BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8979

Length=1041
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009592482.1|  PREDICTED: kinesin KP1-like                        223   5e-62   Nicotiana tomentosiformis
ref|XP_009795668.1|  PREDICTED: kinesin KP1                             221   4e-61   Nicotiana sylvestris
ref|XP_004245601.1|  PREDICTED: kinesin KP1                             218   5e-60   Solanum lycopersicum
ref|XP_006343979.1|  PREDICTED: kinesin-4-like                          213   2e-58   Solanum tuberosum [potatoes]
emb|CDP12027.1|  unnamed protein product                                200   3e-55   Coffea canephora [robusta coffee]
gb|EYU23471.1|  hypothetical protein MIMGU_mgv1a000947mg                192   5e-51   Erythranthe guttata [common monkey flower]
ref|XP_011080952.1|  PREDICTED: kinesin-4-like isoform X1               191   1e-50   Sesamum indicum [beniseed]
ref|XP_011080953.1|  PREDICTED: kinesin-4-like isoform X2               191   1e-50   Sesamum indicum [beniseed]
ref|XP_010925550.1|  PREDICTED: kinesin-4-like                          178   5e-46   
ref|XP_006365419.1|  PREDICTED: kinesin-4-like                          176   1e-45   
emb|CBI34668.3|  unnamed protein product                                174   2e-44   Vitis vinifera
ref|XP_010660655.1|  PREDICTED: uncharacterized protein LOC100256435    174   4e-44   Vitis vinifera
ref|XP_010249569.1|  PREDICTED: kinesin KP1-like isoform X6             172   7e-44   
ref|XP_010249559.1|  PREDICTED: kinesin-4-like isoform X5               172   9e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010249532.1|  PREDICTED: kinesin-4-like isoform X2               172   1e-43   
ref|XP_010249541.1|  PREDICTED: kinesin-4-like isoform X3               172   1e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010249516.1|  PREDICTED: kinesin-4-like isoform X1               172   1e-43   Nelumbo nucifera [Indian lotus]
ref|XP_007036524.1|  P-loop nucleoside triphosphate hydrolases su...    172   1e-43   
ref|XP_010242700.1|  PREDICTED: kinesin-4-like isoform X5               168   2e-43   
ref|XP_010322612.1|  PREDICTED: kinesin-4-like isoform X2               171   3e-43   Solanum lycopersicum
ref|XP_010242698.1|  PREDICTED: kinesin-4-like isoform X3               168   4e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010242699.1|  PREDICTED: kinesin-4-like isoform X4               167   4e-43   
ref|XP_010242696.1|  PREDICTED: kinesin-4-like isoform X2               168   4e-43   
ref|XP_010242695.1|  PREDICTED: kinesin-4-like isoform X1               168   5e-43   Nelumbo nucifera [Indian lotus]
ref|XP_006440967.1|  hypothetical protein CICLE_v10023895mg             168   8e-43   
ref|XP_009605734.1|  PREDICTED: kinesin-4-like                          168   9e-43   
ref|XP_009348139.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-4          169   1e-42   
ref|XP_012093054.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-4          169   2e-42   
ref|XP_009763271.1|  PREDICTED: kinesin-4-like isoform X2               167   3e-42   Nicotiana sylvestris
ref|XP_009763270.1|  PREDICTED: kinesin-4-like isoform X1               167   3e-42   Nicotiana sylvestris
gb|KDO57448.1|  hypothetical protein CISIN_1g042277mg                   166   1e-41   Citrus sinensis [apfelsine]
ref|XP_008794166.1|  PREDICTED: kinesin-4-like                          166   1e-41   
ref|XP_008393309.1|  PREDICTED: kinesin KP1 isoform X3                  166   1e-41   
ref|XP_010243529.1|  PREDICTED: kinesin KP1-like                        165   2e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010322614.1|  PREDICTED: kinesin-4-like isoform X4               162   2e-40   
ref|XP_010322613.1|  PREDICTED: kinesin-4-like isoform X3               162   2e-40   Solanum lycopersicum
ref|XP_010322609.1|  PREDICTED: kinesin-4-like isoform X1               162   2e-40   Solanum lycopersicum
ref|XP_011072725.1|  PREDICTED: carboxy-terminal kinesin 2-like         162   2e-40   Sesamum indicum [beniseed]
ref|XP_008240320.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-2          161   6e-40   
ref|XP_008795115.1|  PREDICTED: kinesin-4-like                          160   1e-39   
ref|XP_008346792.1|  PREDICTED: kinesin-4-like                          160   1e-39   
ref|XP_008393308.1|  PREDICTED: kinesin KP1 isoform X2                  159   2e-39   
ref|XP_002532147.1|  kinesin heavy chain, putative                      159   3e-39   
ref|XP_002321471.2|  hypothetical protein POPTR_0015s03640g             158   6e-39   
ref|XP_010915403.1|  PREDICTED: kinesin-4-like                          157   2e-38   
ref|XP_006485789.1|  PREDICTED: kinesin-4-like isoform X1               155   7e-38   Citrus sinensis [apfelsine]
ref|XP_010053254.1|  PREDICTED: kinesin KP1                             154   2e-37   Eucalyptus grandis [rose gum]
ref|XP_007209035.1|  hypothetical protein PRUPE_ppa014950mg             153   4e-37   
ref|XP_008393310.1|  PREDICTED: kinesin-4 isoform X4                    152   1e-36   
ref|XP_008393307.1|  PREDICTED: kinesin KP1 isoform X1                  151   1e-36   
ref|XP_010314384.1|  PREDICTED: kinesin-4-like                          150   2e-36   
ref|XP_004300795.1|  PREDICTED: kinesin-4 isoform X2                    150   3e-36   Fragaria vesca subsp. vesca
emb|CDO98431.1|  unnamed protein product                                150   4e-36   Coffea canephora [robusta coffee]
ref|XP_011465396.1|  PREDICTED: kinesin-4 isoform X2                    150   5e-36   Fragaria vesca subsp. vesca
ref|XP_009360158.1|  PREDICTED: kinesin-4-like                          150   6e-36   
ref|XP_010915519.1|  PREDICTED: kinesin-4-like                          149   1e-35   
ref|XP_007210907.1|  hypothetical protein PRUPE_ppa000796mg             148   2e-35   
ref|XP_008804600.1|  PREDICTED: kinesin-4-like                          148   2e-35   Phoenix dactylifera
gb|KHG09229.1|  Kinesin-4 -like protein                                 147   3e-35   Gossypium arboreum [tree cotton]
ref|XP_011013061.1|  PREDICTED: kinesin-4-like isoform X2               147   4e-35   Populus euphratica
ref|XP_011013060.1|  PREDICTED: kinesin-4-like isoform X1               147   4e-35   Populus euphratica
ref|XP_004503714.1|  PREDICTED: kinesin-4-like isoform X1               146   1e-34   Cicer arietinum [garbanzo]
ref|XP_006439546.1|  hypothetical protein CICLE_v10018623mg             145   2e-34   
gb|KDO76227.1|  hypothetical protein CISIN_1g001464mg                   145   2e-34   Citrus sinensis [apfelsine]
gb|KDO76228.1|  hypothetical protein CISIN_1g001464mg                   145   2e-34   Citrus sinensis [apfelsine]
gb|KDO76229.1|  hypothetical protein CISIN_1g001464mg                   145   2e-34   Citrus sinensis [apfelsine]
gb|KEH21062.1|  P-loop nucleoside triphosphate hydrolase superfam...    145   3e-34   Medicago truncatula
ref|XP_006439545.1|  hypothetical protein CICLE_v10018623mg             145   3e-34   Citrus clementina [clementine]
ref|XP_010031995.1|  PREDICTED: kinesin-4 isoform X2                    145   3e-34   Eucalyptus grandis [rose gum]
gb|AET04979.2|  P-loop nucleoside triphosphate hydrolase superfam...    145   3e-34   Medicago truncatula
ref|XP_010031985.1|  PREDICTED: kinesin-4 isoform X1                    145   3e-34   Eucalyptus grandis [rose gum]
gb|KCW83857.1|  hypothetical protein EUGRSUZ_B00722                     144   3e-34   Eucalyptus grandis [rose gum]
ref|XP_011465397.1|  PREDICTED: kinesin-4 isoform X3                    144   4e-34   Fragaria vesca subsp. vesca
gb|KJB20679.1|  hypothetical protein B456_003G158800                    144   4e-34   Gossypium raimondii
gb|KJB20677.1|  hypothetical protein B456_003G158800                    144   4e-34   Gossypium raimondii
ref|XP_011465399.1|  PREDICTED: kinesin-4 isoform X5                    144   4e-34   Fragaria vesca subsp. vesca
gb|KJB20676.1|  hypothetical protein B456_003G158800                    144   5e-34   Gossypium raimondii
gb|KJB20675.1|  hypothetical protein B456_003G158800                    144   5e-34   Gossypium raimondii
ref|XP_011465398.1|  PREDICTED: kinesin-4 isoform X4                    144   5e-34   Fragaria vesca subsp. vesca
ref|XP_011465394.1|  PREDICTED: kinesin-4 isoform X1                    144   5e-34   Fragaria vesca subsp. vesca
ref|XP_010249550.1|  PREDICTED: kinesin-4-like isoform X4               144   6e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006476565.1|  PREDICTED: kinesin-4-like isoform X1               143   1e-33   Citrus sinensis [apfelsine]
ref|NP_173277.2|  kinesin motor domain-containing protein               143   1e-33   
gb|KHG03288.1|  Kinesin-4 -like protein                                 139   2e-33   Gossypium arboreum [tree cotton]
ref|XP_010677989.1|  PREDICTED: kinesin-4                               142   3e-33   
ref|XP_010094755.1|  hypothetical protein L484_019965                   141   4e-33   
ref|XP_006416608.1|  hypothetical protein EUTSA_v10006662mg             141   4e-33   
gb|KHN23642.1|  Kinesin-4                                               140   1e-32   Glycine soja [wild soybean]
ref|XP_006580577.1|  PREDICTED: kinesin-4-like isoform X1               140   1e-32   Glycine max [soybeans]
ref|XP_006580580.1|  PREDICTED: kinesin-4-like isoform X4               140   1e-32   Glycine max [soybeans]
ref|XP_006306421.1|  hypothetical protein CARUB_v10012358mg             139   2e-32   
ref|XP_008238831.1|  PREDICTED: kinesin-4                               140   2e-32   Prunus mume [ume]
ref|XP_009364926.1|  PREDICTED: kinesin-4-like                          139   3e-32   Pyrus x bretschneideri [bai li]
gb|AAG52533.1|AC016662_27  putative kinesin; 97201-101676               138   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002318551.2|  hypothetical protein POPTR_0012s05330g             138   4e-32   
gb|AET05326.2|  kinesin motor catalytic domain protein                  139   4e-32   Medicago truncatula
ref|XP_009397984.1|  PREDICTED: kinesin-4-like                          138   5e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391867.1|  PREDICTED: kinesin KP1                             137   8e-32   
ref|XP_010695142.1|  PREDICTED: kinesin-1                               136   2e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007040244.1|  P-loop nucleoside triphosphate hydrolases su...    135   3e-31   
ref|XP_007040242.1|  P-loop nucleoside triphosphate hydrolases su...    135   4e-31   
ref|XP_007040243.1|  P-loop nucleoside triphosphate hydrolases su...    135   4e-31   
ref|XP_010089102.1|  hypothetical protein L484_024275                   134   1e-30   
ref|XP_006584721.1|  PREDICTED: kinesin-4-like isoform X1               134   1e-30   Glycine max [soybeans]
ref|XP_003630850.1|  Kinesin 4-like protein                             134   1e-30   
ref|XP_006390498.1|  hypothetical protein EUTSA_v10018060mg             134   1e-30   
ref|XP_009387623.1|  PREDICTED: kinesin-4-like                          133   2e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB20678.1|  hypothetical protein B456_003G158800                    133   2e-30   Gossypium raimondii
ref|XP_002318552.1|  kinesin motor family protein                       132   4e-30   
gb|KDP20118.1|  hypothetical protein JCGZ_05887                         132   6e-30   Jatropha curcas
gb|KJB39305.1|  hypothetical protein B456_007G005900                    131   6e-30   Gossypium raimondii
ref|NP_177527.3|  putative Kinesin motor protein-related protein        131   9e-30   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011005503.1|  PREDICTED: kinesin KP1-like                        131   9e-30   Populus euphratica
emb|CAN65659.1|  hypothetical protein VITISV_000953                     132   1e-29   Vitis vinifera
ref|XP_010459455.1|  PREDICTED: kinesin-4-like isoform X2               130   2e-29   Camelina sativa [gold-of-pleasure]
ref|XP_011022686.1|  PREDICTED: kinesin-4-like isoform X2               130   3e-29   Populus euphratica
ref|XP_010459454.1|  PREDICTED: kinesin-4-like isoform X1               130   3e-29   
ref|XP_007160066.1|  hypothetical protein PHAVU_002G289700g             130   3e-29   Phaseolus vulgaris [French bean]
ref|XP_011045866.1|  PREDICTED: kinesin KP1-like                        129   3e-29   Populus euphratica
ref|XP_011029283.1|  PREDICTED: kinesin-4 isoform X3                    129   4e-29   Populus euphratica
ref|XP_011029280.1|  PREDICTED: kinesin-4 isoform X1                    129   4e-29   Populus euphratica
ref|XP_010537447.1|  PREDICTED: kinesin-4-like isoform X1               129   4e-29   Tarenaya hassleriana [spider flower]
ref|XP_010537450.1|  PREDICTED: kinesin-4-like isoform X2               129   4e-29   Tarenaya hassleriana [spider flower]
emb|CDX96493.1|  BnaA07g31040D                                          129   5e-29   
emb|CDX73023.1|  BnaC06g34710D                                          129   5e-29   
ref|XP_010537451.1|  PREDICTED: kinesin-4-like isoform X3               129   5e-29   Tarenaya hassleriana [spider flower]
ref|XP_009106042.1|  PREDICTED: kinesin-4                               129   6e-29   
ref|XP_010471464.1|  PREDICTED: kinesin-4                               129   6e-29   Camelina sativa [gold-of-pleasure]
ref|XP_009104788.1|  PREDICTED: kinesin-4-like                          128   9e-29   Brassica rapa
ref|XP_010416204.1|  PREDICTED: kinesin-4-like                          127   2e-28   Camelina sativa [gold-of-pleasure]
gb|KJB39304.1|  hypothetical protein B456_007G005900                    127   2e-28   Gossypium raimondii
ref|XP_004969922.1|  PREDICTED: kinesin-4-like                          127   2e-28   Setaria italica
ref|XP_006654662.1|  PREDICTED: kinesin-4-like                          127   2e-28   
ref|XP_010477019.1|  PREDICTED: carboxy-terminal kinesin 2-like         127   3e-28   
ref|XP_009761313.1|  PREDICTED: kinesin-4-like isoform X4               126   3e-28   Nicotiana sylvestris
ref|XP_009761312.1|  PREDICTED: kinesin-4-like isoform X3               126   3e-28   Nicotiana sylvestris
ref|XP_009761311.1|  PREDICTED: kinesin-4-like isoform X2               126   4e-28   Nicotiana sylvestris
gb|KHN16578.1|  Kinesin-4                                               127   4e-28   Glycine soja [wild soybean]
ref|XP_006301495.1|  hypothetical protein CARUB_v10021921mg             126   4e-28   
ref|XP_011022689.1|  PREDICTED: kinesin-4-like isoform X5               126   4e-28   Populus euphratica
ref|XP_011022688.1|  PREDICTED: kinesin-4-like isoform X4               126   4e-28   Populus euphratica
ref|XP_011022687.1|  PREDICTED: kinesin-4-like isoform X3               126   5e-28   Populus euphratica
ref|XP_009761307.1|  PREDICTED: kinesin-4-like isoform X1               126   5e-28   Nicotiana sylvestris
ref|XP_002304498.1|  kinesin motor family protein                       126   5e-28   
ref|XP_011029282.1|  PREDICTED: kinesin-4 isoform X2                    126   5e-28   Populus euphratica
ref|XP_011022683.1|  PREDICTED: kinesin-4-like isoform X1               126   5e-28   Populus euphratica
gb|AAW81733.1|  Putative Kinesin motor protein-related                  126   6e-28   Brassica oleracea
ref|XP_010428332.1|  PREDICTED: kinesin-4-like isoform X2               125   7e-28   
gb|ERN15129.1|  hypothetical protein AMTR_s00056p00106770               123   8e-28   Amborella trichopoda
ref|XP_010428329.1|  PREDICTED: kinesin-4-like isoform X1               125   9e-28   Camelina sativa [gold-of-pleasure]
ref|XP_008437282.1|  PREDICTED: kinesin-4 isoform X2                    125   9e-28   Cucumis melo [Oriental melon]
ref|XP_010498228.1|  PREDICTED: kinesin KP1-like isoform X1             125   9e-28   
ref|XP_008437280.1|  PREDICTED: kinesin-4 isoform X1                    125   1e-27   Cucumis melo [Oriental melon]
ref|XP_011626803.1|  PREDICTED: kinesin-4                               125   1e-27   
ref|XP_006405988.1|  hypothetical protein EUTSA_v10027628mg             125   1e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010473609.1|  PREDICTED: kinesin-4-like isoform X1               125   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010473610.1|  PREDICTED: kinesin-4-like isoform X2               125   2e-27   Camelina sativa [gold-of-pleasure]
gb|KGN59396.1|  hypothetical protein Csa_3G816090                       125   2e-27   Cucumis sativus [cucumbers]
ref|XP_009606579.1|  PREDICTED: kinesin-4-like                          124   2e-27   
ref|XP_011654742.1|  PREDICTED: kinesin-4 isoform X2                    124   2e-27   Cucumis sativus [cucumbers]
ref|XP_004143905.1|  PREDICTED: kinesin-4 isoform X1                    124   2e-27   Cucumis sativus [cucumbers]
ref|XP_006595426.1|  PREDICTED: kinesin-4-like                          124   3e-27   
ref|NP_176551.3|  microtubule motor protein KinG                        124   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974079.1|  microtubule motor protein KinG                        124   4e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAG52420.1|AC011622_8  kinesin-like protein; 73641-79546             123   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006586333.1|  PREDICTED: kinesin-4-like                          124   4e-27   
ref|NP_001056074.1|  Os05g0521300                                       123   5e-27   
gb|AAT69670.1|  putative kinesin                                        123   5e-27   Oryza sativa Japonica Group [Japonica rice]
gb|ADL28383.1|  kinesin KinG                                            123   7e-27   Arabidopsis thaliana [mouse-ear cress]
gb|EEE64402.1|  hypothetical protein OsJ_19246                          122   7e-27   Oryza sativa Japonica Group [Japonica rice]
emb|CDY26163.1|  BnaA06g12540D                                          123   7e-27   Brassica napus [oilseed rape]
gb|EEC80283.1|  hypothetical protein OsI_22285                          122   8e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_010533669.1|  PREDICTED: kinesin-4 isoform X1                    122   8e-27   Tarenaya hassleriana [spider flower]
gb|AAG52083.1|AC012679_21  kinesin-related protein; 103921-99132        122   8e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010533671.1|  PREDICTED: kinesin-4 isoform X2                    122   1e-26   Tarenaya hassleriana [spider flower]
ref|XP_010418392.1|  PREDICTED: kinesin-4-like isoform X3               122   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_004961465.1|  PREDICTED: kinesin-4-like                          122   1e-26   Setaria italica
ref|XP_010418393.1|  PREDICTED: kinesin-4-like isoform X4               122   1e-26   
ref|XP_010418390.1|  PREDICTED: kinesin-4-like isoform X1               122   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010418391.1|  PREDICTED: kinesin-4-like isoform X2               122   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009149282.1|  PREDICTED: kinesin-2                               122   2e-26   
ref|XP_008657237.1|  PREDICTED: kinesin KP1                             121   2e-26   Zea mays [maize]
emb|CBI15451.3|  unnamed protein product                                121   2e-26   Vitis vinifera
gb|AFW82518.1|  hypothetical protein ZEAMMB73_648725                    120   2e-26   
gb|AFW82519.1|  hypothetical protein ZEAMMB73_648725                    120   2e-26   
gb|AFW82517.1|  kinesin heavy chain                                     120   2e-26   
ref|XP_011652155.1|  PREDICTED: kinesin-4-like                          121   3e-26   Cucumis sativus [cucumbers]
ref|XP_004512859.1|  PREDICTED: kinesin-4-like                          120   3e-26   Cicer arietinum [garbanzo]
ref|XP_006353799.1|  PREDICTED: kinesin-4-like                          120   4e-26   Solanum tuberosum [potatoes]
ref|XP_006580891.1|  PREDICTED: kinesin-4-like                          120   4e-26   
ref|XP_011097028.1|  PREDICTED: kinesin-4-like                          120   4e-26   
ref|XP_008656472.1|  PREDICTED: kinesin-4 isoform X3                    120   4e-26   
ref|XP_008656470.1|  PREDICTED: kinesin-4 isoform X1                    120   4e-26   Zea mays [maize]
ref|XP_010431727.1|  PREDICTED: kinesin-4-like                          120   5e-26   Camelina sativa [gold-of-pleasure]
emb|CDM84045.1|  unnamed protein product                                120   5e-26   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002509807.1|  kinesin heavy chain, putative                      120   7e-26   
ref|XP_010232310.1|  PREDICTED: kinesin-4-like isoform X1               119   8e-26   Brachypodium distachyon [annual false brome]
ref|XP_003569788.1|  PREDICTED: kinesin-4-like isoform X2               119   9e-26   Brachypodium distachyon [annual false brome]
ref|XP_008443607.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    119   1e-25   
ref|XP_006300383.1|  hypothetical protein CARUB_v10019703mg             119   1e-25   Capsella rubella
gb|KHN21564.1|  Kinesin-4                                               119   1e-25   Glycine soja [wild soybean]
ref|XP_002456344.1|  hypothetical protein SORBIDRAFT_03g034310          119   1e-25   
ref|XP_010663596.1|  PREDICTED: kinesin-4 isoform X1                    119   2e-25   
ref|XP_010663597.1|  PREDICTED: kinesin-4 isoform X2                    119   2e-25   
ref|XP_002886395.1|  hypothetical protein ARALYDRAFT_474991             118   2e-25   
ref|XP_002298032.2|  kinesin motor family protein                       118   3e-25   
emb|CDY11085.1|  BnaC06g23370D                                          117   3e-25   Brassica napus [oilseed rape]
emb|CDX68208.1|  BnaA07g22480D                                          117   3e-25   
ref|XP_012086895.1|  PREDICTED: kinesin-4                               117   5e-25   Jatropha curcas
gb|EPS68131.1|  hypothetical protein M569_06641                         114   5e-25   Genlisea aurea
ref|XP_003566026.1|  PREDICTED: kinesin-4-like                          117   6e-25   Brachypodium distachyon [annual false brome]
dbj|BAJ97665.1|  predicted protein                                      116   8e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008647384.1|  PREDICTED: uncharacterized protein LOC100193...    116   1e-24   
ref|XP_008647385.1|  PREDICTED: uncharacterized protein LOC100193...    115   1e-24   
gb|EMT25397.1|  Kinesin-4                                               115   2e-24   
emb|CDY19209.1|  BnaC05g14100D                                          115   2e-24   Brassica napus [oilseed rape]
emb|CDY25511.1|  BnaC09g11360D                                          115   3e-24   Brassica napus [oilseed rape]
ref|XP_009112933.1|  PREDICTED: kinesin-4-like isoform X1               114   4e-24   Brassica rapa
ref|XP_009112934.1|  PREDICTED: kinesin-4-like isoform X2               114   4e-24   Brassica rapa
emb|CDY34366.1|  BnaA09g11080D                                          114   4e-24   Brassica napus [oilseed rape]
ref|XP_006656157.1|  PREDICTED: kinesin-4-like isoform X1               114   5e-24   
ref|NP_001044222.1|  Os01g0744000                                       113   1e-23   
emb|CDY62807.1|  BnaCnng41050D                                          113   1e-23   Brassica napus [oilseed rape]
gb|EEC71463.1|  hypothetical protein OsI_03702                          112   2e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_007160373.1|  hypothetical protein PHAVU_002G316200g             112   2e-23   Phaseolus vulgaris [French bean]
emb|CAZ40331.1|  putative kinesin-like protein                          112   2e-23   Raphanus sativus
emb|CDY45358.1|  BnaA09g12430D                                          112   2e-23   Brassica napus [oilseed rape]
gb|EEE55367.1|  hypothetical protein OsJ_03421                          112   2e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009112751.1|  PREDICTED: kinesin-4-like isoform X1               112   3e-23   Brassica rapa
ref|XP_009112752.1|  PREDICTED: kinesin-4-like isoform X2               112   3e-23   Brassica rapa
ref|XP_002893001.1|  hypothetical protein ARALYDRAFT_335100             112   3e-23   
ref|XP_006644693.1|  PREDICTED: kinesin-4-like                          110   1e-22   
gb|EYU38173.1|  hypothetical protein MIMGU_mgv1a025662mg                110   1e-22   Erythranthe guttata [common monkey flower]
gb|EMS55440.1|  Kinesin-4                                               107   1e-21   Triticum urartu
ref|XP_007152758.1|  hypothetical protein PHAVU_004G157000g             107   1e-21   Phaseolus vulgaris [French bean]
gb|EMS66550.1|  Kinesin-4                                               105   2e-21   Triticum urartu
gb|AAF19694.1|AC008047_1  F2K11.1                                       105   3e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010227619.1|  PREDICTED: kinesin-4-like isoform X2               104   7e-21   
ref|XP_010227618.1|  PREDICTED: kinesin-4-like isoform X1               104   7e-21   
ref|XP_010227621.1|  PREDICTED: kinesin-4-like isoform X4               104   8e-21   
ref|XP_006405368.1|  hypothetical protein EUTSA_v10027635mg             104   8e-21   
ref|XP_010227620.1|  PREDICTED: kinesin-4-like isoform X3               104   8e-21   
gb|KJB39302.1|  hypothetical protein B456_007G005900                    103   1e-20   Gossypium raimondii
ref|XP_009140202.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-4          103   1e-20   
gb|AES76706.2|  P-loop nucleoside triphosphate hydrolase superfam...    103   2e-20   Medicago truncatula
emb|CDY46382.1|  BnaC04g33010D                                          102   3e-20   Brassica napus [oilseed rape]
emb|CDY39749.1|  BnaA04g11040D                                          100   1e-19   Brassica napus [oilseed rape]
ref|XP_004512927.1|  PREDICTED: kinesin-5-like isoform X2               100   1e-19   
gb|EEE65873.1|  hypothetical protein OsJ_21674                          100   2e-19   Oryza sativa Japonica Group [Japonica rice]
gb|EEC80804.1|  hypothetical protein OsI_23351                          100   2e-19   Oryza sativa Indica Group [Indian rice]
ref|XP_004965596.1|  PREDICTED: kinesin-4-like isoform X1             99.8    3e-19   
ref|XP_008656471.1|  PREDICTED: kinesin KP1 isoform X2                99.4    3e-19   
ref|XP_002868605.1|  hypothetical protein ARALYDRAFT_330390           98.2    7e-19   
ref|XP_010447313.1|  PREDICTED: kinesin KP1                           98.2    7e-19   
ref|XP_008676287.1|  PREDICTED: uncharacterized protein LOC103652492  94.7    9e-19   
ref|XP_003620488.1|  Kinesin                                          97.1    1e-18   
gb|KHG17676.1|  Cingulin-like protein 1                               91.7    2e-18   Gossypium arboreum [tree cotton]
gb|KHG08026.1|  Retrovirus-related Pol polyprotein from type-1 re...  91.7    2e-18   Gossypium arboreum [tree cotton]
ref|XP_010441293.1|  PREDICTED: kinesin KP1-like                      96.3    3e-18   
ref|XP_004951394.1|  PREDICTED: LOW QUALITY PROTEIN: kinesin-like...  95.9    5e-18   
ref|XP_004512928.1|  PREDICTED: kinesin-5-like isoform X3             94.4    1e-17   
ref|XP_004512926.1|  PREDICTED: kinesin-5-like isoform X1             94.4    1e-17   
ref|XP_008231871.1|  PREDICTED: uncharacterized protein LOC103331039  90.1    2e-17   Prunus mume [ume]
gb|EMS62353.1|  Kinesin-4                                             93.2    2e-17   Triticum urartu
ref|XP_010234073.1|  PREDICTED: kinesin-4-like                        93.6    3e-17   Brachypodium distachyon [annual false brome]
dbj|BAK01300.1|  predicted protein                                    92.8    4e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADN33985.1|  kinesin heavy chain                                   91.7    1e-16   Cucumis melo subsp. melo
ref|XP_006648475.1|  PREDICTED: calponin homology domain-containi...  90.9    2e-16   
ref|XP_006286204.1|  hypothetical protein CARUB_v10007770mg           90.1    3e-16   
gb|EEC72779.1|  hypothetical protein OsI_06451                        89.7    4e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_008650465.1|  PREDICTED: kinesin-4-like                        89.4    5e-16   
gb|KJB34348.1|  hypothetical protein B456_006G061000                  89.0    7e-16   Gossypium raimondii
gb|EEE56604.1|  hypothetical protein OsJ_05972                        88.6    1e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001046361.1|  Os02g0229600                                     88.2    1e-15   
gb|EPS62917.1|  hypothetical protein M569_11869                       87.8    2e-15   Genlisea aurea
gb|AAF25983.1|AC013354_2  F15H18.10                                   84.7    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198947.1|  kinesin-like protein                                83.2    4e-14   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB11107.1|  kinesin-like protein                                 83.2    5e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KJB52112.1|  hypothetical protein B456_008G247000                  65.5    3e-08   Gossypium raimondii
dbj|BAD26164.1|  putative Carboxy-terminal kinesin 2                  54.7    8e-05   
gb|KHN32041.1|  Kinesin-4                                             53.5    2e-04   
gb|EMT21658.1|  hypothetical protein F775_52710                       52.4    6e-04   



>ref|XP_009592482.1| PREDICTED: kinesin KP1-like [Nicotiana tomentosiformis]
 ref|XP_009592483.1| PREDICTED: kinesin KP1-like [Nicotiana tomentosiformis]
Length=932

 Score =   223 bits (569),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 147/277 (53%), Positives = 188/277 (68%), Gaps = 18/277 (6%)
 Frame = +3

Query  240   MNTESEMPGAEKGEQANINAFRSFNASEQIDCFNNMAKELSASNNHAGSKLPDVFQLKIG  419
             MN E+     E G+ A++N   + + S++++ F      ++A +N AGSKLPD  Q K G
Sbjct  1     MNPEA---ATENGDSASLNEILNCDVSDRVEIF-----RVAAEDNLAGSKLPDGIQSKHG  52

Query  420   CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEI  599
               DI A KISELMK  SLESAST  LFS V +IL+++IERKNGDIPQCV+SL+KLV+QEI
Sbjct  53    FADIPAAKISELMKLNSLESASTHSLFSVVNNILDDSIERKNGDIPQCVASLVKLVVQEI  112

Query  600   EQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaa----------eeheiekaks  749
             E+RVSKQ++NLRKQ+  YKSRE++YQ + +A E L  G            ++ +IEKAK 
Sbjct  113   EERVSKQADNLRKQNGLYKSREERYQSRIKALETLAVGTTEEHEVVMKKLQQIKIEKAKI  172

Query  750   eekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNK  929
             EEKEK +EQ +  L KDKDH EMQISSL  ELE  K  +E   LQL+ H E+ R E   K
Sbjct  173   EEKEKLQEQDLIRLMKDKDHCEMQISSLIAELESSKHAHEKDHLQLKAHAEQTRAESEIK  232

Query  930   IMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             I+EL+ LL +S KK  ELEAFSESKL+  KR+E  YK
Sbjct  233   ILELQGLLNESTKKVQELEAFSESKLVSLKRRELGYK  269



>ref|XP_009795668.1| PREDICTED: kinesin KP1 [Nicotiana sylvestris]
 ref|XP_009795669.1| PREDICTED: kinesin KP1 [Nicotiana sylvestris]
Length=932

 Score =   221 bits (562),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 146/277 (53%), Positives = 185/277 (67%), Gaps = 18/277 (6%)
 Frame = +3

Query  240   MNTESEMPGAEKGEQANINAFRSFNASEQIDCFNNMAKELSASNNHAGSKLPDVFQLKIG  419
             MN E+     E G+ A++N   + + S++++ F   A++     N  GSKLPD  Q K G
Sbjct  1     MNPEA---ATENGDSASLNEILNCDVSDRVEIFRGAAED-----NLGGSKLPDGIQSKHG  52

Query  420   CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEI  599
               DI A KISELMK  SLESAST  LFS V +IL+++IERKNGDIPQCV+SL+KLV+QEI
Sbjct  53    FADIPAAKISELMKLNSLESASTHSLFSVVNNILDDSIERKNGDIPQCVASLVKLVVQEI  112

Query  600   EQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaa----------eeheiekaks  749
             E+RVSKQ++NLRKQ+  YKSRE++YQ + +A E L  G            ++ +IEKAK 
Sbjct  113   EERVSKQADNLRKQNGLYKSREERYQSRIKALETLALGTTEEHEVVMKKLQQIKIEKAKI  172

Query  750   eekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNK  929
             EEKEK +EQ +  L KDKDH EMQISSL  ELE  K  +E   LQL+ H E+ R E   K
Sbjct  173   EEKEKLQEQDLIRLMKDKDHCEMQISSLIAELESSKHAHEKDRLQLKAHAEQTRAESETK  232

Query  930   IMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             I EL+ LL +S KK  ELEAFSESKL+  KR+E  YK
Sbjct  233   IAELQGLLNESTKKVQELEAFSESKLVSLKRRELGYK  269



>ref|XP_004245601.1| PREDICTED: kinesin KP1 [Solanum lycopersicum]
 ref|XP_010325402.1| PREDICTED: kinesin KP1 [Solanum lycopersicum]
Length=921

 Score =   218 bits (554),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 145/277 (52%), Positives = 184/277 (66%), Gaps = 27/277 (10%)
 Frame = +3

Query  240   MNTESEMPGAEKGEQANINAFRSFNASEQIDCFNNMAKELSASNNHAGSKLPDVFQLKIG  419
             MN E+     E G+ A++N   +F  +              A +N A SKL D  Q K G
Sbjct  1     MNPEA---ATENGDSASLNEILNFKGA--------------AEDNLAESKLFDGIQSKHG  43

Query  420   CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEI  599
               DI A KISELMK  SLESAST  LFS V +IL+++IERKNGDIPQCV+SL+KLV+QEI
Sbjct  44    LADIPAAKISELMKLNSLESASTHSLFSVVSNILDDSIERKNGDIPQCVASLVKLVVQEI  103

Query  600   EQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaa----------eeheiekaks  749
             E RVSKQ++NLRKQ+  YKSRE++YQ + +A E L  G            ++ +IEKAK 
Sbjct  104   EARVSKQADNLRKQNGLYKSREERYQSRVKALETLALGTTEEHEVIMKKLQQIKIEKAKM  163

Query  750   eekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNK  929
             EEKEK +EQ +  L +D DH++MQISSL+ ELE  K  +E   LQLE  LE+ R+E  NK
Sbjct  164   EEKEKLQEQDLIRLMEDNDHYKMQISSLDAELESSKHAHEKDRLQLEAQLEQTRVESENK  223

Query  930   IMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             I+EL+CLL++S KK  ELEAFSESKL+K KR+E  YK
Sbjct  224   ILELQCLLSESTKKVQELEAFSESKLVKLKRRELGYK  260



>ref|XP_006343979.1| PREDICTED: kinesin-4-like [Solanum tuberosum]
Length=920

 Score =   213 bits (541),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 142/277 (51%), Positives = 182/277 (66%), Gaps = 27/277 (10%)
 Frame = +3

Query  240   MNTESEMPGAEKGEQANINAFRSFNASEQIDCFNNMAKELSASNNHAGSKLPDVFQLKIG  419
             MN E+     E G+  ++N   +F  +              A +N A SKL D  Q K G
Sbjct  1     MNPEA---ATENGDSTSLNEILNFKGA--------------AEDNLAESKLFDGIQSKHG  43

Query  420   CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEI  599
               DI A KISELMK  SLESAST  LF  V +IL+++IERKNGDIPQCV+SL+KLV+QEI
Sbjct  44    LADIPAAKISELMKLNSLESASTHSLFGVVSNILDDSIERKNGDIPQCVASLVKLVVQEI  103

Query  600   EQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaa----------eeheiekaks  749
             E+RVSKQ++NLRKQ+  YKSRE++YQ + +A E L  G            ++ +IEKAK 
Sbjct  104   EERVSKQADNLRKQNGLYKSREERYQSRVKALETLALGTTEEHEVIMKKLQQIKIEKAKM  163

Query  750   eekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNK  929
             EEKEK +EQ +  L +D DH++MQISSL+ ELE  K  +E   LQL   LE+ R+E  NK
Sbjct  164   EEKEKLQEQDLIRLMEDNDHYKMQISSLDTELESSKHAHEKDRLQLVAQLEQTRVESENK  223

Query  930   IMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             I+EL+CLL++S KK  ELEAFSESKL+K KR+E  YK
Sbjct  224   ILELQCLLSESTKKVQELEAFSESKLVKLKRRELGYK  260



>emb|CDP12027.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   200 bits (508),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 131/278 (47%), Positives = 178/278 (64%), Gaps = 25/278 (9%)
 Frame = +3

Query  240   MNTESEMPGAEKGEQANINAFRSFNASEQIDCFNNMAKELSASNNHAGSKLPDVFQLKIG  419
             M+ +S++   E G+  ++N           +  N ++   +A+ +H GSK  D+F LK G
Sbjct  1     MHRDSDVYENENGDPGSLN-----------EILNGLS---AAAIHHEGSKFSDIFPLKNG  46

Query  420   C-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQE  596
                D+ A +ISE+MK  SLE+AST  LFS V  IL+E+IERKNGDIPQCV+SLLKLV+QE
Sbjct  47    SFADLPAARISEMMKLNSLENASTPSLFSVVNAILDESIERKNGDIPQCVASLLKLVVQE  106

Query  597   IEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQ  776
             IEQRVSK +E+ RKQ N YKSRE+KYQ K RA E L TG  EE+EI   + ++ +  + +
Sbjct  107   IEQRVSKHAESFRKQSNLYKSREEKYQSKIRALETLTTGTTEENEIVINQLQKIKLEKLK  166

Query  777   I----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGN  926
             I          +  L + KD +E+++S L  ELEL KK+YE  C +L T   + + EL  
Sbjct  167   IDEKRKVEEQDVIRLMRQKDQYEIEMSLLKQELELSKKSYEKSCAELVTQAMETKAELEK  226

Query  927   KIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             K+   E LL DS+KK  ELEAFSESK L+W+RKEH +K
Sbjct  227   KLKHTESLLNDSRKKVKELEAFSESKYLRWRRKEHGFK  264



>gb|EYU23471.1| hypothetical protein MIMGU_mgv1a000947mg [Erythranthe guttata]
Length=936

 Score =   192 bits (488),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 136/278 (49%), Positives = 174/278 (63%), Gaps = 21/278 (8%)
 Frame = +3

Query  240   MNTESEMP-GAEKGEQANINAFRSFNASEQIDCFNNMAKELSASNNHAGSKLPDVFQLKI  416
             M+ ++E+  G EK E   +   R+ N S +I+ FN +A+         G+   DV Q K 
Sbjct  1     MDPQTEVRHGNEKEELGGLTEVRNGNVSGRIEAFNGLAE---------GNHFSDVLQSKR  51

Query  417   G-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQ  593
             G   D+ A KISELMK  +LE+AST  LF  V  IL+E+IERKN DIP  V+S+LKLV+Q
Sbjct  52    GNYGDLPASKISELMKLGNLENASTHSLFGVVKMILDESIERKNEDIPLRVASVLKLVVQ  111

Query  594   EIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaa----------eeheieka  743
             EIE RVSKQS+N+RKQ + YKSRE +Y  K +A E L TG +          ++ +IEK 
Sbjct  112   EIEHRVSKQSDNMRKQSSLYKSREDRYHSKIKALETLATGTSEENEVVMNQLQQMKIEKT  171

Query  744   kseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELG  923
             K EEK+K  EQ +  L+ +K   E QI SLN EL L KK++E    QLET  E+ +  L 
Sbjct  172   KIEEKKKLEEQDLINLRNEKHSCESQILSLNEELTLAKKSHEDNLFQLETKAEETKENLQ  231

Query  924   NKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVY  1037
              KI ELECLLTDS K+  ELE FSESK L+WKRKE  Y
Sbjct  232   KKIRELECLLTDSSKRVKELEDFSESKFLRWKRKEQRY  269



>ref|XP_011080952.1| PREDICTED: kinesin-4-like isoform X1 [Sesamum indicum]
Length=932

 Score =   191 bits (486),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 133/278 (48%), Positives = 174/278 (63%), Gaps = 20/278 (7%)
 Frame = +3

Query  240   MNTESEMPGAEKGEQANINAFRSFNASEQIDCFNNMAKELSASNNHAGSKLPDVFQLK-I  416
             M+ +SE+  +E  E   ++  R+ N S +I+ FN +A+         G     V + K +
Sbjct  1     MDPQSEVHVSENRELDGLSEVRNGNVSGRIEAFNGLAE---------GYNFSGVLKSKRV  51

Query  417   GCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQE  596
                DI A+KISEL K  +LESAS+  LFS V  IL+E IE+ N DIPQ V+S+LKLV+QE
Sbjct  52    HYADIPAFKISELTKLGNLESASSHSLFSTVNRILDECIEKSNQDIPQRVASVLKLVVQE  111

Query  597   IEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaa----------eeheiekak  746
             IEQRV+KQ++N+RKQ N YKSRE +Y  K RA E L TG            ++ +I+K K
Sbjct  112   IEQRVTKQADNMRKQSNMYKSREDRYHTKIRALETLATGTTEENEVVMNQLQQMKIQKTK  171

Query  747   seekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGN  926
              EEK+K  EQ +  L+K+KD  E +I SLN EL L KK+YE     LE   E+ + +L  
Sbjct  172   IEEKKKLEEQDLIKLRKEKDICESKILSLNEELNLAKKSYEENLFHLEAKAEESKDKLQK  231

Query  927   KIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             KI ELE LLTDS+KK  ELE FSESK L+WKRKE  YK
Sbjct  232   KIRELESLLTDSRKKIKELEDFSESKFLQWKRKEREYK  269



>ref|XP_011080953.1| PREDICTED: kinesin-4-like isoform X2 [Sesamum indicum]
Length=929

 Score =   191 bits (486),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 133/278 (48%), Positives = 174/278 (63%), Gaps = 20/278 (7%)
 Frame = +3

Query  240   MNTESEMPGAEKGEQANINAFRSFNASEQIDCFNNMAKELSASNNHAGSKLPDVFQLK-I  416
             M+ +SE+  +E  E   ++  R+ N S +I+ FN +A+         G     V + K +
Sbjct  1     MDPQSEVHVSENRELDGLSEVRNGNVSGRIEAFNGLAE---------GYNFSGVLKSKRV  51

Query  417   GCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQE  596
                DI A+KISEL K  +LESAS+  LFS V  IL+E IE+ N DIPQ V+S+LKLV+QE
Sbjct  52    HYADIPAFKISELTKLGNLESASSHSLFSTVNRILDECIEKSNQDIPQRVASVLKLVVQE  111

Query  597   IEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaa----------eeheiekak  746
             IEQRV+KQ++N+RKQ N YKSRE +Y  K RA E L TG            ++ +I+K K
Sbjct  112   IEQRVTKQADNMRKQSNMYKSREDRYHTKIRALETLATGTTEENEVVMNQLQQMKIQKTK  171

Query  747   seekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGN  926
              EEK+K  EQ +  L+K+KD  E +I SLN EL L KK+YE     LE   E+ + +L  
Sbjct  172   IEEKKKLEEQDLIKLRKEKDICESKILSLNEELNLAKKSYEENLFHLEAKAEESKDKLQK  231

Query  927   KIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             KI ELE LLTDS+KK  ELE FSESK L+WKRKE  YK
Sbjct  232   KIRELESLLTDSRKKIKELEDFSESKFLQWKRKEREYK  269



>ref|XP_010925550.1| PREDICTED: kinesin-4-like [Elaeis guineensis]
Length=938

 Score =   178 bits (452),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 104/241 (43%), Positives = 158/241 (66%), Gaps = 11/241 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++ +S  ++HAG K  +VFQLK G   D+ + KISE++K  SL++A T+ L S V  IL
Sbjct  40    MSEPISGLSHHAGHKFHEVFQLKQGLYSDLPSAKISEMIKSNSLDNAPTQSLLSVVNGIL  99

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP CV+ LL+ V+QEIE+R+S Q+E++R Q+N  K+REQKYQL+ +  EA
Sbjct  100   DESIERKNGEIPYCVACLLRKVVQEIERRISTQAEHIRNQNNLVKAREQKYQLRIKVLEA  159

Query  702   LRTGaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELEL  851
             L  G +E  +    + ++ +  + ++          +  L K+K++ +  +S L  +LE 
Sbjct  160   LANGTSEGTQAVMNQLQQTKMEKNKLEERNKVWDDNVVSLMKEKENSDNIVSKLKEDLET  219

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              KK+YE +CLQLET  ++ + EL  +I  +E LL +S+KK  ELE FSESK   WK+K H
Sbjct  220   TKKSYEQQCLQLETKAKETKEELEQRIKAVEFLLAESRKKTKELETFSESKSQNWKQKAH  279

Query  1032  V  1034
             V
Sbjct  280   V  280



>ref|XP_006365419.1| PREDICTED: kinesin-4-like [Solanum tuberosum]
Length=737

 Score =   176 bits (445),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 106/243 (44%), Positives = 160/243 (66%), Gaps = 11/243 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             MA+  +A  +H G K  +VFQLK G   D+   KISE+MK  SL+ A T+ L S V +IL
Sbjct  58    MAEPSAALLHHVGHKFHEVFQLKQGGYADLPPSKISEMMKSNSLDIAPTQSLLSVVNEIL  117

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+  +QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EA
Sbjct  118   DESIERKNGEIPHRVACLLRKAVQEIERRISTQAEHLRTQNNLFKTREEKYQSRIRVLEA  177

Query  702   LRTGaaeehe----------iekakseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
             L TG +EE +            K K + ++++ +Q +  L K+KD H  +I++L  ELE+
Sbjct  178   LATGTSEETQIVMNQLQQIKSVKIKMDAEKRNEDQDVVRLMKEKDDHSQEIAALKQELEI  237

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              KK +E +CL++E      + +L  ++ ++E LL +S+ +A ELE FSESK LKW +KE+
Sbjct  238   AKKAHEERCLEMEKEARNTQQKLEERLKDVEILLKESQHRAKELETFSESKSLKWSKKEN  297

Query  1032  VYK  1040
             VY+
Sbjct  298   VYQ  300



>emb|CBI34668.3| unnamed protein product [Vitis vinifera]
Length=1071

 Score =   174 bits (441),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 162/243 (67%), Gaps = 11/243 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
              ++ L+AS +H G +  + FQLK G   D  A KISEL++QKSLE+  T LLFS + +IL
Sbjct  209   FSEPLAASIHHVGHRFQEGFQLKQGGYADFPAAKISELVEQKSLENTPTHLLFSILINIL  268

