  995

Query  444   AKKTIDEDSTLQQGVMVPREPW---LAIWLPPASPFDNFLRAA  325
             A       +T +  VM   E      +  LP +SP+DNFL+AA
Sbjct  996   ATSYNPPPTTGRASVMCVNEYQHHPHSFRLPASSPYDNFLKAA  1038



>ref|XP_009379628.1| PREDICTED: uncharacterized protein LOC103968023 isoform X2 [Pyrus 
x bretschneideri]
Length=1036

 Score = 54.3 bits (129),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 65/223 (29%), Positives = 95/223 (43%), Gaps = 30/223 (13%)
 Frame = -1

Query  918   ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
             E   + +E+   F PDD    G Q  +D       V SR+S S   D     S +DD   
Sbjct  817   ELSTIREELLSEFLPDDVCPLGAQFCMDAPQKLYQVDSRDSKSMKEDAPI-FSLDDDSFP  875

Query  738   ESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMASQCE  562
              S  +       ++ SP+   ++++ Q +ES LE A QV    VS +P +PY  MA  CE
Sbjct  876   GSFDSQKNNLDFSADSPN---LLSVNQFIESVLETAHQVGRPSVSNAPDVPYKEMARHCE  932

Query  561   TLGTDTRKKLSNWLAH------------ENHYTKAA-------ADVLLPAIPGNGLL--T  445
              L    ++K+SN ++             +NH   A        AD       GN  +  T
Sbjct  933   ALLMGKQQKMSNLMSSQQKQEYLMNQSLQNHNDDAKWITSGFHAD-FGSYRSGNPFVDDT  991

Query  444   AKKTIDEDSTLQQGVMVPREPW---LAIWLPPASPFDNFLRAA  325
             A       +T +  VM   E      +  LP +SP+DNFL+AA
Sbjct  992   ATSYNPPPTTGRASVMCVNEYQHHPHSFRLPASSPYDNFLKAA  1034



>emb|CDY63789.1| BnaA08g31700D [Brassica napus]
Length=928

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 67/131 (51%), Gaps = 17/131 (13%)
 Frame = -1

Query  675  IVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTK  496
            ++++ +LLES  E A QVA   VS+ P+PY  M +QCE L T  ++K+S   + +   TK
Sbjct  799  VLSVNELLESVSETARQVASLPVSSLPVPYDQMMNQCEALMTGKQQKMSVLKSFKPEATK  858

Query  495  AAADVLLPA-IPGNGLLTAKKTIDEDSTLQQGVMVPR---EPWLA----------IWLPP  358
            A   +  P       +   K+T + +   Q+ + V +   +  LA            LPP
Sbjct  859  A---ITFPEDAEEEEVFLLKETEEANEDDQKALTVSQVQPQGQLASCSHGVEQNSFRLPP  915

Query  357  ASPFDNFLRAA  325
            +SP+D FL+AA
Sbjct  916  SSPYDEFLKAA  926



>gb|KJB81105.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=847

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYD  784
            L  DDL K++ E FTPDD F F  QS+ D+DH Q++ HS+ES S+D
Sbjct  798  LGMDDLRKQLLEPFTPDDAFTFVPQSIFDLDHHQMITHSKESLSFD  843



>gb|KJB81106.1| hypothetical protein B456_013G129500 [Gossypium raimondii]
Length=870

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYD  784
            L  DDL K++ E FTPDD F F  QS+ D+DH Q++ HS+ES S+D
Sbjct  798  LGMDDLRKQLLEPFTPDDAFTFVPQSIFDLDHHQMITHSKESLSFD  843



>ref|XP_011048039.1| PREDICTED: uncharacterized protein LOC105142218 [Populus euphratica]
Length=1022

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/213 (26%), Positives = 90/213 (42%), Gaps = 37/213 (17%)
 Frame = -1

Query  900   KEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGD--------FLTNSSAEDDK  745
             +++ + F PDD    G Q  +D  +    V+S+++   +G         FL +S  +  +
Sbjct  824   EKLLDEFLPDDVCPLGAQLFMDTPNQIDQVNSKDNSLVEGTPLFTVDDVFLDSSEGQTTQ  883

