BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8972

Length=663
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007215964.1|  hypothetical protein PRUPE_ppa011439mg             269   1e-87   
ref|XP_008387435.1|  PREDICTED: hexokinase-2-like                       271   3e-87   
ref|XP_009338735.1|  PREDICTED: hexokinase-1-like isoform X2            273   2e-86   Pyrus x bretschneideri [bai li]
ref|XP_009338734.1|  PREDICTED: hexokinase-1-like isoform X1            274   9e-86   Pyrus x bretschneideri [bai li]
ref|XP_008228416.1|  PREDICTED: hexokinase-1-like                       273   3e-85   Prunus mume [ume]
ref|XP_008458856.1|  PREDICTED: hexokinase-1-like isoform X2            271   2e-84   
gb|KDO66593.1|  hypothetical protein CISIN_1g010895mg                   264   2e-84   Citrus sinensis [apfelsine]
ref|XP_008458873.1|  PREDICTED: hexokinase-1-like isoform X3            271   3e-84   Cucumis melo [Oriental melon]
gb|ACJ04704.1|  hexokinase 1                                            270   3e-84   Cucumis melo [Oriental melon]
ref|XP_011648625.1|  PREDICTED: hexokinase-1-like                       269   7e-84   Cucumis sativus [cucumbers]
ref|XP_010915190.1|  PREDICTED: hexokinase-2-like                       269   1e-83   Elaeis guineensis
ref|XP_008387327.1|  PREDICTED: hexokinase-1-like                       269   1e-83   
ref|XP_008458849.1|  PREDICTED: hexokinase-1-like isoform X1            271   1e-83   Cucumis melo [Oriental melon]
ref|XP_006451308.1|  hypothetical protein CICLE_v10008086mg             263   2e-83   
gb|KDO66588.1|  hypothetical protein CISIN_1g010895mg                   263   3e-83   Citrus sinensis [apfelsine]
gb|KHN40379.1|  Hexokinase-2                                            267   5e-83   Glycine soja [wild soybean]
ref|XP_003516783.1|  PREDICTED: hexokinase-1-like                       267   5e-83   Glycine max [soybeans]
ref|XP_009406171.1|  PREDICTED: hexokinase-2-like                       266   1e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010267128.1|  PREDICTED: hexokinase-1-like                       266   1e-82   Nelumbo nucifera [Indian lotus]
ref|XP_010249484.1|  PREDICTED: hexokinase-1                            266   1e-82   Nelumbo nucifera [Indian lotus]
ref|XP_002283608.1|  PREDICTED: hexokinase-1-like                       266   1e-82   Vitis vinifera
gb|AFO84084.1|  hexokinase                                              266   1e-82   Actinidia deliciosa [Chinese gooseberry]
emb|CAN83149.1|  hypothetical protein VITISV_024177                     266   2e-82   Vitis vinifera
gb|KDO66582.1|  hypothetical protein CISIN_1g010895mg                   265   2e-82   Citrus sinensis [apfelsine]
ref|XP_006451309.1|  hypothetical protein CICLE_v10008086mg             263   2e-82   
gb|ADZ96378.1|  hexokinase 1                                            265   3e-82   Eriobotrya japonica [loquat]
gb|AHD25654.1|  hexokinase 1                                            265   4e-82   Camellia sinensis [black tea]
gb|KDO66587.1|  hypothetical protein CISIN_1g010895mg                   263   4e-82   Citrus sinensis [apfelsine]
ref|XP_008242483.1|  PREDICTED: hexokinase-1                            265   6e-82   Prunus mume [ume]
ref|NP_001275786.1|  hexokinase                                         264   8e-82   Citrus sinensis [apfelsine]
emb|CDP03250.1|  unnamed protein product                                263   2e-81   Coffea canephora [robusta coffee]
gb|AHB32106.1|  hexokinase                                              263   2e-81   Camellia sinensis [black tea]
ref|XP_009392524.1|  PREDICTED: hexokinase-2-like                       263   2e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003516735.1|  PREDICTED: hexokinase-1-like                       263   2e-81   Glycine max [soybeans]
gb|AEJ95926.1|  HXK1                                                    262   2e-81   Vitis vinifera
ref|XP_010098150.1|  hypothetical protein L484_026284                   263   3e-81   Morus notabilis
ref|XP_008380854.1|  PREDICTED: hexokinase-1-like isoform X2            259   3e-81   Malus domestica [apple tree]
ref|XP_007203872.1|  hypothetical protein PRUPE_ppa004637mg             262   4e-81   Prunus persica
ref|XP_009352555.1|  PREDICTED: hexokinase-1                            261   9e-81   Pyrus x bretschneideri [bai li]
ref|XP_011093636.1|  PREDICTED: hexokinase-1                            261   9e-81   Sesamum indicum [beniseed]
ref|XP_012076877.1|  PREDICTED: hexokinase-1-like                       261   1e-80   Jatropha curcas
ref|XP_009795017.1|  PREDICTED: hexokinase-2-like                       261   1e-80   Nicotiana sylvestris
gb|AID50967.1|  hexokinase 1                                            261   1e-80   Malus domestica [apple tree]
ref|XP_008337603.1|  PREDICTED: hexokinase-1-like                       261   2e-80   
ref|XP_007013021.1|  Hexokinase 1 isoform 2                             261   2e-80   Theobroma cacao [chocolate]
ref|XP_009415191.1|  PREDICTED: hexokinase-2-like                       260   3e-80   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHG98487.1|  hexokinase                                              260   3e-80   Dimocarpus longan [longan]
ref|XP_007152969.1|  hypothetical protein PHAVU_004G175500g             260   3e-80   Phaseolus vulgaris [French bean]
gb|AAS60196.1|  hexokinase 4b                                           260   3e-80   Nicotiana tabacum [American tobacco]
gb|KCW82328.1|  hypothetical protein EUGRSUZ_C03728                     255   4e-80   Eucalyptus grandis [rose gum]
ref|NP_001280783.1|  uncharacterized protein LOC103443741               259   4e-80   Malus domestica [apple tree]
gb|KHN40378.1|  Hexokinase-1                                            259   4e-80   Glycine soja [wild soybean]
gb|KCW82327.1|  hypothetical protein EUGRSUZ_C03728                     255   5e-80   Eucalyptus grandis [rose gum]
ref|XP_002514221.1|  hexokinase, putative                               259   6e-80   Ricinus communis
ref|XP_002299739.1|  hypothetical protein POPTR_0001s19130g             258   1e-79   Populus trichocarpa [western balsam poplar]
ref|XP_008795842.1|  PREDICTED: hexokinase-2-like isoform X2            258   1e-79   Phoenix dactylifera
ref|XP_008795834.1|  PREDICTED: hexokinase-2-like isoform X1            259   1e-79   Phoenix dactylifera
ref|XP_004302852.1|  PREDICTED: hexokinase-1-like                       258   2e-79   Fragaria vesca subsp. vesca
ref|XP_009777315.1|  PREDICTED: hexokinase-2                            258   2e-79   Nicotiana sylvestris
gb|AAS60194.1|  hexokinase 3                                            258   2e-79   Nicotiana tabacum [American tobacco]
ref|XP_011000949.1|  PREDICTED: hexokinase-1-like                       257   3e-79   Populus euphratica
gb|KCW82326.1|  hypothetical protein EUGRSUZ_C03728                     254   4e-79   Eucalyptus grandis [rose gum]
ref|XP_010110881.1|  hypothetical protein L484_006996                   253   6e-79   Morus notabilis
ref|XP_010688341.1|  PREDICTED: hexokinase-1                            256   8e-79   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006353497.1|  PREDICTED: hexokinase-1-like isoform X2            255   9e-79   Solanum tuberosum [potatoes]
gb|KJB83118.1|  hypothetical protein B456_013G230400                    252   9e-79   Gossypium raimondii
gb|AHY84731.1|  hexokinase                                              256   9e-79   Manihot esculenta [manioc]
ref|XP_002325031.1|  Hexokinase 1 family protein                        256   1e-78   Populus trichocarpa [western balsam poplar]
ref|XP_010049611.1|  PREDICTED: hexokinase-1-like                       256   1e-78   Eucalyptus grandis [rose gum]
ref|XP_010924444.1|  PREDICTED: hexokinase-2-like isoform X2            256   2e-78   Elaeis guineensis
gb|AAS60195.1|  hexokinase 4a                                           255   2e-78   Nicotiana tabacum [American tobacco]
ref|XP_009622660.1|  PREDICTED: hexokinase-2                            255   2e-78   Nicotiana tomentosiformis
ref|XP_006353496.1|  PREDICTED: hexokinase-1-like isoform X1            255   2e-78   Solanum tuberosum [potatoes]
gb|AAS60197.1|  hexokinase 5                                            255   3e-78   Nicotiana tabacum [American tobacco]
ref|XP_010924442.1|  PREDICTED: hexokinase-2-like isoform X1            256   3e-78   Elaeis guineensis
ref|XP_009601881.1|  PREDICTED: hexokinase-2-like                       255   3e-78   Nicotiana tomentosiformis
ref|XP_011008120.1|  PREDICTED: hexokinase-1-like                       254   3e-78   Populus euphratica
gb|KEH21333.1|  hexokinase                                              250   5e-78   Medicago truncatula
ref|XP_003529000.1|  PREDICTED: hexokinase-1-like                       254   5e-78   Glycine max [soybeans]
sp|Q9SEK2.1|HXK1_TOBAC  RecName: Full=Hexokinase-1; AltName: Full...    254   5e-78   Nicotiana tabacum [American tobacco]
ref|XP_009606563.1|  PREDICTED: hexokinase-1                            254   5e-78   Nicotiana tomentosiformis
ref|XP_011014418.1|  PREDICTED: hexokinase-1-like                       254   5e-78   Populus euphratica
ref|NP_001274841.1|  hexokinase-2                                       254   6e-78   Solanum tuberosum [potatoes]
gb|ABA01010.1|  hexokinase                                              254   6e-78   Solanum chacoense
gb|AAT77513.1|  hexokinase 3                                            254   7e-78   Nicotiana sylvestris
gb|KJB83117.1|  hypothetical protein B456_013G230400                    253   9e-78   Gossypium raimondii
ref|XP_003530493.1|  PREDICTED: hexokinase-1-like                       253   1e-77   Glycine max [soybeans]
gb|AAT77511.1|  hexokinase                                              250   1e-77   Nicotiana sylvestris
ref|XP_003525287.1|  PREDICTED: hexokinase-1-like                       253   1e-77   Glycine max [soybeans]
ref|XP_006299465.1|  hypothetical protein CARUB_v10015630mg             253   3e-77   Capsella rubella
ref|XP_004287480.1|  PREDICTED: hexokinase-1                            252   3e-77   Fragaria vesca subsp. vesca
gb|KHG22031.1|  Hexokinase-1                                            253   3e-77   Gossypium arboreum [tree cotton]
ref|XP_010322313.1|  PREDICTED: hexokinase isoform X1                   252   4e-77   Solanum lycopersicum
gb|EYU27268.1|  hypothetical protein MIMGU_mgv1a019208mg                252   4e-77   Erythranthe guttata [common monkey flower]
ref|NP_001234406.1|  hexokinase                                         252   4e-77   
gb|EYU45835.1|  hypothetical protein MIMGU_mgv1a005054mg                251   8e-77   Erythranthe guttata [common monkey flower]
ref|NP_001234710.1|  hexokinase                                         251   8e-77   Solanum lycopersicum
gb|AET05183.2|  hexokinase                                              251   9e-77   Medicago truncatula
ref|XP_009803252.1|  PREDICTED: hexokinase-1                            250   2e-76   Nicotiana sylvestris
ref|XP_010416617.1|  PREDICTED: hexokinase-2-like                       250   2e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010540986.1|  PREDICTED: hexokinase-1-like                       250   2e-76   Tarenaya hassleriana [spider flower]
ref|XP_007160283.1|  hypothetical protein PHAVU_002G308400g             250   2e-76   Phaseolus vulgaris [French bean]
ref|XP_010467922.1|  PREDICTED: hexokinase-2 isoform X1                 250   2e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010489125.1|  PREDICTED: hexokinase-2-like                       250   2e-76   Camelina sativa [gold-of-pleasure]
gb|KHG25517.1|  Hexokinase-1 -like protein                              250   2e-76   Gossypium arboreum [tree cotton]
ref|XP_007024321.1|  Hexokinase 2                                       250   2e-76   
ref|XP_006408903.1|  hypothetical protein EUTSA_v10001968mg             249   3e-76   Eutrema salsugineum [saltwater cress]
gb|KJB65034.1|  hypothetical protein B456_010G077400                    249   5e-76   Gossypium raimondii
ref|XP_004510315.1|  PREDICTED: hexokinase-1-like                       249   6e-76   Cicer arietinum [garbanzo]
sp|Q9SEK3.1|HXK1_SPIOL  RecName: Full=Hexokinase-1; AltName: Full...    249   6e-76   Spinacia oleracea
ref|XP_003630707.1|  Hexokinase                                         251   6e-76   
emb|CDO97969.1|  unnamed protein product                                248   1e-75   Coffea canephora [robusta coffee]
gb|AFO84083.1|  hexokinase                                              248   1e-75   Actinidia chinensis
ref|XP_004503491.1|  PREDICTED: hexokinase-1-like isoform X2            248   1e-75   Cicer arietinum [garbanzo]
gb|AAP40021.1|  hexokinase                                              248   2e-75   Nicotiana benthamiana
ref|XP_010447886.1|  PREDICTED: hexokinase-1                            247   2e-75   
gb|ABI18156.1|  hexokinase                                              247   2e-75   Helianthus annuus
ref|XP_010526433.1|  PREDICTED: hexokinase-1                            247   3e-75   Tarenaya hassleriana [spider flower]
ref|XP_002886018.1|  ATHXK2                                             247   3e-75   Arabidopsis lyrata subsp. lyrata
ref|XP_002515958.1|  hexokinase, putative                               246   4e-75   Ricinus communis
ref|XP_007013020.1|  Hexokinase 1 isoform 1                             247   5e-75   
gb|AHY84734.1|  hexokinase                                              246   8e-75   Manihot esculenta [manioc]
ref|XP_010047252.1|  PREDICTED: hexokinase-2-like                       246   1e-74   Eucalyptus grandis [rose gum]
gb|AAL60584.1|AF454962_1  hexokinase                                    245   1e-74   Brassica oleracea
gb|AAT77514.1|  hexokinase 4                                            241   1e-74   Nicotiana sylvestris
ref|XP_010433133.1|  PREDICTED: hexokinase-1-like                       245   2e-74   Camelina sativa [gold-of-pleasure]
ref|XP_010047667.1|  PREDICTED: hexokinase-1-like                       245   2e-74   Eucalyptus grandis [rose gum]
ref|NP_194642.1|  hexokinase 1                                          245   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002867423.1|  ATHXK1                                             245   2e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_010438337.1|  PREDICTED: hexokinase-1-like                       245   2e-74   Camelina sativa [gold-of-pleasure]
gb|AAO24584.1|  At2g19860                                               245   2e-74   Arabidopsis thaliana [mouse-ear cress]
ref|NP_179576.1|  hexokinase 2                                          245   2e-74   Arabidopsis thaliana [mouse-ear cress]
emb|CDY35895.1|  BnaA07g00920D                                          244   3e-74   Brassica napus [oilseed rape]
ref|XP_009102132.1|  PREDICTED: hexokinase-1                            244   3e-74   Brassica rapa
gb|AAL60583.1|AF454961_1  hexokinase                                    244   4e-74   Brassica oleracea
emb|CDY03331.1|  BnaC09g10170D                                          244   4e-74   
ref|XP_010915379.1|  PREDICTED: hexokinase-2-like                       244   7e-74   Elaeis guineensis
gb|KFK40349.1|  hypothetical protein AALP_AA3G362600                    243   8e-74   Arabis alpina [alpine rockcress]
gb|KFK29465.1|  hypothetical protein AALP_AA7G137600                    243   2e-73   Arabis alpina [alpine rockcress]
ref|XP_003627048.1|  Hexokinase                                         242   2e-73   Medicago truncatula
gb|KJB56835.1|  hypothetical protein B456_009G137700                    242   2e-73   Gossypium raimondii
ref|XP_006585566.1|  PREDICTED: hexokinase-1-like isoform X3            238   3e-73   
ref|XP_006343033.1|  PREDICTED: hexokinase-1-like                       242   3e-73   
ref|XP_006585567.1|  PREDICTED: hexokinase-1-like isoform X4            238   3e-73   
gb|AAT77515.1|  hexokinase 7                                            242   3e-73   Nicotiana tabacum [American tobacco]
sp|Q2KNB9.1|HXK2_ORYSJ  RecName: Full=Hexokinase-2; AltName: Full...    241   5e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006585565.1|  PREDICTED: hexokinase-1-like isoform X2            238   5e-73   
gb|KDO51805.1|  hypothetical protein CISIN_1g0115051mg                  231   5e-73   Citrus sinensis [apfelsine]
pdb|4QS7|A  Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure ...    240   6e-73   Arabidopsis thaliana [mouse-ear cress]