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             + +IERKNGD+P  V+ LL+ ++QEIEQR+S Q+ENL+ Q+N YK+RE+KYQ + R  E 
Sbjct  269   DGSIERKNGDVPHRVAFLLRKIIQEIEQRISTQAENLKNQNNLYKAREEKYQSRIRVLET  328

Query  702   LRTGaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELEL  851
             L TG  EE+ +   + ++ +    +I          +  L K+KD  + +I +L  ELE+
Sbjct  329   LATGTTEENRVVMHQLQQIKIENTKIEERKKLEEQDVDRLMKEKDRSDNEILALKEELEM  388

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              +KT+E  CLQLET  ++ ++EL  K+ ELE LLTDSKKK  ELEAFSESK  +WKRKE 
Sbjct  389   ARKTHEKHCLQLETQAKETKVELEKKLKELENLLTDSKKKVKELEAFSESKSRRWKRKEL  448

Query  1032  VYK  1040
              Y+
Sbjct  449   RYQ  451



>ref|XP_010660655.1| PREDICTED: uncharacterized protein LOC100256435 [Vitis vinifera]
 ref|XP_010660660.1| PREDICTED: uncharacterized protein LOC100256435 [Vitis vinifera]
 ref|XP_010660666.1| PREDICTED: uncharacterized protein LOC100256435 [Vitis vinifera]
 ref|XP_010660672.1| PREDICTED: uncharacterized protein LOC100256435 [Vitis vinifera]
Length=1100

 Score =   174 bits (440),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 162/243 (67%), Gaps = 11/243 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
              ++ L+AS +H G +  + FQLK G   D  A KISEL++QKSLE+  T LLFS + +IL
Sbjct  209   FSEPLAASIHHVGHRFQEGFQLKQGGYADFPAAKISELVEQKSLENTPTHLLFSILINIL  268

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             + +IERKNGD+P  V+ LL+ ++QEIEQR+S Q+ENL+ Q+N YK+RE+KYQ + R  E 
Sbjct  269   DGSIERKNGDVPHRVAFLLRKIIQEIEQRISTQAENLKNQNNLYKAREEKYQSRIRVLET  328

Query  702   LRTGaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELEL  851
             L TG  EE+ +   + ++ +    +I          +  L K+KD  + +I +L  ELE+
Sbjct  329   LATGTTEENRVVMHQLQQIKIENTKIEERKKLEEQDVDRLMKEKDRSDNEILALKEELEM  388

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              +KT+E  CLQLET  ++ ++EL  K+ ELE LLTDSKKK  ELEAFSESK  +WKRKE 
Sbjct  389   ARKTHEKHCLQLETQAKETKVELEKKLKELENLLTDSKKKVKELEAFSESKSRRWKRKEL  448

Query  1032  VYK  1040
              Y+
Sbjct  449   RYQ  451



>ref|XP_010249569.1| PREDICTED: kinesin KP1-like isoform X6 [Nelumbo nucifera]
Length=965

 Score =   172 bits (437),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 156/246 (63%), Gaps = 10/246 (4%)
 Frame = +3

Query  333   CFNNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAV  509
             C   M++  +A  +H G K  +VFQLK GC  D+    ISE+++  SL++A T+ L S V
Sbjct  54    CSPVMSEPSAALIHHVGHKFHEVFQLKHGCYADLPPAMISEMLRSTSLDNAPTQSLLSVV  113

Query  510   GDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDR  689
               IL+E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N YK+RE+KYQ + R
Sbjct  114   NGILDESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLYKAREEKYQSRIR  173

Query  690   AYEALRTGaaeeheiekakseekekhreQI---------ICMLQKDKDHHEMQISSLNHE  842
               E   TG  EE +I   + ++ +  + +I         +  L K+KD +  +ISSL  E
Sbjct  174   VLETYATGPNEETKIVMNQLQQTKTEKPKIEETKKHEQDVLRLIKEKDLNNHEISSLKQE  233

Query  843   LELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKR  1022
             L + K+TYE +CLQLE  +   +I+L  ++ ELECLL  S+++  ELEAFS SK   WK 
Sbjct  234   LVVAKRTYEERCLQLEAEVNGNKIDLEERLKELECLLKASQEEVKELEAFSNSKDENWKE  293

Query  1023  KEHVYK  1040
             KE  Y+
Sbjct  294   KECSYQ  299



>ref|XP_010249559.1| PREDICTED: kinesin-4-like isoform X5 [Nelumbo nucifera]
Length=1097

 Score =   172 bits (437),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 156/246 (63%), Gaps = 10/246 (4%)
 Frame = +3

Query  333   CFNNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAV  509
             C   M++  +A  +H G K  +VFQLK GC  D+    ISE+++  SL++A T+ L S V
Sbjct  186   CSPVMSEPSAALIHHVGHKFHEVFQLKHGCYADLPPAMISEMLRSTSLDNAPTQSLLSVV  245

Query  510   GDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDR  689
               IL+E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N YK+RE+KYQ + R
Sbjct  246   NGILDESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLYKAREEKYQSRIR  305

Query  690   AYEALRTGaaeeheiekakseekekhreQI---------ICMLQKDKDHHEMQISSLNHE  842
               E   TG  EE +I   + ++ +  + +I         +  L K+KD +  +ISSL  E
Sbjct  306   VLETYATGPNEETKIVMNQLQQTKTEKPKIEETKKHEQDVLRLIKEKDLNNHEISSLKQE  365

Query  843   LELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKR  1022
             L + K+TYE +CLQLE  +   +I+L  ++ ELECLL  S+++  ELEAFS SK   WK 
Sbjct  366   LVVAKRTYEERCLQLEAEVNGNKIDLEERLKELECLLKASQEEVKELEAFSNSKDENWKE  425

Query  1023  KEHVYK  1040
             KE  Y+
Sbjct  426   KECSYQ  431



>ref|XP_010249532.1| PREDICTED: kinesin-4-like isoform X2 [Nelumbo nucifera]
Length=1125

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 156/246 (63%), Gaps = 10/246 (4%)
 Frame = +3

Query  333   CFNNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAV  509
             C   M++  +A  +H G K  +VFQLK GC  D+    ISE+++  SL++A T+ L S V
Sbjct  214   CSPVMSEPSAALIHHVGHKFHEVFQLKHGCYADLPPAMISEMLRSTSLDNAPTQSLLSVV  273

Query  510   GDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDR  689
               IL+E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N YK+RE+KYQ + R
Sbjct  274   NGILDESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLYKAREEKYQSRIR  333

Query  690   AYEALRTGaaeeheiekakseekekhreQI---------ICMLQKDKDHHEMQISSLNHE  842
               E   TG  EE +I   + ++ +  + +I         +  L K+KD +  +ISSL  E
Sbjct  334   VLETYATGPNEETKIVMNQLQQTKTEKPKIEETKKHEQDVLRLIKEKDLNNHEISSLKQE  393

Query  843   LELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKR  1022
             L + K+TYE +CLQLE  +   +I+L  ++ ELECLL  S+++  ELEAFS SK   WK 
Sbjct  394   LVVAKRTYEERCLQLEAEVNGNKIDLEERLKELECLLKASQEEVKELEAFSNSKDENWKE  453

Query  1023  KEHVYK  1040
             KE  Y+
Sbjct  454   KECSYQ  459



>ref|XP_010249541.1| PREDICTED: kinesin-4-like isoform X3 [Nelumbo nucifera]
Length=1114

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 156/246 (63%), Gaps = 10/246 (4%)
 Frame = +3

Query  333   CFNNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAV  509
             C   M++  +A  +H G K  +VFQLK GC  D+    ISE+++  SL++A T+ L S V
Sbjct  223   CSPVMSEPSAALIHHVGHKFHEVFQLKHGCYADLPPAMISEMLRSTSLDNAPTQSLLSVV  282

Query  510   GDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDR  689
               IL+E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N YK+RE+KYQ + R
Sbjct  283   NGILDESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLYKAREEKYQSRIR  342

Query  690   AYEALRTGaaeeheiekakseekekhreQI---------ICMLQKDKDHHEMQISSLNHE  842
               E   TG  EE +I   + ++ +  + +I         +  L K+KD +  +ISSL  E
Sbjct  343   VLETYATGPNEETKIVMNQLQQTKTEKPKIEETKKHEQDVLRLIKEKDLNNHEISSLKQE  402

Query  843   LELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKR  1022
             L + K+TYE +CLQLE  +   +I+L  ++ ELECLL  S+++  ELEAFS SK   WK 
Sbjct  403   LVVAKRTYEERCLQLEAEVNGNKIDLEERLKELECLLKASQEEVKELEAFSNSKDENWKE  462

Query  1023  KEHVYK  1040
             KE  Y+
Sbjct  463   KECSYQ  468



>ref|XP_010249516.1| PREDICTED: kinesin-4-like isoform X1 [Nelumbo nucifera]
 ref|XP_010249524.1| PREDICTED: kinesin-4-like isoform X1 [Nelumbo nucifera]
Length=1134

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/246 (43%), Positives = 156/246 (63%), Gaps = 10/246 (4%)
 Frame = +3

Query  333   CFNNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAV  509
             C   M++  +A  +H G K  +VFQLK GC  D+    ISE+++  SL++A T+ L S V
Sbjct  223   CSPVMSEPSAALIHHVGHKFHEVFQLKHGCYADLPPAMISEMLRSTSLDNAPTQSLLSVV  282

Query  510   GDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDR  689
               IL+E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N YK+RE+KYQ + R
Sbjct  283   NGILDESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLYKAREEKYQSRIR  342

Query  690   AYEALRTGaaeeheiekakseekekhreQI---------ICMLQKDKDHHEMQISSLNHE  842
               E   TG  EE +I   + ++ +  + +I         +  L K+KD +  +ISSL  E
Sbjct  343   VLETYATGPNEETKIVMNQLQQTKTEKPKIEETKKHEQDVLRLIKEKDLNNHEISSLKQE  402

Query  843   LELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKR  1022
             L + K+TYE +CLQLE  +   +I+L  ++ ELECLL  S+++  ELEAFS SK   WK 
Sbjct  403   LVVAKRTYEERCLQLEAEVNGNKIDLEERLKELECLLKASQEEVKELEAFSNSKDENWKE  462

Query  1023  KEHVYK  1040
             KE  Y+
Sbjct  463   KECSYQ  468



>ref|XP_007036524.1| P-loop nucleoside triphosphate hydrolases superfamily protein 
with CH domain, putative [Theobroma cacao]
 gb|EOY21025.1| P-loop nucleoside triphosphate hydrolases superfamily protein 
with CH domain, putative [Theobroma cacao]
Length=979

 Score =   172 bits (435),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 153/243 (63%), Gaps = 11/243 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++  +A  +H G K  +VFQLK G   D+ A KISE+MK  SL++A T+ L S V  IL
Sbjct  171   MSEPSAAGLHHVGHKFHEVFQLKQGLYADLPATKISEMMKSNSLDNAPTQSLLSVVNGIL  230

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E++ERK G+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EA
Sbjct  231   DESVERKIGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKAREEKYQSRIRVLEA  290

Query  702   LRTGaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELEL  851
             L +GA EE +    + ++ +    ++          I  L K+ D H ++IS+L  ELE+
Sbjct  291   LASGAGEETKYVTNQLQQIKTENSKVQEKRKVEEQEIKQLMKENDKHNLEISALKQELEI  350

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              KK +E  C ++E  ++  +  L  +I ELECLL DS  +  ELE  SESK  +W  KE+
Sbjct  351   AKKMHEQHCFEVEAGVKGAKAGLQMRIKELECLLADSNNRVKELEVISESKCQRWNMKEN  410

Query  1032  VYK  1040
             +Y+
Sbjct  411   IYQ  413



>ref|XP_010242700.1| PREDICTED: kinesin-4-like isoform X5 [Nelumbo nucifera]
Length=566

 Score =   168 bits (425),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 150/240 (63%), Gaps = 9/240 (4%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++  +A  +H G K  +VFQLK GC  D+   KISE++K  SL++A T+ L S V  IL
Sbjct  98    MSESSAALIHHVGHKFHEVFQLKQGCYADLPPAKISEMLKSTSLDNAPTQSLLSVVNGIL  157

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N YK+RE+KY+ + R  E 
Sbjct  158   DESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLYKAREEKYKSRIRVLET  217

Query  702   LRTGaaeeh--------eiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCK  857
             L  G  E+            +    E+    EQ +  L K+KD  + +ISSL  EL + K
Sbjct  218   LAAGTNEKTKIVNELQQTKTEKTKMEERMKHEQDVLRLMKEKDLTDSEISSLKQELVMAK  277

Query  858   KTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVY  1037
             +TYE +CLQLE+  +  + +L  ++ ELE LL  S+++  E EAFS SK   WK+KE  Y
Sbjct  278   RTYEERCLQLESEAKGTKHDLEERLKELEFLLKTSQEEVKEFEAFSSSKAENWKKKECSY  337



>ref|XP_010322612.1| PREDICTED: kinesin-4-like isoform X2 [Solanum lycopersicum]
Length=985

 Score =   171 bits (432),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 106/233 (45%), Positives = 160/233 (69%), Gaps = 1/233 (0%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             MA+  +A  +H G K  +VFQLK G   D+   KISE+MK  SL+ A T+ L S V +IL
Sbjct  200   MAEPSAALLHHVGHKFHEVFQLKQGGYADLPPSKISEMMKSNSLDIAPTQSLLSVVNEIL  259

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EA
Sbjct  260   DESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKTREEKYQSRIRVLEA  319

Query  702   LRTGaaeeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCL  881
             L TG +EE +  K K + ++++ +Q +  L K+KD H  +I++L  ELE  KK +E +CL
Sbjct  320   LATGTSEETQSVKIKMDAEKRNEDQDVVRLMKEKDDHSQEIAALKQELETAKKAHEERCL  379

Query  882   QLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             ++E      + +L  ++ ++E LL +S+ +A E+E FSESK LKW +KE+VY+
Sbjct  380   EMEEEARTTQQKLEERLKDVEILLKESQSRAKEIETFSESKSLKWSKKENVYQ  432



>ref|XP_010242698.1| PREDICTED: kinesin-4-like isoform X3 [Nelumbo nucifera]
Length=621

 Score =   168 bits (425),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 150/240 (63%), Gaps = 9/240 (4%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++  +A  +H G K  +VFQLK GC  D+   KISE++K  SL++A T+ L S V  IL
Sbjct  228   MSESSAALIHHVGHKFHEVFQLKQGCYADLPPAKISEMLKSTSLDNAPTQSLLSVVNGIL  287

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N YK+RE+KY+ + R  E 
Sbjct  288   DESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLYKAREEKYKSRIRVLET  347

Query  702   LRTGaaeeh--------eiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCK  857
             L  G  E+            +    E+    EQ +  L K+KD  + +ISSL  EL + K
Sbjct  348   LAAGTNEKTKIVNELQQTKTEKTKMEERMKHEQDVLRLMKEKDLTDSEISSLKQELVMAK  407

Query  858   KTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVY  1037
             +TYE +CLQLE+  +  + +L  ++ ELE LL  S+++  E EAFS SK   WK+KE  Y
Sbjct  408   RTYEERCLQLESEAKGTKHDLEERLKELEFLLKTSQEEVKEFEAFSSSKAENWKKKECSY  467



>ref|XP_010242699.1| PREDICTED: kinesin-4-like isoform X4 [Nelumbo nucifera]
Length=610

 Score =   167 bits (424),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 150/240 (63%), Gaps = 9/240 (4%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++  +A  +H G K  +VFQLK GC  D+   KISE++K  SL++A T+ L S V  IL
Sbjct  228   MSESSAALIHHVGHKFHEVFQLKQGCYADLPPAKISEMLKSTSLDNAPTQSLLSVVNGIL  287

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N YK+RE+KY+ + R  E 
Sbjct  288   DESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLYKAREEKYKSRIRVLET  347

Query  702   LRTGaaeeh--------eiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCK  857
             L  G  E+            +    E+    EQ +  L K+KD  + +ISSL  EL + K
Sbjct  348   LAAGTNEKTKIVNELQQTKTEKTKMEERMKHEQDVLRLMKEKDLTDSEISSLKQELVMAK  407

Query  858   KTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVY  1037
             +TYE +CLQLE+  +  + +L  ++ ELE LL  S+++  E EAFS SK   WK+KE  Y
Sbjct  408   RTYEERCLQLESEAKGTKHDLEERLKELEFLLKTSQEEVKEFEAFSSSKAENWKKKECSY  467



>ref|XP_010242696.1| PREDICTED: kinesin-4-like isoform X2 [Nelumbo nucifera]
Length=672

 Score =   168 bits (425),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 150/240 (63%), Gaps = 9/240 (4%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++  +A  +H G K  +VFQLK GC  D+   KISE++K  SL++A T+ L S V  IL
Sbjct  228   MSESSAALIHHVGHKFHEVFQLKQGCYADLPPAKISEMLKSTSLDNAPTQSLLSVVNGIL  287

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N YK+RE+KY+ + R  E 
Sbjct  288   DESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLYKAREEKYKSRIRVLET  347

Query  702   LRTGaaeeh--------eiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCK  857
             L  G  E+            +    E+    EQ +  L K+KD  + +ISSL  EL + K
Sbjct  348   LAAGTNEKTKIVNELQQTKTEKTKMEERMKHEQDVLRLMKEKDLTDSEISSLKQELVMAK  407

Query  858   KTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVY  1037
             +TYE +CLQLE+  +  + +L  ++ ELE LL  S+++  E EAFS SK   WK+KE  Y
Sbjct  408   RTYEERCLQLESEAKGTKHDLEERLKELEFLLKTSQEEVKEFEAFSSSKAENWKKKECSY  467



>ref|XP_010242695.1| PREDICTED: kinesin-4-like isoform X1 [Nelumbo nucifera]
Length=696

 Score =   168 bits (425),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 104/240 (43%), Positives = 150/240 (63%), Gaps = 9/240 (4%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++  +A  +H G K  +VFQLK GC  D+   KISE++K  SL++A T+ L S V  IL
Sbjct  228   MSESSAALIHHVGHKFHEVFQLKQGCYADLPPAKISEMLKSTSLDNAPTQSLLSVVNGIL  287

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N YK+RE+KY+ + R  E 
Sbjct  288   DESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLYKAREEKYKSRIRVLET  347

Query  702   LRTGaaeeh--------eiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCK  857
             L  G  E+            +    E+    EQ +  L K+KD  + +ISSL  EL + K
Sbjct  348   LAAGTNEKTKIVNELQQTKTEKTKMEERMKHEQDVLRLMKEKDLTDSEISSLKQELVMAK  407

Query  858   KTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVY  1037
             +TYE +CLQLE+  +  + +L  ++ ELE LL  S+++  E EAFS SK   WK+KE  Y
Sbjct  408   RTYEERCLQLESEAKGTKHDLEERLKELEFLLKTSQEEVKEFEAFSSSKAENWKKKECSY  467



>ref|XP_006440967.1| hypothetical protein CICLE_v10023895mg, partial [Citrus clementina]
 gb|ESR54207.1| hypothetical protein CICLE_v10023895mg, partial [Citrus clementina]
Length=819

 Score =   168 bits (426),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 106/254 (42%), Positives = 159/254 (63%), Gaps = 16/254 (6%)
 Frame = +3

Query  327   IDCFNNMAKEL-----SASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESAST  488
             I+C  N+  E      +A  +H G K  +VFQLK GC  D+ A KI+E+MK  SL++A T
Sbjct  122   INCLLNLRAEYITEPSTALLHHVGHKFHEVFQLKQGCYSDLPAAKITEMMKSTSLDNAPT  181

Query  489   RLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQ  668
             + L S V  IL+E+++RKNG+IP  V+ LL+ V+QEIE+R+S Q+++LR Q+N +K+RE+
Sbjct  182   QSLLSVVNGILDESVDRKNGEIPHRVACLLRKVVQEIERRISTQADHLRTQNNLFKTREE  241

Query  669   KYQLKDRAYEALRTGaaeeheiekakseekekhreQI----------ICMLQKDKDHHEM  818
             KYQ + R  EAL +G  EE EI   + ++ +  + ++          +  L K+KD   +
Sbjct  242   KYQSRIRVLEALASGTGEETEIVMNQLQQIKTEKSKLEEKKKLEDDDVAKLMKEKDQQML  301

Query  819   QISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSE  998
             +  +L  ELE+ KKTYE +CLQ+ET  +  +     +I ELE LL  S+ K  ELEA S+
Sbjct  302   ENLALKRELEMAKKTYELRCLQMETEYKGAKSGFEERIKELEHLLQVSRNKVRELEANSD  361

Query  999   SKLLKWKRKEHVYK  1040
             SK  +W RKE +Y+
Sbjct  362   SKYQRWSRKESIYQ  375



>ref|XP_009605734.1| PREDICTED: kinesin-4-like, partial [Nicotiana tomentosiformis]
Length=822

 Score =   168 bits (426),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 104/243 (43%), Positives = 159/243 (65%), Gaps = 11/243 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             MA+  +A  +H G K  +VFQLK G   D+   KISE+MK  SL+ A T+ L S V  IL
Sbjct  215   MAEPSAALLHHVGHKFHEVFQLKQGGYADLPPSKISEMMKSNSLDIAPTQSLLSVVNGIL  274

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EA
Sbjct  275   DESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKTREEKYQSRIRVLEA  334

Query  702   LRTGaaeeheiekak----------seekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
             L TG +EE +I   +           EE++K+ +Q +  L K+KD H  +I++L  E+E+
Sbjct  335   LATGTSEETQIVMNQLQQIKNVKIKMEEEKKNEDQDVVRLMKEKDDHSQEIAALKQEMEI  394

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              K+TYE + +++E    + + +L  ++ E+E LL +S  +  E+E FSESK  +W +KE+
Sbjct  395   AKRTYEQRSVEMEKEAREAQQKLEERLKEVESLLKESTNRVKEIEMFSESKSQRWSKKEN  454

Query  1032  VYK  1040
             VY+
Sbjct  455   VYQ  457



>ref|XP_009348139.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-4 [Pyrus x bretschneideri]
Length=932

 Score =   169 bits (427),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 154/244 (63%), Gaps = 14/244 (6%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             MA+   +  +H G K  +VFQLK G   D+ A KISE+MK  SL++A T+ L S V  IL
Sbjct  192   MAETSPSRMHHVGHKFHEVFQLKQGGYADLPAAKISEMMKPNSLDNAPTQSLLSVVNGIL  251

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E++ERKNG+IP  VS LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  E 
Sbjct  252   DESVERKNGEIPHRVSCLLRRVVQEIERRISTQAEHLRTQNNLFKAREEKYQSRIRVLET  311

Query  702   LRTGaaeeheiekakseekekhreQI------------ICMLQKDKDHHEMQISSLNHEL  845
             L +G +EE E+     ++ +  R ++            +  L K++D   ++IS L  EL
Sbjct  312   LASGTSEESELMMNHLQQIKNERTRMEAKKKTDDEDVNVIRLMKERDQSNLEISGLKQEL  371

Query  846   ELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRK  1025
             ++ KKTY+ +CLQ+ET  +  R EL  +I ELE LL +S+ K  EL+A SESK   W +K
Sbjct  372   DIAKKTYDLRCLQMETEAKGARAELEERIKELERLLAESRSKVKELQANSESK-HHWSKK  430

Query  1026  EHVY  1037
               VY
Sbjct  431   LRVY  434



>ref|XP_012093054.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-4 [Jatropha curcas]
Length=1071

 Score =   169 bits (427),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 104/239 (44%), Positives = 151/239 (63%), Gaps = 16/239 (7%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
             +HAG K  +VFQLK G   D+ A KISE+MK  SL++A T+ L S V  IL+E+IERKNG
Sbjct  216   HHAGHKFHEVFQLKQGRYADLSAAKISEMMKSNSLDNAPTQSLLSVVNGILDESIERKNG  275

Query  549   DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
             +IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +KSRE+KYQ + R  EAL +G  EE 
Sbjct  276   EIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKSREEKYQSRIRVLEALASGTGEET  335

Query  729   eiekakseekekhreQI---------------ICMLQKDKDHHEMQISSLNHELELCKKT  863
              I K   ++ +    ++               +  L K+K+   +++S+L  ELE+ KKT
Sbjct  336   GIVKGHLQQIKVXTHELEKSKLDEKRKLEEEAVIKLMKEKEQSNIELSALKQELEMTKKT  395

Query  864   YEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             YE  CLQ+ET  +  + E   ++ EL  LL DS+ K   LEA+SES+   WK+KE +++
Sbjct  396   YELHCLQMETEAKDAKAEFEERLKELGHLLEDSRNKVKMLEAYSESQNQSWKKKELIFQ  454



>ref|XP_009763271.1| PREDICTED: kinesin-4-like isoform X2 [Nicotiana sylvestris]
Length=918

 Score =   167 bits (423),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 159/243 (65%), Gaps = 11/243 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             MA+  +A  +H G K  +VFQLK G   D+   KISE+MK  SL+ A T+ L S V  IL
Sbjct  214   MAEPSAALLHHVGHKFHEVFQLKQGGYADLPPSKISEMMKSNSLDIAPTQSLLSVVNGIL  273

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EA
Sbjct  274   DESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKTREEKYQSRIRVLEA  333

Query  702   LRTGaaeeheiekak----------seekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
             L TG +EE +I   +           EE++K+ +Q +  L K+KD H  +I+++  E+E+
Sbjct  334   LATGTSEETQIVMNQLQQIKNVKIKMEEEKKNEDQDVVRLMKEKDDHSQEIATVKQEMEI  393

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              K+TYE + +++E    + + +L  ++ E+E LL +S  +  E+E FSESK  +W +KE+
Sbjct  394   AKRTYEQRSVEMEKEAREAQQKLEERLKEVESLLKESTNRVKEIEMFSESKSQRWSKKEN  453

Query  1032  VYK  1040
             VY+
Sbjct  454   VYQ  456



>ref|XP_009763270.1| PREDICTED: kinesin-4-like isoform X1 [Nicotiana sylvestris]
Length=1006

 Score =   167 bits (424),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 159/243 (65%), Gaps = 11/243 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             MA+  +A  +H G K  +VFQLK G   D+   KISE+MK  SL+ A T+ L S V  IL
Sbjct  214   MAEPSAALLHHVGHKFHEVFQLKQGGYADLPPSKISEMMKSNSLDIAPTQSLLSVVNGIL  273

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EA
Sbjct  274   DESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKTREEKYQSRIRVLEA  333

Query  702   LRTGaaeeheiekak----------seekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
             L TG +EE +I   +           EE++K+ +Q +  L K+KD H  +I+++  E+E+
Sbjct  334   LATGTSEETQIVMNQLQQIKNVKIKMEEEKKNEDQDVVRLMKEKDDHSQEIATVKQEMEI  393

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              K+TYE + +++E    + + +L  ++ E+E LL +S  +  E+E FSESK  +W +KE+
Sbjct  394   AKRTYEQRSVEMEKEAREAQQKLEERLKEVESLLKESTNRVKEIEMFSESKSQRWSKKEN  453

Query  1032  VYK  1040
             VY+
Sbjct  454   VYQ  456



>gb|KDO57448.1| hypothetical protein CISIN_1g042277mg, partial [Citrus sinensis]
Length=899

 Score =   166 bits (420),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/243 (42%), Positives = 155/243 (64%), Gaps = 11/243 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++  +A  +H G K  +VFQLK GC  D+ A KI+E+MK  SL++A T+ L S V  IL
Sbjct  187   MSESSTALLHHVGHKFHEVFQLKQGCYADLPAAKITEMMKSTSLDNAPTQSLLSVVNGIL  246

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+++RKNG+IP  V+ LL+ V+QEIE+R+S Q+++LR Q+N +K+RE+KYQ + R  EA
Sbjct  247   DESVDRKNGEIPHRVACLLRKVVQEIERRISTQADHLRTQNNLFKTREEKYQSRIRVLEA  306

Query  702   LRTGaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELEL  851
             L +G  EE EI   + ++ +  + ++          +  L K+KD   ++  +L  ELE+
Sbjct  307   LASGTGEETEIVMNQLQQIKTEKSKLEEKKKLEDDDVAKLMKEKDQQMLENLALKQELEM  366

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              KKTYE +CL +ET  +  +     +I ELE LL  S+ K  ELEA S+SK  +W RKE 
Sbjct  367   AKKTYELRCLHMETEYKGAKSGFEERIKELEHLLQVSRNKVRELEANSDSKYQRWSRKES  426

Query  1032  VYK  1040
             +Y+
Sbjct  427   IYQ  429



>ref|XP_008794166.1| PREDICTED: kinesin-4-like [Phoenix dactylifera]
Length=1077

 Score =   166 bits (421),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 103/239 (43%), Positives = 157/239 (66%), Gaps = 9/239 (4%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLK-IGCEDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++ +SA ++HAG K  +VFQLK +   D+   KISE+MK  SL++A T+ L S V  IL
Sbjct  188   MSEPISALSHHAGHKFHEVFQLKQVRYSDLPPAKISEMMKSNSLDNAPTQSLLSVVNGIL  247

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E++R Q+N  K+RE KYQ + +  EA
Sbjct  248   DESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHIRNQNNLIKAREDKYQSRIKVLEA  307

Query  702   LRTGaaeeheiekakseekekhreQ--------IICMLQKDKDHHEMQISSLNHELELCK  857
             L TG +E  +I   +  + EK++ +         +  L K+K++ +  +S L  +LE  K
Sbjct  308   LATGTSEGTQIAMNRQIKMEKNKIEERNKVGDDDVVRLMKEKENSDNMVSKLKEDLETTK  367

Query  858   KTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHV  1034
             K+Y+ +CL+LET  ++ + EL  +I  +E LL +S+KK  ELE FSESK   WK+K +V
Sbjct  368   KSYDQQCLRLETKAKETKEELEQRIKAVEFLLAESRKKTKELETFSESKSQNWKQKANV  426



>ref|XP_008393309.1| PREDICTED: kinesin KP1 isoform X3 [Malus domestica]
Length=951

 Score =   166 bits (419),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 102/212 (48%), Positives = 144/212 (68%), Gaps = 1/212 (0%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
             +H G K  +VFQLK G   D+ A KISE+MK  SL++A T+ L S V  IL+E++ERKNG
Sbjct  63    HHVGHKFHEVFQLKQGGYADLPAAKISEMMKPNSLDNAPTQSLLSVVNGILDESVERKNG  122

Query  549   DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
             +IPQ VS LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  E L +G +EE 
Sbjct  123   EIPQRVSCLLRKVVQEIERRISTQAEHLRTQNNLFKAREEKYQSRIRVLETLASGTSEES  182

Query  729   eiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKM  908
             E E+ + E K+K  ++ +  L K+KD   ++IS L  EL++ KKTY+ +CL +ET  +  
Sbjct  183   ENERTRMEAKKKTDDEDVIRLMKEKDQCNLEISGLRQELDIAKKTYDLRCLXMETEAKGA  242

Query  909   RIELGNKIMELECLLTDSKKKADELEAFSESK  1004
             R EL  +  ELE LL  S+ K  EL+  SESK
Sbjct  243   RAELEERTKELERLLAASRSKVKELQENSESK  274



>ref|XP_010243529.1| PREDICTED: kinesin KP1-like, partial [Nelumbo nucifera]
Length=905

 Score =   165 bits (417),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 104/234 (44%), Positives = 153/234 (65%), Gaps = 11/234 (5%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
             +H G K  D+FQLK  C  ++ A KISE++K  SLE+A T+ L S V  IL+E+IERKNG
Sbjct  19    HHVGHKFHDLFQLKQRCYANLPATKISEMLKSTSLENAPTQSLLSVVKGILDESIERKNG  78

Query  549   DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
             +I   V+ LLK V+QEIE+R++ Q+E+L  Q++ YK+RE+KYQ + R  E L TGA EE 
Sbjct  79    EIAHRVACLLKKVVQEIERRIATQAEHLGTQNSLYKAREEKYQSRIRVLETLATGAHEET  138

Query  729   eiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKC  878
             +I   + ++ +K + ++             L K+KD  + +ISSL  EL++ K+TYE +C
Sbjct  139   KIVMNQLQQMKKEKIEMEERKKLQEQDALRLMKEKDLTDHEISSLKEELQIAKRTYEERC  198

Query  879   LQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             LQLE   +  ++ L  ++ ELECLL  S+K+  ELEAF++SK   WK+KE  Y+
Sbjct  199   LQLEEEAKGTKVGLEERLKELECLLDASQKEVKELEAFTDSKSENWKKKERNYQ  252



>ref|XP_010322614.1| PREDICTED: kinesin-4-like isoform X4 [Solanum lycopersicum]
Length=904

 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/243 (44%), Positives = 160/243 (66%), Gaps = 11/243 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             MA+  +A  +H G K  +VFQLK G   D+   KISE+MK  SL+ A T+ L S V +IL
Sbjct  200   MAEPSAALLHHVGHKFHEVFQLKQGGYADLPPSKISEMMKSNSLDIAPTQSLLSVVNEIL  259

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EA
Sbjct  260   DESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKTREEKYQSRIRVLEA  319

Query  702   LRTGaaeehe----------iekakseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
             L TG +EE +            K K + ++++ +Q +  L K+KD H  +I++L  ELE 
Sbjct  320   LATGTSEETQIVMNQLQQIKSVKIKMDAEKRNEDQDVVRLMKEKDDHSQEIAALKQELET  379

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              KK +E +CL++E      + +L  ++ ++E LL +S+ +A E+E FSESK LKW +KE+
Sbjct  380   AKKAHEERCLEMEEEARTTQQKLEERLKDVEILLKESQSRAKEIETFSESKSLKWSKKEN  439

Query  1032  VYK  1040
             VY+
Sbjct  440   VYQ  442



>ref|XP_010322613.1| PREDICTED: kinesin-4-like isoform X3 [Solanum lycopersicum]
Length=905

 Score =   162 bits (410),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/243 (44%), Positives = 160/243 (66%), Gaps = 11/243 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             MA+  +A  +H G K  +VFQLK G   D+   KISE+MK  SL+ A T+ L S V +IL
Sbjct  200   MAEPSAALLHHVGHKFHEVFQLKQGGYADLPPSKISEMMKSNSLDIAPTQSLLSVVNEIL  259

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EA
Sbjct  260   DESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKTREEKYQSRIRVLEA  319

Query  702   LRTGaaeehe----------iekakseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
             L TG +EE +            K K + ++++ +Q +  L K+KD H  +I++L  ELE 
Sbjct  320   LATGTSEETQIVMNQLQQIKSVKIKMDAEKRNEDQDVVRLMKEKDDHSQEIAALKQELET  379

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              KK +E +CL++E      + +L  ++ ++E LL +S+ +A E+E FSESK LKW +KE+
Sbjct  380   AKKAHEERCLEMEEEARTTQQKLEERLKDVEILLKESQSRAKEIETFSESKSLKWSKKEN  439

Query  1032  VYK  1040
             VY+
Sbjct  440   VYQ  442



>ref|XP_010322609.1| PREDICTED: kinesin-4-like isoform X1 [Solanum lycopersicum]
 ref|XP_010322610.1| PREDICTED: kinesin-4-like isoform X1 [Solanum lycopersicum]
 ref|XP_010322611.1| PREDICTED: kinesin-4-like isoform X1 [Solanum lycopersicum]
Length=995

 Score =   162 bits (411),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 106/243 (44%), Positives = 160/243 (66%), Gaps = 11/243 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             MA+  +A  +H G K  +VFQLK G   D+   KISE+MK  SL+ A T+ L S V +IL
Sbjct  200   MAEPSAALLHHVGHKFHEVFQLKQGGYADLPPSKISEMMKSNSLDIAPTQSLLSVVNEIL  259

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EA
Sbjct  260   DESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKTREEKYQSRIRVLEA  319

Query  702   LRTGaaeehe----------iekakseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
             L TG +EE +            K K + ++++ +Q +  L K+KD H  +I++L  ELE 
Sbjct  320   LATGTSEETQIVMNQLQQIKSVKIKMDAEKRNEDQDVVRLMKEKDDHSQEIAALKQELET  379

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              KK +E +CL++E      + +L  ++ ++E LL +S+ +A E+E FSESK LKW +KE+
Sbjct  380   AKKAHEERCLEMEEEARTTQQKLEERLKDVEILLKESQSRAKEIETFSESKSLKWSKKEN  439

Query  1032  VYK  1040
             VY+
Sbjct  440   VYQ  442



>ref|XP_011072725.1| PREDICTED: carboxy-terminal kinesin 2-like [Sesamum indicum]
 ref|XP_011072733.1| PREDICTED: carboxy-terminal kinesin 2-like [Sesamum indicum]
 ref|XP_011072742.1| PREDICTED: carboxy-terminal kinesin 2-like [Sesamum indicum]
Length=894

 Score =   162 bits (409),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 108/250 (43%), Positives = 150/250 (60%), Gaps = 31/250 (12%)
 Frame = +3

Query  324   QIDCFNNMAKELSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLF  500
             +I+ FN +++         GS   DV Q K G   DI            SLE+ ST+ LF
Sbjct  29    RIEAFNGLSE---------GSYFSDVLQAKCGHYGDI-----------PSLENTSTQSLF  68

Query  501   SAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQL  680
             +    IL+E +E KN +IPQ V+S+LKLV+ EI++RVSKQ++N+RKQ   Y SRE++YQ 
Sbjct  69    TVTNMILDECVEGKNENIPQRVASILKLVMLEIQERVSKQAQNMRKQSTLYNSREERYQS  128

Query  681   KDRAYEALRTGaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISS  830
             K RA E L TG  EE+E+   +  + +  + +I          + +L+++KD  E  I S
Sbjct  129   KIRALETLATGTTEENEVVMNQLRQMKLEKTKIEEVLKLEQHDLTILRQEKDRCESLILS  188

Query  831   LNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLL  1010
             L  E+ L K+ YE KC QLE   E+ + +L  KI+ELE LLTDS+ K  ELE FSESK L
Sbjct  189   LEEEIRLTKQDYEEKCFQLEARAEETKDKLLKKILELERLLTDSRNKVKELEDFSESKFL  248

Query  1011  KWKRKEHVYK  1040
             +WKRKEH Y+
Sbjct  249   RWKRKEHGYR  258



>ref|XP_008240320.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-2 [Prunus mume]
Length=1135

 Score =   161 bits (408),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 100/222 (45%), Positives = 149/222 (67%), Gaps = 8/222 (4%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++  +A  +H G K  +VFQ+K GC  D+ A KISE+MK  SL++A T+ L S V  IL
Sbjct  182   MSEPSAALMHHVGHKFHEVFQMKQGCYADLPAAKISEMMKPNSLDNAPTQSLLSVVNGIL  241

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E++ERK+G+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + +  EA
Sbjct  242   DESVERKSGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKAREEKYQSRVKVLEA  301

Query  702   LRTGaaeeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCL  881
             L +G +EE + E+ + E K+K  ++ +  L K+KD   ++IS L  EL++ KKTY+ +CL
Sbjct  302   LASGTSEESQNERTRLEAKKKIDDEDVIRLLKEKDQSNLEISGLKQELDIAKKTYDLRCL  361

Query  882   QLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKL  1007
             Q+ET  +  R        ELE LL +S+ K  ELE  SESK 
Sbjct  362   QMETEAKGAR-------AELERLLEESRNKVKELEGNSESKF  396



>ref|XP_008795115.1| PREDICTED: kinesin-4-like [Phoenix dactylifera]
Length=1061

 Score =   160 bits (406),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 108/236 (46%), Positives = 156/236 (66%), Gaps = 7/236 (3%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++  SA ++HAG K  +VFQLK G   D+   KISE+MK  SL++A T+ L S V  IL
Sbjct  189   MSEPASALSHHAGHKFHEVFQLKQGRYSDLPPAKISEMMKSNSLDNAPTQSLLSVVNGIL  248

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IPQ VS LL+ V+QEIE+R+S Q+E++R Q+N  K+RE+KYQ + +  E 
Sbjct  249   DESIERKNGEIPQ-VSCLLRKVVQEIERRISTQAEHIRNQNNLIKAREEKYQSRIKLLET  307

Query  702   LRTGaaeehe-----iekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTY  866
             L TG  EE +     +EK K EE++K  E+ +  L K+K+  +  +S L  +LE  K +Y
Sbjct  308   LATGTNEETQVFYLQMEKNKIEERKKVSEEDVVRLMKEKEDSDNIVSKLKEDLEATKNSY  367

Query  867   EGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHV  1034
             E  C QLET  ++ + EL  ++ E+E LL +S+K+  ELE FSESK   W +K +V
Sbjct  368   EQHCQQLETKAKQTKEELERRVKEVEFLLAESRKRTKELETFSESKSQNWNQKAYV  423



>ref|XP_008346792.1| PREDICTED: kinesin-4-like [Malus domestica]
Length=977

 Score =   160 bits (404),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 100/233 (43%), Positives = 146/233 (63%), Gaps = 13/233 (6%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             MA+   +  +H G K  +V QLK G   D+ A KISE+MK  SL++A T+ L S V  IL
Sbjct  192   MAETSPSRMHHVGHKFHEVLQLKQGSYADLPAAKISEMMKPNSLDNAPTQSLLSVVNGIL  251

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E +ERKNG+IP  VS LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  E 
Sbjct  252   DEGVERKNGEIPHRVSCLLRRVVQEIERRISTQAEHLRTQNNLFKAREEKYQSRIRVLET  311

Query  702   LRTGaaeeheiekakseekekhreQI------------ICMLQKDKDHHEMQISSLNHEL  845
             L +G +EE E+     ++ +  R ++            +  L K++D   ++IS L  EL
Sbjct  312   LASGTSEESELMMNHLQQIKSERTRMEAKKKTDGEDVNVIRLMKERDQGNLEISGLKQEL  371

Query  846   ELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESK  1004
             ++ KKTY+ +CLQ+E   +  R EL  +I ELE LL +S+ K  EL+A SESK
Sbjct  372   DIAKKTYDLRCLQMEMEEKGARTELEERIKELERLLAESRSKVKELQANSESK  424



>ref|XP_008393308.1| PREDICTED: kinesin KP1 isoform X2 [Malus domestica]
Length=956

 Score =   159 bits (403),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 102/217 (47%), Positives = 144/217 (66%), Gaps = 6/217 (3%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLE-----SASTRLLFSAVGDILNENI  533
             +H G K  +VFQLK G   D+ A KISE+MK  SL+     +A T+ L S V  IL+E++
Sbjct  63    HHVGHKFHEVFQLKQGGYADLPAAKISEMMKPNSLDHLLLQNAPTQSLLSVVNGILDESV  122

Query  534   ERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             ERKNG+IPQ VS LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  E L +G
Sbjct  123   ERKNGEIPQRVSCLLRKVVQEIERRISTQAEHLRTQNNLFKAREEKYQSRIRVLETLASG  182

Query  714   aaeeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLET  893
              +EE E E+ + E K+K  ++ +  L K+KD   ++IS L  EL++ KKTY+ +CL +ET
Sbjct  183   TSEESENERTRMEAKKKTDDEDVIRLMKEKDQCNLEISGLRQELDIAKKTYDLRCLXMET  242

Query  894   HLEKMRIELGNKIMELECLLTDSKKKADELEAFSESK  1004
               +  R EL  +  ELE LL  S+ K  EL+  SESK
Sbjct  243   EAKGARAELEERTKELERLLAASRSKVKELQENSESK  279



>ref|XP_002532147.1| kinesin heavy chain, putative [Ricinus communis]
 gb|EEF30221.1| kinesin heavy chain, putative [Ricinus communis]
Length=892

 Score =   159 bits (401),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 100/236 (42%), Positives = 151/236 (64%), Gaps = 4/236 (2%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M    +A  +H G K  +VFQLK G   D+ A KISE+MK  SL++A T+ L S V  IL
Sbjct  64    MTDTPTALMHHVGHKFHEVFQLKQGRYADLSAAKISEMMKSNSLDNAPTQSLLSVVNGIL  123

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+K+Q + R  EA
Sbjct  124   DESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKAREEKFQSRIRVLEA  183

Query  702   LRTGaaeeheiekaksee---kekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEG  872
             L +G    +   + +  +   K K  E+    L+K+K+   +++S+L  EL++ K+ +E 
Sbjct  184   LASGNEIANRTHEHEKSKIYEKRKTEEEDAIKLEKEKERINVELSALKQELKIAKEKHEL  243

Query  873   KCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
              CLQ+E   + +R EL  +I EL  LL DS+ K   LE +SESK   WK+KE +++
Sbjct  244   HCLQMEKDAKDVREELEARIKELGSLLEDSRSKVKVLEVYSESKQQLWKKKELIFQ  299



>ref|XP_002321471.2| hypothetical protein POPTR_0015s03640g, partial [Populus trichocarpa]
 gb|EEF05598.2| hypothetical protein POPTR_0015s03640g, partial [Populus trichocarpa]
Length=965

 Score =   158 bits (399),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 105/245 (43%), Positives = 159/245 (65%), Gaps = 7/245 (3%)
 Frame = +3

Query  327   IDCFNNMAKEL------SASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESAS  485
             I C+  +A+        +AS  H   K  ++FQLK GC  D+ A KISE+MK  SL++A 
Sbjct  179   ILCYMKIARNFPLMHPSAASMPHVVHKFHEMFQLKQGCYSDLSAAKISEMMKSNSLDNAP  238

Query  486   TRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSRE  665
             T+ L S V  IL+E+IERK+ +IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K RE
Sbjct  239   TQSLLSVVNGILDESIERKSDEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKVRE  298

Query  666   QKYQLKDRAYEALRTGaaeeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHEL  845
             +KYQ + R  EAL +G  EE  IEK+K EE++K     +  L K+++  ++++S+L  EL
Sbjct  299   EKYQSRIRVLEALASGTGEERGIEKSKMEEEKKIGVDHVAKLTKEQEQRDLELSALKQEL  358

Query  846   ELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRK  1025
             EL K+T+E   LQ+ET  +  +  L  ++ ELE  L DS+ +   LEA+S+SK   + +K
Sbjct  359   ELVKQTHELHRLQMETEAKAAKGGLEGRLKELEIHLEDSRNQVRVLEAYSQSKSKMFNKK  418

Query  1026  EHVYK  1040
             EH++K
Sbjct  419   EHIFK  423



>ref|XP_010915403.1| PREDICTED: kinesin-4-like [Elaeis guineensis]
Length=1084

 Score =   157 bits (397),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 99/241 (41%), Positives = 151/241 (63%), Gaps = 11/241 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++  SA  ++AG K  +VFQLK G   D+   KISE+MK  SL++A T+ L S V  IL
Sbjct  188   MSEPSSAVAHNAGHKFHEVFQLKQGRYSDLPPAKISEMMKSNSLDNAPTQSLLSVVNGIL  247

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IERKNG+IPQ V+ LL+ V+QEIE+R+S Q+E++R Q+N  K+RE+KYQ + +  E 
Sbjct  248   DESIERKNGEIPQRVACLLRKVVQEIERRISTQAEHIRNQNNLIKAREEKYQSRIKLLET  307

Query  702   LRTGaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELEL  851
             L TG  EE +I   + ++ +  + +           +  L K+K+  +  +S L  +L+ 
Sbjct  308   LATGTNEETQISINQVQQIKMEKSRTEERKKVSEEDVVRLMKEKEDSDNIVSKLKEDLKT  367

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              K++YE  C Q ET  ++ + EL  ++ E+E LL +S+K+  ELEAFS SK   W +K H
Sbjct  368   TKRSYEQHCQQQETKAKQTQEELERRVKEVEFLLAESRKRTKELEAFSASKSQNWNQKAH  427