Query  744   ISESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQC  565
              +E    D             + ++++ QLLES LE   QV    V+   + Y  MA  C
Sbjct  884   TTEIVFCD-------------ANLLSVNQLLESVLETTHQVGRLSVTAPDVSYKEMAHHC  930

Query  564   ETLGTDTRKKLSNWLAHE-----------NHYTKAAADVLLPAIPGNGLLTAKKTIDEDS  418
             ETL    ++K+S+ ++ +             Y         P +  N  L A   I    
Sbjct  931   ETLQMGKQQKMSHVMSVQLRQESLMNVPFQKYDDKVRKATNPFLDQN--LIASPQIPPIG  988

Query  417   TLQQGVMV--PREPWLAIWLPPASPFDNFLRAA  325
             T+Q   +    R+P     LP +SPFDNFL+AA
Sbjct  989   TVQMQCVTEYQRQPNF-FRLPASSPFDNFLKAA  1020



>ref|XP_009119100.1| PREDICTED: uncharacterized protein LOC103844080 [Brassica rapa]
Length=913

 Score = 53.9 bits (128),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/129 (31%), Positives = 61/129 (47%), Gaps = 16/129 (12%)
 Frame = -1

Query  675  IVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTK  496
            ++++ +LLES  E A QVA   VS+ P+PY  M +QCE L T   +K+S   + +   TK
Sbjct  787  VLSVNELLESVSETARQVASLPVSSIPVPYDQMMNQCEALVTGKHQKMSVLRSFKPEATK  846

Query  495  AAA-----DVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPWLAI-------WLPPAS  352
            A       ++ L            K +       QG +    P+ A+        LP +S
Sbjct  847  AVTLSEEDELFLLDETEEADEDDHKALTVAQVQPQGQL----PFCALEVEQNSFRLPSSS  902

Query  351  PFDNFLRAA  325
            P+D FL+AA
Sbjct  903  PYDEFLKAA  911



>ref|XP_010319193.1| PREDICTED: protein EFR3 homolog B isoform X3 [Solanum lycopersicum]
Length=973

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 62/225 (28%), Positives = 92/225 (41%), Gaps = 41/225 (18%)
 Frame = -1

Query  921  LETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQV---LVHSRESPSYDGDFLTNSSAED  751
            LE   L +E+ + F+PDD+   G Q   D         LV        DG  L +SS++ 
Sbjct  764  LEVSALREELLKKFSPDDSDSLGTQFFTDAQQRAQQSNLVDLTSIFDDDGPDLFHSSSKQ  823

Query  750  DKISESSVTDMTRFMPTSPSPSSSRIVNIGQLLESALEVAGQVAGTFVSTSP-LPYGAMA  574
            ++ S   + ++               +++ QLLES LE A QV    VST P   Y  MA
Sbjct  824  NEQSAMEIPNL---------------LSVNQLLESVLETAHQVGRMSVSTEPEFSYKEMA  868

Query  573  SQCETLGTDTRKKLSNWLAHENHYTKA---------------AADVLLPAIPGNGLLTAK  439
              CE L T  ++K+ N +  ++    A               A+D  +     N L   K
Sbjct  869  HHCEALLTGKQQKMYNLMNSQHRQDNALIGISESSSDQGEESASDNQVDNQVENQLADQK  928

Query  438  KTIDEDSTLQQ------GVMVPREPWLAIWLPPASPFDNFLRAAR  322
                 D   ++      G      P  +  LP +SP+DNFL+AAR
Sbjct  929  VADVSDKPTREIVPSHCGAEYQSNPE-SFRLPASSPYDNFLKAAR  972



>ref|XP_009111018.1| PREDICTED: protein EFR3 homolog isoform X3 [Brassica rapa]
Length=920

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 62/128 (48%), Gaps = 11/128 (9%)
 Frame = -1

Query  675  IVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTK  496
            ++++ +LLES  E A QVA   VS+ P+PY  M +QCE L T  ++K+S   + +   TK
Sbjct  791  VLSVNELLESVSETARQVASLPVSSLPVPYDQMMNQCEALMTGKQQKMSVLKSFKPEATK  850

Query  495  AAA--------DVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPWL---AIWLPPASP  349
            A          +V L           +K +       QG +      +   +  LPP+SP
Sbjct  851  AITFSEDAEEEEVFLLKETEEANEDDQKALTVSQVQPQGQLASCSHGVEQDSFRLPPSSP  910