gb|KHG28915.1|  Hexokinase-1                                            241   7e-73   Gossypium arboreum [tree cotton]
gb|KJB70380.1|  hypothetical protein B456_011G070700                    241   7e-73   Gossypium raimondii
emb|CDY48733.1|  BnaA09g10080D                                          241   9e-73   Brassica napus [oilseed rape]
ref|XP_009112637.1|  PREDICTED: hexokinase-1-like                       241   9e-73   Brassica rapa
gb|AIX02984.1|  hexokinase                                              240   1e-72   Morella rubra [Chinese arbutus]
pdb|4QS9|A  Chain A, Arabidopsis Hexokinase 1 (athxk1) Mutant S17...    239   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001233957.1|  hexokinase                                         239   2e-72   Solanum lycopersicum
gb|EYU21451.1|  hypothetical protein MIMGU_mgv1a005070mg                239   2e-72   Erythranthe guttata [common monkey flower]
gb|EAY98804.1|  hypothetical protein OsI_20748                          239   2e-72   Oryza sativa Indica Group [Indian rice]
ref|XP_006285258.1|  hypothetical protein CARUB_v10006629mg             239   3e-72   Capsella rubella
ref|XP_003533038.1|  PREDICTED: hexokinase-1-like isoform X1            239   4e-72   Glycine max [soybeans]
ref|XP_012069075.1|  PREDICTED: hexokinase-1-like isoform X2            238   6e-72   Jatropha curcas
gb|KCW79624.1|  hypothetical protein EUGRSUZ_C00983                     237   9e-72   Eucalyptus grandis [rose gum]
ref|XP_006853711.1|  PREDICTED: hexokinase-1                            238   1e-71   Amborella trichopoda
ref|XP_011072439.1|  PREDICTED: hexokinase-1-like                       238   1e-71   Sesamum indicum [beniseed]
ref|XP_012069074.1|  PREDICTED: hexokinase-1-like isoform X1            237   2e-71   Jatropha curcas
ref|XP_010047255.1|  PREDICTED: hexokinase-2-like                       228   5e-71   
gb|EPS70676.1|  hexokinase 1a                                           235   1e-70   Genlisea aurea
dbj|BAJ89593.1|  predicted protein                                      235   1e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004135675.1|  PREDICTED: hexokinase-1-like                       235   1e-70   Cucumis sativus [cucumbers]
gb|EMT07302.1|  Hexokinase-2                                            234   1e-70   
gb|AAT47078.1|  unknown protein                                         243   2e-70   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001284452.1|  hexokinase-1-like                                  234   2e-70   Cucumis melo [Oriental melon]
ref|XP_008789199.1|  PREDICTED: hexokinase-2-like                       234   3e-70   
gb|KCW79126.1|  hypothetical protein EUGRSUZ_C005691                    228   6e-70   Eucalyptus grandis [rose gum]
ref|XP_004503490.1|  PREDICTED: hexokinase-1-like isoform X1            234   8e-70   
ref|XP_003568034.1|  PREDICTED: hexokinase-2 isoform X1                 232   1e-69   Brachypodium distachyon [annual false brome]
ref|XP_009394175.1|  PREDICTED: hexokinase-2-like                       232   1e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007135629.1|  hypothetical protein PHAVU_010G144900g             232   2e-69   Phaseolus vulgaris [French bean]
ref|XP_002283574.1|  PREDICTED: hexokinase-2                            231   6e-69   Vitis vinifera
ref|XP_010041948.1|  PREDICTED: hexokinase-1-like                       223   6e-69   
ref|XP_010232254.1|  PREDICTED: hexokinase-9-like isoform X2            229   7e-69   
ref|XP_006426867.1|  hypothetical protein CICLE_v10025452mg             230   8e-69   Citrus clementina [clementine]
ref|XP_003567061.1|  PREDICTED: hexokinase-9-like isoform X1            230   1e-68   Brachypodium distachyon [annual false brome]
emb|CAN74362.1|  hypothetical protein VITISV_016381                     230   3e-68   Vitis vinifera
ref|XP_006465701.1|  PREDICTED: hexokinase-1-like                       229   3e-68   Citrus sinensis [apfelsine]
ref|XP_004513053.1|  PREDICTED: hexokinase-1-like                       228   5e-68   Cicer arietinum [garbanzo]
ref|XP_011080413.1|  PREDICTED: hexokinase-1-like                       225   7e-67   Sesamum indicum [beniseed]
gb|KJB35042.1|  hypothetical protein B456_006G096800                    223   1e-66   Gossypium raimondii
dbj|BAP47497.1|  hexokinase                                             224   2e-66   Gentiana triflora
gb|KJB35041.1|  hypothetical protein B456_006G096800                    223   3e-66   Gossypium raimondii
ref|XP_002988103.1|  hypothetical protein SELMODRAFT_269350             221   6e-65   Selaginella moellendorffii
ref|XP_010665885.1|  PREDICTED: hexokinase-1-like isoform X1            220   7e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002972691.1|  hypothetical protein SELMODRAFT_441916             218   5e-64   Selaginella moellendorffii
ref|XP_010246625.1|  PREDICTED: hexokinase-3-like                       216   4e-63   Nelumbo nucifera [Indian lotus]
gb|KDO50431.1|  hypothetical protein CISIN_1g0104561mg                  207   6e-63   Citrus sinensis [apfelsine]
ref|NP_001044102.1|  Os01g0722700                                       208   1e-62   
gb|KEH27216.1|  hexokinase                                              213   4e-62   Medicago truncatula
tpg|DAA57818.1|  TPA: hypothetical protein ZEAMMB73_547897              209   5e-62   
tpg|DAA57819.1|  TPA: hypothetical protein ZEAMMB73_547897              208   2e-61   
emb|CDM84160.1|  unnamed protein product                                207   3e-61   Triticum aestivum [Canadian hard winter wheat]
gb|AAL16967.1|AF367451_1  hexokinase                                    202   3e-61   Prunus persica
gb|ACN29323.1|  unknown                                                 209   8e-61   Zea mays [maize]
ref|NP_001146056.1|  hypothetical protein                               209   1e-60   Zea mays [maize]
sp|Q2KNB7.1|HXK9_ORYSJ  RecName: Full=Hexokinase-9; AltName: Full...    209   1e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004969912.1|  PREDICTED: hexokinase-6-like                       209   2e-60   Setaria italica
ref|XP_002458467.1|  hypothetical protein SORBIDRAFT_03g034230          208   4e-60   Sorghum bicolor [broomcorn]
gb|EAY75659.1|  hypothetical protein OsI_03566                          207   5e-60   Oryza sativa Indica Group [Indian rice]
gb|AIT55904.1|  hexokinase                                              207   5e-60   Ipomoea batatas [batate]
ref|XP_008675068.1|  PREDICTED: hexokinase-6                            207   8e-60   Zea mays [maize]
ref|XP_006470700.1|  PREDICTED: hexokinase-3-like                       207   1e-59   Citrus sinensis [apfelsine]
ref|XP_006446203.1|  hypothetical protein CICLE_v10014962mg             207   1e-59   Citrus clementina [clementine]
gb|AAL16968.1|AF367452_1  hexokinase                                    199   1e-59   Prunus persica
ref|XP_004961448.1|  PREDICTED: hexokinase-5-like                       206   2e-59   Setaria italica
ref|XP_006646311.1|  PREDICTED: hexokinase-6-like                       206   2e-59   
ref|XP_003540378.1|  PREDICTED: hexokinase-3-like                       205   3e-59   Glycine max [soybeans]
emb|CBI27996.3|  unnamed protein product                                204   3e-59   Vitis vinifera
gb|KHN09247.1|  Hexokinase-3                                            204   4e-59   Glycine soja [wild soybean]
gb|ABR18277.1|  unknown                                                 206   5e-59   Picea sitchensis
ref|XP_003537744.1|  PREDICTED: hexokinase-3-like                       204   6e-59   Glycine max [soybeans]
gb|AFW82531.1|  hypothetical protein ZEAMMB73_000101                    198   9e-59   
gb|KHN41674.1|  Hexokinase-1                                            201   2e-58   Glycine soja [wild soybean]
ref|XP_006843448.1|  PREDICTED: hexokinase-3                            202   3e-58   Amborella trichopoda
ref|XP_010273315.1|  PREDICTED: hexokinase-3-like                       202   4e-58   Nelumbo nucifera [Indian lotus]
ref|XP_002440104.1|  hypothetical protein SORBIDRAFT_09g026080          202   6e-58   Sorghum bicolor [broomcorn]
ref|NP_001044214.1|  Os01g0742500                                       202   7e-58   
ref|XP_011045448.1|  PREDICTED: hexokinase-3-like                       201   8e-58   Populus euphratica
emb|CBI36049.3|  unnamed protein product                                200   8e-58   Vitis vinifera
ref|XP_002456268.1|  hypothetical protein SORBIDRAFT_03g033200          199   8e-58   
ref|XP_007013022.1|  Hexokinase 2 isoform 3                             200   1e-57   
gb|AFW78822.1|  hexokinase-2                                            201   1e-57   
ref|XP_008800256.1|  PREDICTED: hexokinase-3-like isoform X2            193   1e-57   
ref|XP_006383739.1|  hypothetical protein POPTR_0005s25980g             196   2e-57   
ref|XP_002298298.1|  hexokinase family protein                          201   2e-57   Populus trichocarpa [western balsam poplar]
gb|EMT31348.1|  Hexokinase-9                                            204   3e-57   
ref|XP_008466487.1|  PREDICTED: hexokinase-2, chloroplastic             200   3e-57   Cucumis melo [Oriental melon]
gb|ACG44289.1|  hexokinase-2                                            200   3e-57   Zea mays [maize]
gb|KHN27811.1|  Hexokinase-1                                            198   3e-57   Glycine soja [wild soybean]
ref|XP_007017793.1|  Hexokinase 3                                       199   5e-57   
ref|XP_001754148.1|  hexokinase protein HXK7                            200   5e-57   
ref|XP_012090051.1|  PREDICTED: hexokinase-3-like                       199   5e-57   Jatropha curcas
ref|XP_002306924.2|  hypothetical protein POPTR_0005s25980g             196   5e-57   
ref|XP_002510526.1|  hexokinase, putative                               199   6e-57   Ricinus communis
ref|XP_012073808.1|  PREDICTED: hexokinase-2, chloroplastic             199   6e-57   Jatropha curcas
ref|XP_003568072.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-5...    199   1e-56   
gb|AHY84733.1|  hexokinase                                              199   1e-56   Manihot esculenta [manioc]
gb|EMT15586.1|  Hexokinase-7                                            197   1e-56   
ref|XP_006646274.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-9...    198   1e-56   
ref|NP_001123599.1|  hexokinase2                                        198   1e-56   Zea mays [maize]
gb|KHN25630.1|  Hexokinase-3                                            195   2e-56   Glycine soja [wild soybean]
ref|NP_001056082.1|  Os05g0522500                                       198   2e-56   
ref|XP_008800255.1|  PREDICTED: hexokinase-3-like isoform X1            192   2e-56   
ref|XP_002313358.2|  hexokinase family protein                          198   2e-56   Populus trichocarpa [western balsam poplar]
ref|XP_001752229.1|  hexokinase protein HXK8                            198   3e-56   
gb|AFW82530.1|  hexokinase                                              197   3e-56   
gb|AAA60333.1|  hexokinase                                              196   3e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006362320.1|  PREDICTED: hexokinase-3-like                       197   4e-56   Solanum tuberosum [potatoes]
ref|XP_011045105.1|  PREDICTED: hexokinase-2, chloroplastic             197   5e-56   Populus euphratica
gb|AHY84730.1|  hexokinase                                              196   6e-56   Manihot esculenta [manioc]
ref|NP_001105529.1|  LOC542510                                          197   7e-56   
ref|XP_009414963.1|  PREDICTED: hexokinase-3-like                       196   7e-56   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ93240.1|  predicted protein                                      196   9e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KGN60032.1|  hypothetical protein Csa_3G872140                       195   9e-56   Cucumis sativus [cucumbers]
ref|XP_007131563.1|  hypothetical protein PHAVU_011G023700g             196   1e-55   Phaseolus vulgaris [French bean]
ref|XP_009366073.1|  PREDICTED: hexokinase-3                            196   1e-55   Pyrus x bretschneideri [bai li]
ref|XP_009405075.1|  PREDICTED: hexokinase-2-like                       196   1e-55   
ref|XP_004136385.1|  PREDICTED: hexokinase-2, chloroplastic             195   2e-55   Cucumis sativus [cucumbers]
ref|XP_008387945.1|  PREDICTED: hexokinase-2, chloroplastic             195   2e-55   Malus domestica [apple tree]
ref|XP_001784334.1|  hexokinase protein HXK3                            195   2e-55   
ref|XP_008363245.1|  PREDICTED: hexokinase-3                            195   3e-55   
ref|XP_009335085.1|  PREDICTED: hexokinase-2, chloroplastic             194   3e-55   Pyrus x bretschneideri [bai li]
gb|AEB00843.1|  hexokinase 7                                            186   3e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010673708.1|  PREDICTED: hexokinase-3-like isoform X1            194   4e-55   Beta vulgaris subsp. vulgaris [field beet]
gb|AEB00842.1|  hexokinase 6                                            189   6e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN35090.1|  Hexokinase-3                                            189   6e-55   Glycine soja [wild soybean]
ref|XP_008450397.1|  PREDICTED: hexokinase-3-like                       194   8e-55   Cucumis melo [Oriental melon]
gb|EMT04435.1|  Hexokinase-6                                            193   8e-55   
ref|XP_010921910.1|  PREDICTED: hexokinase-3-like isoform X1            193   8e-55   Elaeis guineensis
ref|XP_004251354.1|  PREDICTED: hexokinase-3-like                       193   1e-54   Solanum lycopersicum
ref|XP_001784630.1|  hexokinase protein HXK2                            193   1e-54   
ref|XP_002984124.1|  hypothetical protein SELMODRAFT_234446             192   2e-54   
ref|XP_011032066.1|  PREDICTED: hexokinase-3 isoform X1                 193   2e-54   
emb|CDP07402.1|  unnamed protein product                                192   2e-54   
ref|XP_009780796.1|  PREDICTED: hexokinase-2, chloroplastic             192   2e-54   
ref|XP_009337028.1|  PREDICTED: hexokinase-3-like                       192   2e-54   
ref|XP_009622479.1|  PREDICTED: hexokinase-3-like                       192   2e-54   
gb|AAS60198.1|  hexokinase 6                                            192   2e-54   
ref|XP_007015149.1|  Hexokinase-like 1                                  192   3e-54   
ref|XP_006473649.1|  PREDICTED: hexokinase-2, chloroplastic-like        191   5e-54   
ref|XP_009343799.1|  PREDICTED: hexokinase-3-like                       192   5e-54   
emb|CDP09609.1|  unnamed protein product                                192   5e-54   
gb|AHY84732.1|  hexokinase                                              191   6e-54   
ref|XP_002972212.1|  hypothetical protein SELMODRAFT_231902             190   6e-54   
ref|XP_004139044.1|  PREDICTED: hexokinase-3                            191   7e-54   
ref|XP_003569773.1|  PREDICTED: hexokinase-6                            191   7e-54   
gb|AHD25655.1|  hexokinase 2                                            191   7e-54   
ref|XP_009798645.1|  PREDICTED: hexokinase-3-like                       191   7e-54   
ref|XP_004511503.1|  PREDICTED: hexokinase-3-like                       191   9e-54   
ref|XP_010031757.1|  PREDICTED: hexokinase-3 isoform X3                 191   9e-54   
ref|XP_008385759.1|  PREDICTED: hexokinase-3-like                       191   1e-53   
sp|Q6Q8A5.1|HXK2_TOBAC  RecName: Full=Hexokinase-2, chloroplastic...    191   1e-53   
ref|NP_001234717.1|  plastidic hexokinase                               191   1e-53   
gb|AEB00838.1|  hexokinase 2                                            190   1e-53   
ref|XP_010031755.1|  PREDICTED: hexokinase-3 isoform X1                 191   1e-53   
ref|XP_002274759.1|  PREDICTED: hexokinase-3 isoform X1                 190   2e-53   
emb|CDM84036.1|  unnamed protein product                                190   2e-53   
ref|XP_008449690.1|  PREDICTED: hexokinase-3                            189   2e-53   
ref|XP_003517518.1|  PREDICTED: hexokinase-3-like                       189   3e-53   
gb|KDO84849.1|  hypothetical protein CISIN_1g011283mg                   189   3e-53   
ref|XP_010695425.1|  PREDICTED: hexokinase-2, chloroplastic             189   3e-53   
ref|XP_008775017.1|  PREDICTED: hexokinase-3-like isoform X2            189   3e-53   