Query  1032  V  1034
             V
Sbjct  428   V  428



>ref|XP_006485789.1| PREDICTED: kinesin-4-like isoform X1 [Citrus sinensis]
Length=905

 Score =   155 bits (391),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 102/248 (41%), Positives = 153/248 (62%), Gaps = 16/248 (6%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLE-----SASTRLLFSA  506
             M++  +A  +H G K  +VFQLK G   D+ A KI+E+MK  SL+     +A T+ L S 
Sbjct  195   MSEPSTALLHHVGHKFHEVFQLKQGRYSDLPAAKITEMMKSTSLDHLLLQNAPTQSLLSV  254

Query  507   VGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKD  686
             V  IL+E+++RKNG+IP  V+ LL+ V+QEIE+R+S Q+++LR Q+N +K+RE+KYQ + 
Sbjct  255   VNGILDESVDRKNGEIPHRVACLLRKVVQEIERRISTQADHLRTQNNLFKTREEKYQSRI  314

Query  687   RAYEALRTGaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLN  836
             R  EAL +G  EE EI   + ++ +  + ++          +  L K+KD   ++  +L 
Sbjct  315   RVLEALASGTGEETEIVMNQLQQIKTEKSKLEEKKKLEDDDVAKLMKEKDQQMLENLALK  374

Query  837   HELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKW  1016
              ELE+ KKTYE +CLQ ET  +        +I ELE LL  S+ K  ELEA S+SK  +W
Sbjct  375   QELEMAKKTYELRCLQRETEYKGANSGFEERIKELEHLLQVSRNKVRELEANSDSKYQRW  434

Query  1017  KRKEHVYK  1040
              RKE +Y+
Sbjct  435   SRKESIYQ  442



>ref|XP_010053254.1| PREDICTED: kinesin KP1 [Eucalyptus grandis]
 ref|XP_010053255.1| PREDICTED: kinesin KP1 [Eucalyptus grandis]
 ref|XP_010053256.1| PREDICTED: kinesin KP1 [Eucalyptus grandis]
 gb|KCW77514.1| hypothetical protein EUGRSUZ_D01842 [Eucalyptus grandis]
Length=925

 Score =   154 bits (388),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 111/279 (40%), Positives = 158/279 (57%), Gaps = 14/279 (5%)
 Frame = +3

Query  240   MNTESEMPGAEKGEQANINAFRSFNASEQIDCFNNMAKELSASNNH-AGSKLPDVFQLKI  416
             MN   E   AE G  A  N  R     E  D F  + +E  AS NH  G K+ +  QLK 
Sbjct  1     MNFHLEEHKAENGRFAGFNGSR--GGDECTDGFEGLVEEPLASANHQPGYKIQETLQLKQ  58

Query  417   GC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQ  593
                 D+   K  EL+K  SLE+A T+ LFS    IL EN ERKNG++   ++ LL+ VLQ
Sbjct  59    EFFADLSTTKSMELIKLTSLENAPTQSLFSVANRILEENFERKNGELSHRMACLLRKVLQ  118

Query  594   EIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhre  773
              IE+R+S Q+EN + Q++ YKSREQK+Q + +  E L  G  EE+E+     E  +  + 
Sbjct  119   IIERRMSVQAENFKHQNDVYKSREQKFQSRIKVLETLAKGTCEENEVALKNLESIKIEKI  178

Query  774   QI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELG  923
             ++          I  ++K+KD    ++S+L  ++E+ +KTYE + LQLE    K ++EL 
Sbjct  179   KVEERKKLEDMDIVKMKKEKDDICAEVSTLKSDIEMARKTYENQRLQLEAEAGKTKLELE  238

Query  924   NKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
               + ELEC L DS+KK  ELE FS +K  +WKRKE+ Y+
Sbjct  239   KMVEELECQLEDSRKKVAELEEFSANKYQRWKRKENKYQ  277



>ref|XP_007209035.1| hypothetical protein PRUPE_ppa014950mg, partial [Prunus persica]
 gb|EMJ10234.1| hypothetical protein PRUPE_ppa014950mg, partial [Prunus persica]
Length=1084

 Score =   153 bits (386),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 103/238 (43%), Positives = 151/238 (63%), Gaps = 20/238 (8%)
 Frame = +3

Query  330   DCFNNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSA  506
             D F+ + K  +A  +H G K  +VFQ+K GC  D+ A KISE+MK  SL++A T+ L S 
Sbjct  152   DGFS-ITKPSAALMHHVGHKFHEVFQMKQGCYADLPAAKISEMMKPNSLDNAPTQSLLSV  210

Query  507   VGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKD  686
             V  IL+E++ERK+G+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + 
Sbjct  211   VNGILDESVERKSGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKAREEKYQSRV  270

Query  687   RAYEALRTGaaeehe-----------iekakseekekhreQIICMLQKDKDHHEMQISSL  833
             +  EAL +G +EE +            E+ + E K+K  ++ +  L K+KD   ++IS L
Sbjct  271   KVLEALASGTSEESQLVMNHHLQQIKNERTRLEAKKKIDDEDVIRLLKEKDQSNLEISGL  330

Query  834   NHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKL  1007
               EL++ KKTY+ +CLQ+ET  +  R        ELE LL +S  K  ELEA SESK 
Sbjct  331   KQELDIAKKTYDLRCLQMETEAKGAR-------AELERLLEESTNKVKELEANSESKF  381



>ref|XP_008393310.1| PREDICTED: kinesin-4 isoform X4 [Malus domestica]
Length=931

 Score =   152 bits (383),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 142/227 (63%), Gaps = 16/227 (7%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLE-----SASTRLLFSAVGDILNENI  533
             +H G K  +VFQLK G   D+ A KISE+MK  SL+     +A T+ L S V  IL+E++
Sbjct  63    HHVGHKFHEVFQLKQGGYADLPAAKISEMMKPNSLDHLLLQNAPTQSLLSVVNGILDESV  122

Query  534   ERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             ERKNG+IPQ VS LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  E L +G
Sbjct  123   ERKNGEIPQRVSCLLRKVVQEIERRISTQAEHLRTQNNLFKAREEKYQSRIRVLETLASG  182

Query  714   aaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKT  863
              +EE E+     ++ +  R ++          +  L K+KD   ++IS L  EL++ KKT
Sbjct  183   TSEESELIMNHLQQIKNERTRMEAKKKTDDEDVIRLMKEKDQCNLEISGLRQELDIAKKT  242

Query  864   YEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESK  1004
             Y+ +CL +ET  +  R EL  +  ELE LL  S+ K  EL+  SESK
Sbjct  243   YDLRCLXMETEAKGARAELEERTKELERLLAASRSKVKELQENSESK  289



>ref|XP_008393307.1| PREDICTED: kinesin KP1 isoform X1 [Malus domestica]
Length=966

 Score =   151 bits (382),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 99/227 (44%), Positives = 142/227 (63%), Gaps = 16/227 (7%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLE-----SASTRLLFSAVGDILNENI  533
             +H G K  +VFQLK G   D+ A KISE+MK  SL+     +A T+ L S V  IL+E++
Sbjct  63    HHVGHKFHEVFQLKQGGYADLPAAKISEMMKPNSLDHLLLQNAPTQSLLSVVNGILDESV  122

Query  534   ERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             ERKNG+IPQ VS LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  E L +G
Sbjct  123   ERKNGEIPQRVSCLLRKVVQEIERRISTQAEHLRTQNNLFKAREEKYQSRIRVLETLASG  182

Query  714   aaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKT  863
              +EE E+     ++ +  R ++          +  L K+KD   ++IS L  EL++ KKT
Sbjct  183   TSEESELIMNHLQQIKNERTRMEAKKKTDDEDVIRLMKEKDQCNLEISGLRQELDIAKKT  242

Query  864   YEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESK  1004
             Y+ +CL +ET  +  R EL  +  ELE LL  S+ K  EL+  SESK
Sbjct  243   YDLRCLXMETEAKGARAELEERTKELERLLAASRSKVKELQENSESK  289



>ref|XP_010314384.1| PREDICTED: kinesin-4-like [Solanum lycopersicum]
Length=924

 Score =   150 bits (379),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 101/234 (43%), Positives = 147/234 (63%), Gaps = 11/234 (5%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
             +H G +  +VFQLK G   +I A +ISE+M+  SL  A T+ L S V  IL+E++ERKNG
Sbjct  224   HHVGHRFHEVFQLKQGSHSEIPAARISEMMRSNSLNIAPTQSLLSVVNGILDESVERKNG  283

Query  549   DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
             +IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q N +KSRE+KYQ + R  E L TG +EE 
Sbjct  284   EIPQRVACLLRKVVQEIERRISTQAEHLRAQSNLFKSREEKYQSRIRIMEDLATGTSEET  343

Query  729   e----------iekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKC  878
             +           EK+K+EEK+K  EQ       +K+ H  +I+ L  E+E+ K+ YE   
Sbjct  344   QIVMNQLHQIKNEKSKAEEKKKIEEQDNSYKSNEKEDHRREIADLKQEMEIAKRLYEQHT  403

Query  879   LQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             L+++    K + EL  K+ E   LLT+S+ +  ELE F ES+   W +KEH+Y+
Sbjct  404   LEMKEKATKAQQELEEKLKEAMSLLTESRNRIKELETFIESQSRSWTKKEHIYQ  457



>ref|XP_004300795.1| PREDICTED: kinesin-4 isoform X2 [Fragaria vesca subsp. vesca]
 ref|XP_011463889.1| PREDICTED: kinesin-4 isoform X1 [Fragaria vesca subsp. vesca]
Length=1119

 Score =   150 bits (380),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 95/223 (43%), Positives = 140/223 (63%), Gaps = 11/223 (5%)
 Frame = +3

Query  405   QLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLK  581
             QLK G   D+   KI E +K  SL++AS+R LF+    IL ++ ER NGD+PQ ++ LL+
Sbjct  227   QLKQGTNVDLFDIKILESIKTTSLDNASSRALFTVGNKILEDSTERNNGDVPQHLAYLLR  286

Query  582   LVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseeke  761
              VLQ IEQR + Q+ NLR Q+N YKSRE+KYQ+K +  E L +G +EE ++   + ++ +
Sbjct  287   KVLQVIEQRFANQTVNLRIQNNMYKSREEKYQMKMKVLETLASGTSEEIQVVLNQLKQIK  346

Query  762   khreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMR  911
               +  I          +  L+++KD   ++IS+L  EL+  K T+E  CLQLE + ++ +
Sbjct  347   IEQFNIEEKQKIEEQDVLRLKEEKDQMGLEISTLKQELQKAKSTHESHCLQLEANAKEAK  406

Query  912   IELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +EL  K+ ELEC+LT SKK   ELEA  ES   KWK+KE  Y+
Sbjct  407   LELERKLKELECMLTSSKKNEKELEASLESVSGKWKQKEGSYQ  449



>emb|CDO98431.1| unnamed protein product [Coffea canephora]
Length=959

 Score =   150 bits (378),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 102/294 (35%), Positives = 156/294 (53%), Gaps = 52/294 (18%)
 Frame = +3

Query  300   FRSFNASEQIDCFNN------MAKELSASNNHAGSKLPDVFQLKIG-CEDILAYKISELM  458
             FRS +   +   F +      MA+  + + +H G K  +VFQLK G   D+ A KISE+M
Sbjct  165   FRSGHGVHKCSSFQHASHSPVMAEPSATTKHHVGHKFHEVFQLKHGRYADLPASKISEMM  224

Query  459   KQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRK  638
             K  SL++A T+ L S V  IL+E+IERKNG+IPQ V+ LL+ V+QEIE+R+S Q E+L+ 
Sbjct  225   KSNSLDNAPTQSLLSVVNGILDESIERKNGEIPQRVAGLLRKVVQEIERRISTQGEHLKT  284

Query  639   QHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQIICMLQKDKDHHEM  818
             Q+N +K+RE+KYQ + R  EAL TG+ +E ++            + ++       +H  +
Sbjct  285   QNNLFKAREEKYQSRIRVLEALATGSNQESQVVILALPSVSARPQFLLAA-----NHATL  339

Query  819   QISSL---------------------------------NHELELCK-------KTYEGKC  878
             +++ L                                 +HE+   K       K +E  C
Sbjct  340   RLADLKESVLLNEQSKVEEKRNVEEQDPVRTIKEQDDFSHEITALKQELEVSRKMHEEHC  399

Query  879   LQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             LQ+ET    ++ EL  K+ E+   L +S+ +  ELEA SESK L W +KEH+Y+
Sbjct  400   LQMETEGRGVQQELEKKLKEVMNFLAESRNRVKELEALSESKSLGWTKKEHIYQ  453



>ref|XP_011465396.1| PREDICTED: kinesin-4 isoform X2 [Fragaria vesca subsp. vesca]
Length=1121

 Score =   150 bits (379),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 95/222 (43%), Positives = 143/222 (64%), Gaps = 11/222 (5%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
             +H G K  +VFQ K G   D+ A KISE+MK  SL++A T+ L S V  IL+E++ER N 
Sbjct  210   HHVGHKFHEVFQFKQGRYADLPAAKISEMMKSNSLDNAPTQSLLSVVNGILDESVERNNS  269

Query  549   DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
             +IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EAL +G  EE 
Sbjct  270   EIPHRVACLLRKVVQEIERRISTQAEHLRTQNNVFKAREEKYQSRIRVLEALASGTNEES  329

Query  729   eiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKC  878
             E+ ++  ++ +  R +I          +  L+K+K+H  ++IS L  EL++ KKT++ + 
Sbjct  330   ELFRSHLQQIKNERTKIEEKKKTGDEDVIRLKKEKEHCNLEISGLKQELDIAKKTFDLRY  389

Query  879   LQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESK  1004
             LQ+ET  + ++  L  K+ ELE  L DS+ K  ELE  SESK
Sbjct  390   LQMETDAKGVKAALEEKVKELERNLADSRNKVKELEENSESK  431



>ref|XP_009360158.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
Length=1088

 Score =   150 bits (378),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 98/227 (43%), Positives = 142/227 (63%), Gaps = 16/227 (7%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLE-----SASTRLLFSAVGDILNENI  533
             +H G K  +VFQLK G   D+ A KISE+MK  SL+     +A T+ L S V  IL+E++
Sbjct  202   HHVGHKFHEVFQLKQGGYADLPAAKISEMMKPNSLDHLLLQNAPTQSLLSVVNGILDESV  261

Query  534   ERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             ERKNG+IP  VS LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  E L +G
Sbjct  262   ERKNGEIPHRVSCLLRKVVQEIERRISTQAEHLRTQNNLFKAREEKYQSRIRVLETLASG  321

Query  714   aaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKT  863
              +EE E+     ++ +  R ++          +  L K+KD   ++I  L  EL++ KKT
Sbjct  322   NSEESELIMNHLQQIKNERTRMEAKKKTDDEDVIRLMKEKDQCNLEILGLRQELDIAKKT  381

Query  864   YEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESK  1004
             Y+ +CLQ+ET  +  R EL  +  ELE LL +S+ K  EL+  SESK
Sbjct  382   YDLRCLQMETEAKGARAELEERTKELERLLAESRSKVKELQENSESK  428



>ref|XP_010915519.1| PREDICTED: kinesin-4-like [Elaeis guineensis]
Length=1031

 Score =   149 bits (375),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 145/238 (61%), Gaps = 11/238 (5%)
 Frame = +3

Query  360   SASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIE  536
             +A ++  G K  +VFQLK G   D    KISE+MK  SLE+A T  LFS +  IL+E+I 
Sbjct  191   TALSHQVGDKFHEVFQLKHGHYSDHSTAKISEMMKSNSLENAPTLSLFSVINGILDESIG  250

Query  537   RKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGa  716
             RKNG+ P  ++ +L+ V+QEIE+RV+ Q+E+ R Q+N  K+RE+KYQ + R  E L  G 
Sbjct  251   RKNGETPHRIALILRKVVQEIERRVATQAEHNRNQNNLIKAREEKYQSRIRVLETLANGT  310

Query  717   aeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTY  866
              EE +I   + +  +  + ++          +  L K+ ++ +  I+ L  ELE+  K Y
Sbjct  311   NEETQIVMNQLKLMKIEKSKVEEKMKLREQDVGRLMKENENKDQTIAELKQELEMTNKMY  370

Query  867   EGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             E +C QLE+  ++ ++ L  +I ++E LL +SKK+  ELE+ SES L  W +KEH+++
Sbjct  371   EHRCQQLESKAKETKLHLDERIKQVEFLLAESKKRIKELESASESTLQNWSKKEHIFQ  428



>ref|XP_007210907.1| hypothetical protein PRUPE_ppa000796mg [Prunus persica]
 gb|EMJ12106.1| hypothetical protein PRUPE_ppa000796mg [Prunus persica]
Length=1000

 Score =   148 bits (374),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 97/213 (46%), Positives = 143/213 (67%), Gaps = 1/213 (0%)
 Frame = +3

Query  405   QLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLK  581
             QLK G   D+ + KI E +K  SL++ASTR LF+    IL+++I+R NGD+P  V+ +L+
Sbjct  144   QLKQGTLVDLSSAKILESIKSTSLDNASTRSLFNVGNRILDDSIDRNNGDVPNRVAYILR  203

Query  582   LVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseeke  761
              V+Q IEQR + Q+ NLR Q+N YK+RE+K+ LK +  E L +G  EE+EIEK   EEK+
Sbjct  204   KVMQVIEQRFANQAVNLRIQNNIYKAREEKFLLKIKVLETLASGTTEENEIEKFDIEEKK  263

Query  762   khreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMEL  941
             K  EQ    L+++KD  + +IS+L  ELE+ K  +E   L+LE + ++ +++L  ++ EL
Sbjct  264   KLEEQDAVRLKEEKDRRDKEISTLKQELEMAKSRHESHSLKLEANAKEAKLQLERRLKEL  323

Query  942   ECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             EC+LTDS K   ELEA  ES+  +WK KEH Y+
Sbjct  324   ECVLTDSNKNQKELEASLESESWRWKEKEHTYQ  356



>ref|XP_008804600.1| PREDICTED: kinesin-4-like [Phoenix dactylifera]
Length=1010

 Score =   148 bits (373),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 91/229 (40%), Positives = 141/229 (62%), Gaps = 11/229 (5%)
 Frame = +3

Query  387   KLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQC  563
             K  +VFQLK G   D  A KISE+MK  SLE+A T  LFS +  IL+E+I+RKNG+ P  
Sbjct  198   KFYEVFQLKHGHYSDHSARKISEMMKSNSLENAPTLSLFSVINGILDESIDRKNGETPHR  257

Query  564   VSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheieka  743
             V+ +L+ V+QEIE+RV+ QSE++  Q+N  K+RE+KYQ + R  E L  G  EE  I   
Sbjct  258   VALILRKVVQEIERRVATQSEHIINQNNLIKAREEKYQSRIRVLETLANGTNEETLIVMN  317

Query  744   kseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLET  893
             + +  +  + ++          +  L K+ ++ +  ++ L  ELE+  K YE +C QLE+
Sbjct  318   QLKLMKIKKSKVEEKMKLQEHDVVRLTKENENKDQTVAELKQELEMTNKMYEHRCQQLES  377

Query  894   HLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
               ++ ++ +  +I ++E LL +SKKK  ELE+ SES L  W +KEH+++
Sbjct  378   KAKETKLHIDERIKQVEFLLAESKKKIKELESASESTLQNWSKKEHIFQ  426



>gb|KHG09229.1| Kinesin-4 -like protein [Gossypium arboreum]
Length=1045

 Score =   147 bits (372),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 103/253 (41%), Positives = 155/253 (61%), Gaps = 19/253 (8%)
 Frame = +3

Query  333   CFNNMAKELSASNNHAGSKLPDV------FQLKIGC-EDILAYKISELMKQKSLESASTR  491
             CFN    + + S  H   K  D+       Q+K GC  D+    + EL+K  SL++ ST+
Sbjct  131   CFN--PNDEANSFQHPSRKRWDLSGEVESIQMKQGCYADLSDATVLELLKSSSLDNVSTQ  188

Query  492   LLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQK  671
              LFS +  I++E+IERK GD+P  V+ LL+ +++EIE RVS ++ NL+ Q+  ++++E+K
Sbjct  189   SLFSIIYKIMDESIERKKGDVPHRVACLLRKIVEEIEWRVSTRARNLKNQNKLFRAQEEK  248

Query  672   YQLKDRAYEALRTGaaeeheie----------kakseekekhreQIICMLQKDKDHHEMQ  821
             YQ + RA E L  G  EE+ +           K+K EEK K  EQ +  L+K+K   +++
Sbjct  249   YQSRIRALETLAKGTMEENMVVLKNLQHIKFEKSKLEEKGKVEEQDVLQLKKEKVQKDLE  308

Query  822   ISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSES  1001
             IS L  ELE  KK +E +CLQLE   E  ++ +  K+ E+ECLL+DS+KK DEL++FSES
Sbjct  309   ISRLKEELESSKKMHEIQCLQLEAQAEDNKVLIEKKLKEVECLLSDSRKKVDELQSFSES  368

Query  1002  KLLKWKRKEHVYK  1040
             K  +WK KE  Y+
Sbjct  369   KQKRWKDKERSYQ  381



>ref|XP_011013061.1| PREDICTED: kinesin-4-like isoform X2 [Populus euphratica]
Length=888

 Score =   147 bits (370),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 148/238 (62%), Gaps = 11/238 (5%)
 Frame = +3

Query  360   SASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIE  536
             +AS  H   K  ++FQLK GC  D+ A KISE+M+  SL++A T+ L S V  IL+E+IE
Sbjct  197   AASMPHVVHKFHEMFQLKQGCYSDLSAAKISEMMRSNSLDNAPTQSLLSVVNGILDESIE  256

Query  537   RKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGa  716
             RK+ +IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K RE+KYQ + R  EAL +G 
Sbjct  257   RKSDEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKVREEKYQSRIRVLEALASGT  316

Query  717   aeeheiekakseekekhreQIICMLQKDKDH----------HEMQISSLNHELELCKKTY  866
              EE  +   + ++ +  + ++    +   DH           ++++S+L  ELEL K+T+
Sbjct  317   GEERGVVMDQLQQIKIEKSKMEEEKKIGVDHVAKLTEEQKQRDLELSALKQELELVKQTH  376

Query  867   EGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             E   LQ+ET  +  +  L  ++ ELE  L DS+ +   LEA+S+SK   + +KEH++K
Sbjct  377   ELNRLQMETEAKATKGGLEGRLKELEMHLEDSRNQVRVLEAYSQSKSKMFNKKEHIFK  434



>ref|XP_011013060.1| PREDICTED: kinesin-4-like isoform X1 [Populus euphratica]
Length=1050

 Score =   147 bits (371),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 150/238 (63%), Gaps = 11/238 (5%)
 Frame = +3

Query  360   SASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIE  536
             +AS  H   K  ++FQLK GC  D+ A KISE+M+  SL++A T+ L S V  IL+E+IE
Sbjct  197   AASMPHVVHKFHEMFQLKQGCYSDLSAAKISEMMRSNSLDNAPTQSLLSVVNGILDESIE  256

Query  537   RKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGa  716
             RK+ +IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K RE+KYQ + R  EAL +G 
Sbjct  257   RKSDEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKVREEKYQSRIRVLEALASGT  316

Query  717   aeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTY  866
              EE  +   + ++ +  + ++          +  L +++   ++++S+L  ELEL K+T+
Sbjct  317   GEERGVVMDQLQQIKIEKSKMEEEKKIGVDHVAKLTEEQKQRDLELSALKQELELVKQTH  376

Query  867   EGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             E   LQ+ET  +  +  L  ++ ELE  L DS+ +   LEA+S+SK   + +KEH++K
Sbjct  377   ELNRLQMETEAKATKGGLEGRLKELEMHLEDSRNQVRVLEAYSQSKSKMFNKKEHIFK  434



>ref|XP_004503714.1| PREDICTED: kinesin-4-like isoform X1 [Cicer arietinum]
 ref|XP_004503715.1| PREDICTED: kinesin-4-like isoform X2 [Cicer arietinum]
Length=1092

 Score =   146 bits (368),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 147/243 (60%), Gaps = 17/243 (7%)
 Frame = +3

Query  363   ASNNHAGSKLPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIER  539
             AS +  G K  ++F+LK G   D+   K+++L+K  +L+S STR LF+ V  IL++  ER
Sbjct  182   ASIDQIGFKSNELFELKQGLHVDLSDAKLNKLLKSNNLDSVSTRFLFNIVNRILSDIFER  241

Query  540   KNGDIPQC--VSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             KNGDIPQ    + LL+ +LQ +E R S Q+E+++ Q+N +K+RE KYQ K  A E L  G
Sbjct  242   KNGDIPQAQRAACLLRKILQVMESRFSNQAESMKNQNNLFKAREGKYQTKINALETLAVG  301

Query  714   aaeeheiek--------------akseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
               EE+E+                 K EEK+K  EQ    L+KDK   E++IS+L  +LEL
Sbjct  302   TTEENEVVTGWFQQLKFSLQHEQTKFEEKKKLEEQDFSRLKKDKIQSEIEISALKQDLEL  361

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              K+++E   LQLE    + + E   +I EL+C L D++K+  E+E FSES+ L W+ KEH
Sbjct  362   AKRSHEEHVLQLELQASESKSEYERRIQELKCHLADARKQVKEMETFSESRYLNWRNKEH  421

Query  1032  VYK  1040
              Y+
Sbjct  422   TYQ  424



>ref|XP_006439546.1| hypothetical protein CICLE_v10018623mg [Citrus clementina]
 gb|ESR52786.1| hypothetical protein CICLE_v10018623mg [Citrus clementina]
Length=1074

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/240 (40%), Positives = 142/240 (59%), Gaps = 11/240 (5%)
 Frame = +3

Query  354   ELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNEN  530
             E SA  +H      DV  LK G   D+   KI E +    +++AST+ LF+ V  IL+E 
Sbjct  184   EESALMHHLAHTFHDVLHLKEGGYTDVSDVKILEFVNSSCMDNASTKSLFNIVNRILDEC  243

Query  531   IERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRT  710
             +ERKNGD P  V+ LL+ V+  IE+R + Q +N + Q+N +++RE+KY+ + R  E L  
Sbjct  244   VERKNGDAPHRVACLLRKVVPLIERRTATQYQNFKNQNNLFRAREEKYKSRIRVLETLTV  303

Query  711   GaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKK  860
             G  EE+++   + E  +  +  I             L+K+ D  +++IS+L  +LEL K+
Sbjct  304   GTTEENQVVANQLERIKTEKTNIAQKEKLEEQNALRLKKENDDRDIEISTLKQDLELAKR  363

Query  861   TYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             T+E  CLQLE  + + +IE   K+ ELE LLT SKKK +ELE+ SESK  +WKR EH Y+
Sbjct  364   THELHCLQLEEQIYETKIESQKKLQELERLLTVSKKKVEELESLSESKSQRWKRIEHSYQ  423



>gb|KDO76227.1| hypothetical protein CISIN_1g001464mg [Citrus sinensis]
Length=1073

 Score =   145 bits (366),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/240 (40%), Positives = 142/240 (59%), Gaps = 11/240 (5%)
 Frame = +3

Query  354   ELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNEN  530
             E SA  +H      DV  LK G   D+   KI E +    +++AST+ LF+ V  IL+E 
Sbjct  184   EESALMHHLAHTFHDVLHLKEGGYTDVSDVKILEFVNSSCMDNASTKSLFNIVNRILDEC  243

Query  531   IERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRT  710
             +ERKNGD P  V+ LL+ V+  IE+R + Q +N + Q+N +++RE+KY+ + R  E L  
Sbjct  244   VERKNGDAPHRVACLLRKVVPLIERRTATQYQNFKNQNNLFRAREEKYKSRIRVLETLTV  303

Query  711   GaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKK  860
             G  EE+++   + E  +  +  I             L+K+ D  +++IS+L  +LEL K+
Sbjct  304   GTTEENQVVANQLERIKTEKTNIAQKEKLEEQNALRLKKENDDRDIEISTLKQDLELAKR  363

Query  861   TYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             T+E  CLQLE  + + +IE   K+ ELE LLT SKKK +ELE+ SESK  +WKR EH Y+
Sbjct  364   THELHCLQLEEQIYETKIESQKKLQELERLLTVSKKKVEELESLSESKSQRWKRIEHSYQ  423



>gb|KDO76228.1| hypothetical protein CISIN_1g001464mg [Citrus sinensis]
Length=1055

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/240 (40%), Positives = 142/240 (59%), Gaps = 11/240 (5%)
 Frame = +3

Query  354   ELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNEN  530
             E SA  +H      DV  LK G   D+   KI E +    +++AST+ LF+ V  IL+E 
Sbjct  184   EESALMHHLAHTFHDVLHLKEGGYTDVSDVKILEFVNSSCMDNASTKSLFNIVNRILDEC  243

Query  531   IERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRT  710
             +ERKNGD P  V+ LL+ V+  IE+R + Q +N + Q+N +++RE+KY+ + R  E L  
Sbjct  244   VERKNGDAPHRVACLLRKVVPLIERRTATQYQNFKNQNNLFRAREEKYKSRIRVLETLTV  303

Query  711   GaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKK  860
             G  EE+++   + E  +  +  I             L+K+ D  +++IS+L  +LEL K+
Sbjct  304   GTTEENQVVANQLERIKTEKTNIAQKEKLEEQNALRLKKENDDRDIEISTLKQDLELAKR  363

Query  861   TYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             T+E  CLQLE  + + +IE   K+ ELE LLT SKKK +ELE+ SESK  +WKR EH Y+
Sbjct  364   THELHCLQLEEQIYETKIESQKKLQELERLLTVSKKKVEELESLSESKSQRWKRIEHSYQ  423



>gb|KDO76229.1| hypothetical protein CISIN_1g001464mg [Citrus sinensis]
Length=1019

 Score =   145 bits (365),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/240 (40%), Positives = 142/240 (59%), Gaps = 11/240 (5%)
 Frame = +3

Query  354   ELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNEN  530
             E SA  +H      DV  LK G   D+   KI E +    +++AST+ LF+ V  IL+E 
Sbjct  184   EESALMHHLAHTFHDVLHLKEGGYTDVSDVKILEFVNSSCMDNASTKSLFNIVNRILDEC  243

Query  531   IERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRT  710
             +ERKNGD P  V+ LL+ V+  IE+R + Q +N + Q+N +++RE+KY+ + R  E L  
Sbjct  244   VERKNGDAPHRVACLLRKVVPLIERRTATQYQNFKNQNNLFRAREEKYKSRIRVLETLTV  303

Query  711   GaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKK  860
             G  EE+++   + E  +  +  I             L+K+ D  +++IS+L  +LEL K+
Sbjct  304   GTTEENQVVANQLERIKTEKTNIAQKEKLEEQNALRLKKENDDRDIEISTLKQDLELAKR  363

Query  861   TYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             T+E  CLQLE  + + +IE   K+ ELE LLT SKKK +ELE+ SESK  +WKR EH Y+
Sbjct  364   THELHCLQLEEQIYETKIESQKKLQELERLLTVSKKKVEELESLSESKSQRWKRIEHSYQ  423



>gb|KEH21062.1| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1072

 Score =   145 bits (365),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 144/243 (59%), Gaps = 17/243 (7%)
 Frame = +3

Query  363   ASNNHAGSKLPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIER  539
             AS +H G K  ++ +LK G   DI   K++EL+   +L+S ST+ LF  V  IL++  ER
Sbjct  169   ASLDHLGFKSNELLKLKQGLRVDISDAKLNELLTSNNLDSVSTQFLFDIVNRILSDIFER  228

Query  540   KNGDIPQC--VSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             KNGDIPQ    + LL  +LQ IE R S Q+E+++ Q+N +K+RE KYQ K  A E +  G
Sbjct  229   KNGDIPQAQRAACLLGKILQVIELRFSNQAESMKNQNNIFKAREGKYQTKINALETMAVG  288

Query  714   aaeeheieka--------------kseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
               +E+E+                 K EEK+K  EQ    L+KDK  +E++IS+L  +LE+
Sbjct  289   TTKENEVVTGWVQQLKFSVQLEKTKFEEKKKLEEQDFSQLKKDKVRNEIEISALKQDLEM  348

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              K+++E   LQLE    + + E   +I EL+C L D+K +  ELE FSES+ L WK KEH
Sbjct  349   AKRSHEEHVLQLEVQASESKAEYEKRIRELKCQLADAKTQVKELETFSESRYLNWKNKEH  408

Query  1032  VYK  1040
              Y+
Sbjct  409   TYQ  411



>ref|XP_006439545.1| hypothetical protein CICLE_v10018623mg [Citrus clementina]
 gb|ESR52785.1| hypothetical protein CICLE_v10018623mg [Citrus clementina]
Length=1070

 Score =   145 bits (365),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 95/240 (40%), Positives = 142/240 (59%), Gaps = 11/240 (5%)
 Frame = +3

Query  354   ELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNEN  530
             E SA  +H      DV  LK G   D+   KI E +    +++AST+ LF+ V  IL+E 
Sbjct  184   EESALMHHLAHTFHDVLHLKEGGYTDVSDVKILEFVNSSCMDNASTKSLFNIVNRILDEC  243

Query  531   IERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRT  710
             +ERKNGD P  V+ LL+ V+  IE+R + Q +N + Q+N +++RE+KY+ + R  E L  
Sbjct  244   VERKNGDAPHRVACLLRKVVPLIERRTATQYQNFKNQNNLFRAREEKYKSRIRVLETLTV  303

Query  711   GaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKK  860
             G  EE+++   + E  +  +  I             L+K+ D  +++IS+L  +LEL K+
Sbjct  304   GTTEENQVVANQLERIKTEKTNIAQKEKLEEQNALRLKKENDDRDIEISTLKQDLELAKR  363

Query  861   TYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             T+E  CLQLE  + + +IE   K+ ELE LLT SKKK +ELE+ SESK  +WKR EH Y+
Sbjct  364   THELHCLQLEEQIYETKIESQKKLQELERLLTVSKKKVEELESLSESKSQRWKRIEHSYQ  423



>ref|XP_010031995.1| PREDICTED: kinesin-4 isoform X2 [Eucalyptus grandis]
Length=1040

 Score =   145 bits (365),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 153/283 (54%), Gaps = 61/283 (22%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
             +H G K  +VFQLK G   D+ A KISE+MK  SL++A T+ L S V  IL+E+IER+NG
Sbjct  175   HHVGLKFHEVFQLKQGRYADLPAAKISEMMKSNSLDNAPTQSLLSVVNGILDESIERQNG  234

Query  549   DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
             +IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +KSRE+KYQ + +  EAL TG  EE 
Sbjct  235   EIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKSREEKYQSRIKVLEALATGPYEET  294

Query  729   eiekakseekekhreQI--------------ICMLQKDKDHHEMQISSLNHELELCKKTY  866
             EI   + +  +  + ++              +    K+K+ H ++IS+L  ELE+ KKTY
Sbjct  295   EISVDQLQRFQAEKIKMEEKIEEKRKLEEEDLARSTKEKESHNLEISALKQELEVAKKTY  354

Query  867   EGKCLQLETHLE--KMRIELG------------NKIMELECL------------------  950
             E + LQ+ET  +  K+ +E G            NK+ ELE                    
Sbjct  355   ELRHLQMETEAKAAKLALEEGTRKLEQDLAGYRNKVQELEAANKTYQLRHVQIETEANAA  414

Query  951   --------------LTDSKKKADELEAFSESKLLKWKRKEHVY  1037
                           L  S+ K  +LEA SESK  KW +KEH +
Sbjct  415   KMMLEERIRKLEQDLAGSRNKVKQLEACSESKNEKWNKKEHSF  457



>gb|AET04979.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=1080

 Score =   145 bits (365),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 144/243 (59%), Gaps = 17/243 (7%)
 Frame = +3

Query  363   ASNNHAGSKLPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIER  539
             AS +H G K  ++ +LK G   DI   K++EL+   +L+S ST+ LF  V  IL++  ER
Sbjct  169   ASLDHLGFKSNELLKLKQGLRVDISDAKLNELLTSNNLDSVSTQFLFDIVNRILSDIFER  228

Query  540   KNGDIPQC--VSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             KNGDIPQ    + LL  +LQ IE R S Q+E+++ Q+N +K+RE KYQ K  A E +  G
Sbjct  229   KNGDIPQAQRAACLLGKILQVIELRFSNQAESMKNQNNIFKAREGKYQTKINALETMAVG  288

Query  714   aaeeheieka--------------kseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
               +E+E+                 K EEK+K  EQ    L+KDK  +E++IS+L  +LE+
Sbjct  289   TTKENEVVTGWVQQLKFSVQLEKTKFEEKKKLEEQDFSQLKKDKVRNEIEISALKQDLEM  348

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              K+++E   LQLE    + + E   +I EL+C L D+K +  ELE FSES+ L WK KEH
Sbjct  349   AKRSHEEHVLQLEVQASESKAEYEKRIRELKCQLADAKTQVKELETFSESRYLNWKNKEH  408

Query  1032  VYK  1040
              Y+
Sbjct  409   TYQ  411



>ref|XP_010031985.1| PREDICTED: kinesin-4 isoform X1 [Eucalyptus grandis]
Length=1044

 Score =   145 bits (365),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 153/283 (54%), Gaps = 61/283 (22%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
             +H G K  +VFQLK G   D+ A KISE+MK  SL++A T+ L S V  IL+E+IER+NG
Sbjct  179   HHVGLKFHEVFQLKQGRYADLPAAKISEMMKSNSLDNAPTQSLLSVVNGILDESIERQNG  238

Query  549   DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
             +IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +KSRE+KYQ + +  EAL TG  EE 
Sbjct  239   EIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKSREEKYQSRIKVLEALATGPYEET  298

Query  729   eiekakseekekhreQI--------------ICMLQKDKDHHEMQISSLNHELELCKKTY  866
             EI   + +  +  + ++              +    K+K+ H ++IS+L  ELE+ KKTY
Sbjct  299   EISVDQLQRFQAEKIKMEEKIEEKRKLEEEDLARSTKEKESHNLEISALKQELEVAKKTY  358

Query  867   EGKCLQLETHLE--KMRIELG------------NKIMELECL------------------  950
             E + LQ+ET  +  K+ +E G            NK+ ELE                    
Sbjct  359   ELRHLQMETEAKAAKLALEEGTRKLEQDLAGYRNKVQELEAANKTYQLRHVQIETEANAA  418

Query  951   --------------LTDSKKKADELEAFSESKLLKWKRKEHVY  1037
                           L  S+ K  +LEA SESK  KW +KEH +
Sbjct  419   KMMLEERIRKLEQDLAGSRNKVKQLEACSESKNEKWNKKEHSF  461



>gb|KCW83857.1| hypothetical protein EUGRSUZ_B00722 [Eucalyptus grandis]
Length=939

 Score =   144 bits (364),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 107/283 (38%), Positives = 153/283 (54%), Gaps = 61/283 (22%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
             +H G K  +VFQLK G   D+ A KISE+MK  SL++A T+ L S V  IL+E+IER+NG
Sbjct  129   HHVGLKFHEVFQLKQGRYADLPAAKISEMMKSNSLDNAPTQSLLSVVNGILDESIERQNG  188

Query  549   DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
             +IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +KSRE+KYQ + +  EAL TG  EE 
Sbjct  189   EIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKSREEKYQSRIKVLEALATGPYEET  248

Query  729   eiekakseekekhreQI--------------ICMLQKDKDHHEMQISSLNHELELCKKTY  866
             EI   + +  +  + ++              +    K+K+ H ++IS+L  ELE+ KKTY
Sbjct  249   EISVDQLQRFQAEKIKMEEKIEEKRKLEEEDLARSTKEKESHNLEISALKQELEVAKKTY  308

Query  867   EGKCLQLETHLE--KMRIELG------------NKIMELECL------------------  950
             E + LQ+ET  +  K+ +E G            NK+ ELE                    
Sbjct  309   ELRHLQMETEAKAAKLALEEGTRKLEQDLAGYRNKVQELEAANKTYQLRHVQIETEANAA  368

Query  951   --------------LTDSKKKADELEAFSESKLLKWKRKEHVY  1037
                           L  S+ K  +LEA SESK  KW +KEH +
Sbjct  369   KMMLEERIRKLEQDLAGSRNKVKQLEACSESKNEKWNKKEHSF  411



>ref|XP_011465397.1| PREDICTED: kinesin-4 isoform X3 [Fragaria vesca subsp. vesca]
Length=1092

 Score =   144 bits (364),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 143/227 (63%), Gaps = 16/227 (7%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLE-----SASTRLLFSAVGDILNENI  533
             +H G K  +VFQ K G   D+ A KISE+MK  SL+     +A T+ L S V  IL+E++
Sbjct  210   HHVGHKFHEVFQFKQGRYADLPAAKISEMMKSNSLDYLLLQNAPTQSLLSVVNGILDESV  269

Query  534   ERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             ER N +IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EAL +G
Sbjct  270   ERNNSEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNVFKAREEKYQSRIRVLEALASG  329

Query  714   aaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKT  863
               EE E+ ++  ++ +  R +I          +  L+K+K+H  ++IS L  EL++ KKT
Sbjct  330   TNEESELFRSHLQQIKNERTKIEEKKKTGDEDVIRLKKEKEHCNLEISGLKQELDIAKKT  389

Query  864   YEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESK  1004
             ++ + LQ+ET  + ++  L  K+ ELE  L DS+ K  ELE  SESK
Sbjct  390   FDLRYLQMETDAKGVKAALEEKVKELERNLADSRNKVKELEENSESK  436



>gb|KJB20679.1| hypothetical protein B456_003G158800 [Gossypium raimondii]
Length=1025

 Score =   144 bits (364),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 154/253 (61%), Gaps = 19/253 (8%)
 Frame = +3

Query  333   CFNNMAKELSASNNHAGSKLPDV------FQLKIGC-EDILAYKISELMKQKSLESASTR  491
             CFN    + + S  H   K  D+       Q+K GC  D+    + EL+K  SL++ ST+
Sbjct  108   CFN--PNDEANSFQHPSRKRWDISGEFESIQMKQGCYADLSDATVLELLKSSSLDNVSTQ  165

Query  492   LLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQK  671
              LFS +  I++E+IERK GD+P  V+ LL+ +++EIE RVS ++ NL+ Q+  ++++E+K
Sbjct  166   SLFSIIYKIMDESIERKKGDVPHRVACLLRKIVEEIEWRVSTRARNLKNQNKLFRAQEEK  225

Query  672   YQLKDRAYEALRTGaaeeheie----------kakseekekhreQIICMLQKDKDHHEMQ  821
             YQ + RA E L  G  EE+ +           K+K EEK K  EQ +  L+K+K   +++
Sbjct  226   YQSRIRALETLAKGTMEENMVVLKNLQHIKFEKSKLEEKGKVEEQDVLQLKKEKVQKDLE  285

Query  822   ISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSES  1001
             IS L  ELE  KK +E +CLQLE   E  ++ L  K+ E+E LL+DS+KK DEL++FSES
Sbjct  286   ISRLKEELESSKKMHEIQCLQLEAQAEDNKVLLEKKLKEVEYLLSDSRKKVDELQSFSES  345

Query  1002  KLLKWKRKEHVYK  1040
             K  +WK +E  Y+
Sbjct  346   KQKRWKDRERSYQ  358



>gb|KJB20677.1| hypothetical protein B456_003G158800 [Gossypium raimondii]
Length=1001

 Score =   144 bits (363),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 154/253 (61%), Gaps = 19/253 (8%)
 Frame = +3

Query  333   CFNNMAKELSASNNHAGSKLPDV------FQLKIGC-EDILAYKISELMKQKSLESASTR  491
             CFN    + + S  H   K  D+       Q+K GC  D+    + EL+K  SL++ ST+
Sbjct  133   CFN--PNDEANSFQHPSRKRWDISGEFESIQMKQGCYADLSDATVLELLKSSSLDNVSTQ  190

Query  492   LLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQK  671
              LFS +  I++E+IERK GD+P  V+ LL+ +++EIE RVS ++ NL+ Q+  ++++E+K
Sbjct  191   SLFSIIYKIMDESIERKKGDVPHRVACLLRKIVEEIEWRVSTRARNLKNQNKLFRAQEEK  250

Query  672   YQLKDRAYEALRTGaaeeheie----------kakseekekhreQIICMLQKDKDHHEMQ  821
             YQ + RA E L  G  EE+ +           K+K EEK K  EQ +  L+K+K   +++
Sbjct  251   YQSRIRALETLAKGTMEENMVVLKNLQHIKFEKSKLEEKGKVEEQDVLQLKKEKVQKDLE  310

Query  822   ISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSES  1001
             IS L  ELE  KK +E +CLQLE   E  ++ L  K+ E+E LL+DS+KK DEL++FSES
Sbjct  311   ISRLKEELESSKKMHEIQCLQLEAQAEDNKVLLEKKLKEVEYLLSDSRKKVDELQSFSES  370

Query  1002  KLLKWKRKEHVYK  1040
             K  +WK +E  Y+
Sbjct  371   KQKRWKDRERSYQ  383



>ref|XP_011465399.1| PREDICTED: kinesin-4 isoform X5 [Fragaria vesca subsp. vesca]
Length=987

 Score =   144 bits (363),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 143/227 (63%), Gaps = 16/227 (7%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLE-----SASTRLLFSAVGDILNENI  533
             +H G K  +VFQ K G   D+ A KISE+MK  SL+     +A T+ L S V  IL+E++
Sbjct  210   HHVGHKFHEVFQFKQGRYADLPAAKISEMMKSNSLDYLLLQNAPTQSLLSVVNGILDESV  269

Query  534   ERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             ER N +IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EAL +G
Sbjct  270   ERNNSEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNVFKAREEKYQSRIRVLEALASG  329

Query  714   aaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKT  863
               EE E+ ++  ++ +  R +I          +  L+K+K+H  ++IS L  EL++ KKT
Sbjct  330   TNEESELFRSHLQQIKNERTKIEEKKKTGDEDVIRLKKEKEHCNLEISGLKQELDIAKKT  389

Query  864   YEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESK  1004
             ++ + LQ+ET  + ++  L  K+ ELE  L DS+ K  ELE  SESK
Sbjct  390   FDLRYLQMETDAKGVKAALEEKVKELERNLADSRNKVKELEENSESK  436



>gb|KJB20676.1| hypothetical protein B456_003G158800 [Gossypium raimondii]
 gb|KJB20680.1| hypothetical protein B456_003G158800 [Gossypium raimondii]
Length=1046

 Score =   144 bits (363),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 154/253 (61%), Gaps = 19/253 (8%)
 Frame = +3

Query  333   CFNNMAKELSASNNHAGSKLPDV------FQLKIGC-EDILAYKISELMKQKSLESASTR  491
             CFN    + + S  H   K  D+       Q+K GC  D+    + EL+K  SL++ ST+
Sbjct  129   CFN--PNDEANSFQHPSRKRWDISGEFESIQMKQGCYADLSDATVLELLKSSSLDNVSTQ  186

Query  492   LLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQK  671
              LFS +  I++E+IERK GD+P  V+ LL+ +++EIE RVS ++ NL+ Q+  ++++E+K
Sbjct  187   SLFSIIYKIMDESIERKKGDVPHRVACLLRKIVEEIEWRVSTRARNLKNQNKLFRAQEEK  246