Query  348  FDNFLRAA  325
            +D FL+AA
Sbjct  911  YDEFLKAA  918



>ref|XP_009111017.1| PREDICTED: protein EFR3 homolog isoform X2 [Brassica rapa]
Length=821

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 62/128 (48%), Gaps = 11/128 (9%)
 Frame = -1

Query  675  IVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTK  496
            ++++ +LLES  E A QVA   VS+ P+PY  M +QCE L T  ++K+S   + +   TK
Sbjct  692  VLSVNELLESVSETARQVASLPVSSLPVPYDQMMNQCEALMTGKQQKMSVLKSFKPEATK  751

Query  495  AAA--------DVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPWL---AIWLPPASP  349
            A          +V L           +K +       QG +      +   +  LPP+SP
Sbjct  752  AITFSEDAEEEEVFLLKETEEANEDDQKALTVSQVQPQGQLASCSHGVEQDSFRLPPSSP  811

Query  348  FDNFLRAA  325
            +D FL+AA
Sbjct  812  YDEFLKAA  819



>ref|XP_009111016.1| PREDICTED: protein EFR3 homolog isoform X1 [Brassica rapa]
Length=921

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 62/128 (48%), Gaps = 11/128 (9%)
 Frame = -1

Query  675  IVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTK  496
            ++++ +LLES  E A QVA   VS+ P+PY  M +QCE L T  ++K+S   + +   TK
Sbjct  792  VLSVNELLESVSETARQVASLPVSSLPVPYDQMMNQCEALMTGKQQKMSVLKSFKPEATK  851

Query  495  AAA--------DVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREPWL---AIWLPPASP  349
            A          +V L           +K +       QG +      +   +  LPP+SP
Sbjct  852  AITFSEDAEEEEVFLLKETEEANEDDQKALTVSQVQPQGQLASCSHGVEQDSFRLPPSSP  911

Query  348  FDNFLRAA  325
            +D FL+AA
Sbjct  912  YDEFLKAA  919



>ref|XP_002892313.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68572.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=1634

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 70/157 (45%), Gaps = 30/157 (19%)
 Frame = -1

Query  918  ETDDLVKEMSEGFTPDDTFLFGLQSMVDMDHIQVLVHSRESPSYDGDFLTNSSAEDDKIS  739
            E  +L KE+   F+ DDT   G +   D       ++  E P+++               
Sbjct  785  EQSNLRKEIQSDFSRDDTHPLGGKLFTDTPGPSSPLNQTELPAFE---------------  829

Query  738  ESSVTDMTRFMPTSPSPSSSR---------------IVNIGQLLESALEVAGQVAGTFVS  604
            E  ++D+  F   SP  S S+               ++++ +LLES  E A QVA   VS
Sbjct  830  EVELSDIVAFEGISPGASGSQSGHRTSLSTNTNPVDVLSVNELLESVSETARQVASLPVS  889

Query  603  TSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTKA  493
            + P+PY  M +QCE L T  ++K+S   + +   TKA
Sbjct  890  SVPVPYDQMMNQCEALVTGKQQKMSVLRSFKPQATKA  926



>emb|CDX86545.1| BnaC08g01580D [Brassica napus]
Length=919

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 62/129 (48%), Gaps = 15/129 (12%)
 Frame = -1

Query  675  IVNIGQLLESALEVAGQVAGTFVSTSPLPYGAMASQCETLGTDTRKKLSNWLAHENHYTK  496
            ++++ +LLES  E A QVA   VS+ P+PY  M +QCE L    ++K+S   + +    K
Sbjct  792  VLSVNELLESVSETARQVASLPVSSLPVPYDQMMNQCEALMNGKQQKMSVLRSFKPEAAK  851

Query  495  AAADVLLPAIPGNGLLTAKKTIDEDSTLQQGVMVPREP--WLA----------IWLPPAS  352
            A             LL   +  +ED    Q  + P +P   LA            LPP+S
Sbjct  852  AITFSEEDEKEEVFLLKETEEANEDD---QKALAPVQPQGQLASCSHGVEQDSFRLPPSS  908

Query  351  PFDNFLRAA  325
            P+D FL+AA
Sbjct  909  PYDEFLKAA  917



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2159265676996