ref|XP_008775016.1|  PREDICTED: hexokinase-3-like isoform X1            189   3e-53   
ref|NP_001275315.1|  hexokinase-related protein 1                       189   4e-53   
gb|KJB83525.1|  hypothetical protein B456_013G251900                    186   5e-53   
ref|XP_006590474.1|  PREDICTED: hexokinase-3-like                       189   5e-53   
gb|KJB83527.1|  hypothetical protein B456_013G251900                    185   5e-53   
gb|EMT13168.1|  Hexokinase-8                                            187   6e-53   
gb|AFO84085.1|  hexokinase                                              189   6e-53   
dbj|BAK06520.1|  predicted protein                                      189   7e-53   
ref|XP_011657629.1|  PREDICTED: hexokinase-3                            188   7e-53   
gb|EAY98739.1|  hypothetical protein OsI_20669                          189   7e-53   
ref|XP_007156986.1|  hypothetical protein PHAVU_002G034000g             188   1e-52   
ref|XP_006435174.1|  hypothetical protein CICLE_v10000939mg             188   1e-52   
gb|EYU46224.1|  hypothetical protein MIMGU_mgv1a004779mg                188   1e-52   
ref|NP_001054835.1|  Os05g0187100                                       185   1e-52   
gb|AIU64847.1|  hexokinase-3                                            188   1e-52   
ref|XP_003564653.1|  PREDICTED: hexokinase-8-like                       187   1e-52   
ref|XP_002883225.1|  hexokinase                                         187   2e-52   
ref|XP_008227191.1|  PREDICTED: hexokinase-3 isoform X1                 187   2e-52   
dbj|BAD93730.1|  hexokinase                                             187   2e-52   
ref|XP_006643859.1|  PREDICTED: hexokinase-8-like                       186   2e-52   
ref|NP_188639.2|  hexokinase-4                                          187   2e-52   
ref|XP_002974995.1|  hypothetical protein SELMODRAFT_150326             187   2e-52   
ref|XP_009626314.1|  PREDICTED: hexokinase-2, chloroplastic             187   2e-52   
ref|XP_010487967.1|  PREDICTED: hexokinase-4                            187   2e-52   
ref|XP_002513538.1|  hexokinase, putative                               187   3e-52   
ref|XP_010508397.1|  PREDICTED: hexokinase-4-like                       186   6e-52   
sp|Q1WM16.2|HXK7_ORYSJ  RecName: Full=Hexokinase-7; AltName: Full...    185   6e-52   
ref|XP_010268380.1|  PREDICTED: hexokinase-2, chloroplastic             186   6e-52   
gb|AAZ93624.1|  hexokinase 7                                            185   7e-52   
gb|KJB83523.1|  hypothetical protein B456_013G251900                    186   7e-52   
gb|KJB83524.1|  hypothetical protein B456_013G251900                    186   8e-52   
gb|EEC78650.1|  hypothetical protein OsI_18744                          185   9e-52   
ref|XP_003610965.1|  Hexokinase                                         185   1e-51   
ref|XP_009405453.1|  PREDICTED: hexokinase-3-like                       185   1e-51   
ref|XP_002977412.1|  hypothetical protein SELMODRAFT_232972             184   2e-51   
sp|O64390.1|HXK1_SOLTU  RecName: Full=Hexokinase-1; AltName: Full...    184   2e-51   
ref|XP_010061051.1|  PREDICTED: hexokinase-2, chloroplastic             184   2e-51   
ref|XP_007211826.1|  hypothetical protein PRUPE_ppa004471mg             184   3e-51   
gb|KHG14450.1|  hypothetical protein F383_08688                         184   3e-51   
ref|XP_003568782.1|  PREDICTED: hexokinase-7                            183   3e-51   
ref|XP_010461577.1|  PREDICTED: hexokinase-like 1 protein isoform X2    181   4e-51   
ref|XP_004968460.1|  PREDICTED: hexokinase-8-like                       183   5e-51   
gb|ABG36927.1|  hexokinase 3                                            174   5e-51   
ref|XP_006829458.1|  PREDICTED: hexokinase-2, chloroplastic             183   5e-51   
ref|XP_010461576.1|  PREDICTED: hexokinase-like 1 protein isoform X1    181   5e-51   
ref|XP_010920252.1|  PREDICTED: hexokinase-2, chloroplastic             183   8e-51   
gb|EPS60819.1|  hexokinase                                              182   8e-51   
ref|XP_008221267.1|  PREDICTED: hexokinase-2, chloroplastic             183   8e-51   
ref|XP_010938649.1|  PREDICTED: hexokinase-3-like                       183   8e-51   
ref|NP_001267834.1|  hexokinase                                         182   1e-50   
gb|AEJ95927.1|  HXK2                                                    182   1e-50   
ref|XP_002894073.1|  hypothetical protein ARALYDRAFT_314227             182   1e-50   
gb|KJB63530.1|  hypothetical protein B456_010G004700                    179   2e-50   
ref|XP_006393149.1|  hypothetical protein EUTSA_v10011415mg             182   2e-50   
ref|NP_001059124.1|  Os07g0197100                                       182   2e-50   
ref|XP_009382579.1|  PREDICTED: hexokinase-3-like isoform X2            181   2e-50   
gb|KEH40228.1|  hexokinase                                              179   2e-50   
dbj|BAK01318.1|  predicted protein                                      182   2e-50   
ref|XP_004291365.1|  PREDICTED: hexokinase-2, chloroplastic             181   3e-50   
ref|XP_009382578.1|  PREDICTED: hexokinase-3-like isoform X1            181   3e-50   
gb|ADN33926.1|  hexokinase                                              182   3e-50   
ref|XP_007222248.1|  hypothetical protein PRUPE_ppa004715mg             181   4e-50   
ref|XP_008807592.1|  PREDICTED: hexokinase-4, chloroplastic-like ...    176   4e-50   
ref|XP_006297494.1|  hypothetical protein CARUB_v10013513mg             181   5e-50   
ref|XP_002891576.1|  hypothetical protein ARALYDRAFT_474175             181   5e-50   
ref|XP_008807594.1|  PREDICTED: hexokinase-4, chloroplastic-like ...    176   5e-50   
ref|XP_008807593.1|  PREDICTED: hexokinase-4, chloroplastic-like ...    176   6e-50   
gb|KJB63531.1|  hypothetical protein B456_010G004700                    179   8e-50   
gb|EAZ03118.1|  hypothetical protein OsI_25263                          180   1e-49   
gb|AFK45195.1|  unknown                                                 179   1e-49   
gb|KHG14299.1|  Hexokinase-2, chloroplastic                             179   1e-49   
ref|XP_011090147.1|  PREDICTED: hexokinase-3-like                       180   1e-49   
ref|XP_011080375.1|  PREDICTED: hexokinase-3 isoform X1                 179   2e-49   
ref|XP_003589478.1|  Hexokinase I                                       179   2e-49   
gb|KJB63529.1|  hypothetical protein B456_010G004700                    179   2e-49   
ref|XP_010479187.1|  PREDICTED: hexokinase-like 1 protein isoform X1    179   3e-49   
gb|ACN35115.1|  unknown                                                 177   3e-49   
gb|ACG43712.1|  hexokinase-1                                            178   5e-49   
ref|XP_002440735.1|  hypothetical protein SORBIDRAFT_09g005840          177   5e-49   
ref|NP_001130970.1|  uncharacterized protein LOC100192075               178   5e-49   
ref|XP_006303965.1|  hypothetical protein CARUB_v10008846mg             178   5e-49   
ref|XP_011080376.1|  PREDICTED: hexokinase-3 isoform X2                 178   6e-49   
ref|XP_008672063.1|  PREDICTED: uncharacterized protein LOC100192...    178   6e-49   
ref|XP_010500300.1|  PREDICTED: hexokinase-like 1 protein               177   7e-49   
ref|XP_004960890.1|  PREDICTED: hexokinase-7-like isoform X1            177   7e-49   
ref|XP_002455027.1|  hypothetical protein SORBIDRAFT_03g003190          177   2e-48   
ref|XP_006601348.1|  PREDICTED: hexokinase-2, chloroplastic-like ...    172   2e-48   
ref|XP_006307314.1|  hypothetical protein CARUB_v10008936mg             176   2e-48   
ref|XP_003580531.1|  PREDICTED: hexokinase-4, chloroplastic             176   3e-48   
gb|ACG47843.1|  hexokinase-1                                            176   3e-48   
ref|NP_175463.1|  hexokinase-like 1                                     176   4e-48   
emb|CDY07303.1|  BnaC05g26650D                                          176   4e-48   
gb|KFK35941.1|  hypothetical protein AALP_AA4G057200                    176   5e-48   
ref|XP_010461899.1|  PREDICTED: hexokinase-3-like                       175   8e-48   
ref|XP_010466178.1|  PREDICTED: hexokinase-4-like                       175   1e-47   
gb|ABG36926.1|  hexokinase 2                                            166   1e-47   
ref|XP_010104447.1|  Hexokinase-2                                       174   1e-47   
ref|XP_010479505.1|  PREDICTED: hexokinase-3 isoform X1                 174   2e-47   
sp|Q1WM15.2|HXK8_ORYSJ  RecName: Full=Hexokinase-8; AltName: Full...    173   2e-47   
ref|XP_006661182.1|  PREDICTED: hexokinase-1-like                       173   2e-47   
gb|EEE54030.1|  hypothetical protein OsJ_00699                          173   3e-47   
ref|XP_011083536.1|  PREDICTED: hexokinase-2, chloroplastic             173   4e-47   
ref|NP_001042264.1|  Os01g0190400                                       173   4e-47   
ref|XP_004960891.1|  PREDICTED: hexokinase-7-like isoform X2            172   4e-47   
gb|EEC70091.1|  hypothetical protein OsI_00720                          172   8e-47   
gb|AAX84838.1|  hexokinase                                              164   1e-46   
ref|XP_003550424.1|  PREDICTED: hexokinase-2, chloroplastic-like ...    172   1e-46   
gb|EMT08969.1|  Hexokinase-5                                            170   1e-46   
ref|XP_006393517.1|  hypothetical protein EUTSA_v10011426mg             172   1e-46   
ref|NP_175220.2|  hexokinase 3                                          172   1e-46   
ref|XP_010443879.1|  PREDICTED: hexokinase-3-like isoform X2            168   1e-46   
gb|EPS64171.1|  hypothetical protein M569_10608                         172   1e-46   
gb|AFW83996.1|  hypothetical protein ZEAMMB73_545591                    169   1e-46   
ref|XP_009144955.1|  PREDICTED: hexokinase-3-like                       171   2e-46   
ref|XP_010443756.1|  PREDICTED: hexokinase-3-like isoform X1            168   2e-46   
ref|XP_004499271.1|  PREDICTED: LOW QUALITY PROTEIN: hexokinase-2...    171   2e-46   
emb|CDY06724.1|  BnaA10g05030D                                          170   4e-46   
ref|XP_002983299.1|  hypothetical protein SELMODRAFT_117919             169   6e-46   
gb|AAZ93625.1|  hexokinase 8                                            169   6e-46   
ref|XP_008656880.1|  PREDICTED: hexokinase-3-like                       169   7e-46   
ref|XP_007160669.1|  hypothetical protein PHAVU_001G007000g             169   9e-46   
ref|XP_009118944.1|  PREDICTED: hexokinase-like 1 protein               169   1e-45   
emb|CDY20902.1|  BnaC06g01220D                                          169   1e-45   
ref|XP_008674565.1|  PREDICTED: hexokinase-3                            169   1e-45   
ref|XP_009107216.1|  PREDICTED: hexokinase-3-like                       169   2e-45   
gb|AAF99786.1|AC012463_3  T2E6.5                                        172   2e-45   
ref|XP_006654666.1|  PREDICTED: hexokinase-5-like                       167   2e-45   
ref|XP_010031756.1|  PREDICTED: hexokinase-3 isoform X2                 168   2e-45   
emb|CDY22797.1|  BnaA06g02800D                                          168   3e-45   
ref|XP_009147837.1|  PREDICTED: hexokinase-3                            168   3e-45   
gb|KFK39985.1|  hypothetical protein AALP_AA3G314900                    167   3e-45   
dbj|BAJ85932.1|  predicted protein                                      168   3e-45   
gb|EAY77169.1|  hypothetical protein OsI_05139                          168   3e-45   
sp|Q2KNB4.1|HXK3_ORYSJ  RecName: Full=Hexokinase-3; AltName: Full...    168   3e-45   
ref|XP_004971218.1|  PREDICTED: hexokinase-3-like                       168   3e-45   
gb|EMS55979.1|  Hexokinase-5                                            166   3e-45   
emb|CDY03607.1|  BnaC03g68660D                                          167   4e-45   
gb|KFK39984.1|  hypothetical protein AALP_AA3G314800                    167   4e-45   
ref|XP_006406425.1|  hypothetical protein EUTSA_v10020562mg             167   6e-45   
gb|ABG36925.1|  hexokinase 1                                            159   7e-45   
gb|EEE55981.1|  hypothetical protein OsJ_04720                          168   8e-45   
ref|NP_001150106.1|  hexokinase-1                                       166   9e-45   
emb|CDY24565.1|  BnaC05g32490D                                          167   1e-44   
ref|XP_003545034.1|  PREDICTED: hexokinase-2, chloroplastic-like        166   1e-44   
ref|XP_002459072.1|  hypothetical protein SORBIDRAFT_03g045420          166   1e-44   
ref|XP_001766433.1|  hexokinase protein HXK5                            166   2e-44   
emb|CDY45062.1|  BnaA08g02130D                                          166   2e-44   
gb|KHN05494.1|  Hexokinase-3                                            165   2e-44   
gb|ACN25682.1|  unknown                                                 165   2e-44   
emb|CDY25373.1|  BnaA05g19110D                                          165   3e-44   
ref|XP_009145689.1|  PREDICTED: hexokinase-4                            165   3e-44   
ref|XP_001776765.1|  hexokinase protein HXK10                           165   4e-44   
ref|XP_001772444.1|  hexokinase protein HXK1                            165   4e-44   
ref|XP_006657535.1|  PREDICTED: hexokinase-4, chloroplastic-like        163   6e-44   
gb|KFK39983.1|  hypothetical protein AALP_AA3G314700                    164   6e-44   
sp|Q2KNB5.1|HXK10_ORYSJ  RecName: Full=Hexokinase-10; AltName: Fu...    164   9e-44   
ref|XP_001770177.1|  hexokinase protein HXK9                            164   1e-43   
ref|XP_003565048.1|  PREDICTED: hexokinase-3                            163   1e-43   
gb|EMS52197.1|  Hexokinase-8                                            161   2e-43   
gb|AAQ72424.1|  hexokinase PpHxk1                                       163   3e-43   
ref|XP_010941986.1|  PREDICTED: hexokinase-2-like                       162   5e-43   
ref|XP_002987642.1|  hypothetical protein SELMODRAFT_269299             160   2e-42   
dbj|BAD87613.1|  putative hexokinase                                    159   8e-42   
gb|AAT01343.1|  putative hexokinase                                     157   3e-41   
ref|XP_002441001.1|  hypothetical protein SORBIDRAFT_09g018720          155   1e-40   
ref|XP_008787361.1|  PREDICTED: hexokinase-2-like                       155   2e-40   
emb|CBI19858.3|  unnamed protein product                                153   3e-40   
ref|XP_001762951.1|  hexokinase protein HXK6                            154   3e-40   
ref|XP_004962258.1|  PREDICTED: hexokinase-10-like                      154   4e-40   
ref|XP_007222247.1|  hypothetical protein PRUPE_ppa004715mg             154   5e-40   
ref|XP_010921911.1|  PREDICTED: hexokinase-3-like isoform X2            153   7e-40   
gb|EPS65982.1|  hypothetical protein M569_08795                         149   3e-39   
gb|AIW63725.1|  hexokinase                                              141   4e-39   
gb|EAZ13494.1|  hypothetical protein OsJ_03410                          149   2e-38   
ref|XP_001779478.1|  hexokinase protein HXK11                           148   5e-38   
ref|XP_010050473.1|  PREDICTED: hexokinase-5-like                       139   2e-37   
gb|AHZ34665.1|  hexokinase 3 (chloroplast)                              146   2e-37   
gb|EMT24694.1|  Hexokinase-10                                           145   4e-37   
gb|EMS52462.1|  Hexokinase-2                                            144   5e-37   
gb|KHN39431.1|  Hexokinase-2, chloroplastic                             145   7e-37   
ref|XP_001760948.1|  hexokinase protein HXK4                            145   8e-37   
ref|XP_010271549.1|  PREDICTED: probable hexokinase-like 2 protein      144   9e-37   
ref|XP_010536106.1|  PREDICTED: hexokinase-4-like                       144   1e-36   
ref|XP_010536107.1|  PREDICTED: hexokinase-4-like isoform X1            144   1e-36   
ref|XP_010536108.1|  PREDICTED: hexokinase-4-like isoform X2            144   1e-36   
ref|XP_010467923.1|  PREDICTED: hexokinase-2 isoform X2                 142   3e-36   
ref|XP_010665884.1|  PREDICTED: hexokinase-1-like                       143   3e-36   
gb|KCW79620.1|  hypothetical protein EUGRSUZ_C00975                     140   4e-36   
ref|NP_001152293.1|  hexokinase-1                                       142   6e-36   
ref|XP_010231125.1|  PREDICTED: hexokinase-2 isoform X2                 141   6e-36   