Query  672   YQLKDRAYEALRTGaaeeheie----------kakseekekhreQIICMLQKDKDHHEMQ  821
             YQ + RA E L  G  EE+ +           K+K EEK K  EQ +  L+K+K   +++
Sbjct  247   YQSRIRALETLAKGTMEENMVVLKNLQHIKFEKSKLEEKGKVEEQDVLQLKKEKVQKDLE  306

Query  822   ISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSES  1001
             IS L  ELE  KK +E +CLQLE   E  ++ L  K+ E+E LL+DS+KK DEL++FSES
Sbjct  307   ISRLKEELESSKKMHEIQCLQLEAQAEDNKVLLEKKLKEVEYLLSDSRKKVDELQSFSES  366

Query  1002  KLLKWKRKEHVYK  1040
             K  +WK +E  Y+
Sbjct  367   KQKRWKDRERSYQ  379



>gb|KJB20675.1| hypothetical protein B456_003G158800 [Gossypium raimondii]
Length=1050

 Score =   144 bits (363),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 102/253 (40%), Positives = 154/253 (61%), Gaps = 19/253 (8%)
 Frame = +3

Query  333   CFNNMAKELSASNNHAGSKLPDV------FQLKIGC-EDILAYKISELMKQKSLESASTR  491
             CFN    + + S  H   K  D+       Q+K GC  D+    + EL+K  SL++ ST+
Sbjct  133   CFN--PNDEANSFQHPSRKRWDISGEFESIQMKQGCYADLSDATVLELLKSSSLDNVSTQ  190

Query  492   LLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQK  671
              LFS +  I++E+IERK GD+P  V+ LL+ +++EIE RVS ++ NL+ Q+  ++++E+K
Sbjct  191   SLFSIIYKIMDESIERKKGDVPHRVACLLRKIVEEIEWRVSTRARNLKNQNKLFRAQEEK  250

Query  672   YQLKDRAYEALRTGaaeeheie----------kakseekekhreQIICMLQKDKDHHEMQ  821
             YQ + RA E L  G  EE+ +           K+K EEK K  EQ +  L+K+K   +++
Sbjct  251   YQSRIRALETLAKGTMEENMVVLKNLQHIKFEKSKLEEKGKVEEQDVLQLKKEKVQKDLE  310

Query  822   ISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSES  1001
             IS L  ELE  KK +E +CLQLE   E  ++ L  K+ E+E LL+DS+KK DEL++FSES
Sbjct  311   ISRLKEELESSKKMHEIQCLQLEAQAEDNKVLLEKKLKEVEYLLSDSRKKVDELQSFSES  370

Query  1002  KLLKWKRKEHVYK  1040
             K  +WK +E  Y+
Sbjct  371   KQKRWKDRERSYQ  383



>ref|XP_011465398.1| PREDICTED: kinesin-4 isoform X4 [Fragaria vesca subsp. vesca]
Length=1008

 Score =   144 bits (363),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 96/236 (41%), Positives = 147/236 (62%), Gaps = 16/236 (7%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLE-----SASTRLLFSA  506
             M++  +   +H G K  +VFQ K G   D+ A KISE+MK  SL+     +A T+ L S 
Sbjct  201   MSEPSTGLMHHVGHKFHEVFQFKQGRYADLPAAKISEMMKSNSLDYLLLQNAPTQSLLSV  260

Query  507   VGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKD  686
             V  IL+E++ER N +IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + 
Sbjct  261   VNGILDESVERNNSEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNVFKAREEKYQSRI  320

Query  687   RAYEALRTGaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLN  836
             R  EAL +G  EE E+ ++  ++ +  R +I          +  L+K+K+H  ++IS L 
Sbjct  321   RVLEALASGTNEESELFRSHLQQIKNERTKIEEKKKTGDEDVIRLKKEKEHCNLEISGLK  380

Query  837   HELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESK  1004
              EL++ KKT++ + LQ+ET  + ++  L  K+ ELE  L DS+ K  ELE  SESK
Sbjct  381   QELDIAKKTFDLRYLQMETDAKGVKAALEEKVKELERNLADSRNKVKELEENSESK  436



>ref|XP_011465394.1| PREDICTED: kinesin-4 isoform X1 [Fragaria vesca subsp. vesca]
 ref|XP_011465395.1| PREDICTED: kinesin-4 isoform X1 [Fragaria vesca subsp. vesca]
Length=1126

 Score =   144 bits (363),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 95/227 (42%), Positives = 143/227 (63%), Gaps = 16/227 (7%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLE-----SASTRLLFSAVGDILNENI  533
             +H G K  +VFQ K G   D+ A KISE+MK  SL+     +A T+ L S V  IL+E++
Sbjct  210   HHVGHKFHEVFQFKQGRYADLPAAKISEMMKSNSLDYLLLQNAPTQSLLSVVNGILDESV  269

Query  534   ERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             ER N +IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EAL +G
Sbjct  270   ERNNSEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNVFKAREEKYQSRIRVLEALASG  329

Query  714   aaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKT  863
               EE E+ ++  ++ +  R +I          +  L+K+K+H  ++IS L  EL++ KKT
Sbjct  330   TNEESELFRSHLQQIKNERTKIEEKKKTGDEDVIRLKKEKEHCNLEISGLKQELDIAKKT  389

Query  864   YEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESK  1004
             ++ + LQ+ET  + ++  L  K+ ELE  L DS+ K  ELE  SESK
Sbjct  390   FDLRYLQMETDAKGVKAALEEKVKELERNLADSRNKVKELEENSESK  436



>ref|XP_010249550.1| PREDICTED: kinesin-4-like isoform X4 [Nelumbo nucifera]
Length=1107

 Score =   144 bits (363),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 89/198 (45%), Positives = 128/198 (65%), Gaps = 9/198 (5%)
 Frame = +3

Query  474   ESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSY  653
             E+A T+ L S V  IL+E+IERKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N Y
Sbjct  244   ENAPTQSLLSVVNGILDESIERKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLY  303

Query  654   KSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQI---------ICMLQKDKD  806
             K+RE+KYQ + R  E   TG  EE +I   + ++ +  + +I         +  L K+KD
Sbjct  304   KAREEKYQSRIRVLETYATGPNEETKIVMNQLQQTKTEKPKIEETKKHEQDVLRLIKEKD  363

Query  807   HHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELE  986
              +  +ISSL  EL + K+TYE +CLQLE  +   +I+L  ++ ELECLL  S+++  ELE
Sbjct  364   LNNHEISSLKQELVVAKRTYEERCLQLEAEVNGNKIDLEERLKELECLLKASQEEVKELE  423

Query  987   AFSESKLLKWKRKEHVYK  1040
             AFS SK   WK KE  Y+
Sbjct  424   AFSNSKDENWKEKECSYQ  441



>ref|XP_006476565.1| PREDICTED: kinesin-4-like isoform X1 [Citrus sinensis]
 ref|XP_006476566.1| PREDICTED: kinesin-4-like isoform X2 [Citrus sinensis]
Length=1073

 Score =   143 bits (361),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 100/272 (37%), Positives = 151/272 (56%), Gaps = 15/272 (6%)
 Frame = +3

Query  258   MPGAEKGEQANINAFRSFNASEQIDCFNNMAKELSASNNHAGSKLPDVFQLKIGC-EDIL  434
              P  E+ E+   +  R F  S           E SA  +H      DV  LK G   D+ 
Sbjct  156   FPATEREERQCNSLDRKFQHS----LHGTATSEESALMHHLAHTFHDVLHLKEGGYTDVS  211

Query  435   AYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVS  614
               KI E +    +++AST+ LF+ V  IL+E +ERKNGD+P  V+ LL+ V+  IE+R +
Sbjct  212   DVKILEFVNSSCVDNASTKSLFNIVNRILDECVERKNGDVPHRVACLLRKVVPLIERRTA  271

Query  615   KQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQI-----  779
              Q +N + Q+N +++RE+KY+ + R  E L  G  EE+++   + E  +  +  I     
Sbjct  272   TQYQNFKNQNNLFRAREEKYKSRIRVLETLTVGTTEENQVVANQLERIKTEKTNIEQKEK  331

Query  780   -----ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELE  944
                     L+K+ D  +++ S+L  +LEL K+T+E  CLQLE  + + +IE   K+ ELE
Sbjct  332   LEEQNALRLKKENDDRDIENSTLKQDLELAKRTHELHCLQLEEQIYETKIESQKKLQELE  391

Query  945   CLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
              LLT SKKK +ELE+ SESK  +WKR EH Y+
Sbjct  392   RLLTVSKKKVEELESLSESKSQRWKRIEHSYQ  423



>ref|NP_173277.2| kinesin motor domain-containing protein [Arabidopsis thaliana]
 gb|AEE29712.1| kinesin motor domain-containing protein [Arabidopsis thaliana]
Length=1140

 Score =   143 bits (361),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 89/196 (45%), Positives = 137/196 (70%), Gaps = 0/196 (0%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
            H G K  + FQ+K G  D+ A KISELMK  +L++A T+ L S V  IL+E IERKNG++
Sbjct  213  HGGHKSHEAFQMKQGRFDLQAAKISELMKSNNLDNAPTQSLLSIVNGILDETIERKNGEL  272

Query  555  PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
            PQ V+ LL+ V+QEIE+R+S QSE+LR Q++ +K+RE+KYQ + +  E L +G +EE+E 
Sbjct  273  PQRVACLLRKVVQEIERRISTQSEHLRTQNSVFKAREEKYQSRIKVLETLASGTSEENET  332

Query  735  ekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRI  914
            EK+K EEK+K +E+ +  ++K+  H+ ++IS+L  ELE  KK YE +CLQ+E+  +    
Sbjct  333  EKSKLEEKKKDKEEDMVGIEKENGHYNLEISTLRRELETTKKAYEQQCLQMESKTKGATA  392

Query  915  ELGNKIMELECLLTDS  962
             + +++ ELE +  D+
Sbjct  393  GIEDRVKELEQMRKDA  408



>gb|KHG03288.1| Kinesin-4 -like protein [Gossypium arboreum]
Length=560

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 99/223 (44%), Positives = 142/223 (64%), Gaps = 10/223 (4%)
 Frame = +3

Query  402   FQLKIGCE-DILAYKISELMKQKSLE---------SASTRLLFSAVGDILNENIERKNGD  551
              QLK G   D+    I ELMK  SLE         +AST+ LFS +  I++ +IER   D
Sbjct  172   IQLKQGYNADLSDATILELMKPSSLEVRPWTPSMHNASTQSLFSMLYRIMDGSIERNKRD  231

Query  552   IPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehe  731
             +P  V+ LL+ +++EIE RVS ++ENL+ Q+N Y++RE+KYQ + RA+E L  G  EE++
Sbjct  232   LPHYVACLLRKIVEEIEWRVSTRAENLKNQNNLYRAREEKYQSRIRAFETLVKGTLEENK  291

Query  732   iekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMR  911
             IEK+K EE     +Q +  L+K+   ++++IS L  ELE  K+ +E  CLQLE   E  +
Sbjct  292   IEKSKVEEMGNVEKQNLLQLKKNNIQNDLEISRLRKELESSKEMHERHCLQLEAQAEGTK  351

Query  912   IELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
               L  K+ ELE LLTDSKKKAD+L++FSES   +WK +E  Y+
Sbjct  352   AVLEVKLKELESLLTDSKKKADDLQSFSESTQKRWKSRECSYQ  394



>ref|XP_010677989.1| PREDICTED: kinesin-4 [Beta vulgaris subsp. vulgaris]
Length=1056

 Score =   142 bits (357),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 88/218 (40%), Positives = 140/218 (64%), Gaps = 11/218 (5%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGD  551
            H  +KL DVFQ+K G   D+ A KISE++K  SL++A T+ L + +  IL+E+IERKN +
Sbjct  167  HGANKLNDVFQMKQGFYSDLPATKISEMLKSNSLDNAPTQSLLNVINGILDESIERKNAE  226

Query  552  IPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehe  731
            IPQ V+ LL+ V+QEIE+R++ Q+E+LR Q N +K+RE+KYQ + +  EAL  G+++E E
Sbjct  227  IPQRVACLLRKVVQEIERRIATQAEHLRTQSNLFKAREEKYQSRIKVLEALAKGSSQESE  286

Query  732  iekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCL  881
            I   + +  +  + ++            M QK KD +++++S+L  ELE  KK +E + +
Sbjct  287  IVMNQLQHIKSEKSKMEEKKRSEQHEAAMSQKQKDENDLEVSTLKQELETAKKAHEMRYV  346

Query  882  QLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFS  995
            +LET  + +R +L  ++ E E LL DSK  + EL+  S
Sbjct  347  ELETQAKLVRSDLEKRLKEQEKLLEDSKASSAELDEVS  384


 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +3

Query  819   QISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSE  998
             ++S+L  ELE+ KKT+E + LQLET  + ++ +L  ++   E +L DSK K  ELE  S 
Sbjct  382   EVSTLKQELEMAKKTHELRSLQLETEAKLIKSDLEERLRLQEQILEDSKVKIKELEVNSR  441

Query  999   SKLLKWKRKEHVY  1037
             ++   W +KEH+Y
Sbjct  442   TQNQSWTKKEHIY  454



>ref|XP_010094755.1| hypothetical protein L484_019965 [Morus notabilis]
 gb|EXB56920.1| hypothetical protein L484_019965 [Morus notabilis]
Length=918

 Score =   141 bits (355),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 100/243 (41%), Positives = 152/243 (63%), Gaps = 11/243 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++  +A  +H G K  +VFQLK G   D+ A KISE+MK  +L++A T+ L S V  IL
Sbjct  62    MSEPSAALAHHVGHKFHEVFQLKQGHYMDLPASKISEMMKSNNLDNAPTQSLLSVVNGIL  121

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E++ERKN +IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EA
Sbjct  122   DESVERKNSEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKAREEKYQSRIRVLEA  181

Query  702   LRTGaaeehe------iekakseekekhreQI----ICMLQKDKDHHEMQISSLNHELEL  851
             L +G  EE E            +   + ++Q+    +  L K+KD   ++IS+L  ELE 
Sbjct  182   LASGTNEESEIVLNQLQRMKNEKTNREEKKQVEDENLSRLMKEKDQSNLEISALKQELET  241

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
               K+YE +CL+ E   + ++  L  ++ ELE LL D K K  ELE++SE+K   W +KE+
Sbjct  242   TMKSYEMRCLEHEKDAKDVKSVLEERLQELELLLADLKNKVLELESYSETKCQSWSKKEN  301

Query  1032  VYK  1040
              Y+
Sbjct  302   TYQ  304



>ref|XP_006416608.1| hypothetical protein EUTSA_v10006662mg [Eutrema salsugineum]
 gb|ESQ34961.1| hypothetical protein EUTSA_v10006662mg [Eutrema salsugineum]
Length=1023

 Score =   141 bits (356),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 88/196 (45%), Positives = 137/196 (70%), Gaps = 0/196 (0%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
            H G K  + FQ+K G  D+ A KISE+MK  +L++A T+ L S V  IL+++IERKNG+I
Sbjct  63   HGGHKFHEAFQMKQGRFDLQAAKISEMMKSNNLDNAPTQSLLSMVNGILDDSIERKNGEI  122

Query  555  PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
            PQ V+ LL+ V+ EIE+R+S QSE+LR Q+N +K+RE+KYQ + +  E L +G +EE+E 
Sbjct  123  PQRVACLLRKVVLEIERRISTQSEHLRTQNNVFKAREEKYQSRIKVLETLASGTSEENET  182

Query  735  ekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRI  914
            EK+K EEK+K++E+ +  L+K+   + ++IS+L  ELE  KK YE +CLQ+E+  +    
Sbjct  183  EKSKLEEKKKNKEEDMVRLEKENGQYNLEISTLRRELETTKKAYEQQCLQMESQTKVATA  242

Query  915  ELGNKIMELECLLTDS  962
             + +++ ELE +  D+
Sbjct  243  GIEDRVKELEQMRKDA  258



>gb|KHN23642.1| Kinesin-4, partial [Glycine soja]
Length=1081

 Score =   140 bits (353),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 99/243 (41%), Positives = 145/243 (60%), Gaps = 17/243 (7%)
 Frame = +3

Query  363   ASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIER  539
              S +H G K  ++FQLK G   D    K++E+ K  +L+S ST+LLF+    IL++  ER
Sbjct  178   TSIDHIGIKSNELFQLKQGLLADFSDAKLNEVFKSNNLDSVSTQLLFNIGNRILSDIFER  237

Query  540   KNGDIPQC--VSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             KNGD+PQ    + LL+ +LQ I+ R S Q+EN++ Q+N +K+RE KYQ +  A E L  G
Sbjct  238   KNGDVPQAHRAACLLRKILQVIQLRFSNQAENMKNQNNLFKAREGKYQTRINALETLAVG  297

Query  714   aaeeheiek--------------akseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
               EE+E+                 K EEK+K  EQ    L+K+K H E++IS+L  +LE+
Sbjct  298   TTEENEVVTSWVQQLKYALQVEQTKFEEKKKLEEQDFSRLKKEKVHSEIEISALKQDLEI  357

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              K+T+E    +LE    + + E   +I EL+  L D++K+  ELEAFSES+ LKWK KE 
Sbjct  358   VKRTHEEHVSELELRATESKAEYEKRIEELKLHLADARKQVKELEAFSESRFLKWKNKED  417

Query  1032  VYK  1040
              Y+
Sbjct  418   TYQ  420



>ref|XP_006580577.1| PREDICTED: kinesin-4-like isoform X1 [Glycine max]
 ref|XP_006580578.1| PREDICTED: kinesin-4-like isoform X2 [Glycine max]
 ref|XP_006580579.1| PREDICTED: kinesin-4-like isoform X3 [Glycine max]
Length=1086

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 99/243 (41%), Positives = 145/243 (60%), Gaps = 17/243 (7%)
 Frame = +3

Query  363   ASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIER  539
              S +H G K  ++FQLK G   D    K++E+ K  +L+S ST+LLF+    IL++  ER
Sbjct  183   TSIDHIGIKSNELFQLKQGLLADFSDAKLNEVFKSNNLDSVSTQLLFNIGNRILSDIFER  242

Query  540   KNGDIPQC--VSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             KNGD+PQ    + LL+ +LQ I+ R S Q+EN++ Q+N +K+RE KYQ +  A E L  G
Sbjct  243   KNGDVPQAHRAACLLRKILQVIQLRFSNQAENMKNQNNLFKAREGKYQTRINALETLAVG  302

Query  714   aaeeheiek--------------akseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
               EE+E+                 K EEK+K  EQ    L+K+K H E++IS+L  +LE+
Sbjct  303   TTEENEVVTSWVQQLKYALQVEQTKFEEKKKLEEQDFSRLKKEKVHSEIEISALKQDLEI  362

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              K+T+E    +LE    + + E   +I EL+  L D++K+  ELEAFSES+ LKWK KE 
Sbjct  363   VKRTHEEHVSELELRATESKAEYEKRIEELKLHLADARKQVKELEAFSESRFLKWKNKED  422

Query  1032  VYK  1040
              Y+
Sbjct  423   TYQ  425



>ref|XP_006580580.1| PREDICTED: kinesin-4-like isoform X4 [Glycine max]
Length=1080

 Score =   140 bits (352),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 99/243 (41%), Positives = 145/243 (60%), Gaps = 17/243 (7%)
 Frame = +3

Query  363   ASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIER  539
              S +H G K  ++FQLK G   D    K++E+ K  +L+S ST+LLF+    IL++  ER
Sbjct  177   TSIDHIGIKSNELFQLKQGLLADFSDAKLNEVFKSNNLDSVSTQLLFNIGNRILSDIFER  236

Query  540   KNGDIPQC--VSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             KNGD+PQ    + LL+ +LQ I+ R S Q+EN++ Q+N +K+RE KYQ +  A E L  G
Sbjct  237   KNGDVPQAHRAACLLRKILQVIQLRFSNQAENMKNQNNLFKAREGKYQTRINALETLAVG  296

Query  714   aaeeheiek--------------akseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
               EE+E+                 K EEK+K  EQ    L+K+K H E++IS+L  +LE+
Sbjct  297   TTEENEVVTSWVQQLKYALQVEQTKFEEKKKLEEQDFSRLKKEKVHSEIEISALKQDLEI  356

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              K+T+E    +LE    + + E   +I EL+  L D++K+  ELEAFSES+ LKWK KE 
Sbjct  357   VKRTHEEHVSELELRATESKAEYEKRIEELKLHLADARKQVKELEAFSESRFLKWKNKED  416

Query  1032  VYK  1040
              Y+
Sbjct  417   TYQ  419



>ref|XP_006306421.1| hypothetical protein CARUB_v10012358mg, partial [Capsella rubella]
 gb|EOA39319.1| hypothetical protein CARUB_v10012358mg, partial [Capsella rubella]
Length=993

 Score =   139 bits (351),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 94/246 (38%), Positives = 153/246 (62%), Gaps = 12/246 (5%)
 Frame = +3

Query  261  PGAEKGEQANINAFRSFNASEQIDCF----------NNMAKELSASNN--HAGSKLPDVF  404
            PG+ +G+    + F    A E+              N+   + S+  +  H G+K  + F
Sbjct  19   PGSSRGDSTPRSPFSPSTAYERHKALPDSKFHRPLQNSSPLDPSSPRSMLHGGNKFQEAF  78

Query  405  QLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKL  584
            Q+K G  D+ A KISE+MK  +L++A T+ L S V  IL+E+IE+KNG++PQ V  LL+ 
Sbjct  79   QMKQGRFDLQAAKISEMMKSNNLDNAPTQSLLSIVNGILDESIEKKNGEMPQRVVCLLRK  138

Query  585  VLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekek  764
            V+ EIE+R+S QSE+LR Q++ +KSRE+KYQ + +  E L +G +EE+E EK+K EEK+ 
Sbjct  139  VVLEIERRISTQSEHLRTQNSVFKSREEKYQSRIKVLETLASGTSEENETEKSKLEEKKN  198

Query  765  hreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELE  944
            ++E+ +  L+K+   + ++IS+L  ELE  KK YE +CLQ+E+  +     + +++ ELE
Sbjct  199  NKEEDMVRLEKENGQYNLEISTLRRELETTKKAYEQQCLQMESQTKVATAGIEDRVKELE  258

Query  945  CLLTDS  962
             +  D+
Sbjct  259  QMRKDA  264



>ref|XP_008238831.1| PREDICTED: kinesin-4 [Prunus mume]
 ref|XP_008238832.1| PREDICTED: kinesin-4 [Prunus mume]
Length=1194

 Score =   140 bits (352),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 98/266 (37%), Positives = 152/266 (57%), Gaps = 19/266 (7%)
 Frame = +3

Query  276   GEQANINAFRSFNASEQIDCFNNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISE  452
             G+Q+  N  R       ID  + +    +A  +H G       QLK G   D+   KI E
Sbjct  199   GQQSTQN--REDTGGNSIDSTSRVTDPSAALVHHIGQ------QLKQGTLVDLSNAKILE  250

Query  453   LMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENL  632
              +K  SL++ASTR LF+    IL+++I+R NGD+P  V+ LL+ V+Q IEQR + Q+ NL
Sbjct  251   SIKSTSLDNASTRSLFNVGNRILDDSIDRNNGDVPNRVAYLLRKVMQVIEQRFANQAVNL  310

Query  633   RKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQI----------I  782
             R Q+N YK+RE+K+ LK +  E L +G  EE+E+     +  +  +  I           
Sbjct  311   RIQNNIYKAREEKFLLKIKVLETLASGTTEENEVVLKLLQSMKIEKFDIEEKKKLEEQDA  370

Query  783   CMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDS  962
               L+++KD  + +IS+L  ELE+ K  +E   L+LE + ++ +++L  ++ ELE +LTDS
Sbjct  371   VRLKEEKDRRDKEISTLKQELEMAKSRHESHSLKLEANAKEAKLQLERRLKELEGILTDS  430

Query  963   KKKADELEAFSESKLLKWKRKEHVYK  1040
              K   ELEA  ES+  +WK+KEH Y+
Sbjct  431   NKNQKELEASLESESWRWKKKEHTYQ  456



>ref|XP_009364926.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364927.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364928.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364929.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364939.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364940.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364941.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364942.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
 ref|XP_009364943.1| PREDICTED: kinesin-4-like [Pyrus x bretschneideri]
Length=1218

 Score =   139 bits (350),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 93/223 (42%), Positives = 136/223 (61%), Gaps = 11/223 (5%)
 Frame = +3

Query  405   QLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLK  581
             QLK G   D    KI E +K  SL++ASTR LF+    IL+++I+R NGDIP  V+ LLK
Sbjct  224   QLKQGTFVDFSDAKILESIKSTSLDNASTRSLFNVGHKILDDSIDRNNGDIPHRVADLLK  283

Query  582   LVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseeke  761
              V+Q  EQR + Q+ NLR Q+N YK+RE+KY LK +  E L +G AEE+E+   + +  +
Sbjct  284   KVMQVTEQRFANQAVNLRIQNNIYKAREEKYLLKIKVLETLTSGTAEENEVVLKQLQNIK  343

Query  762   khreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMR  911
               +  I             L+++KD  + QIS+L  ELE+    +E  C +LE + ++ +
Sbjct  344   LEKFDIEEQKKLEEEDAVRLKEEKDRRDSQISTLKQELEMATSRHESYCHKLEANAKEAK  403

Query  912   IELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             ++L  K+ ELEC+LTDSKK   ELEA  E++  +WK KE  Y+
Sbjct  404   LQLERKLKELECILTDSKKNQKELEASLENESRRWKNKERTYQ  446



>gb|AAG52533.1|AC016662_27 putative kinesin; 97201-101676 [Arabidopsis thaliana]
Length=987

 Score =   138 bits (348),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 91/187 (49%), Positives = 127/187 (68%), Gaps = 2/187 (1%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERK  542
             S +H G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S +  IL+E+IERK
Sbjct  82   GSMHHGGHKFHEVFQMKQGRYDLQASKISEMMKSSSLDNAPTQSLLSVLNGILDESIERK  141

Query  543  NGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae  722
            NG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +    EAL +G   
Sbjct  142  NGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNIFKTREEKYQSRINVLEALASGTGV  201

Query  723  eheiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLE--TH  896
            EHE EK+  EEK+KH E+ +  L K  D H ++IS+L  ELE  K+ YE +  Q+E  T 
Sbjct  202  EHETEKSMWEEKKKHEEEDMVKLMKQNDQHNLEISALKQELETTKRKYEQQYSQIESQTK  261

Query  897  LEKMRIE  917
             EK + E
Sbjct  262  TEKSKWE  268



>ref|XP_002318551.2| hypothetical protein POPTR_0012s05330g [Populus trichocarpa]
 gb|EEE96771.2| hypothetical protein POPTR_0012s05330g [Populus trichocarpa]
Length=814

 Score =   138 bits (347),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 97/228 (43%), Positives = 152/228 (67%), Gaps = 1/228 (0%)
 Frame = +3

Query  360   SASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIE  536
             +AS +H G K  +VFQLK G   ++ A KISE+MK  SL+++ T+ L S V  IL+E+IE
Sbjct  87    AASMHHVGHKFHEVFQLKQGRFSELSAAKISEMMKSNSLDNSPTQSLLSVVNGILDESIE  146

Query  537   RKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGa  716
             RK+ +IP  V+ LL+ VLQEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EAL +G 
Sbjct  147   RKSYEIPHRVACLLRKVLQEIERRISTQAEHLRTQNNLFKAREEKYQSRIRVLEALASGT  206

Query  717   aeeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETH  896
              EE  IEK+K E +++  E+ +  L  +++  ++ +S+L  ELEL K+T+E + L++E  
Sbjct  207   GEERGIEKSKMEGEKRLEEEHVAKLIIEREQRDLDLSTLKQELELVKETHELRHLKMEAE  266

Query  897   LEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
              +  +  L  ++ ELE  L DS+ +   L A+SESK + +  KE ++K
Sbjct  267   AKGAKAGLEERLKELELHLEDSRNQVKVLSAYSESKSMTFNEKEDIFK  314



>gb|AET05326.2| kinesin motor catalytic domain protein [Medicago truncatula]
Length=1254

 Score =   139 bits (349),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 101/248 (41%), Positives = 148/248 (60%), Gaps = 11/248 (4%)
 Frame = +3

Query  321   EQIDCFNNMAKELSASNNH-AGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRL  494
             +++  F+    E SAS  +  G K  +VFQ+K G   D+ A KISE+MK  SL++A T+ 
Sbjct  193   QRVMSFSPSMAEPSASLIYQVGHKFHEVFQIKPGSYSDLPAAKISEMMKSNSLDNAPTQS  252

Query  495   LFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKY  674
             L S V  IL E++ER+NG+IP  V+ LL+ V QEIE+R+S Q+E++R Q N +K+RE+KY
Sbjct  253   LLSVVNGILEESVERRNGEIPHRVACLLRKVSQEIERRISTQAEHIRTQSNLFKAREEKY  312

Query  675   QLKDRAYEALRTGaaeeheiekak---------seekekhreQIICMLQKDKDHHEMQIS  827
             Q + R  EAL +G  EE E+  ++         +EE++K  E+ I  L K  +   ++IS
Sbjct  313   QSRIRVLEALASGTREESEMISSQLQQLKDEKVTEEEKKENEKEIIRLTKMLEDKNLEIS  372

Query  828   SLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKL  1007
              L  +LE  KKTYE KC QLE      + EL  K  E E  L + +    E+E  S+SK 
Sbjct  373   ELKQKLEATKKTYEAKCSQLEEETRDAKAELRQKSQEYEYRLEELRNAVKEIEDSSDSKY  432

Query  1008  LKWKRKEH  1031
              +W+ KE+
Sbjct  433   QEWRVKEN  440



>ref|XP_009397984.1| PREDICTED: kinesin-4-like [Musa acuminata subsp. malaccensis]
 ref|XP_009397987.1| PREDICTED: kinesin-4-like [Musa acuminata subsp. malaccensis]
Length=1104

 Score =   138 bits (347),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 143/241 (59%), Gaps = 11/241 (5%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++  S   +H G K  +VFQLK G   D+   K+SE MK  SL++A T+ L S +  I+
Sbjct  220   MSEPSSPQFHHGGHKFHEVFQLKQGHYYDLPPAKLSETMKSNSLDNAPTQSLLSIINGIV  279

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             +E+IE KNG+IPQ +   L+ V+QEIE+R+S Q+E++R Q+N  K+RE+KYQ + R  E 
Sbjct  280   DESIESKNGEIPQRLPCWLRKVVQEIERRISTQAEHIRNQNNLIKAREEKYQSRIRVLET  339

Query  702   LRTGaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELEL  851
             L TG  EE +I   +    +  + +I          +  L K+K+  +  IS L  ELE+
Sbjct  340   LATGTKEETQIAMNQLHLLKTEKRKIEERNKLGEEDMARLTKEKEKTDQIISELKQELEI  399

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              K+TYE +  Q+ET  ++ + +L  K+ + +  L +S+++ +EL   SESK   W ++E 
Sbjct  400   IKRTYEEQFQQMETKAKEYQTKLEQKLKDAKSYLAESQRRIEELGTISESKFQNWNQREL  459

Query  1032  V  1034
             V
Sbjct  460   V  460



>ref|XP_009391867.1| PREDICTED: kinesin KP1 [Musa acuminata subsp. malaccensis]
Length=936

 Score =   137 bits (345),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 100/294 (34%), Positives = 152/294 (52%), Gaps = 62/294 (21%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
             M++  +   +H G K  +VFQLK G   D+ A KISE+MK  SL++A T+ L S V  IL
Sbjct  1     MSEPSTPPTHHVGHKFHEVFQLKQGRYYDLPAAKISEMMKSNSLDNAPTQSLLSVVNGIL  60

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
              E+IERKNG+IPQ V+ LL+ V+QEIE+R+S Q+E++R Q+N  K+RE+KYQ + R  E 
Sbjct  61    EESIERKNGEIPQRVACLLRKVVQEIERRISTQAEHIRNQNNLIKAREEKYQSRIRVLET  120

Query  702   LRTGaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELEL  851
             L  G  +E +I   + +  +  + +I          +  L K+K+  +  IS L  ELE 
Sbjct  121   LANGTPDETQIVMNQLQLLKTEKHKIEERSKVGEEDMVKLTKEKEKSDKIISDLTQELET  180

Query  852   CKKTYEGKCLQLET-----HLEKM------------------------------------  908
              K+TYE +  Q++T      +EK+                                    
Sbjct  181   IKRTYEDQFPQMDTKTKEYQIEKLEYQIEKLAKEKEKSDKIISELKQELETTKRTYGDQF  240

Query  909   ----------RIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
                       +IEL  K+ + E +L +S+++  ELE  SES    W +KEHV++
Sbjct  241   QQMDTKAKEYQIELEEKLKDAESVLAESQRRIQELETDSESNFQNWNQKEHVFQ  294



>ref|XP_010695142.1| PREDICTED: kinesin-1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695143.1| PREDICTED: kinesin-1 [Beta vulgaris subsp. vulgaris]
 ref|XP_010695144.1| PREDICTED: kinesin-1 [Beta vulgaris subsp. vulgaris]
Length=1052

 Score =   136 bits (343),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 100/278 (36%), Positives = 153/278 (55%), Gaps = 13/278 (5%)
 Frame = +3

Query  243   NTESEMPGAEKGEQANINAFRSFNASE--QIDCFNNMAKELSASNNHAGSKLPDVFQLKI  416
             NT+ E        + N+      + ++  Q+D  N+         N   SK   VF+   
Sbjct  137   NTDRETAHNHVRRRWNVPEVEGLDGTDCSQVDSHNSAKFGPEKRRNSWESKFQTVFRSTT  196

Query  417   GCEDILA-YKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQ  593
                ++    KISEL+K  SL+ A  +LLFS V  +L+E++ER++GD+P  V+ LLK +++
Sbjct  197   LSGNLGPDVKISELVKWNSLDKAPMQLLFSMVDRVLDESLERRSGDVPHRVACLLKKLVR  256

Query  594   EIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhre  773
             EIE+RVS Q++ ++ Q+N  K RE KYQ K RA E L  GAA E E+      + +  + 
Sbjct  257   EIERRVSNQADKIKNQNNLCKVREGKYQSKVRALETLVVGAAGESEVAVNHLRQIKTEKI  316

Query  774   QI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELG  923
             ++          +  L K++D  E++I +L HELEL K +YE  C QLE  +++ R +L 
Sbjct  317   KLEEKSKHGEEDVVRLMKERDEREIEIGALKHELELVKMSYEKDCSQLEIEVKETRAKLQ  376

Query  924   NKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVY  1037
              KIM+LE LL  S KK +ELE   E ++ K K +E  Y
Sbjct  377   EKIMDLESLLQVSNKKVNELEETFEHEIQKLKNRELRY  414



>ref|XP_007040244.1| P-loop nucleoside triphosphate hydrolases superfamily protein 
with CH (Calponin ) domain, putative isoform 3 [Theobroma cacao]
 gb|EOY24745.1| P-loop nucleoside triphosphate hydrolases superfamily protein 
with CH (Calponin) domain, putative isoform 3 [Theobroma cacao]
Length=969

 Score =   135 bits (341),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 149/224 (67%), Gaps = 11/224 (5%)
 Frame = +3

Query  402   FQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLL  578
              QLK GC  D+    I ELMK  SL++AST+ LFS +  I++E+IERK GD+P  V+ LL
Sbjct  83    IQLKQGCYADLSDATILELMKSSSLQNASTQSLFSILYRIMDESIERKKGDVPHRVACLL  142

Query  579   KLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei--------  734
             + ++QEIE RVS ++ENL+ Q+N Y++RE+KYQ + RA E L  G  EE+E+        
Sbjct  143   RTIVQEIEWRVSTRAENLKNQNNVYRAREEKYQSRIRALETLAKGTVEENEVIISQLQHL  202

Query  735   --ekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKM  908
               EK+K EEK K  EQ +  L+K+K  ++++IS L  ELE  KK +E  CLQL+  +E  
Sbjct  203   KIEKSKLEEKGKVEEQDVLQLKKEKIQNDIEISRLREELESSKKMHEWHCLQLDAQVEDA  262

Query  909   RIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             ++EL  K+ ELECLL DS+K+ D+L++FSESK   W  KE  Y+
Sbjct  263   KVELEKKLKELECLLRDSRKEVDQLQSFSESKQKIWAHKECTYQ  306



>ref|XP_007040242.1| P-loop nucleoside triphosphate hydrolases superfamily protein 
with CH (Calponin ) domain, putative isoform 1 [Theobroma cacao]
 gb|EOY24743.1| P-loop nucleoside triphosphate hydrolases superfamily protein 
with CH (Calponin) domain, putative isoform 1 [Theobroma cacao]
Length=1061

 Score =   135 bits (341),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 149/224 (67%), Gaps = 11/224 (5%)
 Frame = +3

Query  402   FQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLL  578
              QLK GC  D+    I ELMK  SL++AST+ LFS +  I++E+IERK GD+P  V+ LL
Sbjct  158   IQLKQGCYADLSDATILELMKSSSLQNASTQSLFSILYRIMDESIERKKGDVPHRVACLL  217

Query  579   KLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei--------  734
             + ++QEIE RVS ++ENL+ Q+N Y++RE+KYQ + RA E L  G  EE+E+        
Sbjct  218   RTIVQEIEWRVSTRAENLKNQNNVYRAREEKYQSRIRALETLAKGTVEENEVIISQLQHL  277

Query  735   --ekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKM  908
               EK+K EEK K  EQ +  L+K+K  ++++IS L  ELE  KK +E  CLQL+  +E  
Sbjct  278   KIEKSKLEEKGKVEEQDVLQLKKEKIQNDIEISRLREELESSKKMHEWHCLQLDAQVEDA  337

Query  909   RIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             ++EL  K+ ELECLL DS+K+ D+L++FSESK   W  KE  Y+
Sbjct  338   KVELEKKLKELECLLRDSRKEVDQLQSFSESKQKIWAHKECTYQ  381



>ref|XP_007040243.1| P-loop nucleoside triphosphate hydrolases superfamily protein 
with CH (Calponin ) domain, putative isoform 2 [Theobroma cacao]
 gb|EOY24744.1| P-loop nucleoside triphosphate hydrolases superfamily protein 
with CH (Calponin) domain, putative isoform 2 [Theobroma cacao]
Length=1044

 Score =   135 bits (340),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 149/224 (67%), Gaps = 11/224 (5%)
 Frame = +3

Query  402   FQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLL  578
              QLK GC  D+    I ELMK  SL++AST+ LFS +  I++E+IERK GD+P  V+ LL
Sbjct  158   IQLKQGCYADLSDATILELMKSSSLQNASTQSLFSILYRIMDESIERKKGDVPHRVACLL  217

Query  579   KLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei--------  734
             + ++QEIE RVS ++ENL+ Q+N Y++RE+KYQ + RA E L  G  EE+E+        
Sbjct  218   RTIVQEIEWRVSTRAENLKNQNNVYRAREEKYQSRIRALETLAKGTVEENEVIISQLQHL  277

Query  735   --ekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKM  908
               EK+K EEK K  EQ +  L+K+K  ++++IS L  ELE  KK +E  CLQL+  +E  
Sbjct  278   KIEKSKLEEKGKVEEQDVLQLKKEKIQNDIEISRLREELESSKKMHEWHCLQLDAQVEDA  337

Query  909   RIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             ++EL  K+ ELECLL DS+K+ D+L++FSESK   W  KE  Y+
Sbjct  338   KVELEKKLKELECLLRDSRKEVDQLQSFSESKQKIWAHKECTYQ  381



>ref|XP_010089102.1| hypothetical protein L484_024275 [Morus notabilis]
 gb|EXB37349.1| hypothetical protein L484_024275 [Morus notabilis]
Length=1161

 Score =   134 bits (338),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 94/230 (41%), Positives = 136/230 (59%), Gaps = 10/230 (4%)
 Frame = +3

Query  381   GSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQ  560
             G K+ +V   +    D    KI E +   SL++ ST+  F+ V  IL ++I+ KNGD+P 
Sbjct  227   GQKVHEVLSRQGYHADFSDDKILEFINSHSLDNTSTQSFFNLVNQILEDSIQTKNGDLPN  286

Query  561   CVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh----  728
              V+ LL+ V+Q IEQR+S Q+   +  +N +K+RE+KYQ K R  E L  G  EEH    
Sbjct  287   RVAYLLRKVMQVIEQRISYQANKFKNHNNLFKAREEKYQAKLRVLETLAMGTTEEHEVVL  346

Query  729   ------eiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLE  890
                   + EK K EEK+K  E  +  + ++K+H E +IS L  ELEL +K +E  CLQLE
Sbjct  347   DQLQLIKSEKLKLEEKKKLEENDVEKITREKEHRESEISRLEQELELTRKRHESHCLQLE  406

Query  891   THLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
              +  + ++E   K+ + E  L DSKKK  ELE+F+ESK  +WKRKE  Y+
Sbjct  407   ENANEAKVEFDKKLKDFERELIDSKKKVKELESFAESKSRRWKRKERTYQ  456



>ref|XP_006584721.1| PREDICTED: kinesin-4-like isoform X1 [Glycine max]
 ref|XP_006584722.1| PREDICTED: kinesin-4-like isoform X2 [Glycine max]
Length=1082

 Score =   134 bits (337),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 96/243 (40%), Positives = 143/243 (59%), Gaps = 17/243 (7%)
 Frame = +3

Query  363   ASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIER  539
              S +H G K  ++FQLK G   D    K++E++K  +L+S ST+LLF+    IL++  ER
Sbjct  179   TSVDHTGIKSNELFQLKQGLLADFSDAKLNEVLKSNNLDSVSTQLLFNIGNRILSDIFER  238

Query  540   KNGDIPQC--VSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             KNGD+PQ    + LL+ +LQ I+ R S Q+E+++ Q++ +K+RE KYQ +  A E L  G
Sbjct  239   KNGDVPQAHRAACLLRKILQVIQLRFSNQAESMKNQNHLFKAREGKYQTRINALETLAVG  298

Query  714   aaeeheiek--------------akseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
               EE+E+                 K EEK+K  EQ    L+K+K H E++IS L  +LE+
Sbjct  299   TTEENEVVTSWVQQLKYALQVEQTKFEEKKKLEEQDFSRLKKEKVHSEIKISELKQDLEI  358

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              K+TYE    +LE    + + E   +I  L+  L D++ +  ELEAFSES+ LKWK KE 
Sbjct  359   AKRTYEEHVSELELQATESKAEYEKRIEGLKLHLADARMQVKELEAFSESRFLKWKNKED  418

Query  1032  VYK  1040
              Y+
Sbjct  419   TYQ  421



>ref|XP_003630850.1| Kinesin 4-like protein [Medicago truncatula]
Length=1284

 Score =   134 bits (337),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 148/251 (59%), Gaps = 14/251 (6%)
 Frame = +3

Query  321   EQIDCFNNMAKELSASNNH-AGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRL  494
             +++  F+    E SAS  +  G K  +VFQ+K G   D+ A KISE+MK  SL++A T+ 
Sbjct  193   QRVMSFSPSMAEPSASLIYQVGHKFHEVFQIKPGSYSDLPAAKISEMMKSNSLDNAPTQS  252

Query  495   LFSAVGDILNENIERKNGDIPQC---VSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSRE  665
             L S V  IL E++ER+NG+IP     V+ LL+ V QEIE+R+S Q+E++R Q N +K+RE
Sbjct  253   LLSVVNGILEESVERRNGEIPHVWLRVACLLRKVSQEIERRISTQAEHIRTQSNLFKARE  312

Query  666   QKYQLKDRAYEALRTGaaeeheiekak---------seekekhreQIICMLQKDKDHHEM  818
             +KYQ + R  EAL +G  EE E+  ++         +EE++K  E+ I  L K  +   +
Sbjct  313   EKYQSRIRVLEALASGTREESEMISSQLQQLKDEKVTEEEKKENEKEIIRLTKMLEDKNL  372

Query  819   QISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSE  998
             +IS L  +LE  KKTYE KC QLE      + EL  K  E E  L + +    E+E  S+
Sbjct  373   EISELKQKLEATKKTYEAKCSQLEEETRDAKAELRQKSQEYEYRLEELRNAVKEIEDSSD  432

Query  999   SKLLKWKRKEH  1031
             SK  +W+ KE+
Sbjct  433   SKYQEWRVKEN  443



>ref|XP_006390498.1| hypothetical protein EUTSA_v10018060mg [Eutrema salsugineum]
 gb|ESQ27784.1| hypothetical protein EUTSA_v10018060mg [Eutrema salsugineum]
Length=1027

 Score =   134 bits (336),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 88/197 (45%), Positives = 131/197 (66%), Gaps = 12/197 (6%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERK  542
             S +H G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S V  IL+E+IE+K
Sbjct  85   GSMHHGGHKFHEVFQMKQGRYDLQASKISEMMKSSSLDNAPTQSLLSVVNGILDESIEKK  144

Query  543  NGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae  722
            NG++PQ V+ LL+ V+QEIE+R++ Q+E+LR Q+N +K+RE+KYQ + +  EAL +G+ E
Sbjct  145  NGEVPQRVACLLRKVVQEIERRITTQAEHLRTQNNMFKTREEKYQSRIKVLEALASGSGE  204

Query  723  eh----------eiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEG  872
            E+          + EK+  EEK++  E+ +  L K+ D + +QIS+L  ELE  +K YE 
Sbjct  205  ENEIATQQLRQIKTEKSNWEEKKRSGEEDMLKLLKENDQYSLQISALRCELETTRKEYEQ  264

Query  873  KCLQLE--THLEKMRIE  917
            +C QLE  T  EK + E
Sbjct  265  QCSQLESQTMTEKAKWE  281



>ref|XP_009387623.1| PREDICTED: kinesin-4-like [Musa acuminata subsp. malaccensis]
Length=1026

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 91/234 (39%), Positives = 136/234 (58%), Gaps = 11/234 (5%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
             +H G    +VFQL+ G   D+ A KISE++K   L++A TR L S +  IL+E+IER+NG
Sbjct  164   HHVGHNFHEVFQLRQGRYSDLSAAKISEMLKSNCLDNAPTRSLLSIINGILDESIERRNG  223

Query  549   DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
             +IP  V+ LLK V+QEIE+R+S Q++++R Q+N  K RE+KY  + R  E L  G  EE+
Sbjct  224   EIPHRVACLLKRVVQEIERRISTQADHIRNQNNLIKVREEKYLSRIRVLEELAKGTHEEN  283

Query  729   eiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKC  878
             +I   + +  +  + +I          +  L K+K+  E  I  L  EL +  K YE +C
Sbjct  284   KIVMHQLQLTKAEKLKIEERKNIGEKEVFKLMKEKEDMESIIVELKQELAMTHKMYENRC  343

Query  879   LQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
              +LE    + +  L  K  E+E LL DSKKK  ELE  S+ K   W+ KE+ ++
Sbjct  344   QELEEKARESKAHLLEKTKEVEFLLADSKKKIKELEENSKLKFKNWENKENNFR  397



>gb|KJB20678.1| hypothetical protein B456_003G158800 [Gossypium raimondii]
Length=1042

 Score =   133 bits (335),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 101/253 (40%), Positives = 148/253 (58%), Gaps = 27/253 (11%)
 Frame = +3

Query  333   CFNNMAKELSASNNHAGSKLPDV------FQLKIGC-EDILAYKISELMKQKSLESASTR  491
             CFN    + + S  H   K  D+       Q+K GC  D+    + EL+K  SL++ ST+
Sbjct  133   CFN--PNDEANSFQHPSRKRWDISGEFESIQMKQGCYADLSDATVLELLKSSSLDNVSTQ  190