>ref|XP_007215964.1| hypothetical protein PRUPE_ppa011439mg [Prunus persica]
 gb|EMJ17163.1| hypothetical protein PRUPE_ppa011439mg [Prunus persica]
Length=210

 Score =   269 bits (688),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH +RSSGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHRIRSSGRWARATAIIKELEEKCGTPIGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G E+GLFYALDLGGTNFRV+RVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGTEKGLFYALDLGGTNFRVLRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV KEG+D+ +PP +QRELGFTFSFP  Q+SI
Sbjct  144  DYIAAELAKFVAKEGQDYQLPPGRQRELGFTFSFPVLQSSI  184



>ref|XP_008387435.1| PREDICTED: hexokinase-2-like [Malus domestica]
Length=291

 Score =   271 bits (694),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHRMRSSGRWARASAIIKELEEKCGTPTGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV KEG+D+ +PP +QRELGFTFSFP  Q+SI
Sbjct  144  DYIAAELAKFVAKEGQDYQLPPGRQRELGFTFSFPVLQSSI  184



>ref|XP_009338735.1| PREDICTED: hexokinase-1-like isoform X2 [Pyrus x bretschneideri]
Length=398

 Score =   273 bits (697),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RHHMR+SGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHHMRNSGRWARASAIIKELEEKCGTPTGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+GLFYALDLGGTNFRVMRVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVMRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV KEG+D+ +PP +QRELGFTFSFP  Q+SI
Sbjct  144  DYIAAELAKFVAKEGQDYQLPPGRQRELGFTFSFPVLQSSI  184



>ref|XP_009338734.1| PREDICTED: hexokinase-1-like isoform X1 [Pyrus x bretschneideri]
Length=497

 Score =   274 bits (701),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RHHMR+SGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHHMRNSGRWARASAIIKELEEKCGTPTGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+GLFYALDLGGTNFRVMRVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVMRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV KEG+D+ +PP +QRELGFTFSFP  Q+SI
Sbjct  144  DYIAAELAKFVAKEGQDYQLPPGRQRELGFTFSFPVLQSSI  184



>ref|XP_008228416.1| PREDICTED: hexokinase-1-like [Prunus mume]
Length=497

 Score =   273 bits (697),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RHHMRSSGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHHMRSSGRWARATAIVKELEEKCGTPIGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G E+GLFYALDLGGTNFRV+RVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGTEKGLFYALDLGGTNFRVLRVQLGGKGRGIISQEFTEVSIPENLMVGTSDALF  143

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV KEG+D+ +PP +QRELGFTFSFP  Q+SI
Sbjct  144  DYIAAELAKFVAKEGQDYQLPPGRQRELGFTFSFPVLQSSI  184



>ref|XP_008458856.1| PREDICTED: hexokinase-1-like isoform X2 [Cucumis melo]
 ref|XP_008458864.1| PREDICTED: hexokinase-1-like isoform X2 [Cucumis melo]
Length=502

 Score =   271 bits (693),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR+SG+WA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  29   RHRMRNSGKWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  88

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  89   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  148

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV +EGE FH  P +QRELGFTFSFP RQTSI+
Sbjct  149  DFIAQALAKFVAEEGEGFHPAPGRQRELGFTFSFPVRQTSIS  190



>gb|KDO66593.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=289

 Score =   264 bits (674),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  EGE FH+ P +QRELGFTFSFP RQTSIA
Sbjct  145  DYIAAALAKFVATEGEGFHVSPGRQRELGFTFSFPVRQTSIA  186



>ref|XP_008458873.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458879.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458886.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458893.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458902.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458909.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458916.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458922.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458929.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458934.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458936.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
 ref|XP_008458939.1| PREDICTED: hexokinase-1-like isoform X3 [Cucumis melo]
Length=498

 Score =   271 bits (692),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR+SG+WA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRNSGKWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV +EGE FH  P +QRELGFTFSFP RQTSI+
Sbjct  145  DFIAQALAKFVAEEGEGFHPAPGRQRELGFTFSFPVRQTSIS  186



>gb|ACJ04704.1| hexokinase 1 [Cucumis melo]
Length=498

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR+SG+WA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRNSGKWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV +EGE FH  P +QRELGFTFSFP RQTSI+
Sbjct  145  DFIAQALAKFVAEEGEGFHPAPGRQRELGFTFSFPVRQTSIS  186



>ref|XP_011648625.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 ref|XP_011648626.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 ref|XP_011648627.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 ref|XP_011648628.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 ref|XP_011648629.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 ref|XP_011648630.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 ref|XP_011648631.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 ref|XP_011648632.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 gb|KGN60576.1| hypothetical protein Csa_2G000830 [Cucumis sativus]
Length=498

 Score =   269 bits (688),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/162 (79%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR+SG+WA+ +A+L+E E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRNSGKWARAMAILREFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV +EGE FH  P +QRELGFTFSFP RQTSI+
Sbjct  145  DFIAQALAKFVAEEGEGFHPAPGRQRELGFTFSFPVRQTSIS  186



>ref|XP_010915190.1| PREDICTED: hexokinase-2-like [Elaeis guineensis]
Length=500

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSGRWA+ VA+LKELEEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAVAILKELEEKCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP +LMVG S  LF
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKEGHVVKQEFEEVSIPPNLMVGRSSELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA ELA FV  EGE+FH+P  +QRELGFTFSFP +QTSI+
Sbjct  145  DFIAAELAKFVASEGEEFHLPAGRQRELGFTFSFPVKQTSIS  186



>ref|XP_008387327.1| PREDICTED: hexokinase-1-like [Malus domestica]
Length=498

 Score =   269 bits (687),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M+SSGRWA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+K VV +ES+EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDKHVVKQESEEVSIPPHLMTGTSEGLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA   A FV  EGE  H  P +QRELGFTFSFP RQTSIA
Sbjct  145  DFIAETJAKFVATEGEGLHPAPGRQRELGFTFSFPVRQTSIA  186



>ref|XP_008458849.1| PREDICTED: hexokinase-1-like isoform X1 [Cucumis melo]
Length=583

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 143/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR+SG+WA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  110  RHRMRNSGKWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  169

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLMVGSSEALF
Sbjct  170  VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKENRVVKQEFEEVSIPPHLMVGSSEALF  229

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV +EGE FH  P +QRELGFTFSFP RQTSI+
Sbjct  230  DFIAQALAKFVAEEGEGFHPAPGRQRELGFTFSFPVRQTSIS  271



>ref|XP_006451308.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 ref|XP_006451311.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|ESR64548.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|ESR64551.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|KDO66590.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
 gb|KDO66591.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
 gb|KDO66592.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=343

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  EGE FH+ P +QRELGFTFSFP RQTSIA
Sbjct  145  DYIAAALAKFVATEGEGFHVSPGRQRELGFTFSFPVRQTSIA  186



>gb|KDO66588.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=356

 Score =   263 bits (673),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  EGE FH+ P +QRELGFTFSFP RQTSIA
Sbjct  145  DYIAAALAKFVATEGEGFHVSPGRQRELGFTFSFPVRQTSIA  186



>gb|KHN40379.1| Hexokinase-2 [Glycine soja]
Length=503

 Score =   267 bits (683),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSG+W + VA++KE EE+CGTP GKLRQVADAM VEMH GLASEGGSKLKMLI+Y
Sbjct  23   RHRMRSSGKWGRAVAIVKEFEEQCGTPIGKLRQVADAMNVEMHEGLASEGGSKLKMLITY  82

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+G+FYALDLGGTNFR +RV LGGKEKGVVN ES++VSIP HLM GSS  LF
Sbjct  83   VDNLPSGDEKGVFYALDLGGTNFRTLRVHLGGKEKGVVNLESEKVSIPPHLMTGSSHELF  142

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DF+A +LA FV  E E+FH+PP +QRELGFTFSFP RQTSIA
Sbjct  143  DFVAAKLAKFVSSEPEEFHLPPGRQRELGFTFSFPVRQTSIA  184



>ref|XP_003516783.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=496

 Score =   267 bits (683),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSG+W + VA++KE EE+CGTP GKLRQVADAM VEMH GLASEGGSKLKMLI+Y
Sbjct  23   RHRMRSSGKWGRAVAIVKEFEEQCGTPIGKLRQVADAMNVEMHEGLASEGGSKLKMLITY  82

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+G+FYALDLGGTNFR +RV LGGKEKGVVN ES++VSIP HLM GSS  LF
Sbjct  83   VDNLPSGDEKGVFYALDLGGTNFRTLRVHLGGKEKGVVNLESEKVSIPPHLMTGSSHELF  142

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DF+A +LA FV  E E+FH+PP +QRELGFTFSFP RQTSIA
Sbjct  143  DFVAAKLAKFVSSEPEEFHLPPGRQRELGFTFSFPVRQTSIA  184



>ref|XP_009406171.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 130/162 (80%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSGR A+  ALLKELEE+C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRCARAAALLKELEERCATPLGKLRQVADAMMVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD LP+GDE GLFYALDLGGTNFRV+RVQLGGKE+ VV +E +EVSIP HLMVG S+ LF
Sbjct  85   VDKLPTGDETGLFYALDLGGTNFRVLRVQLGGKEQRVVKKEPKEVSIPPHLMVGGSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGEDFHIP  +QRELGFTFSFP RQTSIA
Sbjct  145  DFIASALAEFVASEGEDFHIPVGRQRELGFTFSFPVRQTSIA  186



>ref|XP_010267128.1| PREDICTED: hexokinase-1-like [Nelumbo nucifera]
Length=500

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR SGRWA+ +A+LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  27   RHRMRCSGRWARAMAILKEFEEKCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  86

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG +  V+ +E  EVSIP HLM G S+ LF
Sbjct  87   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGNDGQVLKQEFTEVSIPPHLMTGGSDELF  146

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA ELA FV  EGEDFH+PP +QRELGFTFSFP RQ SIA
Sbjct  147  DYIASELAKFVASEGEDFHLPPGRQRELGFTFSFPVRQISIA  188



>ref|XP_010249484.1| PREDICTED: hexokinase-1 [Nelumbo nucifera]
Length=498

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR SGRWA+ +A+L+E EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRCSGRWARAMAILREFEEKCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E GLFYALDLGGTNFRV+RVQLGGK+  VVN+E  EVSIP HLM G SE LF
Sbjct  85   VDNLPTGNERGLFYALDLGGTNFRVLRVQLGGKDGRVVNQEFAEVSIPPHLMTGGSEELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FVK EGEDFH+ P +QRELGFTFSFP RQ SI
Sbjct  145  DYIAAELAKFVKTEGEDFHLSPGRQRELGFTFSFPVRQLSI  185



>ref|XP_002283608.1| PREDICTED: hexokinase-1-like [Vitis vinifera]
Length=497

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSGRWA+ +A+L+E EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMRSSGRWARAMAILREFEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+K VV +E +EVSIP HLMVGSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDKRVVKQEFEEVSIPPHLMVGSSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  EGE  H+ P +QRELGFTFSFP RQ+SI+
Sbjct  145  DYIAAALAKFVATEGEGLHVSPGRQRELGFTFSFPVRQSSIS  186



>gb|AFO84084.1| hexokinase [Actinidia deliciosa]
Length=497

 Score =   266 bits (680),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSGRWAK  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+IS+
Sbjct  25   RHRMRSSGRWAKAAAIVKELEEKCGTPIGKLRQVADAMAVEMHAGLASEGGSKLKMIISF  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+  V  +E +EVSIP HLMVG+S+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDNRVAKQEFEEVSIPPHLMVGTSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  L  FV  EGED H+ P +QRELGFTFSFP +Q+SIA
Sbjct  145  DFIAAALKKFVDTEGEDSHLSPGRQRELGFTFSFPVKQSSIA  186



>emb|CAN83149.1| hypothetical protein VITISV_024177 [Vitis vinifera]
Length=498

 Score =   266 bits (680),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSGRWA+ +A+L+E EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMRSSGRWARAMAILREFEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+K VV +E +EVSIP HLMVGSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDKRVVKQEFEEVSIPPHLMVGSSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  EGE  H+ P +QRELGFTFSFP RQ+SI+
Sbjct  145  DYIAAALAKFVATEGEGLHVSPGRQRELGFTFSFPVRQSSIS  186



>gb|KDO66582.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=465

 Score =   265 bits (676),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  EGE FH+ P +QRELGFTFSFP RQTSIA
Sbjct  145  DYIAAALAKFVATEGEGFHVSPGRQRELGFTFSFPVRQTSIA  186



>ref|XP_006451309.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|ESR64549.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|KDO66589.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=402

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  EGE FH+ P +QRELGFTFSFP RQTSIA
Sbjct  145  DYIAAALAKFVATEGEGFHVSPGRQRELGFTFSFPVRQTSIA  186



>gb|ADZ96378.1| hexokinase 1 [Eriobotrya japonica]
Length=497

 Score =   265 bits (677),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  MRSSGRWA+  A++KELEEKCGTP GKLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RRRMRSSGRWARASAIIKELEEKCGTPTGKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGK +G++++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKGRGIISQEFIEVSIPENLMVGTSDALF  143

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV KEG+D  +PP +QRELGFTFSFP  Q+SI
Sbjct  144  DYIAAELAKFVAKEGQDHQLPPGRQRELGFTFSFPVLQSSI  184



>gb|AHD25654.1| hexokinase 1 (chloroplast) [Camellia sinensis]
Length=495

 Score =   265 bits (677),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M+ SGRW++ +A+LKE EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMKCSGRWSQAMAILKEFEEKCGTPLSKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG++  VV +E  EVSIP +LM+G+S+ LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGRDNHVVKQEFDEVSIPPNLMIGTSDGLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  L  FV  EGEDFH+PPD+QRELGFTFSFP +QTSIA
Sbjct  145  DFIAEALKKFVDTEGEDFHLPPDRQRELGFTFSFPVKQTSIA  186



>gb|KDO66587.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=424

 Score =   263 bits (671),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  EGE FH+ P +QRELGFTFSFP RQTSIA
Sbjct  145  DYIAAALAKFVATEGEGFHVSPGRQRELGFTFSFPVRQTSIA  186



>ref|XP_008242483.1| PREDICTED: hexokinase-1 [Prunus mume]
Length=498

 Score =   265 bits (676),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M+SSGRWA+ +A+L+E E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILREFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKEK VV +E  EVSIP +LM G+SEALF
Sbjct  85   VDNLPTGDEQGLFYALDLGGTNFRVIRVQLGGKEKRVVKQEFDEVSIPPNLMTGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGE FH  P +QRELGFTFSFP  QTSIA
Sbjct  145  DFIAEALAKFVATEGEGFHPAPGRQRELGFTFSFPVWQTSIA  186



>ref|NP_001275786.1| hexokinase [Citrus sinensis]
 ref|XP_006451310.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|AAG28503.1|AF196966_1 hexokinase [Citrus sinensis]
 gb|ESR64550.1| hypothetical protein CICLE_v10008086mg [Citrus clementina]
 gb|KDO66583.1| hypothetical protein CISIN_1g010895mg [Citrus sinensis]
Length=498

 Score =   264 bits (675),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+S+GRWA+ VA+LKE+EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSTGRWARAVAILKEMEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG+E  VV +E +EVSIP HLM GSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGREGRVVKQEFEEVSIPPHLMTGSSHELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  EGE FH+ P +QRELGFTFSFP RQTSIA
Sbjct  145  DYIAAALAKFVATEGEGFHVSPGRQRELGFTFSFPVRQTSIA  186



>emb|CDP03250.1| unnamed protein product [Coffea canephora]
Length=497

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R+ M+S G+WAK +A+LKE EE+CGTP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RNRMKSLGKWAKVMAILKEFEEECGTPTAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGG EK VV RE QEVSIP HLMVGS+EALF
Sbjct  85   VDNLPTGDERGLFYALDLGGTNFRVLRVQLGGHEKRVVKREFQEVSIPPHLMVGSTEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  EGED  +PP +QRELGFTFSFP RQ S+A
Sbjct  145  DYIAGALARFVATEGEDLCLPPGRQRELGFTFSFPVRQLSVA  186



>gb|AHB32106.1| hexokinase [Camellia sinensis]
Length=495

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M+ SGRW++ +A+LKE EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMKCSGRWSQAMAILKEFEEKCGTPLSKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG++  VV +E  EVSIP +LM+G+S+ LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGRDNHVVKQEFDEVSIPPNLMIGTSDGLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  L  FV  EG+DFH+PPD+QRELGFTFSFP +QTSIA
Sbjct  145  DFIAEALKKFVDTEGKDFHLPPDRQRELGFTFSFPVKQTSIA  186



>ref|XP_009392524.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=500

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 141/162 (87%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R+ MRSSGRWA+  ALLKELEE+C TP GKLRQVADAMAVEMHAGLASEGGSKLKMLISY
Sbjct  25   RYRMRSSGRWARVAALLKELEERCATPVGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            V+NLP+G+E GLFYALDLGGTNFRV+RVQLGGKE+ V+ +E +EVSIP  LMVG S+ LF
Sbjct  85   VNNLPTGEETGLFYALDLGGTNFRVLRVQLGGKERHVLKQEFEEVSIPPLLMVGGSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGEDFH+P  +QRE+GFTFSFP RQTSIA
Sbjct  145  DFIASALAKFVASEGEDFHLPVGRQREIGFTFSFPVRQTSIA  186



>ref|XP_003516735.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=496

 Score =   263 bits (672),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSG+W + VA++KE EE+C TP GKLRQVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   RHRMRSSGKWGRVVAIVKEFEEQCRTPIGKLRQVADAMDVEMHAGLASEGGSKLKMLITY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+GLFYALDLGGTNFR +RV LGGKEKGVV  ES EVSIP HLM GSS+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRTLRVHLGGKEKGVVKIESDEVSIPPHLMTGSSQELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA +LA FV  E E+ H PP +QRELGFTFSFP RQTSIA
Sbjct  145  DFIASKLAKFVSSEPEELHPPPGRQRELGFTFSFPVRQTSIA  186



>gb|AEJ95926.1| HXK1 [Vitis vinifera]
Length=470

 Score =   262 bits (670),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/159 (78%), Positives = 140/159 (88%), Gaps = 0/159 (0%)
 Frame = +2

Query  185  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  364
            MRSSGRWA+ +A+L+E EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISYVDN
Sbjct  1    MRSSGRWARAMAILREFEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISYVDN  60

Query  365  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  544
            LP+GDE+GLFYALDLGGTNFRV+RVQLGGK+K VV +E +EVSIP HLMVGSS+ALFD+I
Sbjct  61   LPTGDEKGLFYALDLGGTNFRVLRVQLGGKDKRVVKQEFEEVSIPPHLMVGSSDALFDYI  120

Query  545  AHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            A  LA FV  EGE  H+ P +QRELGFTFSFP RQ+SIA
Sbjct  121  AAALAKFVATEGEGLHVSPGRQRELGFTFSFPVRQSSIA  159



>ref|XP_010098150.1| hypothetical protein L484_026284 [Morus notabilis]
 gb|EXB74587.1| hypothetical protein L484_026284 [Morus notabilis]
Length=499

 Score =   263 bits (671),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSS RW + +A++ +L+E+CGTP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSARWVRAMAIVADLDERCGTPLAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGK+ G+VN+E  EVSIP+ LMVGSS+ LF
Sbjct  85   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKDGGIVNQEFAEVSIPQDLMVGSSDTLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV +EGEDF +PP +QRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVAQEGEDFQLPPGRQRELGFTFSFPVMQTSI  185



>ref|XP_008380854.1| PREDICTED: hexokinase-1-like isoform X2 [Malus domestica]
Length=398

 Score =   259 bits (663),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSGRWA+  A++KELEEKCGTP  KLRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  24   RHRMRSSGRWARASAIIKELEEKCGTPTEKLRQVADAMAVEMHAGLASEGGSKLKMIISY  83

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+GLFYALDLGGTNFRV+RV LGGK +G+V++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVHLGGKGRGIVSQEFIEVSIPENLMVGTSDALF  143

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV KEG+D   PP +QRELGFTFSFP  Q+SI
Sbjct  144  DYIAAELAKFVAKEGQDHQPPPGRQRELGFTFSFPVLQSSI  184



>ref|XP_007203872.1| hypothetical protein PRUPE_ppa004637mg [Prunus persica]
 gb|EMJ05071.1| hypothetical protein PRUPE_ppa004637mg [Prunus persica]
Length=498

 Score =   262 bits (670),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M+ SGRWA+ +A+L+E E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKCSGRWARAMAILREFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKEK VV +E  EVSIP +LM G+SEALF
Sbjct  85   VDNLPTGDEQGLFYALDLGGTNFRVIRVQLGGKEKRVVKQEFDEVSIPPNLMTGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGE FH  P +QRELGFTFSFP  QTSIA
Sbjct  145  DFIAEALAKFVATEGEGFHPAPGRQRELGFTFSFPVWQTSIA  186



>ref|XP_009352555.1| PREDICTED: hexokinase-1 [Pyrus x bretschneideri]
Length=498

 Score =   261 bits (668),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 126/162 (78%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M+SSGRWA+ +A+L+ELE+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILRELEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGKEK VV  E  EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDENGLFYALDLGGTNFRVLRVQLGGKEKHVVKHEFDEVSIPPHLMTGTSEGLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGE  H  P +QRELGFTFSFP  QTSI 
Sbjct  145  DFIAEALAKFVATEGEGLHPAPGRQRELGFTFSFPVWQTSIT  186



>ref|XP_011093636.1| PREDICTED: hexokinase-1 [Sesamum indicum]
Length=496

 Score =   261 bits (668),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/162 (78%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSGRWAK  A+L+ELEEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRQMKSSGRWAKAEAILRELEEKCGTPTAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRVMRVQLGGK+ G++ +E +EVSIP HLMVGSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVMRVQLGGKD-GIMKQEFEEVSIPPHLMVGSSHELF  143

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGEDFH+ P +QRELGFTFSFP RQ S+A
Sbjct  144  DFIAAALAKFVDTEGEDFHLLPGRQRELGFTFSFPVRQLSLA  185



>ref|XP_012076877.1| PREDICTED: hexokinase-1-like [Jatropha curcas]
 gb|KDP33801.1| hypothetical protein JCGZ_07372 [Jatropha curcas]
Length=498

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M+SSGRWA+ +A+L+E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMQSSGRWARAMAILREFEEKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RV LGG+E  VV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVIRVLLGGREDRVVKQEFEEVSIPPHLMTGSSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  EGE  H  P +QRELGFTFSFP RQTSIA
Sbjct  145  DYIAEALAKFVATEGEGLHPSPGQQRELGFTFSFPVRQTSIA  186



>ref|XP_009795017.1| PREDICTED: hexokinase-2-like [Nicotiana sylvestris]
Length=498

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 141/163 (87%), Gaps = 1/163 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M++SG+WAK + +LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHKMKNSGKWAKAMDMLKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  532
            VDNLP+GDE GLFYALDLGGTNFRVMRVQLGGKEK +V +E +EVSIP+++M G SS+AL
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDAL  144

Query  533  FDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FDFIA  L  FV  EG+DFH+PP +QRELGFTFSFP +Q SIA
Sbjct  145  FDFIATTLVKFVATEGDDFHLPPGRQRELGFTFSFPVKQLSIA  187



>gb|AID50967.1| hexokinase 1 [Malus domestica]
Length=498

 Score =   261 bits (667),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M+SSGRWA+ +A+L+ELE+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILRELEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE GLFYALDLGGTNFRV+RV+LGG EK VV +E  EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDENGLFYALDLGGTNFRVLRVRLGGNEKRVVKQEFDEVSIPPHLMTGTSEGLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGE  H  P +QRELGFTFSFP  QTSIA
Sbjct  145  DFIAEALAKFVATEGEGLHPAPSRQRELGFTFSFPVWQTSIA  186



>ref|XP_008337603.1| PREDICTED: hexokinase-1-like [Malus domestica]
Length=498

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M+SSGRWA+ +A+L+ELE+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKSSGRWARAMAILRELEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE GLFYALDLGGTNFRV+RV+LGG EK VV +E  EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDENGLFYALDLGGTNFRVLRVRLGGNEKRVVKQEFDEVSIPPHLMTGTSEGLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGE  H  P +QRELGFTFSFP  QTSIA
Sbjct  145  DFIAEALAKFVATEGEGLHPAPSRQRELGFTFSFPVWQTSIA  186



>ref|XP_007013021.1| Hexokinase 1 isoform 2 [Theobroma cacao]
 gb|EOY30640.1| Hexokinase 1 isoform 2 [Theobroma cacao]
Length=498

 Score =   261 bits (666),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH ++SSG+WA+T+A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRIKSSGKWARTLAILKEFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKESRVVKQEFEEVSIPPHLMTGSSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  E E  H+ P +QRELGFTFSFP RQTSI+
Sbjct  145  DYIASALAKFVATESEGLHVSPGRQRELGFTFSFPVRQTSIS  186



>ref|XP_009415191.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=498

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R+ MRSSG+WA   A++KELEE+C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RNRMRSSGKWAPVSAVVKELEERCATPVGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGKE  V  +E +EVSIP HLMVG S+ LF
Sbjct  86   VDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKEGRVAKQEFEEVSIPPHLMVGGSDELF  145

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGEDFH+P  +QRELGFTFSFP RQ SIA
Sbjct  146  DFIASALAKFVASEGEDFHLPVGRQRELGFTFSFPVRQISIA  187



>gb|AHG98487.1| hexokinase [Dimocarpus longan]
Length=496

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M+SSG+WA+ +A+LK+LE+KCGTP GKLRQ+ADAM VEMHAGLASEGGSKLKMLIS+
Sbjct  25   RHRMQSSGKWARAMAILKDLEDKCGTPIGKLRQIADAMTVEMHAGLASEGGSKLKMLISF  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGG+NFRV+RV LGGKE  VV +E +EVSIP+HLMVGSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGSNFRVLRVLLGGKEGHVVKQEFKEVSIPQHLMVGSSHELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  EGE  H+PP +QRELGFTFSFP RQTSI+
Sbjct  145  NFIAAALAKFVATEGEGLHVPPGRQRELGFTFSFPVRQTSIS  186



>ref|XP_007152969.1| hypothetical protein PHAVU_004G175500g [Phaseolus vulgaris]
 gb|ESW24963.1| hypothetical protein PHAVU_004G175500g [Phaseolus vulgaris]
Length=500

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RHHMRSSG+W + VA+++E E++CGTP  KLR VADA+ VEMHAGLASEGGSKLKMLI++
Sbjct  25   RHHMRSSGKWGRAVAIVREFEKQCGTPIAKLRLVADAIDVEMHAGLASEGGSKLKMLITF  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+GLFYALDLGGTNFR +RVQLGGKEKGVVN ES+EVSIP HLM G S  LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRTLRVQLGGKEKGVVNLESEEVSIPPHLMTGCSHELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA +LA FV  E E+FH  P KQRELGFTFSFP RQTSI+
Sbjct  145  DFIAAKLAKFVSSEPEEFHPAPGKQRELGFTFSFPVRQTSIS  186



>gb|AAS60196.1| hexokinase 4b [Nicotiana tabacum]
Length=498

 Score =   260 bits (664),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M +SG+WAK + +LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHKMENSGKWAKAMDILKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  532
            VDNLP+GDE GLFYALDLGGTNFRVMRVQLGGKEK +V +E +EVSIP+++M G SS+AL
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDAL  144

Query  533  FDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FDFIA  L  FV  EG+DFH+PP +QRELGFTFSFP +Q SIA
Sbjct  145  FDFIATTLVKFVATEGDDFHLPPGRQRELGFTFSFPVKQLSIA  187



>gb|KCW82328.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=354

 Score =   255 bits (652),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+ SG+WA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRQMKRSGKWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKEKGVV++E +EVSIP +LM+GSSEALF
Sbjct  86   VDNLPTGNEQGLFYALDLGGTNFRVLRVQLGGKEKGVVSQEFEEVSIPPYLMIGSSEALF  145

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            ++IA  LA FV  E E  H  P +QRELGFTFSFP RQ SI+
Sbjct  146  NYIAEALAKFVATESEGSHPYPGRQRELGFTFSFPVRQVSIS  187



>ref|NP_001280783.1| uncharacterized protein LOC103443741 [Malus domestica]
 gb|AFU56883.1| hexokinase [Malus domestica]
Length=497

 Score =   259 bits (663),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSGRWA+  A++KELEEKCGTP  KLRQVADAMAVEMHAGLASEGGSKLK++ISY
Sbjct  24   RHRMRSSGRWARASAIIKELEEKCGTPTEKLRQVADAMAVEMHAGLASEGGSKLKVIISY  83

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+GLFYALDLGGTNFRV+RV+LGGK +G+V++E  EVSIP +LMVG+S+ALF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVRLGGKGRGIVSQEFIEVSIPENLMVGTSDALF  143

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV KEG+D   PP +QRELGFTFSFP  Q+SI
Sbjct  144  DYIAAELAKFVAKEGQDHQPPPGRQRELGFTFSFPVLQSSI  184



>gb|KHN40378.1| Hexokinase-1 [Glycine soja]
Length=482

 Score =   259 bits (662),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  179  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  358
            + MRSSG+W + VA++KE EE+C TP GKLRQVADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  12   YRMRSSGKWGRVVAIVKEFEEQCRTPIGKLRQVADAMDVEMHAGLASEGGSKLKMLITYV  71

Query  359  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  538
            DNLPSGDE+GLFYALDLGGTNFR +RV LGGKEKGVV  ES EVSIP HLM GSS+ LFD
Sbjct  72   DNLPSGDEKGLFYALDLGGTNFRTLRVHLGGKEKGVVKIESDEVSIPPHLMTGSSQELFD  131

Query  539  FIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FIA +LA FV  E E+ H PP +QRELGFTFSFP RQTSIA
Sbjct  132  FIASKLAKFVSSEPEELHPPPGRQRELGFTFSFPVRQTSIA  172



>gb|KCW82327.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=357

 Score =   255 bits (652),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+ SG+WA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRQMKRSGKWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKEKGVV++E +EVSIP +LM+GSSEALF
Sbjct  86   VDNLPTGNEQGLFYALDLGGTNFRVLRVQLGGKEKGVVSQEFEEVSIPPYLMIGSSEALF  145

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            ++IA  LA FV  E E  H  P +QRELGFTFSFP RQ SI+
Sbjct  146  NYIAEALAKFVATESEGSHPYPGRQRELGFTFSFPVRQVSIS  187



>ref|XP_002514221.1| hexokinase, putative [Ricinus communis]
 gb|EEF48175.1| hexokinase, putative [Ricinus communis]
Length=498

 Score =   259 bits (662),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M+SSGRW + +A+L E EEKCGTP GKLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMKSSGRWTRAMAILGEFEEKCGTPVGKLRQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM+GSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVLLGGKEDRVVKQEFEEVSIPPHLMIGSSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  L  FV  EGED H  P +QRELGFTFSFP RQ SIA
Sbjct  145  DFIADALKKFVATEGEDLHPLPGQQRELGFTFSFPVRQASIA  186



>ref|XP_002299739.1| hypothetical protein POPTR_0001s19130g [Populus trichocarpa]
 gb|EEE84544.1| hypothetical protein POPTR_0001s19130g [Populus trichocarpa]
Length=494

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            +  M+   RWAK + ++KE++EKCGTP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRKMKRDRRWAKAMEMVKEMQEKCGTPIGKLKQVADAMVVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+GLFYALDLGGTNFRV+RVQLGGK+ G+VN+E  EVSIP +LM+G+S+ALF
Sbjct  86   VDNLPSGDEKGLFYALDLGGTNFRVLRVQLGGKDGGLVNQEFTEVSIPPNLMIGTSDALF  145

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA ELA F+ +EGE+F +PP KQRELGFTFSFP  QTSIA
Sbjct  146  DYIAAELAKFIAQEGEEFELPPGKQRELGFTFSFPVMQTSIA  187



>ref|XP_008795842.1| PREDICTED: hexokinase-2-like isoform X2 [Phoenix dactylifera]
Length=500

 Score =   258 bits (660),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSGRWA+ +A+LK+LEEKC TP GKLRQVADAM VEM AGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAMAILKDLEEKCATPIGKLRQVADAMTVEMLAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGK   VV +E +EVSIP +LMVGSS  LF
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKGGYVVRQEFEEVSIPPNLMVGSSSELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGE+FH+P  +QRELGFTFSFP +QTSI+
Sbjct  145  DFIAAALAKFVASEGEEFHLPVGRQRELGFTFSFPVKQTSIS  186



>ref|XP_008795834.1| PREDICTED: hexokinase-2-like isoform X1 [Phoenix dactylifera]
Length=526

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/162 (77%), Positives = 139/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSGRWA+ +A+LK+LEEKC TP GKLRQVADAM VEM AGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAMAILKDLEEKCATPIGKLRQVADAMTVEMLAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGK   VV +E +EVSIP +LMVGSS  LF
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVLRVQLGGKGGYVVRQEFEEVSIPPNLMVGSSSELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGE+FH+P  +QRELGFTFSFP +QTSI+
Sbjct  145  DFIAAALAKFVASEGEEFHLPVGRQRELGFTFSFPVKQTSIS  186