Query  492   LLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQK  671
              LFS +  I++E+IERK GD+P  V+ LL+ +++EIE RVS ++ NL+         E+K
Sbjct  191   SLFSIIYKIMDESIERKKGDVPHRVACLLRKIVEEIEWRVSTRARNLKN--------EEK  242

Query  672   YQLKDRAYEALRTGaaeeheie----------kakseekekhreQIICMLQKDKDHHEMQ  821
             YQ + RA E L  G  EE+ +           K+K EEK K  EQ +  L+K+K   +++
Sbjct  243   YQSRIRALETLAKGTMEENMVVLKNLQHIKFEKSKLEEKGKVEEQDVLQLKKEKVQKDLE  302

Query  822   ISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSES  1001
             IS L  ELE  KK +E +CLQLE   E  ++ L  K+ E+E LL+DS+KK DEL++FSES
Sbjct  303   ISRLKEELESSKKMHEIQCLQLEAQAEDNKVLLEKKLKEVEYLLSDSRKKVDELQSFSES  362

Query  1002  KLLKWKRKEHVYK  1040
             K  +WK +E  Y+
Sbjct  363   KQKRWKDRERSYQ  375



>ref|XP_002318552.1| kinesin motor family protein [Populus trichocarpa]
 gb|EEE96772.1| kinesin motor family protein [Populus trichocarpa]
Length=847

 Score =   132 bits (332),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 92/238 (39%), Positives = 148/238 (62%), Gaps = 11/238 (5%)
 Frame = +3

Query  360   SASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIE  536
             +AS +H G K  +VFQLK G   ++ A KISE+MK  SL+++ T+ L S V  IL+E+IE
Sbjct  193   AASMHHVGHKFHEVFQLKQGRFSELSAAKISEMMKSNSLDNSPTQSLLSVVNGILDESIE  252

Query  537   RKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGa  716
             RK+ +IP  V+ LL+ VLQEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EAL +G 
Sbjct  253   RKSYEIPHRVACLLRKVLQEIERRISTQAEHLRTQNNLFKAREEKYQSRIRVLEALASGT  312

Query  717   aeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTY  866
              EE    K + +  +  + ++          +  L  +++  ++ +S+L  ELEL K+T+
Sbjct  313   GEERGAVKDQLQHLKIEKSKMEGEKRLEEEHVAKLIIEREQRDLDLSTLKQELELVKETH  372

Query  867   EGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             E + L++E   +  +  L  ++ ELE  L DS+ +   L A+SESK + +  KE ++K
Sbjct  373   ELRHLKMEAEAKGAKAGLEERLKELELHLEDSRNQVKVLSAYSESKSMTFNEKEDIFK  430



>gb|KDP20118.1| hypothetical protein JCGZ_05887 [Jatropha curcas]
Length=1325

 Score =   132 bits (332),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = +3

Query  360  SASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIE  536
            +A  +HAG K  +VFQLK G   D+ A KISE+MK  SL++A T+ L S V  IL+E+IE
Sbjct  250  TALMHHAGHKFHEVFQLKQGRYADLSAAKISEMMKSNSLDNAPTQSLLSVVNGILDESIE  309

Query  537  RKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGa  716
            RKNG+IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +KSRE+KYQ + R  EAL +G 
Sbjct  310  RKNGEIPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKSREEKYQSRIRVLEALASGT  369

Query  717  aeeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYE  869
             EE   EKAK +EK+   ++ +  L K+K+  ++++S L  ELE+ KKT E
Sbjct  370  GEETGNEKAKIDEKKPIEDEHVIQLMKEKEQIDLELSMLKKELEILKKTLE  420


 Score = 69.7 bits (169),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = +3

Query  774   QIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLL  953
             + +  L K+K+   +++S+L  ELE+ KKTYE  CLQ+ET  +  + E   ++ EL  LL
Sbjct  620   EAVIKLMKEKEQSNIELSALKQELEMTKKTYELHCLQMETEAKDAKAEFEERLKELGHLL  679

Query  954   TDSKKKADELEAFSESKLLKWKRKEHVYK  1040
              DS+ K   LEA+SES+   WK+KE +++
Sbjct  680   EDSRNKVKMLEAYSESQNQSWKKKELIFQ  708



>gb|KJB39305.1| hypothetical protein B456_007G005900 [Gossypium raimondii]
Length=852

 Score =   131 bits (330),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 92/273 (34%), Positives = 147/273 (54%), Gaps = 37/273 (14%)
 Frame = +3

Query  333   CFNNMAKELSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAV  509
             CF++ A++ +   +H G    +VFQ K G   D+   KISE+MK  SL++A T+ L S V
Sbjct  8     CFSSSAEQSTTGLHHGGHNFHEVFQWKQGRYADLPGAKISEMMKSNSLDNAPTQSLLSVV  67

Query  510   GDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDR  689
               IL+E+++RKNG+IP  V+ LL+ V+QEIE+R+S Q+++LR Q+N +K RE+KY+ + R
Sbjct  68    NGILDESLDRKNGEIPHRVACLLRKVVQEIERRISTQADHLRTQNNLFKIREEKYKSRIR  127

Query  690   AYEALRTGaaeeheiekakseekekhreQI-----ICMLQKDK----------DHHEMQI  824
               E L  G +EE +I     ++ +    ++     +    KDK          + HE + 
Sbjct  128   VLETLAAGNSEEIKIVTVHPQQTKTESPKVEENRKVEEKVKDKRESVKETDKRETHEHET  187

Query  825   S---------------------SLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMEL  941
             S                     SL  ELE+ K  +E +CL+++   E ++  L  ++ EL
Sbjct  188   SKHKIDKQAIKQETEKHIREIASLKQELEMAKTIHEQQCLEMQKETEGVKAGLQARLNEL  247

Query  942   ECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             E LL DS  +  ELE  ++SK   W  K + Y+
Sbjct  248   ESLLNDSNNRVKELETSAKSKCQSWSMKVNTYQ  280



>ref|NP_177527.3| putative Kinesin motor protein-related protein [Arabidopsis thaliana]
 dbj|BAF01431.1| kinesin-related protein [Arabidopsis thaliana]
 gb|AEE35517.1| putative Kinesin motor protein-related protein [Arabidopsis thaliana]
Length=1025

 Score =   131 bits (330),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 121/197 (61%), Gaps = 12/197 (6%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERK  542
             S +H G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S +  IL+E+IERK
Sbjct  82   GSMHHGGHKFHEVFQMKQGRYDLQASKISEMMKSSSLDNAPTQSLLSVLNGILDESIERK  141

Query  543  NGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae  722
            NG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +    EAL +G   
Sbjct  142  NGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNIFKTREEKYQSRINVLEALASGTGV  201

Query  723  eheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEG  872
            EHEI   +  + E  +             +  L K  D H ++IS+L  ELE  K+ YE 
Sbjct  202  EHEIATQQLRQIETEKSMWEEKKKHEEEDMVKLMKQNDQHNLEISALKQELETTKRKYEQ  261

Query  873  KCLQLE--THLEKMRIE  917
            +  Q+E  T  EK + E
Sbjct  262  QYSQIESQTKTEKSKWE  278



>ref|XP_011005503.1| PREDICTED: kinesin KP1-like [Populus euphratica]
Length=847

 Score =   131 bits (329),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 104/276 (38%), Positives = 165/276 (60%), Gaps = 18/276 (7%)
 Frame = +3

Query  264   GAEKGEQANINAFRSFNASEQIDCFNNMAK-----ELSASNNH-AGSKLPDVFQLKIG-C  422
             G+ +G+ A+ N   S    E+   F+  AK     E SA++ H  G K  +VFQLK G  
Sbjct  156   GSPRGD-ASSNGHFSPTFGEEKRKFSPEAKSQQALEPSAASMHRVGHKFHEVFQLKQGRF  214

Query  423   EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIE  602
              D+ A KISE+MK  SL+++ T+ L S V  IL+E+IERK+ +IP  V+ LL+ V+QEIE
Sbjct  215   SDLSAAKISEMMKSNSLDNSPTQSLLSVVNGILDESIERKSYEIPHRVACLLRKVVQEIE  274

Query  603   QRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQI-  779
             +R+S Q+E+LR Q+N +K+RE+KYQ + R  EAL +G  EE    K + +  +  + ++ 
Sbjct  275   RRISTQAEHLRTQNNLFKAREEKYQSRIRVLEALASGTGEERGAVKDQLQHLKIEKSKME  334

Query  780   ---------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKI  932
                      +  L  +++  ++ +S+L  ELEL K+T+E + LQ+E  ++  +  L  ++
Sbjct  335   GEKRLEEEHVAKLIIEREQRDLDLSTLKQELELVKETHELRHLQMEAEVKGAKAGLEERL  394

Query  933   MELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
              ELE LL DS+ +   L A+SESK   +  KE ++K
Sbjct  395   KELELLLEDSRNQVKVLSAYSESKSKTFNEKEDIFK  430



>emb|CAN65659.1| hypothetical protein VITISV_000953 [Vitis vinifera]
Length=1742

 Score =   132 bits (331),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 107/233 (46%), Positives = 144/233 (62%), Gaps = 29/233 (12%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
              ++  +AS +H G +  + FQLK G   D  A KISEL++QKSLE    R+ F       
Sbjct  198   FSEPXAASIHHVGHRFQEGFQLKQGGYADFPAAKISELVEQKSLE----RVAF-------  246

Query  522   NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
                              LL+ ++QEIEQR+S Q+ENL+ Q+N YK+RE+KYQ + R  E 
Sbjct  247   -----------------LLRKIIQEIEQRISTQAENLKNQNNLYKAREEKYQSRIRVLET  289

Query  702   LRTGaaeeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCL  881
             L TG  EE+ IE  K EE++K  EQ +  L K+KD  + +I +L  ELE+ +KT+E  CL
Sbjct  290   LATGTTEENRIENTKIEERKKLEEQDVDRLMKEKDRSDNEILALKEELEMARKTHEKHCL  349

Query  882   QLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             QLET  ++ ++EL  K+ ELE LLTDSKKK  ELEAFSESK  +WKRKE  Y+
Sbjct  350   QLETQAKETKVELEKKLKELENLLTDSKKKVKELEAFSESKSRRWKRKELRYQ  402



>ref|XP_010459455.1| PREDICTED: kinesin-4-like isoform X2 [Camelina sativa]
 ref|XP_010459456.1| PREDICTED: kinesin-4-like isoform X2 [Camelina sativa]
Length=986

 Score =   130 bits (326),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 129/206 (63%), Gaps = 10/206 (5%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
            H G K  + FQLK G  D+ A KISE+MK  +L++A T+ L S V  IL+E+IE+K+G+I
Sbjct  51   HGGHKFHEAFQLKQGRFDLQAAKISEMMKSNNLDNAPTQSLLSIVNGILDESIEKKSGEI  110

Query  555  PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
            PQ V  LLK V+ EIE+R+S QSE+LR Q++ +K+RE+KYQ + +  E L +G +EE+EI
Sbjct  111  PQRVVCLLKKVVLEIERRISTQSEHLRTQNSVFKAREEKYQSRIKVLETLASGTSEENEI  170

Query  735  ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
               +  + +  + ++          +  L+K    H ++IS+L  ELE  KK Y+ +CLQ
Sbjct  171  ATRQLRKIKTEKSKLEEKKKDKEEDLVKLEKGNGQHNLEISTLRRELETTKKAYQQQCLQ  230

Query  885  LETHLEKMRIELGNKIMELECLLTDS  962
            +E+  +     + +++ ELE +  D+
Sbjct  231  MESQTKVATAGIEDRVKELEQMRKDA  256



>ref|XP_011022686.1| PREDICTED: kinesin-4-like isoform X2 [Populus euphratica]
Length=1117

 Score =   130 bits (327),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 146/245 (60%), Gaps = 12/245 (5%)
 Frame = +3

Query  339   NNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGD  515
             ++++ E +A  + A  KL ++FQ K G   D+    I ELMK K   +ASTR LFS V  
Sbjct  190   DSISSESAALAHDAAHKLSEMFQQKQGSYADLSDSNILELMKSKGFANASTRTLFSLVNI  249

Query  516   ILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAY  695
             IL ENIERKNG +    + +LK V+Q IE RVS Q+ NL+  +N Y+    K Q + +  
Sbjct  250   ILEENIERKNGHV-HHRALILKKVVQVIEHRVSTQALNLKDLNNLYEVNLGKCQSRIKVL  308

Query  696   EALRTGaa----------eeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHEL  845
             E L  G            ++ +IEK K +EK+K  EQ +   +++K H +++ S+L HEL
Sbjct  309   ETLAAGTTEEIQVLLSKLQQIKIEKTKIKEKKKLEEQELFRTKQEKIHSDIENSTLKHEL  368

Query  846   ELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRK  1025
             E+ K  +E  CL L+   E+ +++L  K+ME +C LT+SK++  ELE+FSESK  +WK K
Sbjct  369   EIAKTAHEEHCLLLQMRAEETKVQLEKKLMEFKCFLTESKERVKELESFSESKYQRWKSK  428

Query  1026  EHVYK  1040
             E  YK
Sbjct  429   EGTYK  433



>ref|XP_010459454.1| PREDICTED: kinesin-4-like isoform X1 [Camelina sativa]
Length=994

 Score =   130 bits (326),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 129/206 (63%), Gaps = 10/206 (5%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
            H G K  + FQLK G  D+ A KISE+MK  +L++A T+ L S V  IL+E+IE+K+G+I
Sbjct  59   HGGHKFHEAFQLKQGRFDLQAAKISEMMKSNNLDNAPTQSLLSIVNGILDESIEKKSGEI  118

Query  555  PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
            PQ V  LLK V+ EIE+R+S QSE+LR Q++ +K+RE+KYQ + +  E L +G +EE+EI
Sbjct  119  PQRVVCLLKKVVLEIERRISTQSEHLRTQNSVFKAREEKYQSRIKVLETLASGTSEENEI  178

Query  735  ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
               +  + +  + ++          +  L+K    H ++IS+L  ELE  KK Y+ +CLQ
Sbjct  179  ATRQLRKIKTEKSKLEEKKKDKEEDLVKLEKGNGQHNLEISTLRRELETTKKAYQQQCLQ  238

Query  885  LETHLEKMRIELGNKIMELECLLTDS  962
            +E+  +     + +++ ELE +  D+
Sbjct  239  MESQTKVATAGIEDRVKELEQMRKDA  264



>ref|XP_007160066.1| hypothetical protein PHAVU_002G289700g [Phaseolus vulgaris]
 ref|XP_007160067.1| hypothetical protein PHAVU_002G289700g [Phaseolus vulgaris]
 gb|ESW32060.1| hypothetical protein PHAVU_002G289700g [Phaseolus vulgaris]
 gb|ESW32061.1| hypothetical protein PHAVU_002G289700g [Phaseolus vulgaris]
Length=1080

 Score =   130 bits (326),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 93/243 (38%), Positives = 142/243 (58%), Gaps = 17/243 (7%)
 Frame = +3

Query  363   ASNNHAGSKLPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIER  539
             AS +H   K  ++F LK G   D     ++E++K  +L+S ST+LLF+    IL++  ER
Sbjct  177   ASVDHTAIKSNELFHLKNGLHVDYSDANLNEVLKSNNLDSVSTQLLFNTGKRILSDIFER  236

Query  540   KNGDIPQC--VSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             KNGD+PQ    + LL+ +LQ IE R S Q+E+++ Q+  +KSRE KYQ +  A E L  G
Sbjct  237   KNGDVPQAHRAACLLRKILQVIELRFSNQAESMKNQNYRFKSREGKYQTRINALETLAVG  296

Query  714   aae--------------eheiekakseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
               +                ++E+ K EEK++  EQ    L+K+K   E++IS+L  +LE+
Sbjct  297   TTKENEVLSCWVQQLKYALQVEQTKFEEKKRLEEQDFSHLKKEKVRSEIEISALKQDLEI  356

Query  852   CKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEH  1031
              K+T+E    +LE    + + E   +I EL+  L D++K+  ELEAFSES+ L WK KEH
Sbjct  357   AKRTHEKHVSELELLAAESKTEYEKRIEELKFHLADARKQVKELEAFSESRFLNWKNKEH  416

Query  1032  VYK  1040
              Y+
Sbjct  417   NYQ  419



>ref|XP_011045866.1| PREDICTED: kinesin KP1-like [Populus euphratica]
Length=847

 Score =   129 bits (325),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 103/276 (37%), Positives = 164/276 (59%), Gaps = 18/276 (7%)
 Frame = +3

Query  264   GAEKGEQANINAFRSFNASEQIDCFNNMAK-----ELSASNNH-AGSKLPDVFQLKIG-C  422
             G+ +G+ A+ N   S    E+   F+  AK     E SA++ H  G K  +VFQLK G  
Sbjct  156   GSPRGD-ASSNGHFSPTFGEEKRKFSPEAKSQQALEPSAASMHRVGHKFHEVFQLKQGRF  214

Query  423   EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIE  602
              D+   KISE+MK  SL+++ T+ L S V  IL+E+IERK+ +IP  V+ LL+ V+QEIE
Sbjct  215   SDLSTAKISEMMKSNSLDNSPTQSLLSVVNGILDESIERKSYEIPHRVACLLRKVVQEIE  274

Query  603   QRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQI-  779
             +R+S Q+E+LR Q+N +K+RE+KYQ + R  EAL +G  EE    K + +  +  + ++ 
Sbjct  275   RRISTQAEHLRTQNNLFKAREEKYQSRIRVLEALASGTGEERGAVKDQLQHLKIEKSKME  334

Query  780   ---------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKI  932
                      +  L  +++  ++ +S+L  ELEL K+T+E + LQ+E  ++  +  L  ++
Sbjct  335   GEKRLEEEHVAKLIIEREQRDLDLSTLKQELELVKETHELRHLQMEAEVKGAKAGLEERL  394

Query  933   MELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
              ELE LL DS+ +   L A+SESK   +  KE ++K
Sbjct  395   KELELLLEDSRNQVKVLSAYSESKSKTFNEKEDIFK  430



>ref|XP_011029283.1| PREDICTED: kinesin-4 isoform X3 [Populus euphratica]
Length=1098

 Score =   129 bits (325),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 109/267 (41%), Positives = 154/267 (58%), Gaps = 17/267 (6%)
 Frame = +3

Query  276   GEQANINAFRSFNASEQIDCFNNMAKELSASNNH-AGSKLPDVFQLKIGC-EDILAYKIS  449
             GE + I     +    Q D F+N     SA+  H     L D+FQ K G   D+  + I 
Sbjct  166   GENSTI-----YGEERQRDSFDNKYGSASAALVHDVVHNLSDMFQQKQGSYADLSDFNIL  220

Query  450   ELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSEN  629
             ELMK   L++ STR LFS V  IL E+IERKNG +   ++ ++K V+Q IEQRVS  + N
Sbjct  221   ELMKSNGLDNTSTRTLFSLVNRILEESIERKNGHVHHQMAHIVKKVVQVIEQRVSTLAVN  280

Query  630   LRKQHNSYKSREQKYQLKDRAYEALRTGaa----------eeheiekakseekekhreQI  779
             L+ Q+N YK R  K Q + +  E L  G            ++ +IEK K EEK+K  EQ 
Sbjct  281   LKDQNNLYKVRLGKCQSRIKVLETLAAGTTEEIRVLLSQLQQIKIEKTKIEEKKKLEEQE  340

Query  780   ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTD  959
             +   +++K H +++ S+L HELE+ K T+E  CL L+   E+ ++EL  K+ ELEC L +
Sbjct  341   LLRTKQEKIHSDIENSTLKHELEIAKTTHEEHCLLLQVQAEETKVELEKKLKELECFLAE  400

Query  960   SKKKADELEAFSESKLLKWKRKEHVYK  1040
             SKK+  ELE+FSESK  +WK KE  Y+
Sbjct  401   SKKRVKELESFSESKSQRWKSKEGSYR  427



>ref|XP_011029280.1| PREDICTED: kinesin-4 isoform X1 [Populus euphratica]
 ref|XP_011029281.1| PREDICTED: kinesin-4 isoform X1 [Populus euphratica]
Length=1099

 Score =   129 bits (325),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 109/267 (41%), Positives = 154/267 (58%), Gaps = 17/267 (6%)
 Frame = +3

Query  276   GEQANINAFRSFNASEQIDCFNNMAKELSASNNH-AGSKLPDVFQLKIGC-EDILAYKIS  449
             GE + I     +    Q D F+N     SA+  H     L D+FQ K G   D+  + I 
Sbjct  166   GENSTI-----YGEERQRDSFDNKYGSASAALVHDVVHNLSDMFQQKQGSYADLSDFNIL  220

Query  450   ELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSEN  629
             ELMK   L++ STR LFS V  IL E+IERKNG +   ++ ++K V+Q IEQRVS  + N
Sbjct  221   ELMKSNGLDNTSTRTLFSLVNRILEESIERKNGHVHHQMAHIVKKVVQVIEQRVSTLAVN  280

Query  630   LRKQHNSYKSREQKYQLKDRAYEALRTGaa----------eeheiekakseekekhreQI  779
             L+ Q+N YK R  K Q + +  E L  G            ++ +IEK K EEK+K  EQ 
Sbjct  281   LKDQNNLYKVRLGKCQSRIKVLETLAAGTTEEIRVLLSQLQQIKIEKTKIEEKKKLEEQE  340

Query  780   ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTD  959
             +   +++K H +++ S+L HELE+ K T+E  CL L+   E+ ++EL  K+ ELEC L +
Sbjct  341   LLRTKQEKIHSDIENSTLKHELEIAKTTHEEHCLLLQVQAEETKVELEKKLKELECFLAE  400

Query  960   SKKKADELEAFSESKLLKWKRKEHVYK  1040
             SKK+  ELE+FSESK  +WK KE  Y+
Sbjct  401   SKKRVKELESFSESKSQRWKSKEGSYR  427



>ref|XP_010537447.1| PREDICTED: kinesin-4-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010537448.1| PREDICTED: kinesin-4-like isoform X1 [Tarenaya hassleriana]
Length=945

 Score =   129 bits (325),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 127/204 (62%), Gaps = 10/204 (5%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERK  542
             S +  G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S V  IL+E+IERK
Sbjct  68   GSMHQGGHKFHEVFQMKQGRYDLHAAKISEMMKSNSLDNAPTQSLLSVVNGILDESIERK  127

Query  543  NGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae  722
            NG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +    EAL +G  E
Sbjct  128  NGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNLFKAREEKYQSRINVLEALASGTRE  187

Query  723  eheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEG  872
            E+EI   + ++ +  + ++          +  L K+   H  +I++L  ELE+ +K YE 
Sbjct  188  ENEIATNQLQQIKTEKFKLEEKKKNEEEDMVKLMKENHQHNDEIAALRQELEVTRKAYEQ  247

Query  873  KCLQLETHLEKMRIELGNKIMELE  944
            +C + E+  +     L  ++ ELE
Sbjct  248  QCSETESQTKVATTGLEERLKELE  271



>ref|XP_010537450.1| PREDICTED: kinesin-4-like isoform X2 [Tarenaya hassleriana]
Length=943

 Score =   129 bits (324),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 127/204 (62%), Gaps = 10/204 (5%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERK  542
             S +  G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S V  IL+E+IERK
Sbjct  68   GSMHQGGHKFHEVFQMKQGRYDLHAAKISEMMKSNSLDNAPTQSLLSVVNGILDESIERK  127

Query  543  NGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae  722
            NG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +    EAL +G  E
Sbjct  128  NGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNLFKAREEKYQSRINVLEALASGTRE  187

Query  723  eheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEG  872
            E+EI   + ++ +  + ++          +  L K+   H  +I++L  ELE+ +K YE 
Sbjct  188  ENEIATNQLQQIKTEKFKLEEKKKNEEEDMVKLMKENHQHNDEIAALRQELEVTRKAYEQ  247

Query  873  KCLQLETHLEKMRIELGNKIMELE  944
            +C + E+  +     L  ++ ELE
Sbjct  248  QCSETESQTKVATTGLEERLKELE  271



>emb|CDX96493.1| BnaA07g31040D [Brassica napus]
Length=942

 Score =   129 bits (324),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 121/190 (64%), Gaps = 10/190 (5%)
 Frame = +3

Query  357  LSASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIE  536
            LS  ++H G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S V  IL+E+IE
Sbjct  83   LSPGSHHGGHKFHEVFQMKQGRYDLQASKISEMMKSSSLDNAPTQSLLSVVNGILDESIE  142

Query  537  RKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGa  716
            RKNG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +    EAL +G+
Sbjct  143  RKNGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNIFKAREEKYQSRINVLEALASGS  202

Query  717  aeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTY  866
             EE+EI   +  + +  +             +  L K+ D + ++IS L  ELE  K+  
Sbjct  203  GEENEIATQQLRQMKTEKSNWEEKKKNEEEDMLKLLKENDQYNVEISVLKQELETTKREC  262

Query  867  EGKCLQLETH  896
            E +C ++E+ 
Sbjct  263  EQQCSKMESQ  272



>emb|CDX73023.1| BnaC06g34710D [Brassica napus]
Length=895

 Score =   129 bits (324),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 121/190 (64%), Gaps = 10/190 (5%)
 Frame = +3

Query  357  LSASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIE  536
            LS  ++H G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S V  IL+E+IE
Sbjct  83   LSPGSHHGGHKFHEVFQMKQGRYDLQASKISEMMKSSSLDNAPTQSLLSVVNGILDESIE  142

Query  537  RKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGa  716
            RKNG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +    EAL +G+
Sbjct  143  RKNGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNIFKAREEKYQSRINVLEALASGS  202

Query  717  aeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTY  866
             EE+EI   +  + +  +             +  L K+ D + ++IS L  ELE  K+  
Sbjct  203  GEENEIATQQLRQMKTEKSNWEEKKKNEEEDMLKLLKENDQYNVEISVLKQELETTKREC  262

Query  867  EGKCLQLETH  896
            E +C ++E+ 
Sbjct  263  EQQCSKMESQ  272



>ref|XP_010537451.1| PREDICTED: kinesin-4-like isoform X3 [Tarenaya hassleriana]
Length=928

 Score =   129 bits (324),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 127/204 (62%), Gaps = 10/204 (5%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERK  542
             S +  G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S V  IL+E+IERK
Sbjct  51   GSMHQGGHKFHEVFQMKQGRYDLHAAKISEMMKSNSLDNAPTQSLLSVVNGILDESIERK  110

Query  543  NGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae  722
            NG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +    EAL +G  E
Sbjct  111  NGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNLFKAREEKYQSRINVLEALASGTRE  170

Query  723  eheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEG  872
            E+EI   + ++ +  + ++          +  L K+   H  +I++L  ELE+ +K YE 
Sbjct  171  ENEIATNQLQQIKTEKFKLEEKKKNEEEDMVKLMKENHQHNDEIAALRQELEVTRKAYEQ  230

Query  873  KCLQLETHLEKMRIELGNKIMELE  944
            +C + E+  +     L  ++ ELE
Sbjct  231  QCSETESQTKVATTGLEERLKELE  254



>ref|XP_009106042.1| PREDICTED: kinesin-4 [Brassica rapa]
Length=1021

 Score =   129 bits (324),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 121/190 (64%), Gaps = 10/190 (5%)
 Frame = +3

Query  357  LSASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIE  536
            LS  ++H G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S V  IL+E+IE
Sbjct  83   LSPGSHHGGHKFHEVFQMKQGRYDLQASKISEMMKSSSLDNAPTQSLLSVVNGILDESIE  142

Query  537  RKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGa  716
            RKNG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +    EAL +G+
Sbjct  143  RKNGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNIFKAREEKYQSRINVLEALASGS  202

Query  717  aeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTY  866
             EE+EI   +  + +  +             +  L K+ D + ++IS L  ELE  K+  
Sbjct  203  GEENEIATQQLRQMKTEKSNWEEKKKNEEEDMLKLLKENDQYNVEISVLKQELETTKREC  262

Query  867  EGKCLQLETH  896
            E +C ++E+ 
Sbjct  263  EQQCSKMESQ  272



>ref|XP_010471464.1| PREDICTED: kinesin-4 [Camelina sativa]
Length=1031

 Score =   129 bits (324),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 122/197 (62%), Gaps = 12/197 (6%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERK  542
             S +H G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S V  IL+E+IERK
Sbjct  83   GSMHHGGHKFHEVFQMKQGRYDLQASKISEMMKSSSLDNAPTQSLLSVVNGILDESIERK  142

Query  543  NGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae  722
            NG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +    EAL +G   
Sbjct  143  NGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNIFKTREEKYQSRINVLEALASGTGV  202

Query  723  eheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEG  872
            EHEI   +  + +  +             +  L K  D + ++I++L  ELE  KK +E 
Sbjct  203  EHEIATQQLRQIKTEKSMWEEKKKLEEEDMVKLMKQNDQYNLEIAALKQELEASKKEHEQ  262

Query  873  KCLQLE--THLEKMRIE  917
            +  Q+E  T  EK++ E
Sbjct  263  QYSQMESKTMTEKLKWE  279



>ref|XP_009104788.1| PREDICTED: kinesin-4-like [Brassica rapa]
 ref|XP_009104789.1| PREDICTED: kinesin-4-like [Brassica rapa]
Length=1020

 Score =   128 bits (322),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 129/197 (65%), Gaps = 12/197 (6%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERK  542
             S +H G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S V  IL+E+IERK
Sbjct  80   GSMHHGGHKFHEVFQMKQGRYDLQASKISEMMKSSSLDNAPTQSLLSVVNGILDESIERK  139

Query  543  NGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae  722
            NG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +    EAL +G+ +
Sbjct  140  NGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNIFKTREEKYQSRINVLEALASGSGK  199

Query  723  eh----------eiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEG  872
            +           + EK+  EEK+K+ E+ +  L K+   ++++IS+L  ELE  K+ Y+ 
Sbjct  200  DSEIATQQLRQIKTEKSTWEEKKKNGEEDMLKLLKENCQYDLEISALRQELETTKREYKQ  259

Query  873  KCLQLE--THLEKMRIE  917
            +C  +E  T  EK + E
Sbjct  260  QCTHMESQTMTEKTKWE  276



>ref|XP_010416204.1| PREDICTED: kinesin-4-like [Camelina sativa]
 ref|XP_010416205.1| PREDICTED: kinesin-4-like [Camelina sativa]
Length=1031

 Score =   127 bits (320),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 122/197 (62%), Gaps = 12/197 (6%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERK  542
             S +H G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S V  IL+E+IERK
Sbjct  83   GSMHHGGHKFHEVFQMKQGRYDLQASKISEMMKSSSLDNAPTQSLLSVVNGILDESIERK  142

Query  543  NGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae  722
            NG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +    EAL +G+  
Sbjct  143  NGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNIFKTREEKYQSRINVLEALASGSGV  202

Query  723  eheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEG  872
            EHEI   +  + +  +             +  L K  D + ++I++L  ELE  KK +E 
Sbjct  203  EHEIATQQLRQIKTEKSMWEEKKKHEEEDMVKLMKQNDQYNLEIAALKQELEASKKEHEQ  262

Query  873  KCLQLE--THLEKMRIE  917
            +  Q+E  T  EK + E
Sbjct  263  QYSQMESKTMTEKSKWE  279



>gb|KJB39304.1| hypothetical protein B456_007G005900 [Gossypium raimondii]
Length=879

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 88/260 (34%), Positives = 139/260 (53%), Gaps = 37/260 (14%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
             +H G    +VFQ K G   D+   KISE+MK  SL++A T+ L S V  IL+E+++RKNG
Sbjct  62    HHGGHNFHEVFQWKQGRYADLPGAKISEMMKSNSLDNAPTQSLLSVVNGILDESLDRKNG  121

Query  549   DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
             +IP  V+ LL+ V+QEIE+R+S Q+++LR Q+N +K RE+KY+ + R  E L  G +EE 
Sbjct  122   EIPHRVACLLRKVVQEIERRISTQADHLRTQNNLFKIREEKYKSRIRVLETLAAGNSEEI  181

Query  729   eiekakseekekhreQI----------------ICMLQKDKDH-HEM-------------  818
             +I     ++ +    ++                +    K + H HE              
Sbjct  182   KIVTVHPQQTKTESPKVEENRKVEEKVKDKRESVKETDKRETHEHETSKHKIDKQAIKQE  241

Query  819   ------QISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADE  980
                   +I+SL  ELE+ K  +E +CL+++   E ++  L  ++ ELE LL DS  +  E
Sbjct  242   TEKHIREIASLKQELEMAKTIHEQQCLEMQKETEGVKAGLQARLNELESLLNDSNNRVKE  301

Query  981   LEAFSESKLLKWKRKEHVYK  1040
             LE  ++SK   W  K + Y+
Sbjct  302   LETSAKSKCQSWSMKVNTYQ  321



>ref|XP_004969922.1| PREDICTED: kinesin-4-like [Setaria italica]
Length=959

 Score =   127 bits (319),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 85/233 (36%), Positives = 139/233 (60%), Gaps = 11/233 (5%)
 Frame = +3

Query  375   HAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGD  551
             H+G K+ D FQ+K G   D+ A KISE+M   SL++A T+ L   V  IL+E++ERK G+
Sbjct  170   HSGQKVHDAFQIKRGSYTDLPAAKISEMMHSSSLDNAPTQSLLRVVNGILDESVERKRGE  229

Query  552   IPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehe  731
             IP  V  LL+ V+QEIE R++ Q++++R Q++  K+RE KY+ K +A E L  G  EE+E
Sbjct  230   IPHRVVYLLRNVVQEIEHRIAIQADHIRNQNSIIKTREDKYRSKIKALETLVNGTNEENE  289

Query  732   iekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCL  881
             +   + E  E  + +I          +  L ++K++ E  I+SL  E+++  + +E    
Sbjct  290   MTVNRLELIEVEKSKIDEKRKLGEQDMVRLMREKENAENAIASLQQEIQILSRMHEQYRE  349

Query  882   QLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             ++ET   +M   L  +I E E LL  SK+K +E+E+ S+ K   W RK ++++
Sbjct  350   RMETEARQMEEHLTTRIKEAEFLLMQSKRKVEEIESASQLKSQLWSRKANIFQ  402



>ref|XP_006654662.1| PREDICTED: kinesin-4-like [Oryza brachyantha]
Length=921

 Score =   127 bits (318),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 93/231 (40%), Positives = 141/231 (61%), Gaps = 11/231 (5%)
 Frame = +3

Query  381   GSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIP  557
             G KL ++FQLK G   D+ A KISE+M   SL++A T+ L S V  IL+E+IERK G+IP
Sbjct  89    GQKLREIFQLKRGSYADLPAAKISEMMHSNSLDNAPTQSLLSVVNGILDESIERKKGEIP  148

Query  558   QCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheie  737
               V  LL+ V+QEIE+R+  Q+E++R Q+   K+RE KY+ K +A E L  G  EE+++ 
Sbjct  149   HRVVYLLRKVVQEIERRLCIQAEHIRSQNMIIKTREDKYRSKIKALEMLVNGTNEENQMA  208

Query  738   k----------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQL  887
                        +K EEK+K  EQ +  L K+K++ E  I SL  E+++    +E +  ++
Sbjct  209   TNRLQIIKEEKSKIEEKQKLGEQDVARLMKEKEYAESTIVSLKKEMDVMTSMHEQQLQKI  268

Query  888   ETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             E + ++M   L  KI E+E LL  S KK +E+EA S+ K   W +KE +++
Sbjct  269   EINAKQMEEHLATKIKEVEFLLGQSNKKIEEVEAASQLKSQLWNKKEGIFQ  319



>ref|XP_010477019.1| PREDICTED: carboxy-terminal kinesin 2-like [Camelina sativa]
Length=1009

 Score =   127 bits (318),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 130/206 (63%), Gaps = 10/206 (5%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
            H G K  + FQLK G  D+ A KISE+MK  +L++A T+ L S V  IL+E+IE+K G+I
Sbjct  51   HGGHKFHEAFQLKQGRFDLQAAKISEMMKSNNLDNAPTQSLLSIVNGILDESIEKKTGEI  110

Query  555  PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
            PQ V  LLK V+ EIE+R+S QSE+LR Q++ +K+RE+KYQ + +  E L +G +EE+EI
Sbjct  111  PQRVVCLLKKVVLEIERRISTQSEHLRTQNSVFKAREEKYQSRIKVLETLASGTSEENEI  170

Query  735  ekak----------seekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
               +           EEK+K +E  +  L+K+   H ++IS+L  E E  KK Y+ +CLQ
Sbjct  171  ATRQLRKIKTEKSKLEEKKKDKEDDMVKLEKENGQHNLEISTLRREREATKKAYQQQCLQ  230

Query  885  LETHLEKMRIELGNKIMELECLLTDS  962
            +E+  +     + +++ ELE +  D+
Sbjct  231  MESQTKVATAGIEDRVKELEQMRKDA  256



>ref|XP_009761313.1| PREDICTED: kinesin-4-like isoform X4 [Nicotiana sylvestris]
Length=833

 Score =   126 bits (317),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 124/186 (67%), Gaps = 15/186 (8%)
 Frame = +3

Query  345  MAKELSASNNHAGSKLPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDIL  521
            MA+  +A  +H G K  +VFQLK G   +I A +ISE+MK  SL+ A T+ L S V  IL
Sbjct  210  MAEPSAALLDHVGHKFHEVFQLKQGSHTEIPAARISEMMKSNSLDIAPTQSLLSVVNGIL  269

Query  522  NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
            +E+IERKNG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N YK+RE+KYQ + R  EA
Sbjct  270  DESIERKNGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNLYKTREEKYQSRIRVLEA  329

Query  702  LRTGaaeehe----------iekakseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
            L TG +EE +           EK K EEK+K+ EQ +  L++  D    QI++L  ELE+
Sbjct  330  LATGTSEETQIVMNQLQQIKNEKNKMEEKKKNEEQDVPKLKEKDD----QIAALKQELEI  385

Query  852  CKKTYE  869
             KK+YE
Sbjct  386  AKKSYE  391


 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +3

Query  795   KDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKA  974
             K+K+ H+ +I++L  E+E+ KK+YE   L+++    + + EL  K+ E   LLT+S+ + 
Sbjct  523   KEKEDHKQEIAALKQEMEISKKSYEQHTLEMDKKATEAQKELEEKLKEATSLLTESRNRI  582

Query  975   DELEAFSESKLLKWKRKEHVYK  1040
              ELE FS+ K   W +KEH+Y+
Sbjct  583   KELETFSQEKSQDWTKKEHIYQ  604



>ref|XP_009761312.1| PREDICTED: kinesin-4-like isoform X3 [Nicotiana sylvestris]
Length=838

 Score =   126 bits (317),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 124/186 (67%), Gaps = 15/186 (8%)
 Frame = +3

Query  345  MAKELSASNNHAGSKLPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDIL  521
            MA+  +A  +H G K  +VFQLK G   +I A +ISE+MK  SL+ A T+ L S V  IL
Sbjct  210  MAEPSAALLDHVGHKFHEVFQLKQGSHTEIPAARISEMMKSNSLDIAPTQSLLSVVNGIL  269

Query  522  NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
            +E+IERKNG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N YK+RE+KYQ + R  EA
Sbjct  270  DESIERKNGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNLYKTREEKYQSRIRVLEA  329

Query  702  LRTGaaeehe----------iekakseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
            L TG +EE +           EK K EEK+K+ EQ +  L++  D    QI++L  ELE+
Sbjct  330  LATGTSEETQIVMNQLQQIKNEKNKMEEKKKNEEQDVPKLKEKDD----QIAALKQELEI  385

Query  852  CKKTYE  869
             KK+YE
Sbjct  386  AKKSYE  391


 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +3

Query  795   KDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKA  974
             K+K+ H+ +I++L  E+E+ KK+YE   L+++    + + EL  K+ E   LLT+S+ + 
Sbjct  523   KEKEDHKQEIAALKQEMEISKKSYEQHTLEMDKKATEAQKELEEKLKEATSLLTESRNRI  582

Query  975   DELEAFSESKLLKWKRKEHVYK  1040
              ELE FS+ K   W +KEH+Y+
Sbjct  583   KELETFSQEKSQDWTKKEHIYQ  604



>ref|XP_009761311.1| PREDICTED: kinesin-4-like isoform X2 [Nicotiana sylvestris]
Length=1031

 Score =   126 bits (317),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 124/186 (67%), Gaps = 15/186 (8%)
 Frame = +3

Query  345  MAKELSASNNHAGSKLPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDIL  521
            MA+  +A  +H G K  +VFQLK G   +I A +ISE+MK  SL+ A T+ L S V  IL
Sbjct  210  MAEPSAALLDHVGHKFHEVFQLKQGSHTEIPAARISEMMKSNSLDIAPTQSLLSVVNGIL  269

Query  522  NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
            +E+IERKNG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N YK+RE+KYQ + R  EA
Sbjct  270  DESIERKNGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNLYKTREEKYQSRIRVLEA  329

Query  702  LRTGaaeehe----------iekakseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
            L TG +EE +           EK K EEK+K+ EQ +  L++  D    QI++L  ELE+
Sbjct  330  LATGTSEETQIVMNQLQQIKNEKNKMEEKKKNEEQDVPKLKEKDD----QIAALKQELEI  385

Query  852  CKKTYE  869
             KK+YE
Sbjct  386  AKKSYE  391


 Score = 64.3 bits (155),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +3

Query  795   KDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKA  974
             K+K+ H+ +I++L  E+E+ KK+YE   L+++    + + EL  K+ E   LLT+S+ + 
Sbjct  523   KEKEDHKQEIAALKQEMEISKKSYEQHTLEMDKKATEAQKELEEKLKEATSLLTESRNRI  582

Query  975   DELEAFSESKLLKWKRKEHVYK  1040
              ELE FS+ K   W +KEH+Y+
Sbjct  583   KELETFSQEKSQDWTKKEHIYQ  604



>gb|KHN16578.1| Kinesin-4 [Glycine soja]
Length=1196

 Score =   127 bits (318),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 91/260 (35%), Positives = 152/260 (58%), Gaps = 17/260 (7%)
 Frame = +3

Query  276   GEQANINAFRSFNASEQIDCFNNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISE  452
             GEQ  I A       +++     MA+  ++  +H G    +VFQ+K G   D+ A KI+E
Sbjct  178   GEQRKIAAGSML---QRVKSSPVMAESSASLIHHVGHNFHEVFQMKPGSYADLPAAKIAE  234

Query  453   LMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENL  632
             +MK  S+++A T+ L S V  IL E++ER+NG+IP CV+ LLK V QEIE+R+S Q+E+L
Sbjct  235   MMKSNSIDNAPTQSLLSVVNGILEESVERRNGEIPHCVACLLKKVTQEIERRMSTQAEHL  294

Query  633   RKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQI---------IC  785
             R Q+N +K+RE+KYQ + R  EAL +G  +E EI  ++ ++ +  + +          + 
Sbjct  295   RTQNNLFKAREEKYQSRIRVLEALASGTIDESEICPSQFQQLKGEKIKEKVKKVDENEVV  354

Query  786   MLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIME----LECLL  953
              L K+++   ++IS+L  ELE  K+TYE +  Q+E   +  +  L  K+ E    LE L 
Sbjct  355   RLIKEQEDKNLEISALKVELETTKRTYEVQFSQMEEEAKSFKASLTWKVQEYEHQLEELR  414

Query  954   TDSKKKADELEAFSESKLLK  1013
              + +K  +E++   E ++++
Sbjct  415   NEVEKIKEEVKTADEKEIVR  434



>ref|XP_006301495.1| hypothetical protein CARUB_v10021921mg [Capsella rubella]
 gb|EOA34393.1| hypothetical protein CARUB_v10021921mg [Capsella rubella]
Length=1041

 Score =   126 bits (317),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 83/197 (42%), Positives = 120/197 (61%), Gaps = 12/197 (6%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERK  542
             S +H G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S +  IL+E+IERK
Sbjct  82   GSMHHGGHKFHEVFQMKQGRYDLQASKISEMMKSSSLDNAPTQSLLSVLNGILDESIERK  141

Query  543  NGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae  722
            NG+IPQ V+ LL+ V QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +    EAL +G+  
Sbjct  142  NGEIPQRVACLLRKVAQEIERRISTQAEHLRTQNNIFKTREEKYQSRINVLEALASGSGV  201

Query  723  eheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEG  872
            EHEI   +  + +  +             +  L K  D + ++I++L  ELE  KK YE 
Sbjct  202  EHEIATQQLRQIKTEKSMWEEKKKSEEEDMVKLMKQNDQYNLEIAALKQELEASKKEYEQ  261

Query  873  KCLQLE--THLEKMRIE  917
               Q+E  T  EK + E
Sbjct  262  HYSQMESKTMTEKSKWE  278



>ref|XP_011022689.1| PREDICTED: kinesin-4-like isoform X5 [Populus euphratica]
Length=1166

 Score =   126 bits (317),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 147/246 (60%), Gaps = 13/246 (5%)
 Frame = +3

Query  339   NNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSL-ESASTRLLFSAVG  512
             ++++ E +A  + A  KL ++FQ K G   D+    I ELMK K   ++ASTR LFS V 
Sbjct  190   DSISSESAALAHDAAHKLSEMFQQKQGSYADLSDSNILELMKSKGFAQNASTRTLFSLVN  249

Query  513   DILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRA  692
              IL ENIERKNG +    + +LK V+Q IE RVS Q+ NL+  +N Y+    K Q + + 
Sbjct  250   IILEENIERKNGHV-HHRALILKKVVQVIEHRVSTQALNLKDLNNLYEVNLGKCQSRIKV  308

Query  693   YEALRTGaa----------eeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHE  842
              E L  G            ++ +IEK K +EK+K  EQ +   +++K H +++ S+L HE
Sbjct  309   LETLAAGTTEEIQVLLSKLQQIKIEKTKIKEKKKLEEQELFRTKQEKIHSDIENSTLKHE  368

Query  843   LELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKR  1022
             LE+ K  +E  CL L+   E+ +++L  K+ME +C LT+SK++  ELE+FSESK  +WK 
Sbjct  369   LEIAKTAHEEHCLLLQMRAEETKVQLEKKLMEFKCFLTESKERVKELESFSESKYQRWKS  428

Query  1023  KEHVYK  1040
             KE  YK
Sbjct  429   KEGTYK  434



>ref|XP_011022688.1| PREDICTED: kinesin-4-like isoform X4 [Populus euphratica]
Length=1040

 Score =   126 bits (317),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 147/246 (60%), Gaps = 13/246 (5%)
 Frame = +3

Query  339   NNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSL-ESASTRLLFSAVG  512
             ++++ E +A  + A  KL ++FQ K G   D+    I ELMK K   ++ASTR LFS V 
Sbjct  112   DSISSESAALAHDAAHKLSEMFQQKQGSYADLSDSNILELMKSKGFAQNASTRTLFSLVN  171

Query  513   DILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRA  692
              IL ENIERKNG +    + +LK V+Q IE RVS Q+ NL+  +N Y+    K Q + + 
Sbjct  172   IILEENIERKNGHV-HHRALILKKVVQVIEHRVSTQALNLKDLNNLYEVNLGKCQSRIKV  230

Query  693   YEALRTGaa----------eeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHE  842
              E L  G            ++ +IEK K +EK+K  EQ +   +++K H +++ S+L HE
Sbjct  231   LETLAAGTTEEIQVLLSKLQQIKIEKTKIKEKKKLEEQELFRTKQEKIHSDIENSTLKHE  290

Query  843   LELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKR  1022
             LE+ K  +E  CL L+   E+ +++L  K+ME +C LT+SK++  ELE+FSESK  +WK 
Sbjct  291   LEIAKTAHEEHCLLLQMRAEETKVQLEKKLMEFKCFLTESKERVKELESFSESKYQRWKS  350

Query  1023  KEHVYK  1040
             KE  YK
Sbjct  351   KEGTYK  356



>ref|XP_011022687.1| PREDICTED: kinesin-4-like isoform X3 [Populus euphratica]
Length=1117

 Score =   126 bits (317),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 147/246 (60%), Gaps = 13/246 (5%)
 Frame = +3

Query  339   NNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSL-ESASTRLLFSAVG  512
             ++++ E +A  + A  KL ++FQ K G   D+    I ELMK K   ++ASTR LFS V 
Sbjct  190   DSISSESAALAHDAAHKLSEMFQQKQGSYADLSDSNILELMKSKGFAQNASTRTLFSLVN  249

Query  513   DILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRA  692
              IL ENIERKNG +    + +LK V+Q IE RVS Q+ NL+  +N Y+    K Q + + 
Sbjct  250   IILEENIERKNGHV-HHRALILKKVVQVIEHRVSTQALNLKDLNNLYEVNLGKCQSRIKV  308

Query  693   YEALRTGaa----------eeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHE  842
              E L  G            ++ +IEK K +EK+K  EQ +   +++K H +++ S+L HE
Sbjct  309   LETLAAGTTEEIQVLLSKLQQIKIEKTKIKEKKKLEEQELFRTKQEKIHSDIENSTLKHE  368

Query  843   LELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKR  1022
             LE+ K  +E  CL L+   E+ +++L  K+ME +C LT+SK++  ELE+FSESK  +WK 
Sbjct  369   LEIAKTAHEEHCLLLQMRAEETKVQLEKKLMEFKCFLTESKERVKELESFSESKYQRWKS  428

Query  1023  KEHVYK  1040
             KE  YK
Sbjct  429   KEGTYK  434



>ref|XP_009761307.1| PREDICTED: kinesin-4-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009761308.1| PREDICTED: kinesin-4-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009761309.1| PREDICTED: kinesin-4-like isoform X1 [Nicotiana sylvestris]
 ref|XP_009761310.1| PREDICTED: kinesin-4-like isoform X1 [Nicotiana sylvestris]
Length=1063

 Score =   126 bits (317),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 90/186 (48%), Positives = 124/186 (67%), Gaps = 15/186 (8%)
 Frame = +3

Query  345  MAKELSASNNHAGSKLPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDIL  521
            MA+  +A  +H G K  +VFQLK G   +I A +ISE+MK  SL+ A T+ L S V  IL
Sbjct  210  MAEPSAALLDHVGHKFHEVFQLKQGSHTEIPAARISEMMKSNSLDIAPTQSLLSVVNGIL  269

Query  522  NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
            +E+IERKNG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N YK+RE+KYQ + R  EA
Sbjct  270  DESIERKNGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNLYKTREEKYQSRIRVLEA  329

Query  702  LRTGaaeehe----------iekakseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
            L TG +EE +           EK K EEK+K+ EQ +  L++  D    QI++L  ELE+
Sbjct  330  LATGTSEETQIVMNQLQQIKNEKNKMEEKKKNEEQDVPKLKEKDD----QIAALKQELEI  385

Query  852  CKKTYE  869
             KK+YE
Sbjct  386  AKKSYE  391


 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/82 (38%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +3

Query  795   KDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKA  974
             K+K+ H+ +I++L  E+E+ KK+YE   L+++    + + EL  K+ E   LLT+S+ + 
Sbjct  523   KEKEDHKQEIAALKQEMEISKKSYEQHTLEMDKKATEAQKELEEKLKEATSLLTESRNRI  582

Query  975   DELEAFSESKLLKWKRKEHVYK  1040
              ELE FS+ K   W +KEH+Y+
Sbjct  583   KELETFSQEKSQDWTKKEHIYQ  604



>ref|XP_002304498.1| kinesin motor family protein [Populus trichocarpa]
 gb|EEE79477.1| kinesin motor family protein [Populus trichocarpa]
Length=1133

 Score =   126 bits (317),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 147/246 (60%), Gaps = 13/246 (5%)
 Frame = +3

Query  339   NNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLE-SASTRLLFSAVG  512
             ++++ E +A  + A  KL ++FQ K G   D+    I ELMK    + +ASTR LFS V 
Sbjct  190   DSISSESAALAHDAAHKLSEMFQQKQGSYADLSDSNILELMKSNGFDQNASTRTLFSLVN  249

Query  513   DILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRA  692
              IL ENIERKNG +   ++ +LK V+Q IE RVS Q+ NL+  +N Y+    K Q + + 
Sbjct  250   RILEENIERKNGHV-HHMALILKKVVQVIEHRVSTQAVNLKDLNNLYEVHLGKCQSRIKV  308

Query  693   YEALRTGaa----------eeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHE  842
              E L  G            ++ +IEK K E+K+K  EQ +   ++++ H +++ S+L HE
Sbjct  309   LETLAAGTTEEIQVLLSKLQQIKIEKTKIEKKKKLEEQELLRTRQERIHSDIENSTLKHE  368

Query  843   LELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKR  1022
             LE+ K  +E  CL L+   E+ +++L  K+ME +C LT+SK++  ELE+FSESK  +WK 
Sbjct  369   LEIAKTAHEEHCLLLQMRAEETKVQLEKKLMEFKCFLTESKERVKELESFSESKYQRWKS  428

Query  1023  KEHVYK  1040
             KE  YK
Sbjct  429   KEGTYK  434



>ref|XP_011029282.1| PREDICTED: kinesin-4 isoform X2 [Populus euphratica]
Length=1098

 Score =   126 bits (317),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 109/267 (41%), Positives = 154/267 (58%), Gaps = 18/267 (7%)
 Frame = +3

Query  276   GEQANINAFRSFNASEQIDCFNNMAKELSASNNH-AGSKLPDVFQLKIGC-EDILAYKIS  449
             GE + I     +    Q D F+N     SA+  H     L D+FQ K G   D+  + I 
Sbjct  166   GENSTI-----YGEERQRDSFDNKYGSASAALVHDVVHNLSDMFQQKQGSYADLSDFNIL  220

Query  450   ELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSEN  629
             ELMK   L++ STR LFS V  IL E+IERKNG +   ++ ++K V+Q IEQRVS  + N
Sbjct  221   ELMKSNGLDNTSTRTLFSLVNRILEESIERKNGHV-HHMAHIVKKVVQVIEQRVSTLAVN  279

Query  630   LRKQHNSYKSREQKYQLKDRAYEALRTGaa----------eeheiekakseekekhreQI  779
             L+ Q+N YK R  K Q + +  E L  G            ++ +IEK K EEK+K  EQ 
Sbjct  280   LKDQNNLYKVRLGKCQSRIKVLETLAAGTTEEIRVLLSQLQQIKIEKTKIEEKKKLEEQE  339

Query  780   ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTD  959
             +   +++K H +++ S+L HELE+ K T+E  CL L+   E+ ++EL  K+ ELEC L +
Sbjct  340   LLRTKQEKIHSDIENSTLKHELEIAKTTHEEHCLLLQVQAEETKVELEKKLKELECFLAE  399

Query  960   SKKKADELEAFSESKLLKWKRKEHVYK  1040
             SKK+  ELE+FSESK  +WK KE  Y+
Sbjct  400   SKKRVKELESFSESKSQRWKSKEGSYR  426



>ref|XP_011022683.1| PREDICTED: kinesin-4-like isoform X1 [Populus euphratica]
 ref|XP_011022684.1| PREDICTED: kinesin-4-like isoform X1 [Populus euphratica]
 ref|XP_011022685.1| PREDICTED: kinesin-4-like isoform X1 [Populus euphratica]
Length=1118

 Score =   126 bits (317),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 99/246 (40%), Positives = 147/246 (60%), Gaps = 13/246 (5%)
 Frame = +3

Query  339   NNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSL-ESASTRLLFSAVG  512
             ++++ E +A  + A  KL ++FQ K G   D+    I ELMK K   ++ASTR LFS V 
Sbjct  190   DSISSESAALAHDAAHKLSEMFQQKQGSYADLSDSNILELMKSKGFAQNASTRTLFSLVN  249

Query  513   DILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRA  692
              IL ENIERKNG +    + +LK V+Q IE RVS Q+ NL+  +N Y+    K Q + + 
Sbjct  250   IILEENIERKNGHV-HHRALILKKVVQVIEHRVSTQALNLKDLNNLYEVNLGKCQSRIKV  308

Query  693   YEALRTGaa----------eeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHE  842
              E L  G            ++ +IEK K +EK+K  EQ +   +++K H +++ S+L HE
Sbjct  309   LETLAAGTTEEIQVLLSKLQQIKIEKTKIKEKKKLEEQELFRTKQEKIHSDIENSTLKHE  368

Query  843   LELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKR  1022
             LE+ K  +E  CL L+   E+ +++L  K+ME +C LT+SK++  ELE+FSESK  +WK 
Sbjct  369   LEIAKTAHEEHCLLLQMRAEETKVQLEKKLMEFKCFLTESKERVKELESFSESKYQRWKS  428

Query  1023  KEHVYK  1040
             KE  YK
Sbjct  429   KEGTYK  434



>gb|AAW81733.1| Putative Kinesin motor protein-related [Brassica oleracea]
Length=1116

 Score =   126 bits (316),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 121/174 (70%), Gaps = 0/174 (0%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
            H G K  + FQ+K G  D+ A KISE+MK  +L++A T+ L S    IL+++IER NG++
Sbjct  64   HGGHKFHEAFQMKQGRFDLQAAKISEMMKSNNLDNAPTQSLLSIATGILDDSIERNNGEV  123

Query  555  PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
            PQ V+ LL+ V+ EIE+R+S QSE+LR Q++ +K+RE+KYQ + +  E L +G +EE+E 
Sbjct  124  PQRVACLLRKVVLEIERRISTQSEHLRTQNSVFKAREEKYQSRIKVLETLASGTSEENET  183

Query  735  ekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETH  896
            EK+K EEK+K +E+ +  L+K+   +  +IS+L  ELE  KK YE + LQ E+H
Sbjct  184  EKSKLEEKKKTKEEDMVKLEKENGQYNHEISTLRRELETAKKAYEQQGLQTESH  237



>ref|XP_010428332.1| PREDICTED: kinesin-4-like isoform X2 [Camelina sativa]
Length=1025

 Score =   125 bits (315),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 122/197 (62%), Gaps = 12/197 (6%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERK  542
             S +H G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S V  IL+E+IERK
Sbjct  84   GSMHHGGHKFHEVFQMKQGRYDLQASKISEMMKSSSLDNAPTQSLLSVVNGILDESIERK  143

Query  543  NGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae  722
            NG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +    EAL +G+  
Sbjct  144  NGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNIFKTREEKYQSRINVLEALASGSGV  203

Query  723  eheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEG  872
            EHEI   +  + +  +             +  L K  D + ++I++L  ELE  KK +E 
Sbjct  204  EHEIATQQLRQIKTEKSMWEEKKKHEEEDMVKLMKQNDQYNLEIAALKQELEASKKEHEQ  263

Query  873  KCLQLE--THLEKMRIE  917
            +  ++E  T  EK + E
Sbjct  264  QYSKMESKTMTEKSKWE  280



>gb|ERN15129.1| hypothetical protein AMTR_s00056p00106770 [Amborella trichopoda]
Length=510

 Score =   123 bits (308),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 140/239 (59%), Gaps = 16/239 (7%)
 Frame = +3

Query  360   SASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIER  539
             SA  +H G K  +VFQL     D+ + +   +M   SL++A T+ L S V  IL E   +
Sbjct  23    SAWLHHVGQKFHEVFQLNQSHSDLSSARSLGMMNLNSLDNAPTQSLLSLVSAILGE---K  79

Query  540   KNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYK---SREQKYQLKDRAYEALRT  710
             +NG+IP  V  LL+ V+QEIE+R+S Q E+++K  NS +   SRE++   +    E L +
Sbjct  80    QNGEIPPRVEILLRKVMQEIERRLSTQGEHIKKLKNSLREVLSREERLVSRASVLETLAS  139

Query  711   GaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKK  860
             G+ EE +I   + ++ +  + +I          +  L K+KD  E  IS+L  EL+  +K
Sbjct  140   GSNEEIQIVTDQLQKIKAEKVKIEEERKLGEKDLLRLMKEKDGVESAISTLKQELKATRK  199

Query  861   TYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVY  1037
              YE +C QLET   + +++L  ++ E+E  LT+S+K+ +ELEAFSESK+ +W +KE  Y
Sbjct  200   KYEEQCTQLETQGREAQVKLQERLKEVEEQLTESRKRVEELEAFSESKIQRWNKKEISY  258



>ref|XP_010428329.1| PREDICTED: kinesin-4-like isoform X1 [Camelina sativa]
 ref|XP_010428330.1| PREDICTED: kinesin-4-like isoform X1 [Camelina sativa]
 ref|XP_010428331.1| PREDICTED: kinesin-4-like isoform X1 [Camelina sativa]
Length=1032

 Score =   125 bits (315),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 122/197 (62%), Gaps = 12/197 (6%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERK  542
             S +H G K  +VFQ+K G  D+ A KISE+MK  SL++A T+ L S V  IL+E+IERK
Sbjct  84   GSMHHGGHKFHEVFQMKQGRYDLQASKISEMMKSSSLDNAPTQSLLSVVNGILDESIERK  143

Query  543  NGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae  722
            NG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +    EAL +G+  
Sbjct  144  NGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNIFKTREEKYQSRINVLEALASGSGV  203

Query  723  eheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEG  872
            EHEI   +  + +  +             +  L K  D + ++I++L  ELE  KK +E 
Sbjct  204  EHEIATQQLRQIKTEKSMWEEKKKHEEEDMVKLMKQNDQYNLEIAALKQELEASKKEHEQ  263

Query  873  KCLQLE--THLEKMRIE  917
            +  ++E  T  EK + E
Sbjct  264  QYSKMESKTMTEKSKWE  280



>ref|XP_008437282.1| PREDICTED: kinesin-4 isoform X2 [Cucumis melo]
Length=1095

 Score =   125 bits (315),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 129/215 (60%), Gaps = 10/215 (5%)
 Frame = +3

Query  426   DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQ  605
             D+    + EL+K ++LE+ ST  LF+ +  IL+  +E KNGD+   V+ +L+ V+Q +EQ
Sbjct  174   DVSGSNVVELIKSENLENVSTESLFNMINRILDGTVETKNGDVSHQVAYILRKVVQVLEQ  233

Query  606   RVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQIIC  785
             R+   + NL+ Q N  K+RE+K+  K R  E L TG  EE+E+   + +  +    ++  
Sbjct  234   RILTHAGNLKHQSNLLKAREEKFLSKLRVLETLATGTTEENEVVMNQLQRLKIEMFKVEE  293

Query  786   M----------LQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIM  935
             M          L++ K   ++++S+L  ELE  K  +E  CLQLET+ ++ + +   K+ 
Sbjct  294   MKNCEEQDKMALKEQKALCDVKLSNLKDELEKAKSEHENHCLQLETNAKEEKAKYEEKLN  353

Query  936   ELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             ELECLL DS+K   ELE FSESK LKWK+KE VY+
Sbjct  354   ELECLLADSRKHVKELETFSESKSLKWKKKEFVYR  388



>ref|XP_010498228.1| PREDICTED: kinesin KP1-like isoform X1 [Camelina sativa]
Length=1008

 Score =   125 bits (314),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 128/206 (62%), Gaps = 10/206 (5%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
            H G K  + FQLK G  D+ A KISE+MK  +L++A T+ L S V  IL+E+IE+K+G+I
Sbjct  51   HGGHKFHEAFQLKQGRFDLQAAKISEMMKSNNLDNAPTQSLLSIVNGILDESIEKKSGEI  110

Query  555  PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
            PQ V  LLK V+ EI +R+S QSE+LR Q++ +KSRE+KYQ + +  E L +G +EE+EI
Sbjct  111  PQRVVCLLKKVVLEIARRISTQSEHLRTQNSVFKSREEKYQSRIKVLETLASGTSEENEI  170

Query  735  ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
               +  + +  + ++          +  L+K+     ++IS+L  ELE  KK Y+ +CLQ
Sbjct  171  ATRQLRKIKTEKSKLEEKKKDKEEDMVKLEKENGQSNLEISTLRRELEATKKAYQQQCLQ  230

Query  885  LETHLEKMRIELGNKIMELECLLTDS  962
            +E+  +     + +++ ELE +  D+
Sbjct  231  MESQTKVATAGIEDRVKELEQMRKDA  256



>ref|XP_008437280.1| PREDICTED: kinesin-4 isoform X1 [Cucumis melo]
 ref|XP_008437281.1| PREDICTED: kinesin-4 isoform X1 [Cucumis melo]
Length=1119

 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 129/215 (60%), Gaps = 10/215 (5%)
 Frame = +3

Query  426   DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQ  605
             D+    + EL+K ++LE+ ST  LF+ +  IL+  +E KNGD+   V+ +L+ V+Q +EQ
Sbjct  174   DVSGSNVVELIKSENLENVSTESLFNMINRILDGTVETKNGDVSHQVAYILRKVVQVLEQ  233

Query  606   RVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQIIC  785
             R+   + NL+ Q N  K+RE+K+  K R  E L TG  EE+E+   + +  +    ++  
Sbjct  234   RILTHAGNLKHQSNLLKAREEKFLSKLRVLETLATGTTEENEVVMNQLQRLKIEMFKVEE  293

Query  786   M----------LQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIM  935
             M          L++ K   ++++S+L  ELE  K  +E  CLQLET+ ++ + +   K+ 
Sbjct  294   MKNCEEQDKMALKEQKALCDVKLSNLKDELEKAKSEHENHCLQLETNAKEEKAKYEEKLN  353

Query  936   ELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             ELECLL DS+K   ELE FSESK LKWK+KE VY+
Sbjct  354   ELECLLADSRKHVKELETFSESKSLKWKKKEFVYR  388



>ref|XP_011626803.1| PREDICTED: kinesin-4, partial [Amborella trichopoda]
Length=1086

 Score =   125 bits (314),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 89/244 (36%), Positives = 143/244 (59%), Gaps = 16/244 (7%)
 Frame = +3

Query  345   MAKELSASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILN  524
             M++  SA  +H G K  +VFQL     D+ + +   +M   SL++A T+ L S V  IL 
Sbjct  186   MSEPTSAWLHHVGQKFHEVFQLNQSHSDLSSARSLGMMNLNSLDNAPTQSLLSLVSAILG  245

Query  525   ENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYK---SREQKYQLKDRAY  695
             E   ++NG+IP  V  LL+ V+QEIE+R+S Q E+++K  NS +   SRE++   +    
Sbjct  246   E---KQNGEIPPRVEILLRKVMQEIERRLSTQGEHIKKLKNSLREVLSREERLVSRASVL  302

Query  696   EALRTGaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHEL  845
             E L +G+ EE +I   + ++ +  + +I          +  L K+KD  E  IS+L  EL
Sbjct  303   ETLASGSNEEIQIVTDQLQKIKAEKVKIEEERKLGEKDLLRLMKEKDGVESAISTLKQEL  362

Query  846   ELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRK  1025
             +  +K YE +C QLET   + +++L  ++ E+E  LT+S+K+ +ELEAFSESK+ +W +K
Sbjct  363   KATRKKYEEQCTQLETQGREAQVKLQERLKEVEEQLTESRKRVEELEAFSESKIQRWNKK  422

Query  1026  EHVY  1037
             E  Y
Sbjct  423   EISY  426



>ref|XP_006405988.1| hypothetical protein EUTSA_v10027628mg [Eutrema salsugineum]
 gb|ESQ47441.1| hypothetical protein EUTSA_v10027628mg [Eutrema salsugineum]
Length=1065

 Score =   125 bits (313),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 81/226 (36%), Positives = 135/226 (60%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E D+   KISEL+K  SL +A TR LF  +  +L+E++++ NG +   ++S
Sbjct  170   DGFQSKEGSEIDVSDNKISELLKSNSLRNAPTRSLFDMLDKLLDESVKKMNGHVSHAMAS  229

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakse  752
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E L  G  +E+EI     E
Sbjct  230   LLSALVQVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTKENEIVTNCME  289

Query  753   ekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
               +  + +I          +  L+K+K+ ++ +I  L  EL+L K+T+E +CL LE   +
Sbjct  290   HIKLEKTRIEEREQSEEKDVARLKKEKERNDAEIRKLKQELKLVKETHENQCLDLEAKAQ  349

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             K ++EL  K+ + E  + +S +K  ELE   +SK  KW++KE  Y+
Sbjct  350   KTKVELEKKLKDAEIQVAESTRKVKELEKLCQSKSQKWEKKECTYQ  395



>ref|XP_010473609.1| PREDICTED: kinesin-4-like isoform X1 [Camelina sativa]
Length=1073

 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 136/228 (60%), Gaps = 11/228 (5%)
 Frame = +3

Query  390   LPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCV  566
             L D FQ K G E DI   KISEL+K  SL +A TR LF  +  +L+E++ + NG +   +
Sbjct  174   LTDEFQSKEGSEIDISDAKISELLKSNSLRNAPTRSLFDMLDKLLDESMTKMNGHVSHAM  233

Query  567   SSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiek--  740
             +SLL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E L  G  +E+E     
Sbjct  234   ASLLSALVQVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTKENETVTNC  293

Query  741   --------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETH  896
                      + EE+E+  E+ +  L+K+KD  + +I  L  EL++ K+T+E +CL LE  
Sbjct  294   MEHIKLEKNRIEERERSEEKDVVKLRKEKDRSDAEIRKLKQELKVVKETHEKQCLDLEAK  353

Query  897   LEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
              +K R EL  K+ + E  + DS +K  ELE   +SK  +W++KE +Y+
Sbjct  354   AQKTRDELEKKLKDAELHVVDSSRKVKELEKLCQSKSQRWEKKECIYQ  401



>ref|XP_010473610.1| PREDICTED: kinesin-4-like isoform X2 [Camelina sativa]
Length=1072

 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 85/228 (37%), Positives = 136/228 (60%), Gaps = 11/228 (5%)
 Frame = +3

Query  390   LPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCV  566
             L D FQ K G E DI   KISEL+K  SL +A TR LF  +  +L+E++ + NG +   +
Sbjct  174   LTDEFQSKEGSEIDISDAKISELLKSNSLRNAPTRSLFDMLDKLLDESMTKMNGHVSHAM  233

Query  567   SSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiek--  740
             +SLL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E L  G  +E+E     
Sbjct  234   ASLLSALVQVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTKENETVTNC  293

Query  741   --------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETH  896
                      + EE+E+  E+ +  L+K+KD  + +I  L  EL++ K+T+E +CL LE  
Sbjct  294   MEHIKLEKNRIEERERSEEKDVVKLRKEKDRSDAEIRKLKQELKVVKETHEKQCLDLEAK  353

Query  897   LEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
              +K R EL  K+ + E  + DS +K  ELE   +SK  +W++KE +Y+
Sbjct  354   AQKTRDELEKKLKDAELHVVDSSRKVKELEKLCQSKSQRWEKKECIYQ  401



>gb|KGN59396.1| hypothetical protein Csa_3G816090 [Cucumis sativus]
Length=1374

 Score =   125 bits (313),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 82/189 (43%), Positives = 124/189 (66%), Gaps = 7/189 (4%)
 Frame = +3

Query  345  MAKELSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLE-----SASTRLLFSA  506
            M++ L  SN+  G K  +VFQLK G   DI A KISE+MK  SL+     +A T+ L S 
Sbjct  226  MSESLVGSNHQVGHKFHEVFQLKQGRYADIPAAKISEMMKSNSLDHLLLQNAPTQSLLSV  285

Query  507  VGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKD  686
            V  IL+E++E+KNG+IP  V+ LL+ V+QEIE+R+S Q+++LR Q+N +K+RE+K+Q + 
Sbjct  286  VNGILDESLEKKNGEIPHRVACLLRKVVQEIERRISTQADHLRTQNNLFKAREEKFQSRI  345

Query  687  RAYEALRTGaaeeheiekakseekekhr-eQIICMLQKDKDHHEMQISSLNHELELCKKT  863
            R  EAL +   EE++  +    E++K+   + +  L K++D  + +I  L  ELE  KKT
Sbjct  346  RVLEALASNINEENQQAEKTKAEEKKNSLNEDVSRLIKERDECKAEIVLLKQELETAKKT  405

Query  864  YEGKCLQLE  890
            YE +CLQ+E
Sbjct  406  YELRCLQVE  414


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 48/87 (55%), Gaps = 0/87 (0%)
 Frame = +3

Query  780   ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTD  959
             +  L K++D  + + + L HELE   KTYE + L++ET  +  ++ L  +I ELE LL D
Sbjct  679   VTRLIKERDESKTETAVLKHELETTTKTYELRRLEVETETKSAQLMLEERIKELENLLED  738

Query  960   SKKKADELEAFSESKLLKWKRKEHVYK  1040
             S  +  EL    E K  KW  K + YK
Sbjct  739   SSNEVQELSTSFELKQKKWNEKANSYK  765



>ref|XP_009606579.1| PREDICTED: kinesin-4-like [Nicotiana tomentosiformis]
Length=1050

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 124/188 (66%), Gaps = 15/188 (8%)
 Frame = +3

Query  345  MAKELSASNNHAGSKLPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDIL  521
            MA+  +A  +H G K  +VFQLK G   +I A KISE+MK  SL+ A T+ L S V  IL
Sbjct  214  MAEPSAALLHHVGHKFHEVFQLKQGSNTEIPAAKISEMMKSNSLDIAPTQSLLSVVNGIL  273

Query  522  NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
            +E+IERKNG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EA
Sbjct  274  DESIERKNGEIPQRVACLLRKVVQEIERRISTQAEHLRMQNNLFKTREEKYQSRIRVLEA  333

Query  702  LRTGaaeehe----------iekakseekekhreQIICMLQKDKDHHEMQISSLNHELEL  851
            L  G +EE +           EK K EEK+K+ EQ +  L++  D    QI++L  ELE+
Sbjct  334  LAAGTSEETQIVMNQLQQIKNEKNKMEEKKKNEEQDVPRLKEKDD----QIATLKQELEI  389

Query  852  CKKTYEGK  875
             KK+YE K
Sbjct  390  AKKSYESK  397


 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +3

Query  795   KDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKA  974
             K+K+ H+ +I++L  E+E+ KK+YE   L++E    + + EL  K+ E   LLT+S+ + 
Sbjct  518   KEKEDHKQEIAALKQEMEIAKKSYEHHTLEMEKKATESQQELEEKLKEATSLLTESRNRI  577

Query  975   DELEAFSESKLLKWKRKEHVYK  1040
              ELE F +SK   W +KEH+Y+
Sbjct  578   KELETFCQSKSENWTKKEHIYQ  599



>ref|XP_011654742.1| PREDICTED: kinesin-4 isoform X2 [Cucumis sativus]
Length=1095

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 130/215 (60%), Gaps = 10/215 (5%)
 Frame = +3

Query  426   DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQ  605
             D+    I EL+K K+LE+ ST+ LF+ +  IL+ ++E KNGD+   V+ +L+ V+Q +EQ
Sbjct  174   DVSGSNIVELIKSKNLENVSTQSLFNMISRILDGSVETKNGDVSHQVAYILRKVVQVLEQ  233

Query  606   RVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQIIC  785
             R+   + NL+ Q N  K+RE+K+  K R  E L TG  EE+E+   + +  +    ++  
Sbjct  234   RILTHAGNLKHQSNLLKAREEKFLSKLRVLETLATGTTEENEVVMNQLQRLKIEMFKVEE  293

Query  786   M----------LQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIM  935
             M          L++ K   ++++S L  ELE  K+ +E  CLQ ET+ ++ + +   K+ 
Sbjct  294   MKNCEEQDKMALKEQKALCDVELSDLKDELEKAKREHENYCLQQETNAKEEKAKFEEKLN  353

Query  936   ELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             ELECLL DS+K   +LE FSESK LKWK+KE VY+
Sbjct  354   ELECLLADSRKHVKDLETFSESKSLKWKKKEFVYQ  388



>ref|XP_004143905.1| PREDICTED: kinesin-4 isoform X1 [Cucumis sativus]
 ref|XP_011654741.1| PREDICTED: kinesin-4 isoform X1 [Cucumis sativus]
 gb|KGN50095.1| hypothetical protein Csa_5G153100 [Cucumis sativus]
Length=1119

 Score =   124 bits (312),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 83/215 (39%), Positives = 130/215 (60%), Gaps = 10/215 (5%)
 Frame = +3

Query  426   DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQ  605
             D+    I EL+K K+LE+ ST+ LF+ +  IL+ ++E KNGD+   V+ +L+ V+Q +EQ
Sbjct  174   DVSGSNIVELIKSKNLENVSTQSLFNMISRILDGSVETKNGDVSHQVAYILRKVVQVLEQ  233

Query  606   RVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQIIC  785
             R+   + NL+ Q N  K+RE+K+  K R  E L TG  EE+E+   + +  +    ++  
Sbjct  234   RILTHAGNLKHQSNLLKAREEKFLSKLRVLETLATGTTEENEVVMNQLQRLKIEMFKVEE  293

Query  786   M----------LQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIM  935
             M          L++ K   ++++S L  ELE  K+ +E  CLQ ET+ ++ + +   K+ 
Sbjct  294   MKNCEEQDKMALKEQKALCDVELSDLKDELEKAKREHENYCLQQETNAKEEKAKFEEKLN  353

Query  936   ELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             ELECLL DS+K   +LE FSESK LKWK+KE VY+
Sbjct  354   ELECLLADSRKHVKDLETFSESKSLKWKKKEFVYQ  388



>ref|XP_006595426.1| PREDICTED: kinesin-4-like [Glycine max]
Length=890

 Score =   124 bits (310),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 77/178 (43%), Positives = 116/178 (65%), Gaps = 1/178 (1%)
 Frame = +3

Query  372  NHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
            +  G K P+VF+L+ G   D+ + KISELMK  SL++A T+ L S V  IL E++ER+NG
Sbjct  56   SQVGHKFPEVFRLRQGSYGDLPSAKISELMKSTSLDNAPTQSLLSVVNGILEESVERRNG  115

Query  549  DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
            +IP  V+ LL+ V+QEIE+R+S Q+ +L+ Q+N +K+RE+KY  + +  EAL  G  EE 
Sbjct  116  EIPHRVACLLRKVVQEIERRISTQAAHLKTQNNLFKAREEKYHSRIKILEALTFGTKEES  175

Query  729  eiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
            E+ + K E+K+   ++ +    KD +   M+IS+L  ELE  +KTYE +  QLE   E
Sbjct  176  EVGRTKKEDKKMENDKDVIRYTKDIEDKNMEISTLKQELETMRKTYEVQLSQLEAKAE  233


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +3

Query  816   MQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFS  995
             ++IS+   ELE  KKTYE KC QLE  +E  + EL +K  E E LL   + +  E E  S
Sbjct  355   VEISTFKQELETTKKTYEVKCSQLEAKVEDAKEELKHKSQEYEHLLEKLRNEVKENEVIS  414

Query  996   ESKLLKWKRKEH  1031
             ESK  KW  KE+
Sbjct  415   ESKYQKWIMKEN  426



>ref|NP_176551.3| microtubule motor protein KinG [Arabidopsis thaliana]
 gb|AEE34122.1| microtubule motor protein KinG [Arabidopsis thaliana]
Length=1071

 Score =   124 bits (310),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/226 (36%), Positives = 135/226 (60%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E D+   KIS+L+K  SL +A TR LF  +  +L+E++ + NG +   ++S
Sbjct  175   DGFQSKEGSEIDMSDAKISDLLKSNSLRNAPTRSLFDMLDKLLDESMTKMNGHVSHAMAS  234

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakse  752
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E+L  G  +E+EI     E
Sbjct  235   LLSALVQVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLESLAAGTTKENEIVTNCME  294

Query  753   ekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
               +  + +I          +  L+K+K+  + +I  L  EL+L K+T+E +CL+LE   +
Sbjct  295   HIKLEKTRIEEKERSEEKDVVRLRKEKERSDAEIRQLKQELKLVKETHENQCLELEAKAQ  354

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             K R EL  K+ + E  + DS +K  ELE   +SK  +W++KE +Y+
Sbjct  355   KTRDELEKKLKDAELHVVDSSRKVKELEKLCQSKSQRWEKKECIYQ  400



>ref|NP_974079.1| microtubule motor protein KinG [Arabidopsis thaliana]
 gb|AEE34123.1| microtubule motor protein KinG [Arabidopsis thaliana]
Length=1065

 Score =   124 bits (310),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/226 (36%), Positives = 135/226 (60%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E D+   KIS+L+K  SL +A TR LF  +  +L+E++ + NG +   ++S
Sbjct  175   DGFQSKEGSEIDMSDAKISDLLKSNSLRNAPTRSLFDMLDKLLDESMTKMNGHVSHAMAS  234

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakse  752
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E+L  G  +E+EI     E
Sbjct  235   LLSALVQVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLESLAAGTTKENEIVTNCME  294

Query  753   ekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
               +  + +I          +  L+K+K+  + +I  L  EL+L K+T+E +CL+LE   +
Sbjct  295   HIKLEKTRIEEKERSEEKDVVRLRKEKERSDAEIRQLKQELKLVKETHENQCLELEAKAQ  354

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             K R EL  K+ + E  + DS +K  ELE   +SK  +W++KE +Y+
Sbjct  355   KTRDELEKKLKDAELHVVDSSRKVKELEKLCQSKSQRWEKKECIYQ  400



>gb|AAG52420.1|AC011622_8 kinesin-like protein; 73641-79546 [Arabidopsis thaliana]
Length=1056

 Score =   123 bits (309),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 81/226 (36%), Positives = 135/226 (60%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E D+   KIS+L+K  SL +A TR LF  +  +L+E++ + NG +   ++S
Sbjct  167   DGFQSKEGSEIDMSDAKISDLLKSNSLRNAPTRSLFDMLDKLLDESMTKMNGHVSHAMAS  226

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakse  752
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E+L  G  +E+EI     E
Sbjct  227   LLSALVQVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLESLAAGTTKENEIVTNCME  286

Query  753   ekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
               +  + +I          +  L+K+K+  + +I  L  EL+L K+T+E +CL+LE   +
Sbjct  287   HIKLEKTRIEEKERSEEKDVVRLRKEKERSDAEIRQLKQELKLVKETHENQCLELEAKAQ  346

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             K R EL  K+ + E  + DS +K  ELE   +SK  +W++KE +Y+
Sbjct  347   KTRDELEKKLKDAELHVVDSSRKVKELEKLCQSKSQRWEKKECIYQ  392



>ref|XP_006586333.1| PREDICTED: kinesin-4-like [Glycine max]
Length=1272

 Score =   124 bits (310),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 93/265 (35%), Positives = 152/265 (57%), Gaps = 17/265 (6%)
 Frame = +3

Query  276   GEQANINAFRSFNASEQIDCFNNMAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISE  452
             GEQ  I A       +++     MA+  ++  +H G    +VFQ+K G   D+ A KI+E
Sbjct  178   GEQRKIAAGSML---QRVKSSPVMAESSASLIHHVGHNFHEVFQMKPGSYADLPAAKIAE  234

Query  453   LMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENL  632
             +MK  S+++A T+ L S V  IL E++ER+NG+IP  V+ LLK V QEIE+R+S Q+E+L
Sbjct  235   MMKSNSIDNAPTQSLLSVVNGILEESVERRNGEIPHRVACLLKKVTQEIERRMSTQAEHL  294

Query  633   RKQHNSYKSREQKYQLKDRAYEALRTGaaeehe---------iekakseekekhreQIIC  785
             R Q+N +K+RE+KYQ + R  EAL +G  +E E           +   E+ +K  E  + 
Sbjct  295   RTQNNLFKAREEKYQSRIRVLEALASGTIDESEICPSQFQQLKGEKIKEKVKKVDENEVV  354

Query  786   MLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIME----LECLL  953
              L K+++   ++IS+L  ELE  K+TYE +  Q+E      +  L  K+ E    LE L 
Sbjct  355   RLIKEQEDKNLEISALKVELETAKRTYEVQFSQMEEEANSFKAALTRKVQEYEHQLEELR  414

Query  954   TDSKKKADELEAFSESKLLKWKRKE  1028
              +++K  +E++   E + +K+ +++
Sbjct  415   NEAEKINEEVKTTDEEESIKFMKEQ  439



>ref|NP_001056074.1| Os05g0521300 [Oryza sativa Japonica Group]
 dbj|BAF17988.1| Os05g0521300 [Oryza sativa Japonica Group]
Length=926

 Score =   123 bits (308),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 95/231 (41%), Positives = 138/231 (60%), Gaps = 11/231 (5%)
 Frame = +3

Query  381   GSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIP  557
             G KL ++FQLK G   D+ A KISE+M   SL++A T+ L S V  IL+E+IERK G+IP
Sbjct  89    GRKLREIFQLKRGSYADLPAAKISEMMHSNSLDNAPTQSLLSVVNGILDESIERKKGEIP  148

Query  558   QCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheie  737
               V  LL+ V+QEIE+R+  Q+E++R Q+   K+RE KY  K +A E L  G  EE+++ 
Sbjct  149   HRVVYLLRKVVQEIERRLCIQAEHIRSQNVIIKTREDKYHSKIKALEILVNGTNEENQMA  208

Query  738   ----------kakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQL  887
                       K+K EEK K  EQ +  L K+K+  E  I+SL  E+E+    +E +  ++
Sbjct  209   INRLQIIKEEKSKIEEKRKLGEQDVARLMKEKEISENTIASLKKEMEVMTSMHEQQLQKI  268

Query  888   ETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             E   ++M   L  KI E+E LL  S KK +E+EA S  K   W +KE +++
Sbjct  269   ELTAKQMEEHLTTKIKEVESLLVQSNKKIEEVEAASLLKSQLWNKKEGIFQ  319



>gb|AAT69670.1| putative kinesin [Oryza sativa Japonica Group]
Length=918

 Score =   123 bits (308),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 95/231 (41%), Positives = 138/231 (60%), Gaps = 11/231 (5%)
 Frame = +3

Query  381   GSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIP  557
             G KL ++FQLK G   D+ A KISE+M   SL++A T+ L S V  IL+E+IERK G+IP
Sbjct  89    GRKLREIFQLKRGSYADLPAAKISEMMHSNSLDNAPTQSLLSVVNGILDESIERKKGEIP  148

Query  558   QCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheie  737
               V  LL+ V+QEIE+R+  Q+E++R Q+   K+RE KY  K +A E L  G  EE+++ 
Sbjct  149   HRVVYLLRKVVQEIERRLCIQAEHIRSQNVIIKTREDKYHSKIKALEILVNGTNEENQMA  208

Query  738   ----------kakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQL  887
                       K+K EEK K  EQ +  L K+K+  E  I+SL  E+E+    +E +  ++
Sbjct  209   INRLQIIKEEKSKIEEKRKLGEQDVARLMKEKEISENTIASLKKEMEVMTSMHEQQLQKI  268

Query  888   ETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             E   ++M   L  KI E+E LL  S KK +E+EA S  K   W +KE +++
Sbjct  269   ELTAKQMEEHLTTKIKEVESLLVQSNKKIEEVEAASLLKSQLWNKKEGIFQ  319



>gb|ADL28383.1| kinesin KinG [Arabidopsis thaliana]
Length=1071

 Score =   123 bits (308),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 135/226 (60%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E D+   KIS+++K  SL +A TR LF  +  +L+E++ + NG +   ++S
Sbjct  175   DGFQSKEGSEIDMSDAKISDILKSNSLRNAPTRSLFDMLDKLLDESMTKMNGHVSHAMAS  234

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakse  752
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E+L  G  +E+EI     E
Sbjct  235   LLSALVQVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLESLAAGTTKENEIVTNCME  294

Query  753   ekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
               +  + +I          +  L+K+K+  + +I  L  EL+L K+T+E +CL+LE   +
Sbjct  295   HIKLEKTRIEEKERSEEKDVVRLRKEKERSDAEIRQLKQELKLVKETHENQCLELEAKAQ  354

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             K R EL  K+ + E  + DS +K  ELE   +SK  +W++KE +Y+
Sbjct  355   KTRDELEKKLKDAELHVVDSSRKVKELEKLCQSKSQRWEKKECIYQ  400



>gb|EEE64402.1| hypothetical protein OsJ_19246 [Oryza sativa Japonica Group]
Length=1016

 Score =   122 bits (307),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 95/231 (41%), Positives = 138/231 (60%), Gaps = 11/231 (5%)
 Frame = +3

Query  381   GSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIP  557
             G KL ++FQLK G   D+ A KISE+M   SL++A T+ L S V  IL+E+IERK G+IP
Sbjct  179   GRKLREIFQLKRGSYADLPAAKISEMMHSNSLDNAPTQSLLSVVNGILDESIERKKGEIP  238

Query  558   QCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheie  737
               V  LL+ V+QEIE+R+  Q+E++R Q+   K+RE KY  K +A E L  G  EE+++ 
Sbjct  239   HRVVYLLRKVVQEIERRLCIQAEHIRSQNVIIKTREDKYHSKIKALEILVNGTNEENQMA  298

Query  738   ----------kakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQL  887
                       K+K EEK K  EQ +  L K+K+  E  I+SL  E+E+    +E +  ++
Sbjct  299   INRLQIIKEEKSKIEEKRKLGEQDVARLMKEKEISENTIASLKKEMEVMTSMHEQQLQKI  358

Query  888   ETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             E   ++M   L  KI E+E LL  S KK +E+EA S  K   W +KE +++
Sbjct  359   ELTAKQMEEHLTTKIKEVESLLVQSNKKIEEVEAASLLKSQLWNKKEGIFQ  409



>emb|CDY26163.1| BnaA06g12540D [Brassica napus]
Length=1088

 Score =   123 bits (308),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 116/184 (63%), Gaps = 10/184 (5%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
            H G K  + FQ+K G  D+ A KISE+MK  +L++A T+ L S    IL+++IER NG++
Sbjct  69   HGGHKFHEAFQMKQGRFDLQAAKISEMMKSNNLDNAPTQSLLSIATGILDDSIERNNGEV  128

Query  555  PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
            PQ V+ LL+ V+ EIE+R+S QSE+LR Q++ +K+RE+KYQ + +  E L +G +EE+EI
Sbjct  129  PQRVACLLRKVVLEIERRISTQSEHLRTQNSVFKAREEKYQSRIKVLETLASGTSEENEI  188

Query  735  ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
               +    +  + ++          +  L+K    +  +IS+L  ELE  KK YE +CLQ
Sbjct  189  ATKQLRRIKTEKSKLEEKKKTKEEDMVRLEKANGEYNHEISTLRRELETAKKAYEQQCLQ  248

Query  885  LETH  896
            +E+H
Sbjct  249  MESH  252



>gb|EEC80283.1| hypothetical protein OsI_22285 [Oryza sativa Indica Group]
Length=1016

 Score =   122 bits (307),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 95/231 (41%), Positives = 138/231 (60%), Gaps = 11/231 (5%)
 Frame = +3

Query  381   GSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIP  557
             G KL ++FQLK G   D+ A KISE+M   SL++A T+ L S V  IL+E+IERK G+IP
Sbjct  179   GRKLREIFQLKRGSYADLPAAKISEMMHSNSLDNAPTQSLLSVVNGILDESIERKKGEIP  238

Query  558   QCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheie  737
               V  LL+ V+QEIE+R+  Q+E++R Q+   K+RE KY  K +A E L  G  EE+++ 
Sbjct  239   HRVVYLLRKVVQEIERRLCIQAEHIRSQNVIIKTREDKYHSKIKALEILVNGTNEENQMA  298

Query  738   ----------kakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQL  887
                       K+K EEK K  EQ +  L K+K+  E  I+SL  E+E+    +E +  ++
Sbjct  299   INRLQIIKEEKSKIEEKRKLGEQDVARLMKEKEISENTIASLKKEMEVMTSMHEQQLQKI  358

Query  888   ETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             E   ++M   L  KI E+E LL  S KK +E+EA S  K   W +KE +++
Sbjct  359   ELTAKQMEEHLTTKIKEVESLLVQSNKKIEEVEAASLLKSQLWNKKEGIFQ  409



>ref|XP_010533669.1| PREDICTED: kinesin-4 isoform X1 [Tarenaya hassleriana]
 ref|XP_010533670.1| PREDICTED: kinesin-4 isoform X1 [Tarenaya hassleriana]
Length=1077

 Score =   122 bits (307),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 140/232 (60%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             A + L D FQ K G + +I   KI EL+K  SL++ASTR LF  +  +L EN++  NG+I
Sbjct  167   ADNNLSDGFQFKEGTDINISDDKILELLKSNSLQNASTRSLFDMLDKLLEENMKNMNGNI  226

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
                ++S+LK ++Q IE+R+S Q+EN + Q+  ++ RE+KY+ + +  E L  G  EE+EI
Sbjct  227   CNAMASILKAIVQVIERRISIQAENSKNQNILFRVREEKYRSRIKVLETLAAGTTEENEI  286

Query  735   ek----------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                         A+ EE+E+  E+ +  L+K+K+  + +IS L  E E+ KK +E +CL+
Sbjct  287   VTNHLEHIKLEKARVEERERSEEKDVLRLRKEKERRDAEISKLKREFEMEKKLHEKRCLE  346

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             LE   +K+++E   K+ + E    DS KK  ELE   ESK  KW++KE  Y+
Sbjct  347   LEAKAQKIKVEFEKKLKDAELREIDSTKKVKELETLCESKSQKWEKKEGTYQ  398



>gb|AAG52083.1|AC012679_21 kinesin-related protein; 103921-99132 [Arabidopsis thaliana]
Length=1050

 Score =   122 bits (307),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 90/217 (41%), Positives = 127/217 (59%), Gaps = 32/217 (15%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKSLES------------ASTRLLFSA  506
             S +H G K  +VFQ+K G  D+ A KISE+MK  SL+S            A T+ L S 
Sbjct  82   GSMHHGGHKFHEVFQMKQGRYDLQASKISEMMKSSSLDSIDNVVGLCLMQNAPTQSLLSV  141

Query  507  VGDILNENIERKNGDIPQC--------------------VSSLLKLVLQEIEQRVSKQSE  626
            +  IL+E+IERKNG+IPQ                     V+ LL+ V+QEIE+R+S Q+E
Sbjct  142  LNGILDESIERKNGEIPQIPSFVLLLLGKCFDKSYNEQRVACLLRKVVQEIERRISTQAE  201

Query  627  NLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQIICMLQKDKD  806
            +LR Q+N +K+RE+KYQ +    EAL +G   EHE EK+  EEK+KH E+ +  L K  D
Sbjct  202  HLRTQNNIFKTREEKYQSRINVLEALASGTGVEHETEKSMWEEKKKHEEEDMVKLMKQND  261

Query  807  HHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIE  917
             H ++IS+L  ELE  K+ YE +  Q+E+  +K + E
Sbjct  262  QHNLEISALKQELETTKRKYEQQYSQIESQTKKSKWE  298