>ref|XP_004302852.1| PREDICTED: hexokinase-1-like [Fragaria vesca subsp. vesca]
Length=498

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  MR  G W+K  A++KELEEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  24   RQRMRCCGEWSKATAIVKELEEKCGTPIAKLRQVADAMTVEMHAGLASEGGSKLKMIISY  83

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGK +G+VN+E  EVSIP  LMVG++E LF
Sbjct  84   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKGRGLVNQEFTEVSIPEGLMVGTTETLF  143

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            DFIA ELA FV KEG ++ +PP +QRELGFTFSFP +QTSI
Sbjct  144  DFIATELAKFVGKEGPEYQLPPGRQRELGFTFSFPVQQTSI  184



>ref|XP_009777315.1| PREDICTED: hexokinase-2 [Nicotiana sylvestris]
Length=497

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR S +WA+  A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRKSSKWARARAILKEFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDEEG+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEEGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFTEASIPPNLMVGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV +E E FH PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVAEEEEKFHQPPGKQRELGFTFSFPIMQTSI  185



>gb|AAS60194.1| hexokinase 3 [Nicotiana tabacum]
Length=497

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR S +WA+  A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRKSSKWARARAILKEFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDEEG+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEEGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFTEASIPPNLMVGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV +E E FH PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVAEEEEKFHQPPGKQRELGFTFSFPIMQTSI  185



>ref|XP_011000949.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=494

 Score =   257 bits (657),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 142/162 (88%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            +  M+   RWAK + ++KE++EKCGTP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRKMKRDRRWAKAMEMVKEMQEKCGTPIGKLKQVADAMVVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+GLFYALDLGGTNFRV+RVQLGGK+ G+VN+E  EVSIP +LM+G+S+ALF
Sbjct  86   VDNLPSGDEKGLFYALDLGGTNFRVLRVQLGGKDGGLVNQEFTEVSIPPNLMIGTSDALF  145

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA ELA F+ +EG++F +PP KQRELGFTFSFP  QTSIA
Sbjct  146  DYIAAELAKFIAQEGQEFELPPGKQRELGFTFSFPVMQTSIA  187



>gb|KCW82326.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=417

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+ SG+WA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRQMKRSGKWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKEKGVV++E +EVSIP +LM+GSSEALF
Sbjct  86   VDNLPTGNEQGLFYALDLGGTNFRVLRVQLGGKEKGVVSQEFEEVSIPPYLMIGSSEALF  145

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            ++IA  LA FV  E E  H  P +QRELGFTFSFP RQ SI+
Sbjct  146  NYIAEALAKFVATESEGSHPYPGRQRELGFTFSFPVRQVSIS  187



>ref|XP_010110881.1| hypothetical protein L484_006996 [Morus notabilis]
 gb|EXC28700.1| hypothetical protein L484_006996 [Morus notabilis]
Length=386

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M+SSG+WA+ +A+LKE EEK  TP GKLRQVADAMAVEMHAGLASEGGSKLKMLISY
Sbjct  26   RHRMKSSGKWARAMAILKEFEEKGATPIGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GL+YALDLGGTNFRV+RVQLGGKE  V  +E  EVSIP HLM GSS+ALF
Sbjct  86   VDNLPTGDEKGLYYALDLGGTNFRVLRVQLGGKEGRVDKQEFDEVSIPPHLMTGSSDALF  145

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV +EGE FH  P +QRELGFTFSFP RQ SI+
Sbjct  146  DFIAGALAKFVSEEGEGFHPAPGRQRELGFTFSFPVRQLSIS  187



>ref|XP_010688341.1| PREDICTED: hexokinase-1 [Beta vulgaris subsp. vulgaris]
Length=498

 Score =   256 bits (654),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SS +WA+ +A+LKEL+EKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RQRMKSSSKWARAMAILKELDEKCETPLGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE GLFYALDLGGTNFRV+RV+LGGKEKGVV +E  EVSIP  LMVG+SE LF
Sbjct  85   VDNLPTGDEHGLFYALDLGGTNFRVLRVKLGGKEKGVVQQEFDEVSIPPELMVGTSEELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  EGE  H  P++QRELGFTFSFP +QTSIA
Sbjct  145  DYIAAALAKFVATEGEGLHPEPNRQRELGFTFSFPVKQTSIA  186



>ref|XP_006353497.1| PREDICTED: hexokinase-1-like isoform X2 [Solanum tuberosum]
Length=466

 Score =   255 bits (652),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            +  M++SG W K  ALLK+ EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRRMKNSGEWGKVEALLKDFEEKCATPMGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  532
            VDNLP+GDEEGLFYALDLGGTNFRVMRVQLGG EK +V  E +EVSIP+++M G SSE L
Sbjct  86   VDNLPTGDEEGLFYALDLGGTNFRVMRVQLGGNEKRIVKHEVKEVSIPQNVMAGSSSEVL  145

Query  533  FDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FDFIA  LA FV  EG+DFH+PP +QRELGFTFSFP +Q SIA
Sbjct  146  FDFIATALAEFVATEGDDFHLPPGRQRELGFTFSFPVKQLSIA  188



>gb|KJB83118.1| hypothetical protein B456_013G230400 [Gossypium raimondii]
Length=364

 Score =   252 bits (644),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  179  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  358
            H M+SSG+WA+  ++LK+ EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISYV
Sbjct  26   HRMKSSGKWAQAQSILKDFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISYV  85

Query  359  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  538
            DNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ALFD
Sbjct  86   DNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKEHRVVKQEFEEVSIPPHLMTGSSDALFD  145

Query  539  FIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +IA  LA FV  E E  H  PD+QRELGFTFSFP RQTSI+
Sbjct  146  YIAEALAKFVATESEGLHFSPDRQRELGFTFSFPVRQTSIS  186



>gb|AHY84731.1| hexokinase [Manihot esculenta]
Length=498

 Score =   256 bits (654),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR SGRWA+ +A+L+E E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKML+SY
Sbjct  25   RHRMRCSGRWARAMAILREFEDKCGTPLGKLRQVADAMTVEMHAGLASEGGSKLKMLLSY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RV LGGK+  VV +E +EVSIP HLM+GSS+ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVIRVVLGGKDDRVVKQEFEEVSIPPHLMIGSSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  E E  H  P +QRELGFTFSFP RQTSIA
Sbjct  145  DYIAEALAKFVATEDEGLHPLPGQQRELGFTFSFPVRQTSIA  186



>ref|XP_002325031.1| Hexokinase 1 family protein [Populus trichocarpa]
 gb|EEF03596.1| Hexokinase 1 family protein [Populus trichocarpa]
Length=498

 Score =   256 bits (654),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR SGRWA+ +A+L+E EE CGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRCSGRWARAMAILREFEENCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSG+E GLFYALDLGGTNFRV+RV LGG++ GVV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPSGEENGLFYALDLGGTNFRVIRVLLGGRDGGVVKQEFEEVSIPPHLMTGSSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             FIA  LA FV  E E  H  P +QRELGFTFSFP RQTSIA
Sbjct  145  GFIATALANFVATESEGLHCSPGRQRELGFTFSFPVRQTSIA  186



>ref|XP_010049611.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
 gb|KCW82325.1| hypothetical protein EUGRSUZ_C03728 [Eucalyptus grandis]
Length=500

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 140/162 (86%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+ SG+WA+ +A+LKE E+KCGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRQMKRSGKWARAMAILKEFEDKCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKEKGVV++E +EVSIP +LM+GSSEALF
Sbjct  86   VDNLPTGNEQGLFYALDLGGTNFRVLRVQLGGKEKGVVSQEFEEVSIPPYLMIGSSEALF  145

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            ++IA  LA FV  E E  H  P +QRELGFTFSFP RQ SI+
Sbjct  146  NYIAEALAKFVATESEGSHPYPGRQRELGFTFSFPVRQVSIS  187



>ref|XP_010924444.1| PREDICTED: hexokinase-2-like isoform X2 [Elaeis guineensis]
Length=500

 Score =   256 bits (653),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSGRWA+ + +LKELEE C TP GKLRQVADAM VEM AGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAMEILKELEENCATPIGKLRQVADAMTVEMLAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP GDE GLFYALDLGGTNFRV+RVQLGGK   VV +E +EVSIP +LMVGSS  LF
Sbjct  85   VDNLPKGDETGLFYALDLGGTNFRVLRVQLGGKGGRVVKQEFEEVSIPPNLMVGSSSELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGE+FH+P  +QRELGFTFSFP +QTSI+
Sbjct  145  DFIAAALAKFVASEGEEFHLPVGRQRELGFTFSFPVKQTSIS  186



>gb|AAS60195.1| hexokinase 4a [Nicotiana tabacum]
Length=498

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M++SG+WAK + +LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHKMKNSGKWAKAMDILKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  532
            VDNLP+GDE GLFYALDLGGTNFRVMRVQLGGKEK +V +E +EVSIP+++M G SS+AL
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDAL  144

Query  533  FDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FDFIA  L  FV  E +DF +PP +QRELGFTFSFP +Q SIA
Sbjct  145  FDFIATALVKFVATEDDDFRLPPGRQRELGFTFSFPVKQLSIA  187



>ref|XP_009622660.1| PREDICTED: hexokinase-2 [Nicotiana tomentosiformis]
Length=497

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR S +WA+ +A+LKE EEKC TP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRKSSKWARAMAILKEFEEKCRTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDEEG+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEEGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV +E E FH PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVAEEEERFHQPPGKQRELGFTFSFPIMQTSI  185



>ref|XP_006353496.1| PREDICTED: hexokinase-1-like isoform X1 [Solanum tuberosum]
Length=499

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            +  M++SG W K  ALLK+ EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRRMKNSGEWGKVEALLKDFEEKCATPMGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  532
            VDNLP+GDEEGLFYALDLGGTNFRVMRVQLGG EK +V  E +EVSIP+++M G SSE L
Sbjct  86   VDNLPTGDEEGLFYALDLGGTNFRVMRVQLGGNEKRIVKHEVKEVSIPQNVMAGSSSEVL  145

Query  533  FDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FDFIA  LA FV  EG+DFH+PP +QRELGFTFSFP +Q SIA
Sbjct  146  FDFIATALAEFVATEGDDFHLPPGRQRELGFTFSFPVKQLSIA  188



>gb|AAS60197.1| hexokinase 5 [Nicotiana tabacum]
Length=499

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            +  M++SG W K  ALLK+ EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRRMKNSGEWGKVEALLKDFEEKCATPMGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  532
            VDNLP+GDEEGLFYALDLGGTNFRVMRVQLGG EK +V  E +EVSIP+++M G SSE L
Sbjct  86   VDNLPTGDEEGLFYALDLGGTNFRVMRVQLGGNEKRIVKHEVKEVSIPQNVMAGSSSEVL  145

Query  533  FDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FDFIA  LA FV  EG+DFH+PP +QRELGFTFSFP +Q SIA
Sbjct  146  FDFIATALAEFVATEGDDFHLPPGRQRELGFTFSFPVKQLSIA  188



>ref|XP_010924442.1| PREDICTED: hexokinase-2-like isoform X1 [Elaeis guineensis]
Length=526

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSGRWA+ + +LKELEE C TP GKLRQVADAM VEM AGLASEGGSKLKMLISY
Sbjct  25   RHRMRSSGRWARAMEILKELEENCATPIGKLRQVADAMTVEMLAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP GDE GLFYALDLGGTNFRV+RVQLGGK   VV +E +EVSIP +LMVGSS  LF
Sbjct  85   VDNLPKGDETGLFYALDLGGTNFRVLRVQLGGKGGRVVKQEFEEVSIPPNLMVGSSSELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGE+FH+P  +QRELGFTFSFP +QTSI+
Sbjct  145  DFIAAALAKFVASEGEEFHLPVGRQRELGFTFSFPVKQTSIS  186



>ref|XP_009601881.1| PREDICTED: hexokinase-2-like [Nicotiana tomentosiformis]
Length=498

 Score =   255 bits (651),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M++SG+WAK + +LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHKMKNSGKWAKAMDILKEFEEKCETPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  532
            VDNLP+GDE GLFYALDLGGTNFRVMRVQLGGKEK +V +E +EVSIP+++M G SS+AL
Sbjct  85   VDNLPTGDETGLFYALDLGGTNFRVMRVQLGGKEKRIVKQEVKEVSIPKNVMAGSSSDAL  144

Query  533  FDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FDFIA  L  FV  E +DF +PP +QRELGFTFSFP +Q SIA
Sbjct  145  FDFIATALVEFVATEDDDFRLPPGRQRELGFTFSFPVKQLSIA  187



>ref|XP_011008120.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=498

 Score =   254 bits (650),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR SGRWA+ +A+L+E EE CGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRCSGRWARAMAILREFEENCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSG+E GLFYALDLGGTNFRV+RV LGG++ GVV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPSGEENGLFYALDLGGTNFRVIRVLLGGRDGGVVKQEFEEVSIPPHLMTGSSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             FIA  LA FV  E E  H  P +QRELGFTFSFP RQTSIA
Sbjct  145  GFIATALANFVATESEGLHPSPGRQRELGFTFSFPVRQTSIA  186



>gb|KEH21333.1| hexokinase [Medicago truncatula]
Length=363

 Score =   250 bits (639),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M SS +W ++V++LKE  EKC TP GKLRQ+ADAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMISSRKWTRSVSILKEFGEKCETPIGKLRQLADAMDVEMHAGLASEGGSKLSMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGKEKGV+++E  EVSIP  LM GSSE LF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKEKGVISQEFDEVSIPPQLMTGSSEGLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV+ E E FH PP +QRELGFTFSFP +QTSIA
Sbjct  145  DFIAAALAKFVESEPEGFHPPPGRQRELGFTFSFPVKQTSIA  186



>ref|XP_003529000.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=498

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH  RSSG+W +  A+ KELEE+C TP  KLRQVADA+ VEMHAGLASEGG KLKMLI+Y
Sbjct  25   RHRTRSSGKWGRATAIAKELEEQCWTPISKLRQVADALDVEMHAGLASEGGCKLKMLITY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+GLFYALDLGGTNFR +RV LGGKEKGVV  ES+EVSIP HLM GSS+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRTLRVHLGGKEKGVVKIESEEVSIPPHLMTGSSQELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA +LA FV  E E+ H PP +QRELGFTFSFP +QTSIA
Sbjct  145  DFIASKLAKFVSSEPEELHPPPGRQRELGFTFSFPVKQTSIA  186



>sp|Q9SEK2.1|HXK1_TOBAC RecName: Full=Hexokinase-1; AltName: Full=NtHxK1 [Nicotiana tabacum]
 gb|AAF18585.1|AF118133_1 chloroplast outer envelope hexokinase 1 [Nicotiana tabacum]
Length=497

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
             H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   NHRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV +EGE F  PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVNEEGEKFQQPPGKQRELGFTFSFPVMQTSI  185



>ref|XP_009606563.1| PREDICTED: hexokinase-1 [Nicotiana tomentosiformis]
Length=497

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
             H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   NHRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV +EGE F  PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVNEEGEKFQQPPGKQRELGFTFSFPVMQTSI  185



>ref|XP_011014418.1| PREDICTED: hexokinase-1-like [Populus euphratica]
Length=498

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR SGRWA+ +A+L+E EE CGTP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMRCSGRWARAMAILREFEENCGTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSG+E GLFYALDLGGTNFRV+RV LGG++ GVV +E +EVSIP HLM GSS+ALF
Sbjct  85   VDNLPSGEENGLFYALDLGGTNFRVIRVLLGGRDGGVVKQEFEEVSIPPHLMTGSSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             FIA  LA FV  E E  H  P +QRELGFTFSFP RQTSIA
Sbjct  145  GFIATVLANFVATESEGLHPSPGRQRELGFTFSFPVRQTSIA  186



>ref|NP_001274841.1| hexokinase-2 [Solanum tuberosum]
 sp|Q9SQ76.1|HXK2_SOLTU RecName: Full=Hexokinase-2; AltName: Full=StHK2 [Solanum tuberosum]
 gb|AAF14186.1| hexokinase 2 [Solanum tuberosum]
Length=496

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M  S +WA+  A+LKE EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEGGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPNLMVGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV +EGE+FH PP +QRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVAEEGEEFHPPPGRQRELGFTFSFPIMQTSI  185



>gb|ABA01010.1| hexokinase [Solanum chacoense]
Length=496

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M  S +WA+  A+LKE EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEGGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPNLMVGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV +EGE+FH PP +QRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVAEEGEEFHPPPGRQRELGFTFSFPIMQTSI  185



>gb|AAT77513.1| hexokinase 3 [Nicotiana sylvestris]
Length=496

 Score =   254 bits (648),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M  S +WA+  A+LKE EEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDGKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEGGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPNLMVGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV +EGE+FH PP +QRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVAEEGEEFHPPPGRQRELGFTFSFPIMQTSI  185



>gb|KJB83117.1| hypothetical protein B456_013G230400 [Gossypium raimondii]
Length=498