>ref|XP_010533671.1| PREDICTED: kinesin-4 isoform X2 [Tarenaya hassleriana]
Length=1074

 Score =   122 bits (307),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 89/232 (38%), Positives = 140/232 (60%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             A + L D FQ K G + +I   KI EL+K  SL++ASTR LF  +  +L EN++  NG+I
Sbjct  164   ADNNLSDGFQFKEGTDINISDDKILELLKSNSLQNASTRSLFDMLDKLLEENMKNMNGNI  223

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
                ++S+LK ++Q IE+R+S Q+EN + Q+  ++ RE+KY+ + +  E L  G  EE+EI
Sbjct  224   CNAMASILKAIVQVIERRISIQAENSKNQNILFRVREEKYRSRIKVLETLAAGTTEENEI  283

Query  735   ek----------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                         A+ EE+E+  E+ +  L+K+K+  + +IS L  E E+ KK +E +CL+
Sbjct  284   VTNHLEHIKLEKARVEERERSEEKDVLRLRKEKERRDAEISKLKREFEMEKKLHEKRCLE  343

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             LE   +K+++E   K+ + E    DS KK  ELE   ESK  KW++KE  Y+
Sbjct  344   LEAKAQKIKVEFEKKLKDAELREIDSTKKVKELETLCESKSQKWEKKEGTYQ  395



>ref|XP_010418392.1| PREDICTED: kinesin-4-like isoform X3 [Camelina sativa]
Length=1072

 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 136/226 (60%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E DI   KISEL+K  SL +A TR LF  +  +L+E++ + NG +   ++S
Sbjct  176   DEFQSKEGSEIDISDAKISELLKSNSLRNAPTRSLFDMLDKLLDESMTKMNGHVSHAMAS  235

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiek----  740
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E L  G  +E+EI      
Sbjct  236   LLSALVQVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTKENEIVTNCME  295

Query  741   ------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
                    + EE+E+  E+ +  L+K+K+  + +I  L  EL++ K+T+E +CL LE   +
Sbjct  296   HIKLEKNRIEERERSEEKDVVRLRKEKERSDAEIRKLKQELKVVKETHENQCLDLEAKAQ  355

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             K R EL  K+ + E  + DS +K  ELE   +SK  +W++KE +Y+
Sbjct  356   KTRDELEKKLRDAELHVVDSSRKVKELEKLCQSKSQRWEKKECIYQ  401



>ref|XP_004961465.1| PREDICTED: kinesin-4-like [Setaria italica]
Length=1005

 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 87/232 (38%), Positives = 139/232 (60%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K  +VFQLK G   D+ A KISE+M   SL++A T+ L S V  IL+E+IERK G+I
Sbjct  182   SGQKFREVFQLKRGSYSDLPASKISEMMHSSSLDNAPTQSLISVVNGILDESIERKKGEI  241

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE+R+  Q+E++R Q+   K+RE+KY  K +A E L  G  EE+++
Sbjct  242   PHRVVYLLRKVVQEIERRLCIQAEHIRSQNIIIKTREEKYCSKIKALEMLVKGTNEENQM  301

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + +  +  + +I          +  L K+K+H E  I SL  ++E   + +E +  +
Sbjct  302   ATNRLQILKDEKSKIEERRKLSEQDVHRLVKEKEHSENIIQSLKKDMEAMNRMHEEQLEK  361

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +E   ++M  +L  K+ E+E LL  S KK +E+EA S+ K   W +KE++++
Sbjct  362   IERKAKQMEEQLTTKVKEVEYLLLQSNKKIEEVEAASKLKSQLWDKKENIFQ  413



>ref|XP_010418393.1| PREDICTED: kinesin-4-like isoform X4 [Camelina sativa]
Length=1073

 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 136/226 (60%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E DI   KISEL+K  SL +A TR LF  +  +L+E++ + NG +   ++S
Sbjct  176   DEFQSKEGSEIDISDAKISELLKSNSLRNAPTRSLFDMLDKLLDESMTKMNGHVSHAMAS  235

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiek----  740
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E L  G  +E+EI      
Sbjct  236   LLSALVQVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTKENEIVTNCME  295

Query  741   ------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
                    + EE+E+  E+ +  L+K+K+  + +I  L  EL++ K+T+E +CL LE   +
Sbjct  296   HIKLEKNRIEERERSEEKDVVRLRKEKERSDAEIRKLKQELKVVKETHENQCLDLEAKAQ  355

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             K R EL  K+ + E  + DS +K  ELE   +SK  +W++KE +Y+
Sbjct  356   KTRDELEKKLRDAELHVVDSSRKVKELEKLCQSKSQRWEKKECIYQ  401



>ref|XP_010418390.1| PREDICTED: kinesin-4-like isoform X1 [Camelina sativa]
Length=1073

 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 136/226 (60%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E DI   KISEL+K  SL +A TR LF  +  +L+E++ + NG +   ++S
Sbjct  176   DEFQSKEGSEIDISDAKISELLKSNSLRNAPTRSLFDMLDKLLDESMTKMNGHVSHAMAS  235

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiek----  740
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E L  G  +E+EI      
Sbjct  236   LLSALVQVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTKENEIVTNCME  295

Query  741   ------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
                    + EE+E+  E+ +  L+K+K+  + +I  L  EL++ K+T+E +CL LE   +
Sbjct  296   HIKLEKNRIEERERSEEKDVVRLRKEKERSDAEIRKLKQELKVVKETHENQCLDLEAKAQ  355

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             K R EL  K+ + E  + DS +K  ELE   +SK  +W++KE +Y+
Sbjct  356   KTRDELEKKLRDAELHVVDSSRKVKELEKLCQSKSQRWEKKECIYQ  401



>ref|XP_010418391.1| PREDICTED: kinesin-4-like isoform X2 [Camelina sativa]
Length=1072

 Score =   122 bits (306),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 84/226 (37%), Positives = 136/226 (60%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E DI   KISEL+K  SL +A TR LF  +  +L+E++ + NG +   ++S
Sbjct  176   DEFQSKEGSEIDISDAKISELLKSNSLRNAPTRSLFDMLDKLLDESMTKMNGHVSHAMAS  235

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiek----  740
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E L  G  +E+EI      
Sbjct  236   LLSALVQVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTKENEIVTNCME  295

Query  741   ------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
                    + EE+E+  E+ +  L+K+K+  + +I  L  EL++ K+T+E +CL LE   +
Sbjct  296   HIKLEKNRIEERERSEEKDVVRLRKEKERSDAEIRKLKQELKVVKETHENQCLDLEAKAQ  355

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             K R EL  K+ + E  + DS +K  ELE   +SK  +W++KE +Y+
Sbjct  356   KTRDELEKKLRDAELHVVDSSRKVKELEKLCQSKSQRWEKKECIYQ  401



>ref|XP_009149282.1| PREDICTED: kinesin-2 [Brassica rapa]
Length=1091

 Score =   122 bits (305),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 116/184 (63%), Gaps = 10/184 (5%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
            H G K  + FQ+K G  D+ A KISE+MK  +L++A T+ L S    IL+++IER NG++
Sbjct  65   HGGHKFHETFQMKQGRFDLQAAKISEMMKSNNLDNAPTQSLLSIATGILDDSIERNNGEV  124

Query  555  PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
            PQ V+ LL+ V+ EIE+R+S QSE+LR Q++ +K+RE+KYQ + +  E L +G +EE+EI
Sbjct  125  PQRVACLLRKVVLEIERRISTQSEHLRTQNSVFKAREEKYQSRIKVLETLASGTSEENEI  184

Query  735  ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
               +    +  + ++          +  L+K    +  +IS+L  ELE  KK YE +CLQ
Sbjct  185  ATKQLRRIKTEKSKLEEKKKNKEEDMVRLEKANVEYNHEISTLRRELETAKKAYEQQCLQ  244

Query  885  LETH  896
            +E+H
Sbjct  245  MESH  248



>ref|XP_008657237.1| PREDICTED: kinesin KP1 [Zea mays]
Length=964

 Score =   121 bits (304),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 83/233 (36%), Positives = 138/233 (59%), Gaps = 11/233 (5%)
 Frame = +3

Query  375   HAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGD  551
             H+G K+ D FQLK G   D+ A K+SE+M  +SL++A T+ L   V  IL+E+IERK G+
Sbjct  176   HSGQKVHDAFQLKRGSYTDLPAAKVSEMMHPRSLDNAPTQSLLRVVNGILDESIERKRGE  235

Query  552   IPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehe  731
             IP     LL+ V+QEIE R++ Q++++R Q++  K+RE KY+ K +A E L  G  EE+E
Sbjct  236   IPHRAVYLLRNVVQEIEHRIAIQADHIRNQNSIIKTREDKYRSKIKALETLVNGTNEENE  295

Query  732   iekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCL  881
             +   + E  E  + ++          +  L ++K++ E  I+SL  E+++  + +E    
Sbjct  296   MTVDRLELVEVEKSKLDEKRKLGEQDMVRLMQEKENAENTIASLQQEIQVLSRMHEQYHE  355

Query  882   QLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             + ET   +M   L  ++ E E LL  S+KK +E+E+ S+ K   W RK ++++
Sbjct  356   RKETEARQMEEHLAMRLKEAEFLLMQSEKKVEEIESVSQLKSQLWTRKANIFQ  408



>emb|CBI15451.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   121 bits (303),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 135/241 (56%), Gaps = 35/241 (15%)
 Frame = +3

Query  375   HAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGD  551
             H G K  +VFQLK G   DI A K++E+MK  SL++A T+ L S V  IL+E++ERKN +
Sbjct  141   HVGHKFHEVFQLKQGRYADIPAAKLTEMMKSNSLDNAPTQSLLSVVNGILDESVERKNEE  200

Query  552   IPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehe  731
             IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +KSRE+KYQ + R  E L TG  +E++
Sbjct  201   IPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKSREEKYQSRIRVLETLATGTNDENQ  260

Query  732   iekakseekekhreQIICMLQKDKDHHEM---------QISSLNHELELCKKTYEG--KC  878
             I              ++  LQ+ K   E+         QIS    E+E    T +     
Sbjct  261   I--------------VLNHLQQIKMRMEIVRFDCPLIYQISPFMMEVEGV-FTIDSILNL  305

Query  879   LQLET-HLEKM-------RIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHV  1034
             LQL   H  +M       + E   +  ELE LL DS+ K ++LEA+S  +  +W +KE  
Sbjct  306   LQLLIKHFSEMEKQGMGDKAEFEKRSRELEQLLADSRNKINKLEAYSGLEGQRWDKKEQS  365

Query  1035  Y  1037
             Y
Sbjct  366   Y  366



>gb|AFW82518.1| hypothetical protein ZEAMMB73_648725 [Zea mays]
Length=686

 Score =   120 bits (301),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 137/232 (59%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K+ +VFQLK G   D+ A KISE+M   SL++A T+ L S V  IL+E+IERK G+I
Sbjct  18    SGQKVREVFQLKRGSYSDLTAAKISEMMHSNSLDNAPTQSLISVVNGILDESIERKKGEI  77

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE R+  Q+E++R Q+ + K+REQKY  K +A E L  G  EE+++
Sbjct  78    PHRVVYLLRKVVQEIEHRLCIQAEHIRSQNVTIKTREQKYCSKIKALEMLVNGTNEENQM  137

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + +  +  + QI          +  L K+K++ +  I +L  ++E   + +E +  Q
Sbjct  138   AINRLQIVKNEKSQIEEKKELCEKDVQRLMKEKEYSKSIIMNLTKDMEAMNRLHEQQLEQ  197

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +    ++M  +L  ++ E+E LL  S KK +ELE  S  K   W +KE++++
Sbjct  198   IGRKAKEMEEQLTTRVKEVEYLLLQSNKKVEELEIASRLKSQLWDQKENIFQ  249



>gb|AFW82519.1| hypothetical protein ZEAMMB73_648725 [Zea mays]
Length=842

 Score =   120 bits (302),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 137/232 (59%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K+ +VFQLK G   D+ A KISE+M   SL++A T+ L S V  IL+E+IERK G+I
Sbjct  18    SGQKVREVFQLKRGSYSDLTAAKISEMMHSNSLDNAPTQSLISVVNGILDESIERKKGEI  77

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE R+  Q+E++R Q+ + K+REQKY  K +A E L  G  EE+++
Sbjct  78    PHRVVYLLRKVVQEIEHRLCIQAEHIRSQNVTIKTREQKYCSKIKALEMLVNGTNEENQM  137

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + +  +  + QI          +  L K+K++ +  I +L  ++E   + +E +  Q
Sbjct  138   AINRLQIVKNEKSQIEEKKELCEKDVQRLMKEKEYSKSIIMNLTKDMEAMNRLHEQQLEQ  197

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +    ++M  +L  ++ E+E LL  S KK +ELE  S  K   W +KE++++
Sbjct  198   IGRKAKEMEEQLTTRVKEVEYLLLQSNKKVEELEIASRLKSQLWDQKENIFQ  249



>gb|AFW82517.1| kinesin heavy chain [Zea mays]
Length=842

 Score =   120 bits (302),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 137/232 (59%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K+ +VFQLK G   D+ A KISE+M   SL++A T+ L S V  IL+E+IERK G+I
Sbjct  18    SGQKVREVFQLKRGSYSDLTAAKISEMMHSNSLDNAPTQSLISVVNGILDESIERKKGEI  77

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE R+  Q+E++R Q+ + K+REQKY  K +A E L  G  EE+++
Sbjct  78    PHRVVYLLRKVVQEIEHRLCIQAEHIRSQNVTIKTREQKYCSKIKALEMLVNGTNEENQM  137

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + +  +  + QI          +  L K+K++ +  I +L  ++E   + +E +  Q
Sbjct  138   AINRLQIVKNEKSQIEEKKELCEKDVQRLMKEKEYSKSIIMNLTKDMEAMNRLHEQQLEQ  197

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +    ++M  +L  ++ E+E LL  S KK +ELE  S  K   W +KE++++
Sbjct  198   IGRKAKEMEEQLTTRVKEVEYLLLQSNKKVEELEIASRLKSQLWDQKENIFQ  249



>ref|XP_011652155.1| PREDICTED: kinesin-4-like [Cucumis sativus]
Length=1364

 Score =   121 bits (304),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 124/199 (62%), Gaps = 17/199 (9%)
 Frame = +3

Query  345  MAKELSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLE-----SASTRLLFSA  506
            M++ L  SN+  G K  +VFQLK G   DI A KISE+MK  SL+     +A T+ L S 
Sbjct  196  MSESLVGSNHQVGHKFHEVFQLKQGRYADIPAAKISEMMKSNSLDHLLLQNAPTQSLLSV  255

Query  507  VGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKD  686
            V  IL+E++E+KNG+IP  V+ LL+ V+QEIE+R+S Q+++LR Q+N +K+RE+K+Q + 
Sbjct  256  VNGILDESLEKKNGEIPHRVACLLRKVVQEIERRISTQADHLRTQNNLFKAREEKFQSRI  315

Query  687  RAYEALRTGa-----------aeeheiekakseekekhreQIICMLQKDKDHHEMQISSL  833
            R  EAL +              +  + EK K+EEK+    + +  L K++D  + +I  L
Sbjct  316  RVLEALASNINEENQCVLSQFQQTKQAEKTKAEEKKNSLNEDVSRLIKERDECKAEIVLL  375

Query  834  NHELELCKKTYEGKCLQLE  890
              ELE  KKTYE +CLQ+E
Sbjct  376  KQELETAKKTYELRCLQVE  394


 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 48/87 (55%), Gaps = 0/87 (0%)
 Frame = +3

Query  780   ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTD  959
             +  L K++D  + + + L HELE   KTYE + L++ET  +  ++ L  +I ELE LL D
Sbjct  659   VTRLIKERDESKTETAVLKHELETTTKTYELRRLEVETETKSAQLMLEERIKELENLLED  718

Query  960   SKKKADELEAFSESKLLKWKRKEHVYK  1040
             S  +  EL    E K  KW  K + YK
Sbjct  719   SSNEVQELSTSFELKQKKWNEKANSYK  745



>ref|XP_004512859.1| PREDICTED: kinesin-4-like [Cicer arietinum]
Length=1013

 Score =   120 bits (302),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 87/228 (38%), Positives = 129/228 (57%), Gaps = 10/228 (4%)
 Frame = +3

Query  375   HAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGD  551
               G K  +VFQ+K G   D+ A KISE+MK  SL++A T+ L S V  IL E++ER+NG+
Sbjct  207   QVGHKFHEVFQIKPGSYADLPASKISEMMKSNSLDNAPTQSLLSVVNGILEESVERRNGE  266

Query  552   IPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRT-------  710
             IP  V+ LL+ V QEIE+R+S Q+E++R Q N +K+RE+KYQ + R  E L +       
Sbjct  267   IPHRVACLLRKVSQEIERRISTQAEHMRIQSNLFKAREEKYQSRIRVLETLASTNSKENE  326

Query  711   --GaaeeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                +  +        EE++K  E+ +  L K  +   ++IS L  +LE  KKT E +  Q
Sbjct  327   IFASQLQQLKGLIVKEEEKKEDEKEVIRLTKMLEDKILEISELKQKLEAAKKTNEAQFSQ  386

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKE  1028
             LE      + E  +K  E E  L + + +  ELEA S+SK  +W  K+
Sbjct  387   LEEEATDAKAETRHKYQEYEYRLEELRNEVKELEASSDSKYQEWNMKK  434



>ref|XP_006353799.1| PREDICTED: kinesin-4-like [Solanum tuberosum]
Length=1331

 Score =   120 bits (302),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 118/179 (66%), Gaps = 15/179 (8%)
 Frame = +3

Query  372  NHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
            +H G K  +VFQLK G   +I A +ISE+M+  SL+ A T+ L S V  IL+E++ERKNG
Sbjct  224  HHVGHKFHEVFQLKQGSYTEIPAARISEMMRSNSLDIAPTQSLLSVVNGILDESVERKNG  283

Query  549  DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
            +IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q N +KSRE+KYQ + R  E L TG +EE 
Sbjct  284  EIPQRVACLLRKVVQEIERRISTQAEHLRTQSNLFKSREEKYQSRIRIMEVLATGTSEET  343

Query  729  e----------iekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGK  875
            +           EK K+EEK+K  EQ +  L++  D    QI++L  ELE+ KK+YE K
Sbjct  344  QIVMNQLHQIKNEKNKAEEKKKIEEQDVPRLKEKDD----QIAALKQELEMAKKSYESK  398


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 50/81 (62%), Gaps = 0/81 (0%)
 Frame = +3

Query  798   DKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKAD  977
             +K+ H  +I+ L  E+E+ KK YE   L+++    + + EL  K+ E   LLT+S+ +  
Sbjct  792   EKEDHRREIADLKQEMEIAKKLYEQHTLEMKEKATEAQQELEEKLKEAMSLLTESRNRIK  851

Query  978   ELEAFSESKLLKWKRKEHVYK  1040
             ELE F++S    WK+KEH+Y+
Sbjct  852   ELETFAQSNSHSWKKKEHIYQ  872



>ref|XP_006580891.1| PREDICTED: kinesin-4-like [Glycine max]
Length=1294

 Score =   120 bits (302),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 87/233 (37%), Positives = 139/233 (60%), Gaps = 14/233 (6%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
             +H G K  + FQLK G   D+ A KISE+MK  S+++A T+ L S V  IL E++ER+NG
Sbjct  263   HHVGHKFHEEFQLKPGSYADLPAAKISEMMKSNSIDNAPTQSLLSVVNGILEESVERRNG  322

Query  549   DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
             +IP  V+ LLK V QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EAL +G  +E 
Sbjct  323   EIPHRVACLLKKVTQEIERRMSTQAEHLRTQNNLFKAREEKYQSRIRVLEALASGTRDES  382

Query  729   e---------iekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCL  881
             E           +   E+++K  E  +  L K+++   ++IS+L  ELE  K+T E +  
Sbjct  383   EICSSQVQQFKGEMIKEKEKKVDENEVVRLIKEQEDKNLEISALKVELETAKRTCEVQFS  442

Query  882   QLETHLEKMRIELGNKIME----LECLLTDSKKKADELEAFSESKLLKWKRKE  1028
             QLE      +  L  K+ E    LE L  +++K  +E++   E + +++ +++
Sbjct  443   QLEEEANGFKATLTRKVQEYEHQLEELRNEAEKIKEEVKTTDEKETIRFMKEQ  495



>ref|XP_011097028.1| PREDICTED: kinesin-4-like, partial [Sesamum indicum]
Length=983

 Score =   120 bits (301),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 113/176 (64%), Gaps = 11/176 (6%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGD  551
            H G K  +VFQLK G   D+ A KISE+MK  SL++A T+ L S V  IL+E+IERK+G 
Sbjct  1    HVGHKFHEVFQLKQGSYTDLPAAKISEMMKSNSLDNAPTQSLLSVVNGILDESIERKSGA  60

Query  552  IPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehe  731
            IP  V+ LL+ V+QEIE+R+  Q+E+LR Q+N +K+RE+KYQ + R  EAL TG +EE +
Sbjct  61   IPHRVACLLRKVVQEIERRICTQAEHLRTQNNLFKAREEKYQSRIRVLEALATGTSEETQ  120

Query  732  iekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYE  869
            I   + ++ +  + +I          +  L K+KD    +I++L  ELE+ + +YE
Sbjct  121  IVMNQLQQLKSEKNKIEERKRVEEQDVLRLIKEKDDLNQEIANLMQELEIARSSYE  176



>ref|XP_008656472.1| PREDICTED: kinesin-4 isoform X3 [Zea mays]
Length=787

 Score =   120 bits (300),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 137/232 (59%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K+ +VFQLK G   D+ A KISE+M   SL++A T+ L S V  IL+E+IERK G+I
Sbjct  183   SGQKVREVFQLKRGSYSDLTAAKISEMMHSNSLDNAPTQSLISVVNGILDESIERKKGEI  242

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE R+  Q+E++R Q+ + K+REQKY  K +A E L  G  EE+++
Sbjct  243   PHRVVYLLRKVVQEIEHRLCIQAEHIRSQNVTIKTREQKYCSKIKALEMLVNGTNEENQM  302

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + +  +  + QI          +  L K+K++ +  I +L  ++E   + +E +  Q
Sbjct  303   AINRLQIVKNEKSQIEEKKELCEKDVQRLMKEKEYSKSIIMNLTKDMEAMNRLHEQQLEQ  362

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +    ++M  +L  ++ E+E LL  S KK +ELE  S  K   W +KE++++
Sbjct  363   IGRKAKEMEEQLTTRVKEVEYLLLQSNKKVEELEIASRLKSQLWDQKENIFQ  414



>ref|XP_008656470.1| PREDICTED: kinesin-4 isoform X1 [Zea mays]
Length=1007

 Score =   120 bits (301),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 85/232 (37%), Positives = 137/232 (59%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K+ +VFQLK G   D+ A KISE+M   SL++A T+ L S V  IL+E+IERK G+I
Sbjct  183   SGQKVREVFQLKRGSYSDLTAAKISEMMHSNSLDNAPTQSLISVVNGILDESIERKKGEI  242

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE R+  Q+E++R Q+ + K+REQKY  K +A E L  G  EE+++
Sbjct  243   PHRVVYLLRKVVQEIEHRLCIQAEHIRSQNVTIKTREQKYCSKIKALEMLVNGTNEENQM  302

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + +  +  + QI          +  L K+K++ +  I +L  ++E   + +E +  Q
Sbjct  303   AINRLQIVKNEKSQIEEKKELCEKDVQRLMKEKEYSKSIIMNLTKDMEAMNRLHEQQLEQ  362

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +    ++M  +L  ++ E+E LL  S KK +ELE  S  K   W +KE++++
Sbjct  363   IGRKAKEMEEQLTTRVKEVEYLLLQSNKKVEELEIASRLKSQLWDQKENIFQ  414



>ref|XP_010431727.1| PREDICTED: kinesin-4-like [Camelina sativa]
Length=1015

 Score =   120 bits (301),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 136/226 (60%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E DI   KISEL+K  SL +A TR LF  +  +L+E++ + NG +   ++S
Sbjct  176   DEFQSKEGSEIDISDAKISELLKSNSLRNAPTRSLFDMLDKLLDESMTKMNGHVSHAMAS  235

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiek----  740
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E L  G  +E+EI      
Sbjct  236   LLSALVQVIEQRISTQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTKENEIVTNCME  295

Query  741   ------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
                    + EE+E+  E+ +  ++K+K+  + +I  L  EL++ K+T+E +CL LE   +
Sbjct  296   HIKLEKNRIEERERSEEKDVVRMRKEKERSDAEIRKLKQELKVVKETHENQCLDLEAKAQ  355

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             K R EL  K+ + E  + DS +K  ELE   +S+  +W++KE +Y+
Sbjct  356   KTRDELEKKLKDAELHVVDSSRKVKELEKLCQSRSQRWEKKECIYQ  401



>emb|CDM84045.1| unnamed protein product [Triticum aestivum]
Length=972

 Score =   120 bits (300),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 135/232 (58%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K  +VFQ K G   D+ A KISE+++  SL++A T+ L   V  IL+E+IERK G+I
Sbjct  170   SGQKANEVFQFKRGQYTDLPAAKISEMIQSNSLDNAPTQSLLRVVNGILDESIERKRGEI  229

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE R+S Q+E++R Q+N  K+RE KY+ K +A E L  G  EE+E+
Sbjct  230   PHRVVYLLRNVVQEIEHRISIQAEHIRNQNNIIKTREDKYRSKIKALETLVNGTNEENEM  289

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + E  +  + +I          +  L ++K++ E  +++L  E+++  + +E    Q
Sbjct  290   AINRLELVKVEKSKIDERRKIGEQDMVRLMREKENAENTVTNLQQEIQVMSRMFEEYREQ  349

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +E    +M   L  +  E E LL  SKK+ +ELE  SE +L  W +K + ++
Sbjct  350   MEEKTSQMEEHLTLRAKEAEFLLMQSKKRVEELETASELQLQLWSKKANTFR  401



>ref|XP_002509807.1| kinesin heavy chain, putative [Ricinus communis]
 gb|EEF51194.1| kinesin heavy chain, putative [Ricinus communis]
Length=1069

 Score =   120 bits (300),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 103/237 (43%), Positives = 148/237 (62%), Gaps = 7/237 (3%)
 Frame = +3

Query  348   AKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILN  524
               E SA  + +G K  D   LK G   D+    I ELMK   L+SASTR LFS    IL+
Sbjct  161   GPEPSALLHDSGHKFSDELPLKQGLYGDLSDSNILELMKSNGLDSASTRTLFSLANRILD  220

Query  525   ENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEAL  704
             ++ ERKNG + Q ++ +LK ++Q IEQR S Q+ NL+ Q+N Y  R +KYQ + R  E L
Sbjct  221   DSTERKNGQL-QHMTRILKKIVQVIEQRFSTQANNLKDQNNLYNVRTEKYQSRIRVLETL  279

Query  705   RTGaaeehei-----ekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYE  869
              +G  +E E+     EK K E+KEK  EQ +  L+++K+H +++  +L  ELEL KKT+E
Sbjct  280   ASGTTDEIEVLCLQIEKIKIEQKEKLEEQDLRRLKEEKNHSDIEKLTLKQELELAKKTHE  339

Query  870   GKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
                L LE H ++ ++EL  K+ ELE LL +S+ K +ELE+FSESK  +W++KE  Y+
Sbjct  340   EHYLLLEDHAKETKVELEKKLKELESLLAESRNKVEELESFSESKSKRWRKKEGKYR  396



>ref|XP_010232310.1| PREDICTED: kinesin-4-like isoform X1 [Brachypodium distachyon]
Length=1022

 Score =   119 bits (299),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 137/231 (59%), Gaps = 11/231 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K+ +VFQ K G   DI + KISE+++  SL+SA T+ L   V  IL+E+IERK G+I
Sbjct  179   SGQKVNEVFQFKRGQYTDIPSAKISEMIQSNSLDSAPTQSLLRVVNGILDESIERKRGEI  238

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE+R S Q++++R Q++  K+RE KY+ K +A E L  G  EE+E+
Sbjct  239   PHRVVYLLRNVVQEIERRFSIQADHIRNQNSIIKTREDKYRSKIKALETLVNGTNEENEM  298

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + E  +  + +I          +  L ++K++ E  +++L  E+++  + +E    Q
Sbjct  299   AINRLELVKVEKSKIDERRKLGEQDMVRLMREKENAENTVTNLQQEIQVMSRMFEEYREQ  358

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVY  1037
             +ET   +M  +L  +  E E LL  SKK+ +E+EA SE K   W +K + +
Sbjct  359   METKASQMEEQLTLRAKEAEFLLMQSKKRVEEVEAASELKSQLWSKKANTF  409



>ref|XP_003569788.1| PREDICTED: kinesin-4-like isoform X2 [Brachypodium distachyon]
Length=990

 Score =   119 bits (298),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 84/231 (36%), Positives = 137/231 (59%), Gaps = 11/231 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K+ +VFQ K G   DI + KISE+++  SL+SA T+ L   V  IL+E+IERK G+I
Sbjct  179   SGQKVNEVFQFKRGQYTDIPSAKISEMIQSNSLDSAPTQSLLRVVNGILDESIERKRGEI  238

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE+R S Q++++R Q++  K+RE KY+ K +A E L  G  EE+E+
Sbjct  239   PHRVVYLLRNVVQEIERRFSIQADHIRNQNSIIKTREDKYRSKIKALETLVNGTNEENEM  298

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + E  +  + +I          +  L ++K++ E  +++L  E+++  + +E    Q
Sbjct  299   AINRLELVKVEKSKIDERRKLGEQDMVRLMREKENAENTVTNLQQEIQVMSRMFEEYREQ  358

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVY  1037
             +ET   +M  +L  +  E E LL  SKK+ +E+EA SE K   W +K + +
Sbjct  359   METKASQMEEQLTLRAKEAEFLLMQSKKRVEEVEAASELKSQLWSKKANTF  409



>ref|XP_008443607.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103487162 
[Cucumis melo]
Length=1377

 Score =   119 bits (299),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 83/199 (42%), Positives = 124/199 (62%), Gaps = 17/199 (9%)
 Frame = +3

Query  345  MAKELSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLE-----SASTRLLFSA  506
            M++ L  SN+  G K  +VFQLK G   D+ A KISE+MK  SL+     +A T+ L S 
Sbjct  198  MSESLVGSNHQVGHKFHEVFQLKQGRYADLPAAKISEMMKSNSLDHLLLQNAPTQSLLSV  257

Query  507  VGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKD  686
            V  IL+E++E+KNG+IP  V+ LL+ V+QEIE+R+S Q+++LR Q+N +K+RE+K+Q + 
Sbjct  258  VNGILDESLEKKNGEIPHRVACLLRKVVQEIERRISTQADHLRTQNNLFKAREEKFQSRI  317

Query  687  RAYEALRTGa-----------aeeheiekakseekekhreQIICMLQKDKDHHEMQISSL  833
            R  EAL +              +  + EK K+EEK+    + +  L K++D  + +I  L
Sbjct  318  RVLEALASNINEENQSVLSQLQQTKQAEKTKAEEKKNSLNEDVSRLIKERDECKAEILLL  377

Query  834  NHELELCKKTYEGKCLQLE  890
              ELE  KKTYE +CLQ+E
Sbjct  378  KQELETAKKTYELRCLQVE  396


 Score = 58.5 bits (140),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 0/87 (0%)
 Frame = +3

Query  780   ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTD  959
             +  L K++D  + +I+ L HELE   KTYE + L++ET  +  ++ L  +I ELE LL D
Sbjct  660   VTKLIKERDESKTEIAVLKHELETTTKTYELRRLEVETETKSAQLMLEERIKELENLLED  719

Query  960   SKKKADELEAFSESKLLKWKRKEHVYK  1040
             S  +  EL    ESK  KW  K + YK
Sbjct  720   SSNEVKELTTSFESKQKKWNEKANSYK  746



>ref|XP_006300383.1| hypothetical protein CARUB_v10019703mg [Capsella rubella]
 gb|EOA33281.1| hypothetical protein CARUB_v10019703mg [Capsella rubella]
Length=1057

 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 83/226 (37%), Positives = 136/226 (60%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E DI   KISEL+K  SL +A TR LF  +  +L+E++ + NG +   ++S
Sbjct  165   DRFQSKEGSEIDISDDKISELLKSNSLRNAPTRSLFDMLDKLLDESMTKMNGHVSHAMAS  224

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiek----  740
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E L  G  +E+EI      
Sbjct  225   LLSALVQVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTKENEIVTNCME  284

Query  741   ------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
                    + EE+E+  E+ +  L+K+K+  + +I  L  EL++ K+T+E +CL LE   +
Sbjct  285   HIKLEKTRIEERERSEEKDVVRLRKEKERSDAEIRKLKQELKVVKETHENQCLDLEAKAQ  344

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             + R EL  K+ + E  + DS +K  ELE   +SK  +W++KE +Y+
Sbjct  345   QTREELEKKLKDAELHVVDSSRKVKELEKLCQSKSQRWEKKECMYQ  390



>gb|KHN21564.1| Kinesin-4 [Glycine soja]
Length=1141

 Score =   119 bits (298),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 88/228 (39%), Positives = 137/228 (60%), Gaps = 14/228 (6%)
 Frame = +3

Query  372   NHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
             +H G K  + FQLK G   D+ A KISE+MK  S+++A T+ L S V  IL E++ER+NG
Sbjct  208   HHVGHKFHEEFQLKPGSYADLPAAKISEMMKSNSIDNAPTQSLLSVVNGILEESVERRNG  267

Query  549   DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
             +IP  V+ LLK V QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  EAL +G  +E 
Sbjct  268   EIPHRVACLLKKVTQEIERRMSTQAEHLRTQNNLFKAREEKYQSRIRVLEALASGTRDES  327

Query  729   e---------iekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCL  881
             E           +   EE++K  E  +  L K+++   ++IS+L  ELE  K+T E +  
Sbjct  328   EICSSQVQQFKGEMIKEEEKKVDENEVVRLIKEQEDKNLEISALKVELETAKRTCEVQFS  387

Query  882   QLETHLEKMRIELGNKIME----LECLLTDSKKKADELEAFSESKLLK  1013
             QLE      +  L  K+ E    LE L  + +K  +E++  +E+++++
Sbjct  388   QLEEEANGFKATLTRKVQEYEHQLEELRNEVEKIKEEVKTENENEIVR  435



>ref|XP_002456344.1| hypothetical protein SORBIDRAFT_03g034310 [Sorghum bicolor]
 gb|EES01464.1| hypothetical protein SORBIDRAFT_03g034310 [Sorghum bicolor]
Length=921

 Score =   119 bits (297),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 136/231 (59%), Gaps = 11/231 (5%)
 Frame = +3

Query  375   HAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGD  551
             H+G K+ D FQLK G   D+   K+SE+M  +SL++A T+ L   V  IL+E+IERK G+
Sbjct  177   HSGQKVHDAFQLKRGSYTDLPPAKVSEMMHPRSLDNAPTQSLLRVVNGILDESIERKRGE  236

Query  552   IPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehe  731
             IP  V  LL+ V+QEIE R++ Q++++R Q++  K+RE KY+ K +A E L  G  EE+E
Sbjct  237   IPHRVVYLLRNVVQEIEHRIAIQADHIRNQNSIIKTREDKYRSKIKALETLVNGTNEENE  296

Query  732   iekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCL  881
             +   + E  E  + ++          +  L ++K++ E  I+SL  E+++  + +E    
Sbjct  297   MTVNRLELVEVEKSKLDEKRKLGEQDMVRLMQEKENAENTIASLQQEIQILSRMHEQYRE  356

Query  882   QLETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHV  1034
             + ET   +M   +  ++ + E LL  SKKK +E+E+ S+ K   W RK ++
Sbjct  357   RKETEARQMEEHMAMRLKDAEFLLMQSKKKVEEIESASQLKSQLWSRKANI  407



>ref|XP_010663596.1| PREDICTED: kinesin-4 isoform X1 [Vitis vinifera]
Length=1192

 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 130/221 (59%), Gaps = 20/221 (9%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGD  551
            H G K  +VFQLK G   DI A K++E+MK  SL++A T+ L S V  IL+E++ERKN +
Sbjct  230  HVGHKFHEVFQLKQGRYADIPAAKLTEMMKSNSLDNAPTQSLLSVVNGILDESVERKNEE  289

Query  552  IPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehe  731
            IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +KSRE+KYQ + R  E L TG  +E++
Sbjct  290  IPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKSREEKYQSRIRVLETLATGTNDENQ  349

Query  732  iekakseekekhreQI---------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
            I     ++ +  +  +         +  L K+KD   ++ISSL  E+E+ +K  E +   
Sbjct  350  IVLNHLQQIKTKKANVEDKKKLEEDMARLIKEKDDTNLEISSLKQEMEMARKK-EKEQYH  408

Query  885  LETHLEKMRIELG---------NKIMELECLLTDSKKKADE  980
            LE    K  +E+          +KI+ L   L  +KKK D+
Sbjct  409  LELSALKQELEIARKKEKDPNDSKILVLRQELEMAKKKKDQ  449


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = +3

Query  795   KDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKA  974
             K+KD + ++I++L  ELE+ +KTYE    ++E      + E   +  ELE LL DS+ K 
Sbjct  466   KEKDQNNIEITALKQELEIARKTYEEHFSEMEKQGMGDKAEFEKRSRELEQLLADSRNKI  525

Query  975   DELEAFSESKLLKWKRKEHVY  1037
             ++LEA+S  +  +W +KE  Y
Sbjct  526   NKLEAYSGLEGQRWDKKEQSY  546



>ref|XP_010663597.1| PREDICTED: kinesin-4 isoform X2 [Vitis vinifera]
Length=1174

 Score =   119 bits (297),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 86/221 (39%), Positives = 130/221 (59%), Gaps = 20/221 (9%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGD  551
            H G K  +VFQLK G   DI A K++E+MK  SL++A T+ L S V  IL+E++ERKN +
Sbjct  212  HVGHKFHEVFQLKQGRYADIPAAKLTEMMKSNSLDNAPTQSLLSVVNGILDESVERKNEE  271

Query  552  IPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehe  731
            IP  V+ LL+ V+QEIE+R+S Q+E+LR Q+N +KSRE+KYQ + R  E L TG  +E++
Sbjct  272  IPHRVACLLRKVVQEIERRISTQAEHLRTQNNLFKSREEKYQSRIRVLETLATGTNDENQ  331

Query  732  iekakseekekhreQI---------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
            I     ++ +  +  +         +  L K+KD   ++ISSL  E+E+ +K  E +   
Sbjct  332  IVLNHLQQIKTKKANVEDKKKLEEDMARLIKEKDDTNLEISSLKQEMEMARKK-EKEQYH  390

Query  885  LETHLEKMRIELG---------NKIMELECLLTDSKKKADE  980
            LE    K  +E+          +KI+ L   L  +KKK D+
Sbjct  391  LELSALKQELEIARKKEKDPNDSKILVLRQELEMAKKKKDQ  431


 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = +3

Query  795   KDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKA  974
             K+KD + ++I++L  ELE+ +KTYE    ++E      + E   +  ELE LL DS+ K 
Sbjct  448   KEKDQNNIEITALKQELEIARKTYEEHFSEMEKQGMGDKAEFEKRSRELEQLLADSRNKI  507

Query  975   DELEAFSESKLLKWKRKEHVY  1037
             ++LEA+S  +  +W +KE  Y
Sbjct  508   NKLEAYSGLEGQRWDKKEQSY  528



>ref|XP_002886395.1| hypothetical protein ARALYDRAFT_474991 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62654.1| hypothetical protein ARALYDRAFT_474991 [Arabidopsis lyrata subsp. 
lyrata]
Length=1065

 Score =   118 bits (295),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 134/226 (59%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E DI   KISEL+K  SL +A TR LF  +  +L++++ + NG +   ++S
Sbjct  174   DGFQSKEGSEIDISDAKISELLKSNSLRNAPTRSLFDMLDKLLDKSMTKMNGHVSHAMAS  233

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiek----  740
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E L  G  +E+EI      
Sbjct  234   LLSALVQVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTQENEIVTNCME  293

Query  741   ------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
                    + EE+E+  E+ +  L+K+K+  + +I  L  EL++ K+T+E +CL LE   +
Sbjct  294   HIKLEKNRIEERERSEEKDVVRLRKEKERSDAEIRKLKQELKVVKETHENQCLDLEAKAQ  353

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             K R EL  K+ + E    DS +K  E E   +SK  +W++KE +Y+
Sbjct  354   KTRDELEKKLKDAEFHAVDSSRKVKEFEKLCQSKSQRWEKKECIYQ  399



>ref|XP_002298032.2| kinesin motor family protein [Populus trichocarpa]
 gb|EEE82837.2| kinesin motor family protein [Populus trichocarpa]
Length=1018

 Score =   118 bits (295),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 96/225 (43%), Positives = 136/225 (60%), Gaps = 11/225 (5%)
 Frame = +3

Query  399   VFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSL  575
             +FQ K G   D+    I ELMK   L++ STR LFS V  IL E+IERKNG +   ++ +
Sbjct  160   MFQQKQGSYADLSDSNILELMKSNGLDNTSTRTLFSLVNRILEESIERKNGHVHHQMAHI  219

Query  576   LKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaa----------ee  725
             +K V+Q IEQRVS  + NL+ Q+N YK R  K Q + +  E L  G            ++
Sbjct  220   VKKVVQVIEQRVSTLAVNLKDQNNLYKVRLGKCQSRIKVLETLAAGTTEEIRVLLSQLQQ  279

Query  726   heiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEK  905
              +IEK K EEK+K  EQ +   +++K H +++ S+L HELE+ K T+E  CL L+   E+
Sbjct  280   IKIEKTKIEEKKKLEEQELLRTKQEKIHSDIENSTLKHELEIAKTTHEEHCLLLQVQAEE  339

Query  906   MRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
              ++EL  K+ ELEC L +S K+  ELE+FSESK  +WK KE  Y+
Sbjct  340   TKVELEKKLKELECFLAESMKRVKELESFSESKSQRWKSKEGSYR  384



>emb|CDY11085.1| BnaC06g23370D [Brassica napus]
Length=1012

 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 128/208 (62%), Gaps = 23/208 (11%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKS-----------LESASTRLLFSAV  509
             S +H G K  +VFQ+K G  D+ A KISE+MK              +++A T+ L S V
Sbjct  80   GSMHHGGHKFHEVFQMKQGRYDLQASKISEMMKSIYSLFTMFFGLCLMQNAPTQSLLSVV  139

Query  510  GDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDR  689
              IL+E+IERKNG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +  
Sbjct  140  NGILDESIERKNGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNIFKTREEKYQSRIN  199

Query  690  AYEALRTGaaeeh----------eiekakseekekhreQIICMLQKDKDHHEMQISSLNH  839
              EAL +G  ++           + EK+  EEK+K+ E+ +  L K+   ++++IS+L  
Sbjct  200  VLEALASGTGKDSEIATQQLRQIKTEKSTWEEKKKNGEEDMLKLLKENCQYDLEISALRQ  259

Query  840  ELELCKKTYEGKCLQLE--THLEKMRIE  917
            ELE  K+ Y+ +C Q+E  T  EK + E
Sbjct  260  ELETTKREYKQQCTQMESQTMTEKTKWE  287



>emb|CDX68208.1| BnaA07g22480D [Brassica napus]
Length=1012

 Score =   117 bits (294),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 84/208 (40%), Positives = 129/208 (62%), Gaps = 23/208 (11%)
 Frame = +3

Query  363  ASNNHAGSKLPDVFQLKIGCEDILAYKISELMKQKS-----------LESASTRLLFSAV  509
             S +H G K  +VFQ+K G  D+ A KISE+MK              +++A T+ L S V
Sbjct  80   GSMHHGGHKFHEVFQMKQGRYDLQASKISEMMKSIYSLFTMFFGLCLMQNAPTQSLLSVV  139

Query  510  GDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDR  689
              IL+E+IERKNG+IPQ V+ LL+ V+QEIE+R+S Q+E+LR Q+N +K+RE+KYQ +  
Sbjct  140  NGILDESIERKNGEIPQRVACLLRKVVQEIERRISTQAEHLRTQNNIFKTREEKYQSRIN  199

Query  690  AYEALRTGaaeeh----------eiekakseekekhreQIICMLQKDKDHHEMQISSLNH  839
              EAL +G+ ++           + EK+  EEK+K+ E+ +  L K+   ++++IS+L  
Sbjct  200  VLEALASGSGKDSEIATQQLRQIKTEKSTWEEKKKNGEEDMLKLLKENCQYDLEISALRQ  259

Query  840  ELELCKKTYEGKCLQLE--THLEKMRIE  917
            ELE  K+ Y+ +C Q+E  T  EK + E
Sbjct  260  ELETTKREYKQQCTQMESQTMTEKTKWE  287



>ref|XP_012086895.1| PREDICTED: kinesin-4 [Jatropha curcas]
 ref|XP_012086896.1| PREDICTED: kinesin-4 [Jatropha curcas]
 gb|KDP25433.1| hypothetical protein JCGZ_20589 [Jatropha curcas]
Length=1136

 Score =   117 bits (293),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 91/231 (39%), Positives = 144/231 (62%), Gaps = 11/231 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIP  557
             AG K+ + F  K G  D+    I ELMK   L++ASTR LFS +  I+++++ERKNG + 
Sbjct  213   AGHKISEAFLPKQGHADLSDSNILELMKSNGLDNASTRTLFSLLNRIMDDSMERKNGFV-  271

Query  558   QCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheie  737
             Q ++ L+K V+Q IEQR S Q+ENL+ Q+N Y  R +KYQ + R  E L +G  EE E+ 
Sbjct  272   QNMARLMKKVIQLIEQRFSTQAENLKDQNNLYNVRTEKYQSRIRVLETLASGTTEEIEVL  331

Query  738   kakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQL  887
              ++ ++ +  + ++          +  L+++K+H +++  +L  ELEL KK +E  CL L
Sbjct  332   LSQLQQIKMEKTKLEQKEKLEWQDLNRLREEKNHSDIEKLTLKKELELVKKKHEEHCLVL  391

Query  888   ETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             E   ++ ++EL  ++ ELEC L +S+ K  ELE+FSESK  +WK+KE  Y+
Sbjct  392   EVQSKETKVELEKRLEELECFLAESRNKVKELESFSESKSQRWKKKEGTYQ  442



>gb|EPS68131.1| hypothetical protein M569_06641, partial [Genlisea aurea]
Length=466

 Score =   114 bits (285),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 82/215 (38%), Positives = 133/215 (62%), Gaps = 10/215 (5%)
 Frame = +3

Query  426   DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQ  605
             D+ A K SELMK  SL+ AS + LF  +   L+  ++R+N D+P+ V+S+L +V+QE+EQ
Sbjct  15    DLPACKHSELMKLGSLQDASIQSLFGVMYKSLDGCVKRRNDDVPRGVASMLLIVMQEMEQ  74

Query  606   RVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaa----------eeheiekaksee  755
             R S+ +++ RKQ   Y+SRE++++ K +A E L TG A          ++ +IEK K E+
Sbjct  75    RFSELAKSSRKQSAMYRSREERHRSKFKALEILATGTAEENEIVRKELQQMKIEKTKLEK  134

Query  756   kekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIM  935
              ++ +EQ +  L+++K+H E Q+     EL   K  +E   LQ++   + ++     KI 
Sbjct  135   VKRRQEQDLTKLRQEKEHFENQVMFTEEELNSAKTAFEENFLQMKIEAKDIQERQLKKIQ  194