 Score =   253 bits (647),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  179  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  358
            H M+SSG+WA+  ++LK+ EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISYV
Sbjct  26   HRMKSSGKWAQAQSILKDFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISYV  85

Query  359  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  538
            DNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ALFD
Sbjct  86   DNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKEHRVVKQEFEEVSIPPHLMTGSSDALFD  145

Query  539  FIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +IA  LA FV  E E  H  PD+QRELGFTFSFP RQTSI+
Sbjct  146  YIAEALAKFVATESEGLHFSPDRQRELGFTFSFPVRQTSIS  186



>ref|XP_003530493.1| PREDICTED: hexokinase-1-like [Glycine max]
 gb|KHN16646.1| Hexokinase-1 [Glycine soja]
Length=498

 Score =   253 bits (647),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M SS +W++ +A+LKE EEKCGTP  KLRQVADAM VEMHAGLASEGGSKL MLIS+
Sbjct  25   RHRMISSRKWSRAMAILKEFEEKCGTPIVKLRQVADAMDVEMHAGLASEGGSKLNMLISF  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGK+KGV+ +E +EVSIP +LM GSS+ALF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKDKGVIGQEFEEVSIPPNLMTGSSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  E E FH PP +QRELGFTFSFP RQTSIA
Sbjct  145  DFIAAALAKFVGSEPEGFHPPPGRQRELGFTFSFPVRQTSIA  186



>gb|AAT77511.1| hexokinase [Nicotiana sylvestris]
Length=383

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
             H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   NHRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV +E E F  PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVAEEEEKFQQPPGKQRELGFTFSFPVMQTSI  185



>ref|XP_003525287.1| PREDICTED: hexokinase-1-like [Glycine max]
Length=498

 Score =   253 bits (646),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/162 (75%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M SS +W++ +A+LKE E+KCGTP  KLRQVADAM VEMHAGLASEGGSKL MLIS+
Sbjct  25   RHRMISSRKWSRAMAILKEFEDKCGTPIVKLRQVADAMDVEMHAGLASEGGSKLNMLISF  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGK+KGV+ +E +EVSIP +LM GSSEALF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKDKGVIGQEFEEVSIPPNLMTGSSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  E E FH PP +QRELGFTFSFP RQTSIA
Sbjct  145  DFIAAALAKFVGSEPEGFHPPPGRQRELGFTFSFPVRQTSIA  186



>ref|XP_006299465.1| hypothetical protein CARUB_v10015630mg [Capsella rubella]
 gb|EOA32363.1| hypothetical protein CARUB_v10015630mg [Capsella rubella]
Length=504

 Score =   253 bits (645),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S+ LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGEDFH+PP KQRELGFTFSFP +QTS++
Sbjct  145  DFIAEVLAKFVATEGEDFHLPPGKQRELGFTFSFPVKQTSLS  186



>ref|XP_004287480.1| PREDICTED: hexokinase-1 [Fragaria vesca subsp. vesca]
Length=498

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 123/162 (76%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  ++SS RWA+ +A+LKE EEKC TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRLKSSRRWARAMAILKEFEEKCDTPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKEK V+ +E  EVSIP HLM G+SE LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKEKRVIKQEFDEVSIPPHLMTGTSEGLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGE FH  P + RELGFTFSFP  QTSIA
Sbjct  145  DFIAEALAKFVATEGEGFHPAPGRLRELGFTFSFPVWQTSIA  186



>gb|KHG22031.1| Hexokinase-1 [Gossypium arboreum]
Length=529

 Score =   253 bits (646),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  179  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  358
            H M+SSG+WA+  ++LK+ EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISYV
Sbjct  57   HRMKSSGKWAQAQSILKDFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISYV  116

Query  359  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  538
            DNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ALFD
Sbjct  117  DNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKEHRVVKQEFEEVSIPPHLMTGSSDALFD  176

Query  539  FIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +IA  LA FV  E E  H  PD+QRELGFTFSFP RQTSI+
Sbjct  177  YIAEALAKFVATESEGLHFSPDRQRELGFTFSFPVRQTSIS  217



>ref|XP_010322313.1| PREDICTED: hexokinase isoform X1 [Solanum lycopersicum]
Length=496

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M  S +WA+  A+LKE EEKC TP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIMHQEFAEASIPPNLMVGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV +EGE FH PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVDEEGEKFHPPPGKQRELGFTFSFPIMQTSI  185



>gb|EYU27268.1| hypothetical protein MIMGU_mgv1a019208mg [Erythranthe guttata]
Length=489

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 137/162 (85%), Gaps = 4/162 (2%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG WAK  A+ +ELE+KCGTP  KLRQVADAMAVEMHAG+AS+GGSKLKMLIS+
Sbjct  25   RRQMKSSGEWAKAEAIFRELEDKCGTPTAKLRQVADAMAVEMHAGVASDGGSKLKMLISF  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRVMRVQLG    G + +E ++VSIP H MVGSS  LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVMRVQLG----GTIKQECEQVSIPPHFMVGSSHELF  140

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  +A FV KEGEDFH+PP +QRELGFTFSFP RQ+S+A
Sbjct  141  DFIAGVVAKFVAKEGEDFHLPPGRQRELGFTFSFPVRQSSLA  182



>ref|NP_001234406.1| hexokinase [Solanum lycopersicum]
 gb|AAG35735.1|AF208543_1 hexokinase [Solanum lycopersicum]
Length=496

 Score =   252 bits (643),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M  S +WA+  A+LKE EEKC TP  KL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMGKSSKWARARAILKEFEEKCATPDAKLKQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIMHQEFAEASIPPNLMVGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV +EGE FH PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVDEEGEKFHPPPGKQRELGFTFSFPIMQTSI  185



>gb|EYU45835.1| hypothetical protein MIMGU_mgv1a005054mg [Erythranthe guttata]
Length=498

 Score =   251 bits (641),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSGRWA+ VA++KE EEKCGTP  KL Q+ADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RQRMKSSGRWARAVAIVKEFEEKCGTPEAKLVQIADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+EEG+FYALDLGGTNFRV+RVQLGGKE G+V++E  E SIP  LM G+S+ALF
Sbjct  85   VDNLPTGEEEGVFYALDLGGTNFRVLRVQLGGKEGGIVHQEFAEASIPPALMCGTSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA +LA FV +E + FH PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAEKLANFVAEEEQIFHQPPGKQRELGFTFSFPVMQTSI  185



>ref|NP_001234710.1| hexokinase [Solanum lycopersicum]
 gb|AAY60841.1| hexokinase [Solanum lycopersicum]
Length=499

 Score =   251 bits (641),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            +H +++SG W K  ALLK+ EEKC TP  KL+QVADAM VEM AGLASEGGSKLKMLISY
Sbjct  26   KHRVKNSGEWGKVEALLKDFEEKCATPVEKLKQVADAMTVEMQAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVG-SSEAL  532
            VDNLP+GDE+GLFYALDLGGTNFRVMRVQLGGKEK +V  E +EVSIP+++M G SSE L
Sbjct  86   VDNLPTGDEKGLFYALDLGGTNFRVMRVQLGGKEKRIVKHEVKEVSIPQNVMTGSSSEVL  145

Query  533  FDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FDFIA  LA FV  EG+DFH+PP +QRELGFTFSFP +Q SIA
Sbjct  146  FDFIATALAEFVATEGDDFHLPPGRQRELGFTFSFPVKQLSIA  188



>gb|AET05183.2| hexokinase [Medicago truncatula]
Length=498

 Score =   251 bits (641),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M SS +W ++V++LKE  EKC TP GKLRQ+ADAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMISSRKWTRSVSILKEFGEKCETPIGKLRQLADAMDVEMHAGLASEGGSKLSMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGKEKGV+++E  EVSIP  LM GSSE LF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKEKGVISQEFDEVSIPPQLMTGSSEGLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV+ E E FH PP +QRELGFTFSFP +QTSIA
Sbjct  145  DFIAAALAKFVESEPEGFHPPPGRQRELGFTFSFPVKQTSIA  186



>ref|XP_009803252.1| PREDICTED: hexokinase-1 [Nicotiana sylvestris]
 gb|AAS60192.1| hexokinase 1a [Nicotiana tabacum]
Length=497

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 136/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
             H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   NHRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP +LMVG+SEALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPNLMVGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV +E E F  PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVAEEEEKFQQPPGKQRELGFTFSFPVMQTSI  185



>ref|XP_010416617.1| PREDICTED: hexokinase-2-like [Camelina sativa]
Length=502

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKAFEEDCATPVAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S+ LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFI   LA FV  EGEDFH+PP +QRELGFTFSFP +QTS++
Sbjct  145  DFIVEVLAKFVATEGEDFHLPPGRQRELGFTFSFPVKQTSLS  186



>ref|XP_010540986.1| PREDICTED: hexokinase-1-like [Tarenaya hassleriana]
Length=499

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  MRSSG+WA+ +A+L+  EE C TP  KLRQVADA+ VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRRMRSSGKWARAMAILRAFEEDCATPIAKLRQVADALTVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRVMRV LGGKE  VV +E +EVSIP HLM G S+ LF
Sbjct  86   VDNLPTGDEKGLFYALDLGGTNFRVMRVLLGGKEGRVVKQEFEEVSIPPHLMTGGSDELF  145

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            DFIA  LA FV+ EGEDFH  P +QRELGFTFSFP RQTS+
Sbjct  146  DFIADALAKFVETEGEDFHPAPGRQRELGFTFSFPVRQTSL  186



>ref|XP_007160283.1| hypothetical protein PHAVU_002G308400g [Phaseolus vulgaris]
 gb|ESW32277.1| hypothetical protein PHAVU_002G308400g [Phaseolus vulgaris]
Length=498

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/162 (74%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M SS +W++ +A+LKE EEK GTP  KLRQVADAM VEMHAGLASEGGSKL MLIS+
Sbjct  25   RHRMISSRKWSRAIAILKEFEEKSGTPLAKLRQVADAMDVEMHAGLASEGGSKLNMLISF  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGK+KGV+ +E  EVSIP  LM G+SEALF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKDKGVIGQEFAEVSIPPQLMTGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  E E FH PP +QRELGFTFSFP RQTSI+
Sbjct  145  DFIASALAKFVAAEPEGFHPPPGRQRELGFTFSFPVRQTSIS  186



>ref|XP_010467922.1| PREDICTED: hexokinase-2 isoform X1 [Camelina sativa]
Length=502

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKAFEEDCATPVAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S+ LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFI   LA FV  EGEDFH+PP +QRELGFTFSFP +QTS++
Sbjct  145  DFIVEVLAKFVATEGEDFHLPPGRQRELGFTFSFPVKQTSLS  186



>ref|XP_010489125.1| PREDICTED: hexokinase-2-like [Camelina sativa]
Length=502

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKAFEEDCATPVAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S+ LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFI   LA FV  EGEDFH+PP +QRELGFTFSFP +QTS++
Sbjct  145  DFIVEVLAKFVATEGEDFHLPPGRQRELGFTFSFPVKQTSLS  186



>gb|KHG25517.1| Hexokinase-1 -like protein [Gossypium arboreum]
Length=498

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH ++SSG+WA+ +++L E EEKCGTP+ KL+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRIKSSGKWARALSILTEFEEKCGTPSSKLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKESRVVKQEFEEVSIPPHLMTGSSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  E +  H+ P +QRELGFTFSFP RQTSI+
Sbjct  145  DYIASALAKFVATESDSQHVSPGRQRELGFTFSFPVRQTSIS  186



>ref|XP_007024321.1| Hexokinase 2 [Theobroma cacao]
 gb|EOY26943.1| Hexokinase 2 [Theobroma cacao]
Length=498

 Score =   250 bits (638),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/159 (74%), Positives = 136/159 (86%), Gaps = 0/159 (0%)
 Frame = +2

Query  185  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  364
            M+ SGRW K + ++KE EEKCGTP  KLRQVADAM VEMHAGLASEGGSKLKMLISYVDN
Sbjct  28   MKKSGRWVKAMEIVKEFEEKCGTPIWKLRQVADAMTVEMHAGLASEGGSKLKMLISYVDN  87

Query  365  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  544
            LP+G+E+GLFYALDLGGTNFRV+RVQLGGK  G+VN++ +EVSIP  LM G+S+ALFD+I
Sbjct  88   LPTGNEKGLFYALDLGGTNFRVLRVQLGGKGSGIVNQQFKEVSIPPSLMTGTSDALFDYI  147

Query  545  AHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            A ELA FV +EG DF + P +QRELGFTFSFP  QTSI+
Sbjct  148  AVELAKFVAQEGTDFQLTPGRQRELGFTFSFPVMQTSIS  186



>ref|XP_006408903.1| hypothetical protein EUTSA_v10001968mg [Eutrema salsugineum]
 gb|ESQ50356.1| hypothetical protein EUTSA_v10001968mg [Eutrema salsugineum]
Length=499

 Score =   249 bits (637),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+WA+ + +LK LEE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILKVLEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEHGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPHLMTGGSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  EGEDFH+P  +QRELGFTFSFP RQTS++
Sbjct  145  NFIAEALAKFVATEGEDFHLPAGRQRELGFTFSFPVRQTSLS  186



>gb|KJB65034.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
 gb|KJB65035.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
 gb|KJB65036.1| hypothetical protein B456_010G077400 [Gossypium raimondii]
Length=498

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M+SSG+WA+ +++LKE EEKCGTP+  L+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRMKSSGKWARALSILKEFEEKCGTPSSNLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            V NLP+GDE+GLFYALDLGGTNFRV+RV LGGKE  VV +E +EVSIP HLM GSS+ LF
Sbjct  85   VHNLPTGDEKGLFYALDLGGTNFRVLRVHLGGKESRVVKQEFEEVSIPAHLMTGSSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  E +  H+ P +QRELGFTFSFP RQTSI+
Sbjct  145  DYIASALAKFVATESDSQHVSPGRQRELGFTFSFPVRQTSIS  186



>ref|XP_004510315.1| PREDICTED: hexokinase-1-like [Cicer arietinum]
Length=495

 Score =   249 bits (635),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 138/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            + HM+ S RW K +++LKE EEKC TP  KL+QVADAM VEMHAGLASEGGSKLKMLIS+
Sbjct  25   QRHMKKSRRWGKAMSILKEFEEKCATPTWKLKQVADAMTVEMHAGLASEGGSKLKMLISF  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            V NLP+G+EEGLFYALDLGGTNFRV+R+QLGGK+ G+++RE  EVSIP +LMVG+S ALF
Sbjct  85   VHNLPTGNEEGLFYALDLGGTNFRVLRMQLGGKDGGIISREFTEVSIPPNLMVGTSTALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA ELA FV +E +DF +PP ++RELGFTFSFP  QTSIA
Sbjct  145  DYIAAELAKFVNEESQDFQVPPGRKRELGFTFSFPVMQTSIA  186



>sp|Q9SEK3.1|HXK1_SPIOL RecName: Full=Hexokinase-1; AltName: Full=SoHxK1 [Spinacia oleracea]
 gb|AAF18584.1|AF118132_1 chloroplast outer envelope hexokinase 1 [Spinacia oleracea]
Length=498

 Score =   249 bits (635),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SS +W + +A+LKEL++ CGTP GKLRQVADAM VEMHAGLASEG SKLKMLISY
Sbjct  25   RQRMKSSSKWGRVMAILKELDDNCGTPLGKLRQVADAMTVEMHAGLASEGASKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE GLFYALDLGGTNFRV+RV+LGGKEK VV +E  EVSIP  LMVG+SE LF
Sbjct  85   VDNLPTGDEHGLFYALDLGGTNFRVLRVKLGGKEKRVVEQEFDEVSIPPELMVGTSEQLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA  LA FV  E E  H  P+KQRELGFTFSFP +QTSIA
Sbjct  145  DYIAEALAKFVATESEGLHPEPNKQRELGFTFSFPVKQTSIA  186



>ref|XP_003630707.1| Hexokinase [Medicago truncatula]
Length=610

 Score =   251 bits (642),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 121/162 (75%), Positives = 136/162 (84%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M SS +W ++V++LKE  EKC TP GKLRQ+ADAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMISSRKWTRSVSILKEFGEKCETPIGKLRQLADAMDVEMHAGLASEGGSKLSMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGKEKGV+++E  EVSIP  LM GSSE LF
Sbjct  85   VDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKEKGVISQEFDEVSIPPQLMTGSSEGLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV+ E E FH PP +QRELGFTFSFP +QTSIA
Sbjct  145  DFIAAALAKFVESEPEGFHPPPGRQRELGFTFSFPVKQTSIA  186