Query  936   ELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +L  LL DS+ K + LE FS+SK+++WKRKE  YK
Sbjct  195   DLGGLLADSRNKLNNLENFSDSKVIEWKRKEQKYK  229



>ref|XP_003566026.1| PREDICTED: kinesin-4-like [Brachypodium distachyon]
Length=1013

 Score =   117 bits (292),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 79/229 (34%), Positives = 132/229 (58%), Gaps = 11/229 (5%)
 Frame = +3

Query  381   GSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIP  557
             G KL ++FQLK G   D+ + KISE+M   SL+ A T+ L + V  IL+E+IERK G+IP
Sbjct  182   GEKLREIFQLKRGSYADLPSAKISEMMHSNSLDDAPTQSLLTVVNGILDESIERKKGEIP  241

Query  558   QCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheie  737
               V  LL+ V+QEIE+R+  Q+E +R Q+   ++RE+KY+ K +A E L  G  EE+++ 
Sbjct  242   HRVVYLLRKVVQEIERRLCIQAEYIRNQNTITRTREEKYRSKIKALEVLVNGTNEENQMI  301

Query  738   kakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQL  887
               + +  ++ +  I          +  L  +K++ E  + SL  E+E   + ++ +  Q 
Sbjct  302   LNRLKAVKEEKINIEERRKLSEQNVIRLMTEKENAENMVGSLKEEMEEMSRLHQQQLEQF  361

Query  888   ETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHV  1034
             E    +MR +L N++ E E  +  S +K +E+E  S+ K   W +KE++
Sbjct  362   EIKTMQMREQLTNRVKEFELFVFQSNRKIEEVETASQLKSQLWNKKENI  410



>dbj|BAJ97665.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=974

 Score =   116 bits (291),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 84/232 (36%), Positives = 133/232 (57%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K  +VFQ K G   DI A KISE+++  SL++A T+ L   V  IL+E+IERK G+I
Sbjct  170   SGQKTNEVFQFKRGQYTDIPAAKISEMIQSNSLDNAPTQSLLRVVNGILDESIERKRGEI  229

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE R+S Q+E++R Q+N  K+RE KY+ K +A E L  G  EE+E+
Sbjct  230   PHRVVYLLRNVVQEIEHRISIQAEHIRNQNNIIKTREDKYRSKIKALETLVNGTNEENEM  289

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + E  +  + +I          +  L ++K+  E  +++L  E+++  K +E    Q
Sbjct  290   AINRLELVKVEKSKIDERRKLGEQDMVRLIREKEDAENTVNNLRQEIQVMSKMFEEYREQ  349

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +E    +M   L  +  E E LL  SKK+ +E+E  SE +   W +K + ++
Sbjct  350   MEAKTNQMEEHLTLRAKEAEFLLMQSKKRIEEVETASELQSQLWSKKANTFR  401



>ref|XP_008647384.1| PREDICTED: uncharacterized protein LOC100193412 isoform X1 [Zea 
mays]
Length=1006

 Score =   116 bits (290),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 132/232 (57%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K  DVFQLK G      A KISE+M   SL++A T+ L S V  IL+E+IERK G+I
Sbjct  184   SGQKFCDVFQLKHGSYSGPAAAKISEMMHSNSLDNAPTQSLISVVNGILDESIERKKGEI  243

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE+R+  Q+E++R Q+   K REQKY  K +  E L  G  EE+++
Sbjct  244   PHRVVYLLRKVVQEIERRLYIQAEHIRSQNVIMKRREQKYCSKIKVLEMLVNGTNEENQM  303

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + +  +  + +I          +  L ++K+H E  I++L  ++E   + +E +  Q
Sbjct  304   AINRLQIVKNEKSKIEERRKLSEQDVHRLMREKEHSENIIANLKKDIEAMNRLHEQQLEQ  363

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
              E   ++M  +L  K+ E+E LL  SKKK +E+E  S  K   W +KE  ++
Sbjct  364   TERKAKEMEEQLTTKVKEVEYLLLQSKKKVEEVETASRLKSQLWDKKEDNFQ  415



>ref|XP_008647385.1| PREDICTED: uncharacterized protein LOC100193412 isoform X2 [Zea 
mays]
Length=1006

 Score =   115 bits (289),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 86/232 (37%), Positives = 132/232 (57%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K  DVFQLK G      A KISE+M   SL++A T+ L S V  IL+E+IERK G+I
Sbjct  184   SGQKFCDVFQLKHGSYSGPAAAKISEMMHSNSLDNAPTQSLISVVNGILDESIERKKGEI  243

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE+R+  Q+E++R Q+   K REQKY  K +  E L  G  EE+++
Sbjct  244   PHRVVYLLRKVVQEIERRLYIQAEHIRSQNVIMKRREQKYCSKIKVLEMLVNGTNEENQM  303

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + +  +  + +I          +  L ++K+H E  I++L  ++E   + +E +  Q
Sbjct  304   AINRLQIVKNEKSKIEERRKLSEQDVHRLMREKEHSENIIANLKKDIEAMNRLHEQQLEQ  363

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
              E   ++M  +L  K+ E+E LL  SKKK +E+E  S  K   W +KE  ++
Sbjct  364   TERKAKEMEEQLTTKVKEVEYLLLQSKKKVEEVETASRLKSQLWDKKEDNFQ  415



>gb|EMT25397.1| Kinesin-4 [Aegilops tauschii]
Length=926

 Score =   115 bits (289),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 82/232 (35%), Positives = 135/232 (58%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K  +VFQ K G   D+ A KISE+++  SL++A T+ L   V  IL+E+IERK G+I
Sbjct  208   SGQKANEVFQFKRGQYTDLPAAKISEMIQSNSLDNAPTQSLLRVVNGILDESIERKRGEI  267

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE R+S Q+E++R Q++  K+RE KY+ K +A E L  G  EE+E+
Sbjct  268   PHRVVYLLRNVVQEIEHRISIQAEHIRNQNSIIKTREDKYRSKIKALETLVNGTNEENEM  327

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + E  +  + +I          +  L ++K++ E  +++L  E+++  + +E    Q
Sbjct  328   AINRLELVKVEKSKIDERRKIGEQDMVRLMREKENAENTVTNLQQEIQVMSRMFEEYREQ  387

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +E    +M   L  +  E E LLT SKK+ +E+E  SE +   W +K + ++
Sbjct  388   MEEKTSQMEEHLTLRAKEAEFLLTQSKKRVEEVETASELQSQLWSKKANTFR  439



>emb|CDY19209.1| BnaC05g14100D [Brassica napus]
Length=933

 Score =   115 bits (287),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 88/249 (35%), Positives = 140/249 (56%), Gaps = 28/249 (11%)
 Frame = +3

Query  375   HAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             H G K  + FQ+K G  D+ A KISE+MK  +L++A T+ L S    IL+++IER +G++
Sbjct  78    HGGHKFHEAFQMKQGRFDLQAAKISEMMKSNNLDNAPTQSLLSIASGILDDSIERNSGEV  137

Query  555   P----------------QCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKD  686
             P                Q V+ LL+ V+ EIE+R+S QSE+LR Q++ +K+RE+KYQ + 
Sbjct  138   PQQMHTLGKPSDLISNDQRVACLLRKVVLEIERRISTQSEHLRTQNSVFKAREEKYQSRI  197

Query  687   RAYEALRTGaaeeheiekakseekekhreQI----------ICMLQKDKDHHEMQISSLN  836
             +  E L +G +EE+EI   +    +  + ++          +  L+K+   +  +IS+L 
Sbjct  198   KVLETLASGTSEENEIATKQLRRIKTEKSKLEEKKKTKEEDMVKLEKENGQYNHEISTLR  257

Query  837   HELELCKKTYEGKCLQLETHLEKMRIELGNKIMEL-ECLLTDSKKKADELEAFSESKLLK  1013
              ELE  KK YE + LQ+E+H  K+  E  N+  ++ E  L   K KA E+E  S+ K   
Sbjct  258   RELETAKKAYEQQRLQMESHT-KLEEEKKNREDDMFEHNLAQWKSKAKEMEENSDLKNRN  316

Query  1014  WKRKEHVYK  1040
             W +KE  Y+
Sbjct  317   WSQKELSYR  325



>emb|CDY25511.1| BnaC09g11360D [Brassica napus]
Length=1042

 Score =   115 bits (287),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 136/226 (60%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E DI   KIS+L+K  SL +A TR LF  +  +L+E++++ NG +   ++S
Sbjct  175   DGFQSKEGFEIDISDAKISDLLKSNSLRNAPTRTLFDMLDKLLDESVKKMNGHVSHAMAS  234

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae----------  722
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE KY+ + +  E L  GA +          
Sbjct  235   LLSALVQVIEQRISNQADNLKNQNILFRVREDKYRSRIKVLETLAAGATQENEIVTNCME  294

Query  723   eheiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
               ++EK + EE+E+  E+ +  L+K+K+  + +I  L  EL++ K+T+  +CL+LE   +
Sbjct  295   RTKLEKNRIEERERSEEKDVVRLKKEKELSDAEIRKLKQELKVVKETHANQCLELEAQAQ  354

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
               ++EL +K+ + E  + +S +K  ELE    SK  KW++KE  Y+
Sbjct  355   NSKVELESKLKDAELQVAESTRKVKELEKLYLSKSQKWEKKECTYQ  400



>ref|XP_009112933.1| PREDICTED: kinesin-4-like isoform X1 [Brassica rapa]
Length=1071

 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 135/226 (60%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E D+   KISEL+K  SL +A TR LF  +  +L+E++++ NG +   ++S
Sbjct  175   DGFQSKEGFEIDVSDAKISELLKSNSLRNAPTRTLFDMLDKLLDESVKKMNGHVSHAMAS  234

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae----------  722
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE KY+ + +  E L  GA +          
Sbjct  235   LLSALVQVIEQRISNQADNLKNQNILFRVREDKYRSRIKVLETLAAGATQENEIVTNCME  294

Query  723   eheiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
               ++EK + EE+E+  E+ +  L+K+K+  + +I  L  EL++ K+T+  +CL+LE   +
Sbjct  295   RTKLEKNRIEERERSEEKDVVRLKKEKELSDAEIRKLKQELKVVKETHANQCLELEAQAQ  354

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
               ++EL +K+ + E  +  S +K  ELE    SK  KW++KE  Y+
Sbjct  355   NSKVELESKLKDAELQVAQSTRKVKELEKLYLSKSQKWEKKECTYQ  400



>ref|XP_009112934.1| PREDICTED: kinesin-4-like isoform X2 [Brassica rapa]
Length=1070

 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 80/226 (35%), Positives = 135/226 (60%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E D+   KISEL+K  SL +A TR LF  +  +L+E++++ NG +   ++S
Sbjct  175   DGFQSKEGFEIDVSDAKISELLKSNSLRNAPTRTLFDMLDKLLDESVKKMNGHVSHAMAS  234

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae----------  722
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE KY+ + +  E L  GA +          
Sbjct  235   LLSALVQVIEQRISNQADNLKNQNILFRVREDKYRSRIKVLETLAAGATQENEIVTNCME  294

Query  723   eheiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
               ++EK + EE+E+  E+ +  L+K+K+  + +I  L  EL++ K+T+  +CL+LE   +
Sbjct  295   RTKLEKNRIEERERSEEKDVVRLKKEKELSDAEIRKLKQELKVVKETHANQCLELEAQAQ  354

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
               ++EL +K+ + E  +  S +K  ELE    SK  KW++KE  Y+
Sbjct  355   NSKVELESKLKDAELQVAQSTRKVKELEKLYLSKSQKWEKKECTYQ  400



>emb|CDY34366.1| BnaA09g11080D [Brassica napus]
Length=1042

 Score =   114 bits (286),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 81/226 (36%), Positives = 134/226 (59%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E DI   KISEL+K  SL +A TR LF  +  +L+E++++ NG +   ++S
Sbjct  175   DGFQSKEGFEIDISDAKISELLKSNSLRNAPTRTLFDMLDKLLDESVKKMNGHVSHAMAS  234

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaae----------  722
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE KY+ + +  E L  GA +          
Sbjct  235   LLSALVQVIEQRISNQADNLKNQNILFRVREDKYRSRIKVLETLAAGATQENEIVTNCME  294

Query  723   eheiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
               ++EK + EE+E+  E+ +  L+K+K+  + +I  L  EL++ K+T+  +CL+LE   +
Sbjct  295   RTKLEKNRIEERERSEEKDVVRLKKEKELSDAEIRKLKQELKVVKETHANQCLELEAQAQ  354

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
               ++EL +K+   E  +  S +K  ELE    SK  KW++KE  Y+
Sbjct  355   NSKVELESKLKNAELQVAQSTRKVKELEKLYLSKSQKWEKKECTYQ  400



>ref|XP_006656157.1| PREDICTED: kinesin-4-like isoform X1 [Oryza brachyantha]
Length=972

 Score =   114 bits (285),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 90/273 (33%), Positives = 133/273 (49%), Gaps = 59/273 (22%)
 Frame = +3

Query  357   LSASNNHAGSKLPDVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENI  533
             LS+ + HAG    DVFQL+ GC  D+ + KISE+MK  SL+ A T+ L + V  IL+  I
Sbjct  40    LSSISRHAGHNFHDVFQLRQGCYFDLPSSKISEMMKSTSLDHAPTQSLLTVVNTILDGLI  99

Query  534   ERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
             ERKNG+I   V+ LL+ ++ EIE+R+S Q+E++R Q+N  K+RE+KY+ +    EAL +G
Sbjct  100   ERKNGEISYHVACLLRKIILEIERRISTQAEHIRNQNNLMKAREEKYKSRITVLEALASG  159

Query  714   aaeeheiekakseekekhreQIICMLQKDKDHH-------EMQISSLNHELELCKKTYEG  872
                +  ++      K               DHH       +  I  LN ELE  K +YE 
Sbjct  160   TGRQTHVKSCAENGKAHVSA----------DHHMNEKEESKDTIMKLNQELEALKSSYEE  209

Query  873   KCLQLE----------------------------------THLEKMRI-------ELGNK  929
               + LE                                  TH+++M         +L  K
Sbjct  210   TNIMLESKKKEVLQLLMDKENIDYTVSQLKQDLAIERSHQTHIQEMETRALQAHKKLEKK  269

Query  930   IMELECLLTDSKKKADELEAFSESKLLKWKRKE  1028
             IME+E  L DSK +  ++E   ES+   W++KE
Sbjct  270   IMEMEHRLEDSKSRTRDIEELLESRRQAWEQKE  302



>ref|NP_001044222.1| Os01g0744000 [Oryza sativa Japonica Group]
 dbj|BAD87516.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAD87915.1| putative kinesin heavy chain [Oryza sativa Japonica Group]
 dbj|BAF06136.1| Os01g0744000 [Oryza sativa Japonica Group]
Length=971

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 82/232 (35%), Positives = 135/232 (58%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K+ +V Q K G   D+ A KISE++   SL++A T+ L   V  IL+E+IERK G+I
Sbjct  169   SGQKINEVVQFKHGTYTDLPAAKISEMLHSNSLDNAPTQSLLRVVNGILDESIERKRGEI  228

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE R+  Q++++R Q++  K+RE KY+ K +A E L  G  EE+E+
Sbjct  229   PHRVVHLLRNVIQEIEHRIGIQADHIRNQNSIIKTREDKYRSKIKALETLVNGTNEENEM  288

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + E  +  + +I          +  L ++K++ E  I+SL+ E+++  + +E    Q
Sbjct  289   AINRLEVVKVEKSKIDEKRKLGEQDMIRLIREKENAENIIASLHQEMQVMNRMHEQFREQ  348

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +ET   +M   L  +  E E  L  SKKK +E+EA S+ K   W +K ++++
Sbjct  349   METKARQMEEHLTLRAKEAEFCLMQSKKKVEEVEATSQLKSQLWSKKANIFQ  400



>emb|CDY62807.1| BnaCnng41050D [Brassica napus]
Length=1067

 Score =   113 bits (282),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 82/226 (36%), Positives = 133/226 (59%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K   E DI   KISEL+K  SL +A TR LF  +  +L+E +++ NG +   ++S
Sbjct  163   DGFQSKEESEIDISDAKISELLKSNSLRNAPTRSLFDMLEQLLDECVKKMNGHVSHAMAS  222

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiek----  740
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE+KY+ + +  E L  G  +E+EI      
Sbjct  223   LLSALVQVIEQRISNQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTQENEIVTNCME  282

Query  741   ------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
                    + EE+E+  E+ +  L+ +K+  + +I  L  EL+L K+T+E +CL+LE   +
Sbjct  283   HIKLEKTRIEERERAEEKDVVHLKMEKERTDAEICKLKQELKLVKETHENQCLELEAKAQ  342

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
               ++EL  K+ + E  + DS +K  ELE   +S   KWK+KE  Y+
Sbjct  343   HDKVELEKKLKDAELQVVDSTRKIKELEKLCQSNSQKWKKKECTYQ  388



>gb|EEC71463.1| hypothetical protein OsI_03702 [Oryza sativa Indica Group]
Length=938

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/232 (35%), Positives = 135/232 (58%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K+ +V Q K G   D+ A KISE++   SL++A T+ L   V  IL+E+IERK G+I
Sbjct  169   SGQKINEVVQFKHGTYTDLPAAKISEMLHSNSLDNAPTQSLLRVVNGILDESIERKRGEI  228

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE R+  Q++++R Q++  K+RE KY+ K +A E L  G  EE+E+
Sbjct  229   PHRVVHLLRNVIQEIEHRIGIQADHIRNQNSIIKTREDKYRSKIKALETLVNGTNEENEM  288

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + E  +  + +I          +  L ++K++ E  I+SL+ E+++  + +E    Q
Sbjct  289   AINRLEVVKVEKSKIDEKRKLGEQDMIRLIREKENAENIIASLHQEMQVMNRMHEQFREQ  348

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +ET   +M   L  +  E E  L  SKKK +E+EA S+ K   W +K ++++
Sbjct  349   METKSRQMEEHLTLRAKEAEFCLMQSKKKVEEVEATSQLKSQLWSKKANIFQ  400



>ref|XP_007160373.1| hypothetical protein PHAVU_002G316200g [Phaseolus vulgaris]
 gb|ESW32367.1| hypothetical protein PHAVU_002G316200g [Phaseolus vulgaris]
Length=1053

 Score =   112 bits (281),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/214 (37%), Positives = 132/214 (62%), Gaps = 2/214 (1%)
 Frame = +3

Query  345  MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
            MA+  ++  ++ G    +VFQLK G   D+ A  ISE+M   S+++A T+ L S V  IL
Sbjct  71   MAEPSASLIHYVGHNFHEVFQLKPGSYADLPAENISEMMNSNSIDNAPTQSLLSVVNGIL  130

Query  522  NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             E++ER+NG+IP  V+ LL+ V QEIE+R+S Q+E+LR Q+N +K+RE+KYQ + R  E 
Sbjct  131  EESVERRNGEIPHRVACLLRKVSQEIERRMSTQAEHLRTQNNLFKAREEKYQSRIRVLET  190

Query  702  LRTGaaeeheiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCL  881
            L +   +E E +  K EEK    ++++ ++ K++   +M+IS+L  ELE  K+ +  +  
Sbjct  191  LASETKDESEGKWVKEEEKRVDEKEVVRLI-KEQKSKKMEISALKIELETAKRRHVVQFE  249

Query  882  QLETHLEKMRIELGNKIMELECLLTDSKKKADEL  983
            QLE   +  + EL + + E +  + + K KA+ +
Sbjct  250  QLEEEAKGAKAELTHMVHEYKQQIEELKNKAESM  283



>emb|CAZ40331.1| putative kinesin-like protein [Raphanus sativus]
Length=1045

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 77/226 (34%), Positives = 129/226 (57%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E D    KISEL+K  SL +A TR LF  +  +L+E++++ NG +   ++S
Sbjct  145   DGFQSKEGFEIDTSDAKISELLKSDSLRNAPTRTLFDMLDKLLDESVKKMNGHVSHAMAS  204

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakse  752
             LL  ++Q IEQR+S Q++NL+ Q+  ++ RE KY+ + +  E L  GA +E+EI     E
Sbjct  205   LLSALVQVIEQRISNQADNLKNQNILFRVREDKYRSRIKVLETLAAGATQENEIVSNCME  264

Query  753   ekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
               +  + +I          +  L+K+K+  + +I  L  EL++ K+ +  +CL+LE   +
Sbjct  265   RTKLEKSRIEEREKSEEKDVVRLKKEKERSDAEIRKLKQELKVVKEAHANQCLELEAKAQ  324

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
                +EL +K+ + E  + +S +K  ELE    SK  KW+ +E  Y+
Sbjct  325   NSTVELESKLKDAELQVAESTRKVKELEKLYLSKSQKWENRESTYQ  370



>emb|CDY45358.1| BnaA09g12430D [Brassica napus]
Length=1063

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 76/226 (34%), Positives = 134/226 (59%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K   + DI   KI+EL+K  SL +A TR LF  +  +L+E++++ NG +   ++S
Sbjct  160   DGFQSKEESDIDISDAKIAELLKSNSLRNAPTRSLFDMLEQLLDESVKKMNGHVSHAMAS  219

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiek----  740
             LL  ++Q IEQR++ Q++NL+ Q+  ++ RE+KY+ + +  E L  G  +E+EI      
Sbjct  220   LLSALVQVIEQRITNQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTQENEIVTNCME  279

Query  741   ------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
                    + EE+E+  E+ +  L+++K+  + +I  L  EL++ K+T+E +C +LE   +
Sbjct  280   HIKLEKTRIEERERSEEKDVVHLKREKERTDAEIRKLKQELKMVKETHENQCWELEAKAQ  339

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
               ++E+  K+ + E  + DS +K  ELE   +SK   WK+KE  Y+
Sbjct  340   NDKVEMEKKLKDAELQVADSTRKVKELEKLCQSKSQNWKKKESTYQ  385



>gb|EEE55367.1| hypothetical protein OsJ_03421 [Oryza sativa Japonica Group]
Length=1317

 Score =   112 bits (280),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 82/232 (35%), Positives = 135/232 (58%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K+ +V Q K G   D+ A KISE++   SL++A T+ L   V  IL+E+IERK G+I
Sbjct  163   SGQKINEVVQFKHGTYTDLPAAKISEMLHSNSLDNAPTQSLLRVVNGILDESIERKRGEI  222

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE R+  Q++++R Q++  K+RE KY+ K +A E L  G  EE+E+
Sbjct  223   PHRVVHLLRNVIQEIEHRIGIQADHIRNQNSIIKTREDKYRSKIKALETLVNGTNEENEM  282

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + E  +  + +I          +  L ++K++ E  I+SL+ E+++  + +E    Q
Sbjct  283   AINRLEVVKVEKSKIDEKRKLGEQDMIRLIREKENAENIIASLHQEMQVMNRMHEQFREQ  342

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +ET   +M   L  +  E E  L  SKKK +E+EA S+ K   W +K ++++
Sbjct  343   METKARQMEEHLTLRAKEAEFCLMQSKKKVEEVEATSQLKSQLWSKKANIFQ  394



>ref|XP_009112751.1| PREDICTED: kinesin-4-like isoform X1 [Brassica rapa]
Length=1060

 Score =   112 bits (279),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/226 (34%), Positives = 134/226 (59%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K   + DI   KI+EL+K  SL +A TR LF  +  +L+E++++ NG +   ++S
Sbjct  162   DGFQSKEESDIDISDAKIAELLKSNSLRNAPTRSLFDMLEQLLDESVKKMNGHVSHAMAS  221

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiek----  740
             LL  ++Q IEQR++ Q++NL+ Q+  ++ RE+KY+ + +  E L  G  +E+EI      
Sbjct  222   LLSALVQVIEQRITNQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTQENEIVTNCME  281

Query  741   ------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
                    + EE+E+  E+ +  L+++K+  + +I  L  EL++ K+T+E +C +LE   +
Sbjct  282   HIKLEKTRIEERERSEEKDVVHLKREKERTDAEIRKLKQELKMVKETHENQCWELEAKAQ  341

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
               ++E+  K+ + E  + DS +K  ELE   +SK   WK+KE  Y+
Sbjct  342   NDKVEMEKKLKDAELQVADSTRKVKELEKLCQSKSQNWKKKESTYQ  387



>ref|XP_009112752.1| PREDICTED: kinesin-4-like isoform X2 [Brassica rapa]
Length=1059

 Score =   112 bits (279),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 76/226 (34%), Positives = 134/226 (59%), Gaps = 11/226 (5%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K   + DI   KI+EL+K  SL +A TR LF  +  +L+E++++ NG +   ++S
Sbjct  162   DGFQSKEESDIDISDAKIAELLKSNSLRNAPTRSLFDMLEQLLDESVKKMNGHVSHAMAS  221

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiek----  740
             LL  ++Q IEQR++ Q++NL+ Q+  ++ RE+KY+ + +  E L  G  +E+EI      
Sbjct  222   LLSALVQVIEQRITNQADNLKNQNILFRVREEKYRSRIKVLETLAAGTTQENEIVTNCME  281

Query  741   ------akseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLE  902
                    + EE+E+  E+ +  L+++K+  + +I  L  EL++ K+T+E +C +LE   +
Sbjct  282   HIKLEKTRIEERERSEEKDVVHLKREKERTDAEIRKLKQELKMVKETHENQCWELEAKAQ  341

Query  903   KMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
               ++E+  K+ + E  + DS +K  ELE   +SK   WK+KE  Y+
Sbjct  342   NDKVEMEKKLKDAELQVADSTRKVKELEKLCQSKSQNWKKKESTYQ  387



>ref|XP_002893001.1| hypothetical protein ARALYDRAFT_335100 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69260.1| hypothetical protein ARALYDRAFT_335100 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   112 bits (279),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
            H G K  + FQ+K    D+ A KISELMK  +L++A T+ L S V  IL+E IERKNG+I
Sbjct  50   HGGHKSHEAFQMKQCRFDLQAAKISELMKSNNLDNAPTQSLLSIVNGILDETIERKNGEI  109

Query  555  PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
            PQ V+SLL+ V+QEIE+R+S QSE+LR Q++ +K+RE+KYQ + +  E L +G
Sbjct  110  PQRVASLLRKVVQEIERRISTQSEHLRTQNSVFKAREEKYQSRIKVLETLASG  162



>ref|XP_006644693.1| PREDICTED: kinesin-4-like [Oryza brachyantha]
Length=928

 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 82/232 (35%), Positives = 134/232 (58%), Gaps = 11/232 (5%)
 Frame = +3

Query  378   AGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G  + +V Q K G   D+ A KISE++   SL++A T+ L   V  IL+E+IERK G+I
Sbjct  121   SGQMVNEVVQFKQGSYMDLPAAKISEMLHSNSLDNAPTQSLLRVVNGILDESIERKRGEI  180

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE R+  Q++++R Q++  K+RE KY+ K +A E L  G  EE+EI
Sbjct  181   PHRVVHLLRNVIQEIEHRICIQADHIRNQNSITKTREDKYRSKIKALETLVNGTNEENEI  240

Query  735   ekakseekekhreQI----------ICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQ  884
                + E  +  + +I          +  L ++K++ E  I+SL+ E+++  + +E    Q
Sbjct  241   AINRLEVVKVEKTKIDEKRKLGEQDMIRLMREKENAETIINSLHQEIQVMTRMHEQLREQ  300

Query  885   LETHLEKMRIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             +ET   +M   L  +  E E  L  SKKK +E+EA S+ K   W +K ++++
Sbjct  301   METKARQMEEHLSLRAKEAEFCLMQSKKKVEEVEAASQLKSQLWSKKANIFQ  352



>gb|EYU38173.1| hypothetical protein MIMGU_mgv1a025662mg, partial [Erythranthe 
guttata]
Length=986

 Score =   110 bits (274),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 75/165 (45%), Positives = 109/165 (66%), Gaps = 4/165 (2%)
 Frame = +3

Query  372  NHAGSKLPDVFQLK-IGCEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
            NH G K  +VFQ K +   D     ISE+MK  S +++ T+ L S +  IL+E+IE+KNG
Sbjct  211  NHVGHKFHEVFQFKQVSYTDA---NISEMMKSNSFDNSPTQSLLSVINGILDESIEQKNG  267

Query  549  DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeh  728
            +IP  V+ LL+ V+QEIE+R+  Q+E+LR Q+N +K+RE+KYQ + R  EAL TG ++E 
Sbjct  268  EIPHRVACLLRKVVQEIERRICTQAEHLRTQNNIFKAREEKYQSRIRVLEALATGTSDET  327

Query  729  eiekakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKT  863
            + EK K EEK+K  EQ +  L K+KD    +IS+L  +L+   KT
Sbjct  328  QNEKNKIEEKKKAEEQEMARLMKEKDDLNQEISNLKQQLQDIAKT  372



>gb|EMS55440.1| Kinesin-4 [Triticum urartu]
Length=964

 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 86/121 (71%), Gaps = 1/121 (1%)
 Frame = +3

Query  354  ELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNEN  530
            ELS++  HAG    +VFQL+ G   D+ + KIS++MK  SL++A T+ L S V  IL+E 
Sbjct  83   ELSSTARHAGRNFHEVFQLRQGGYSDLPSSKISDMMKSTSLDNAPTQSLLSVVNGILDEI  142

Query  531  IERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRT  710
            IERKNG+IP  ++ LL+ ++ E+E+R+S Q+E++R Q+N  K+RE+KY+ + R  EAL +
Sbjct  143  IERKNGEIPYHLAFLLRKIILEVERRISTQAEHIRNQNNLMKAREEKYKSRIRVLEALAS  202

Query  711  G  713
            G
Sbjct  203  G  203



>ref|XP_007152758.1| hypothetical protein PHAVU_004G157000g [Phaseolus vulgaris]
 gb|ESW24752.1| hypothetical protein PHAVU_004G157000g [Phaseolus vulgaris]
Length=1143

 Score =   107 bits (266),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 126/220 (57%), Gaps = 39/220 (18%)
 Frame = +3

Query  345  MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLE-----SASTRLLFSA  506
            MA+  +      G K P+VF+LK G   D+ + KISELMK  SL+     +A T+ L S 
Sbjct  47   MAEPSTTLITQVGHKFPEVFRLKQGSYADLPSTKISELMKSTSLDHLLLQNAPTQSLLSV  106

Query  507  VGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKD  686
            V  IL E++ER+NG+IP  V+ LL+ V+QEIE+R+S Q+E+L+ Q+N +K+RE+KY  + 
Sbjct  107  VNGILEESVERRNGEIPHRVACLLRKVVQEIERRISTQAEHLKTQNNIFKAREEKYHSRI  166

Query  687  RAYEALRTGaaeeheiekakseekekh--------------------------------r  770
            R  EAL +G  EE+EIE+ K EEK+                                   
Sbjct  167  RVLEALASGTEEENEIERVKKEEKKVDGLKQTRMNKMEEEKENDMKLVENTKREEKRECD  226

Query  771  eQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLE  890
            +++I  +++ KD   ++IS+L  +LE  KKTYE +C Q+E
Sbjct  227  KEVIRYIKELKDKT-VEISTLKQKLETMKKTYEVQCSQME  265



>gb|EMS66550.1| Kinesin-4 [Triticum urartu]
Length=875

 Score =   105 bits (263),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 76/224 (34%), Positives = 118/224 (53%), Gaps = 31/224 (14%)
 Frame = +3

Query  378   AGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDI  554
             +G K  +VFQ K G   D+ A KISE+++  SL++A T+ L   V  IL+E+IERK G+I
Sbjct  210   SGQKANEVFQFKRGQYTDLPAAKISEMIQSNSLDNAPTQSLLRVVNGILDESIERKRGEI  269

Query  555   PQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeehei  734
             P  V  LL+ V+QEIE R+S Q+E++R Q++  K+RE KY+ K +A E L  G       
Sbjct  270   PHRVVYLLRNVVQEIEHRISIQAEHIRNQNSIIKTREDKYRSKIKALETLVNGT------  323

Query  735   ekakseekekhreQIICMLQKDKDHHEMQISSLN--HELELCKKTYEGKCLQLETHLEKM  908
                                    + +EM I+ L    E+++  + +E    Q+E    +M
Sbjct  324   ----------------------NEENEMAINRLELVKEIQVMSRMFEEYREQMEEKTSQM  361

Query  909   RIELGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
                L  +  E E LL  SKK+ +E+E  SE +   W +K + ++
Sbjct  362   EEHLTLRAKEAEFLLMQSKKRVEEVETASELQSQLWSKKANTFR  405



>gb|AAF19694.1|AC008047_1 F2K11.1 [Arabidopsis thaliana]
Length=1109

 Score =   105 bits (263),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 78/216 (36%), Positives = 125/216 (58%), Gaps = 6/216 (3%)
 Frame = +3

Query  396   DVFQLKIGCE-DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSS  572
             D FQ K G E D+   KIS+L+K  SL +A TR LF  +  +L+E++ + NG +   ++S
Sbjct  167   DGFQSKEGSEIDMSDAKISDLLKSNSLRNAPTRSLFDMLDKLLDESMTKMNGHVSHAMAS  226

Query  573   LLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakse  752
             LL  ++Q IEQR+S Q++NL+   N        +  K +     R        +EK + E
Sbjct  227   LLSALVQVIEQRISNQADNLKNVKNKGLRILGSWDNKGK-----RGTIVTGSSLEKTRIE  281

Query  753   ekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKI  932
             EKE+  E+ +  L+K+K+  + +I  L  EL+L K+T+E +CL+LE   +K R EL  K+
Sbjct  282   EKERSEEKDVVRLRKEKERSDAEIRQLKQELKLVKETHENQCLELEAKAQKTRDELEKKL  341

Query  933   MELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
              + E  + DS +K  ELE   +SK  +W++KE +Y+
Sbjct  342   KDAELHVVDSSRKVKELEKLCQSKSQRWEKKECIYQ  377



>ref|XP_010227619.1| PREDICTED: kinesin-4-like isoform X2 [Brachypodium distachyon]
Length=1117

 Score =   104 bits (260),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGD  551
            HAGS   +VFQL++G   D+ + +IS++MK  SL +A T+ L S V  IL+E IER NG+
Sbjct  100  HAGSNFHEVFQLRLGGYSDLPSSRISDMMKSTSLNNAPTQSLLSVVNGILDETIERNNGE  159

Query  552  IPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
            IP  ++ LL+ ++ EIE+R+S Q+E++R Q+N  K+RE+KY+ + R  EAL +G
Sbjct  160  IPYNLACLLRKIVLEIERRISTQAEHIRNQNNLMKAREEKYRSRIRVLEALASG  213



>ref|XP_010227618.1| PREDICTED: kinesin-4-like isoform X1 [Brachypodium distachyon]
Length=1126

 Score =   104 bits (260),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGD  551
            HAGS   +VFQL++G   D+ + +IS++MK  SL +A T+ L S V  IL+E IER NG+
Sbjct  100  HAGSNFHEVFQLRLGGYSDLPSSRISDMMKSTSLNNAPTQSLLSVVNGILDETIERNNGE  159

Query  552  IPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
            IP  ++ LL+ ++ EIE+R+S Q+E++R Q+N  K+RE+KY+ + R  EAL +G
Sbjct  160  IPYNLACLLRKIVLEIERRISTQAEHIRNQNNLMKAREEKYRSRIRVLEALASG  213



>ref|XP_010227621.1| PREDICTED: kinesin-4-like isoform X4 [Brachypodium distachyon]
Length=1103

 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGD  551
            HAGS   +VFQL++G   D+ + +IS++MK  SL +A T+ L S V  IL+E IER NG+
Sbjct  100  HAGSNFHEVFQLRLGGYSDLPSSRISDMMKSTSLNNAPTQSLLSVVNGILDETIERNNGE  159

Query  552  IPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
            IP  ++ LL+ ++ EIE+R+S Q+E++R Q+N  K+RE+KY+ + R  EAL +G
Sbjct  160  IPYNLACLLRKIVLEIERRISTQAEHIRNQNNLMKAREEKYRSRIRVLEALASG  213



>ref|XP_006405368.1| hypothetical protein EUTSA_v10027635mg [Eutrema salsugineum]
 gb|ESQ46821.1| hypothetical protein EUTSA_v10027635mg [Eutrema salsugineum]
Length=921

 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 67/221 (30%), Positives = 118/221 (53%), Gaps = 27/221 (12%)
 Frame = +3

Query  384   SKLPDVFQLKIGCEDILA--YKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIP  557
             S   D  Q K G + I     KI +L+K  SL++ STR LF  +  +L E++++ N D+ 
Sbjct  150   SNFNDGLQFKEGSDQISISHAKILDLLKSNSLQNTSTRSLFDMLDKLLYESVQKMNVDVS  209

Query  558   QCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheie  737
                +S+L+ ++Q +EQR+S Q+ENL+ Q+  ++ RE+KY+ +    E L +G        
Sbjct  210   HTFASILRGIVQVVEQRISNQAENLKNQNILFRVREEKYRSRINVLETLASG--------  261

Query  738   kakseekekhreQIICMLQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIE  917
                              +  + +  + ++S L  ELE+ K+T+E + L+LE++  K + E
Sbjct  262   -----------------ITDENELSDAELSKLKQELEIVKETHEKEMLELESNARKAKTE  304

Query  918   LGNKIMELECLLTDSKKKADELEAFSESKLLKWKRKEHVYK  1040
             L  ++ + E  +  S +K  ELE   E+K  +W++KE  YK
Sbjct  305   LEKQLEDSELRVVGSTEKVKELEKLCETKTKRWEKKEQTYK  345



>ref|XP_010227620.1| PREDICTED: kinesin-4-like isoform X3 [Brachypodium distachyon]
Length=1105

 Score =   104 bits (259),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 81/114 (71%), Gaps = 1/114 (1%)
 Frame = +3

Query  375  HAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGD  551
            HAGS   +VFQL++G   D+ + +IS++MK  SL +A T+ L S V  IL+E IER NG+
Sbjct  100  HAGSNFHEVFQLRLGGYSDLPSSRISDMMKSTSLNNAPTQSLLSVVNGILDETIERNNGE  159

Query  552  IPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
            IP  ++ LL+ ++ EIE+R+S Q+E++R Q+N  K+RE+KY+ + R  EAL +G
Sbjct  160  IPYNLACLLRKIVLEIERRISTQAEHIRNQNNLMKAREEKYRSRIRVLEALASG  213



>gb|KJB39302.1| hypothetical protein B456_007G005900 [Gossypium raimondii]
 gb|KJB39303.1| hypothetical protein B456_007G005900 [Gossypium raimondii]
Length=935

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 79/115 (69%), Gaps = 1/115 (1%)
 Frame = +3

Query  372  NHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNG  548
            +H G    +VFQ K G   D+   KISE+MK  SL++A T+ L S V  IL+E+++RKNG
Sbjct  62   HHGGHNFHEVFQWKQGRYADLPGAKISEMMKSNSLDNAPTQSLLSVVNGILDESLDRKNG  121

Query  549  DIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
            +IP  V+ LL+ V+QEIE+R+S Q+++LR Q+N +K RE+KY+ + R  E L  G
Sbjct  122  EIPHRVACLLRKVVQEIERRISTQADHLRTQNNLFKIREEKYKSRIRVLETLAAG  176


 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = +3

Query  789   LQKDKDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKK  968
             ++++ + H  +I+SL  ELE+ K  +E +CL+++   E ++  L  ++ ELE LL DS  
Sbjct  261   IKQETEKHIREIASLKQELEMAKTIHEQQCLEMQKETEGVKAGLQARLNELESLLNDSNN  320

Query  969   KADELEAFSESKLLKWKRKEHVYK  1040
             +  ELE  ++SK   W  K + Y+
Sbjct  321   RVKELETSAKSKCQSWSMKVNTYQ  344



>ref|XP_009140202.1| PREDICTED: LOW QUALITY PROTEIN: kinesin-4 [Brassica rapa]
Length=993

 Score =   103 bits (257),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/200 (33%), Positives = 116/200 (58%), Gaps = 9/200 (5%)
 Frame = +3

Query  441   KISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQ  620
             KI +L+K  +L++ STR LF  +  +L+E++ + N D+    +S+L+ ++Q +EQR+S Q
Sbjct  183   KILDLLKSNTLQNTSTRSLFDMLDKLLDESVSKMNVDVSHDFASILRGIVQVVEQRISNQ  242

Query  621   SENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQIICMLQKD  800
             +ENL+ Q+  ++ RE+KY+ +    E L +G            E +    EQ +  L++ 
Sbjct  243   AENLKNQNILFRVREEKYRSRINVLENLASG---------TTDENELGSEEQDVLQLKRK  293

Query  801   KDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADE  980
             K+  + ++S L  EL++ K+T+E + L+LE + ++ +  L  ++ E E  + DS  K  E
Sbjct  294   KERSDAELSKLKKELQVLKETHEKQFLELELYAQEAKTVLEKQLEESELRVVDSTNKVKE  353

Query  981   LEAFSESKLLKWKRKEHVYK  1040
             LE F E K   W++KE  YK
Sbjct  354   LEKFCEIKTKIWEKKEQTYK  373



>gb|AES76706.2| P-loop nucleoside triphosphate hydrolase superfamily protein 
[Medicago truncatula]
Length=854

 Score =   103 bits (256),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 83/124 (67%), Gaps = 1/124 (1%)
 Frame = +3

Query  345  MAKELSASNNHAGSKLPDVFQLKIGC-EDILAYKISELMKQKSLESASTRLLFSAVGDIL  521
            M +   A  N  G+K  + FQ K G   D+ + KISELMK  SL++A T+ L S V  IL
Sbjct  47   MTEPPGALINQVGNKFYEAFQQKHGSYVDLPSAKISELMKSSSLDNAPTQSLLSVVNGIL  106

Query  522  NENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEA  701
             E++ER+NG+IP  V+ LL+ V+QEIE+R+S Q E+L+ Q+N +K+RE+KY+ +    EA
Sbjct  107  EESVERRNGEIPPRVACLLRKVVQEIERRISTQQEHLKTQNNLFKTREEKYKSRITVLEA  166

Query  702  LRTG  713
            L +G
Sbjct  167  LASG  170



>emb|CDY46382.1| BnaC04g33010D [Brassica napus]
Length=916

 Score =   102 bits (254),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/200 (33%), Positives = 116/200 (58%), Gaps = 9/200 (5%)
 Frame = +3

Query  441   KISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQ  620
             KI +L+K  +L++ STR LF  +  +L+E++ + N D+    +S+L+ ++Q +EQR+S Q
Sbjct  183   KILDLLKSNTLQNTSTRSLFDMLDKLLDESVYKMNVDVSHDFASILRGIVQVVEQRISNQ  242

Query  621   SENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQIICMLQKD  800
             +ENL+ Q+  ++ RE+KY+ +    E L +G            E + +  EQ +  L++ 
Sbjct  243   AENLKNQNILFRVREEKYRSRINVLENLASG---------TTDENELRSEEQDVLQLKRK  293

Query  801   KDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADE  980
             K+  + ++S L  ELE+ K+T+E + L+LE + ++ +  L  ++ E E  + DS  K  E
Sbjct  294   KERSDAELSKLKQELEVLKETHEKQFLELELYAQEAKTVLEKQLEESELRVVDSTNKVKE  353

Query  981   LEAFSESKLLKWKRKEHVYK  1040
             LE   E K   W++KE  YK
Sbjct  354   LEKLCEIKTKIWEKKEQTYK  373



>emb|CDY39749.1| BnaA04g11040D [Brassica napus]
Length=954

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/200 (32%), Positives = 114/200 (57%), Gaps = 9/200 (5%)
 Frame = +3

Query  441   KISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQRVSKQ  620
             KI +L+K  +L++ STR LF  +  + +E++ + N D+    +S+L+ ++Q +EQR+S Q
Sbjct  183   KILDLLKSNTLQNTSTRSLFDMLDKLFDESVSKMNVDVSHDFASILRGIVQVVEQRISNQ  242

Query  621   SENLRKQHNSYKSREQKYQLKDRAYEALRTGaaeeheiekakseekekhreQIICMLQKD  800
             +ENL+ Q+  ++ RE+KY+ +    E L +G            E +    EQ +  L++ 
Sbjct  243   AENLKNQNILFRVREEKYRSRINVLENLASG---------TTDENELGSEEQDVLQLKRK  293

Query  801   KDHHEMQISSLNHELELCKKTYEGKCLQLETHLEKMRIELGNKIMELECLLTDSKKKADE  980
             K+  + ++S L  EL++ K+T+E + L+LE + ++ +  L  ++ E E  + DS  K  E
Sbjct  294   KERSDAELSKLKQELQVLKETHEKQFLELELYAQETKTVLEKQLEESELRVVDSTNKVKE  353

Query  981   LEAFSESKLLKWKRKEHVYK  1040
             LE   E K   W++KE  YK
Sbjct  354   LEKLCEIKTKIWEKKEQTYK  373



>ref|XP_004512927.1| PREDICTED: kinesin-5-like isoform X2 [Cicer arietinum]
Length=1092

 Score =   100 bits (249),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/96 (53%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  426  DILAYKISELMKQKSLESASTRLLFSAVGDILNENIERKNGDIPQCVSSLLKLVLQEIEQ  605
            D+ A KISELMK   L++A T+ L S V  IL E++ER+NG+IPQ V+ LL+ V+QEIE+
Sbjct  65   DLPAAKISELMKSSCLDNAPTQSLLSVVNGILEESVERRNGEIPQRVACLLRKVVQEIER  124

Query  606  RVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
            R+S Q E+LR Q+N +K+RE+KYQ + R  E L +G
Sbjct  125  RISTQQEHLRTQNNIFKTREEKYQSRIRVLETLASG  160



>gb|EEE65873.1| hypothetical protein OsJ_21674 [Oryza sativa Japonica Group]
Length=1136

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +3

Query  357  LSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENI  533
            LS+ + HAG    DVFQL+ G   D+ + KISE+MK  SL++A T+ L S V  IL+E +
Sbjct  128  LSSISRHAGHSFHDVFQLRQGRYSDLPSSKISEMMKSTSLDNAPTQSLLSVVNVILDELV  187

Query  534  ERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
            E K G+IP  ++ LL+ V+ EIE+R+S Q+E++R Q+N  K+RE+KY+ + R  EAL +G
Sbjct  188  ETKIGEIPYHLACLLRKVILEIERRISTQAEHIRNQNNLMKAREEKYKSRIRVLEALASG  247



>gb|EEC80804.1| hypothetical protein OsI_23351 [Oryza sativa Indica Group]
Length=1192

 Score =   100 bits (248),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = +3

Query  357  LSASNNHAGSKLPDVFQLKIG-CEDILAYKISELMKQKSLESASTRLLFSAVGDILNENI  533
            LS+ + HAG    DVFQL+ G   D+ + KISE+MK  SL++A T+ L S V  IL+E +
Sbjct  184  LSSISRHAGHSFHDVFQLRQGRYSDLPSSKISEMMKSTSLDNAPTQSLLSVVNVILDELV  243

Query  534  ERKNGDIPQCVSSLLKLVLQEIEQRVSKQSENLRKQHNSYKSREQKYQLKDRAYEALRTG  713
            E K G+IP  ++ LL+ V+ EIE+R+S Q+E++R Q+N  K+RE+KY+ + R  EAL +G
Sbjct  244  ETKIGEIPYHLACLLRKVILEIERRISTQAEHIRNQNNLMKAREEKYKSRIRVLEALASG  303



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2679384764527