>emb|CDO97969.1| unnamed protein product [Coffea canephora]
Length=495

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MR S RWA+ +A+++ELEEKCG+P  KL+QVADAM VEMHAGLASEGGSKLKMLIS+
Sbjct  25   RHRMRCSSRWARAMAIVRELEEKCGSPEAKLKQVADAMTVEMHAGLASEGGSKLKMLISH  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDEEG++YALDLGGTNFRV+RV+LGGK  G+V++E  E SIP  LMVG+SEALF
Sbjct  85   VDNLPTGDEEGVYYALDLGGTNFRVLRVELGGKTGGIVSQEFAEASIPPELMVGTSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA F+ +E E +H PP +QRELGFTFSFP  Q SI
Sbjct  145  DYIAAELAKFITEEEEKYHPPPGRQRELGFTFSFPVMQNSI  185



>gb|AFO84083.1| hexokinase [Actinidia chinensis]
Length=497

 Score =   248 bits (634),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 135/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  188  RSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNL  367
            RSSGRW K  A+L+EL++KC TP GKLRQVAD MA EMHAGLASEGGS LKM+ISYVDNL
Sbjct  29   RSSGRWDKAAAILRELKDKCRTPIGKLRQVADDMAFEMHAGLASEGGSNLKMIISYVDNL  88

Query  368  PSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  547
            P+GDE+GLFYALDLGGTNFRV+RVQLGGK+K V  +E +EVSIP HLMVG+S ALFDFIA
Sbjct  89   PTGDEKGLFYALDLGGTNFRVLRVQLGGKDKYVAKQEFEEVSIPPHLMVGTSVALFDFIA  148

Query  548  HELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
              L  FV  EGEDFH+ P ++RELGFTFSFP +Q+SIA
Sbjct  149  EALKKFVDTEGEDFHLSPGRRRELGFTFSFPVKQSSIA  186



>ref|XP_004503491.1| PREDICTED: hexokinase-1-like isoform X2 [Cicer arietinum]
Length=498

 Score =   248 bits (633),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 119/162 (73%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M +S +W++ ++++KE EEKCGTP GKLRQ+ DAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMINSRKWSRALSIVKEFEEKCGTPIGKLRQLGDAMDVEMHAGLASEGGSKLSMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDEEGLFYALDLGGTNFRV+RV LGGKEKGV+ +E  EVSIP HLM GSSE LF
Sbjct  85   VDNLPTGDEEGLFYALDLGGTNFRVLRVHLGGKEKGVIGQEFDEVSIPPHLMTGSSEGLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV+ E E FH P  K RELGFTFSFP +QTSI+
Sbjct  145  DFIAAALAKFVESEPEVFHPPSGKLRELGFTFSFPVKQTSIS  186



>gb|AAP40021.1| hexokinase [Nicotiana benthamiana]
Length=497

 Score =   248 bits (632),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 135/161 (84%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
             H MR S +WA+ +A+L+E EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   NHRMRKSSKWARAMAILREFEEKCGTPDAKLKQVADAMTVEMHAGLASEGGSKLKMLITY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP +LMVG+SE LF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPNLMVGTSEELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV +E E F  PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVAEEEEKFQQPPGKQRELGFTFSFPVMQTSI  185



>ref|XP_010447886.1| PREDICTED: hexokinase-1 [Camelina sativa]
 ref|XP_010447887.1| PREDICTED: hexokinase-1 [Camelina sativa]
 ref|XP_010447888.1| PREDICTED: hexokinase-1 [Camelina sativa]
Length=496

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+W +  A+LK  EE C TP  KLRQVADAMAVEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVSAILKAFEEDCATPISKLRQVADAMAVEMHAGLASDGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK+  V  +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQDRVAKQEFEEVSIPPHLMTGGSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  EGEDFH+P  +QRELGFTFSFP RQTS++
Sbjct  145  NFIAEALAKFVATEGEDFHLPEGRQRELGFTFSFPVRQTSLS  186



>gb|ABI18156.1| hexokinase [Helianthus annuus]
Length=498

 Score =   247 bits (631),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 135/162 (83%), Gaps = 2/162 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M++SG+WAK + +LKE E+KCGTP  KLRQVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RHRMKNSGKWAKAMEILKEFEDKCGTPVSKLRQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RV+LGG   G V +E +EVSIP +LM+G SE LF
Sbjct  85   VDNLPTGDETGIFYALDLGGTNFRVLRVKLGG--VGNVKKEFKEVSIPPNLMIGKSEDLF  142

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA ELA FV  E ED  IPP  QRELGFTFSFP +Q+SIA
Sbjct  143  DFIAGELAKFVATEDEDMQIPPGTQRELGFTFSFPVKQSSIA  184



>ref|XP_010526433.1| PREDICTED: hexokinase-1 [Tarenaya hassleriana]
Length=499

 Score =   247 bits (631),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  MRSSG+WA+ +A+L+  EE C TP  KLRQVADA+ VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRRMRSSGKWARAMAILRAFEEDCATPIAKLRQVADALTVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRVMRV LGGKE  VV +E +EVSIP HLM G S+ LF
Sbjct  86   VDNLPTGDEKGLFYALDLGGTNFRVMRVLLGGKEGRVVKQEFEEVSIPPHLMTGGSDELF  145

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
             FIA  LA FV  EGEDFH  P +QRELGFTFSFP RQTS+
Sbjct  146  SFIAEALAKFVATEGEDFHPAPGRQRELGFTFSFPVRQTSL  186



>ref|XP_002886018.1| ATHXK2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62277.1| ATHXK2 [Arabidopsis lyrata subsp. lyrata]
Length=502

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSSGKWARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK+  VV RE +E SIP HLM G S  LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDRVVKREFKEESIPPHLMTGKSHELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFI   LA FV  EGEDFH+PP +QRELGFTFSFP +Q S++
Sbjct  145  DFIVDVLAKFVATEGEDFHLPPGRQRELGFTFSFPVKQISLS  186



>ref|XP_002515958.1| hexokinase, putative [Ricinus communis]
 gb|EEF46378.1| hexokinase, putative [Ricinus communis]
Length=494

 Score =   246 bits (629),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+  G+WA+ + ++KELEEKC TP GKL+QVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RQKMKKDGKWARVMEIVKELEEKCATPIGKLKQVADAMVVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G +YALDLGGTNFRV+RV LGGK+ G++N+E  EV IP +LM G+S+ALF
Sbjct  86   VDNLPTGDENGYYYALDLGGTNFRVLRVHLGGKDGGLINQEFAEVPIPPNLMTGTSDALF  145

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA EL  F+ +E E+FH PP K+RELGFTFSFP  QTSIA
Sbjct  146  DYIAAELVKFISQESEEFHPPPGKKRELGFTFSFPVIQTSIA  187



>ref|XP_007013020.1| Hexokinase 1 isoform 1 [Theobroma cacao]
 gb|EOY30639.1| Hexokinase 1 isoform 1 [Theobroma cacao]
Length=521

 Score =   247 bits (631),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 140/185 (76%), Gaps = 23/185 (12%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH ++SSG+WA+T+A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRIKSSGKWARTLAILKEFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  356  VDNLPSG-----------------------DEEGLFYALDLGGTNFRVMRVQLGGKEKGV  466
            VDNLP+G                       DE+GLFYALDLGGTNFRV+RVQLGGKE  V
Sbjct  85   VDNLPTGWDVSVVEHCHILISELFVLGIKHDEKGLFYALDLGGTNFRVLRVQLGGKESRV  144

Query  467  VNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTR  646
            V +E +EVSIP HLM GSS+ALFD+IA  LA FV  E E  H+ P +QRELGFTFSFP R
Sbjct  145  VKQEFEEVSIPPHLMTGSSDALFDYIASALAKFVATESEGLHVSPGRQRELGFTFSFPVR  204

Query  647  QTSIA  661
            QTSI+
Sbjct  205  QTSIS  209



>gb|AHY84734.1| hexokinase [Manihot esculenta]
Length=494

 Score =   246 bits (627),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            +  MR+  +WAK + ++K++EEKC TP GKL+Q+ADAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   KRKMRTGDKWAKAIEIVKDMEEKCATPIGKLKQIADAMVVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE GLFYALDLGGTNFRV+RVQLGGK+  +VN+E  EV IP +LM G+SE LF
Sbjct  86   VDNLPTGDENGLFYALDLGGTNFRVLRVQLGGKDGRLVNQEFAEVPIPPNLMTGTSEVLF  145

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA ELA FV +EGE+  +PP K RELGFTFSFP  QTSIA
Sbjct  146  DYIAAELAKFVAQEGEELRLPPGKMRELGFTFSFPVIQTSIA  187



>ref|XP_010047252.1| PREDICTED: hexokinase-2-like [Eucalyptus grandis]
 gb|KCW79118.1| hypothetical protein EUGRSUZ_C00559 [Eucalyptus grandis]
Length=508

 Score =   246 bits (627),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +2

Query  191  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  370
            S G+W +   ++KELEEKCGTP  KLRQVA+AM VEMHAGLAS+GGSKLKMLISYVD+LP
Sbjct  43   SDGKWERAAEMVKELEEKCGTPVWKLRQVAEAMVVEMHAGLASDGGSKLKMLISYVDSLP  102

Query  371  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  550
            +GDE+GL+YALDLGGTNFR++RV LGGKEKG++ RE +EVSIP HLM GSS  LFDFIA 
Sbjct  103  TGDEKGLYYALDLGGTNFRILRVHLGGKEKGIIKREYEEVSIPPHLMTGSSNELFDFIAM  162

Query  551  ELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             LA FV  EGED H+ P +QRELGFTFSFP RQ+SIA
Sbjct  163  ALAKFVATEGEDSHLYPGRQRELGFTFSFPVRQSSIA  199



>gb|AAL60584.1|AF454962_1 hexokinase [Brassica oleracea]
 emb|CDX82746.1| BnaC07g01200D [Brassica napus]
Length=499

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+WA+ + +L+ LEE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILRVLEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSG+E G FYALDLGGTNFRVMRV LGGK+  VV +E++EVSIP HLM   S+ LF
Sbjct  85   VDNLPSGEEHGFFYALDLGGTNFRVMRVLLGGKQGRVVKQEAKEVSIPPHLMTSGSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  EGEDFH+P  +QRELGFTFSFP +QTS++
Sbjct  145  NFIAEALANFVATEGEDFHLPEGRQRELGFTFSFPVKQTSLS  186



>gb|AAT77514.1| hexokinase 4 [Nicotiana sylvestris]
Length=355

 Score =   241 bits (615),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
             H MR S +W + +A+L+E EEKC T   KL+QVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   NHRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVADAMTVEMHAGLASEGGSKLKMLITY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP  LMVG+S+ALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPSLMVGTSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV  E E FH PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVAAEEEKFHQPPGKQRELGFTFSFPVMQTSI  185



>ref|XP_010433133.1| PREDICTED: hexokinase-1-like [Camelina sativa]
 ref|XP_010433134.1| PREDICTED: hexokinase-1-like [Camelina sativa]
Length=499

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+W +  A+LK  EE C TP  KLRQVADAMAVEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVSAILKAFEEDCATPISKLRQVADAMAVEMHAGLASDGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK+  V  +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQDRVAKQEFEEVSIPPHLMTGGSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  E EDFH+P  +QRELGFTFSFP RQTS++
Sbjct  145  NFIAEALAKFVATESEDFHLPEGRQRELGFTFSFPVRQTSLS  186



>ref|XP_010047667.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
Length=510

 Score =   245 bits (626),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 133/157 (85%), Gaps = 0/157 (0%)
 Frame = +2

Query  191  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  370
            S G+W +   ++KELEEKCGTP  KLRQVA+AM VEMHAGLAS+GGSKLKMLISYVD+LP
Sbjct  45   SDGKWERAAEMVKELEEKCGTPVWKLRQVAEAMVVEMHAGLASDGGSKLKMLISYVDSLP  104

Query  371  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  550
            +GDE+GL+YALDLGGTNFR++RV LGGKEKG++ RE +EVSIP HLM GSS  LFDFIA 
Sbjct  105  TGDEKGLYYALDLGGTNFRILRVHLGGKEKGIIKREYEEVSIPPHLMTGSSNELFDFIAM  164

Query  551  ELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             LA FV  EGED H+ P +QRELGFTFSFP RQ+SIA
Sbjct  165  ALAKFVATEGEDSHLYPGRQRELGFTFSFPVRQSSIA  201



>ref|NP_194642.1| hexokinase 1 [Arabidopsis thaliana]
 sp|Q42525.2|HXK1_ARATH RecName: Full=Hexokinase-1; AltName: Full=Protein GLUCOSE INSENSITIVE 
2 [Arabidopsis thaliana]
 gb|AAB49908.1| hexokinase 1 [Arabidopsis thaliana]
 emb|CAB43927.1| hexokinase [Arabidopsis thaliana]
 emb|CAB79671.1| hexokinase [Arabidopsis thaliana]
 gb|AAL77665.1| AT4g29130/F19B15_160 [Arabidopsis thaliana]
 gb|AAM70518.1| AT4g29130/F19B15_160 [Arabidopsis thaliana]
 dbj|BAF02067.1| hexokinase [Arabidopsis thaliana]
 gb|AEE85590.1| hexokinase 1 [Arabidopsis thaliana]
Length=496

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK++ VV +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQERVVKQEFEEVSIPPHLMTGGSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  E EDFH+P  +QRELGFTFSFP +QTS++
Sbjct  145  NFIAEALAKFVATECEDFHLPEGRQRELGFTFSFPVKQTSLS  186



>ref|XP_002867423.1| ATHXK1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43682.1| ATHXK1 [Arabidopsis lyrata subsp. lyrata]
Length=496

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK++ VV +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQERVVKQEFEEVSIPPHLMTGGSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  E EDFH+P  +QRELGFTFSFP +QTS++
Sbjct  145  NFIAEALAKFVATECEDFHLPEGRQRELGFTFSFPVKQTSLS  186



>ref|XP_010438337.1| PREDICTED: hexokinase-1-like [Camelina sativa]
Length=499

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+W +  A+LK  EE C TP  KLRQVADAMAVEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVSAILKAFEEDCATPISKLRQVADAMAVEMHAGLASDGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK+  V  +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQDRVAKQEFEEVSIPPHLMTGGSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  E EDFH+P  +QRELGFTFSFP RQTS++
Sbjct  145  NFIAEALAKFVATESEDFHLPEGRQRELGFTFSFPVRQTSLS  186



>gb|AAO24584.1| At2g19860 [Arabidopsis thaliana]
 dbj|BAE99655.1| hexokinase [Arabidopsis thaliana]
Length=502

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+S+G+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSAGKWARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK   VV RE +E SIP HLM G S  LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKHDRVVKREFKEESIPPHLMTGKSHELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFI   LA FV  EGEDFH+PP +QRELGFTFSFP +Q S++
Sbjct  145  DFIVDVLAKFVATEGEDFHLPPGRQRELGFTFSFPVKQLSLS  186



>ref|NP_179576.1| hexokinase 2 [Arabidopsis thaliana]
 sp|P93834.1|HXK2_ARATH RecName: Full=Hexokinase-2 [Arabidopsis thaliana]
 gb|AAB49911.1| hexokinase 2 [Arabidopsis thaliana]
 gb|AAC62130.1| hexokinase (ATHXK2) [Arabidopsis thaliana]
 gb|AEC06934.1| hexokinase 2 [Arabidopsis thaliana]
Length=502

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 128/162 (79%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+S+G+WA+ + +LK  EE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSAGKWARVIEILKAFEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE G FYALDLGGTNFRVMRV LGGK   VV RE +E SIP HLM G S  LF
Sbjct  85   VDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKHDRVVKREFKEESIPPHLMTGKSHELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFI   LA FV  EGEDFH+PP +QRELGFTFSFP +Q S++
Sbjct  145  DFIVDVLAKFVATEGEDFHLPPGRQRELGFTFSFPVKQLSLS  186



>emb|CDY35895.1| BnaA07g00920D [Brassica napus]
Length=500

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+WA+ + +L+ LEE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILRVLEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSG+E G FYALDLGGTNFRVMRV LGGKE  VV +E++EVSIP HLM   S+ LF
Sbjct  85   VDNLPSGEEHGFFYALDLGGTNFRVMRVLLGGKEGRVVKQEAKEVSIPPHLMTSGSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  EGEDFH+P  +QRELGFTFSFP +QTS++
Sbjct  145  NFIAEALANFVATEGEDFHLPEGRQRELGFTFSFPVKQTSLS  186



>ref|XP_009102132.1| PREDICTED: hexokinase-1 [Brassica rapa]
Length=500

 Score =   244 bits (624),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+WA+ + +L+ LEE C TP  KLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMQSSGKWARVIEILRVLEEDCATPIAKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSG+E G FYALDLGGTNFRVMRV LGGKE  VV +E++EVSIP HLM   S+ LF
Sbjct  85   VDNLPSGEEHGFFYALDLGGTNFRVMRVLLGGKEGRVVKQEAKEVSIPPHLMTSGSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  EGEDFH+P  +QRELGFTFSFP +QTS++
Sbjct  145  NFIAEALANFVATEGEDFHLPEGRQRELGFTFSFPVKQTSLS  186



>gb|AAL60583.1|AF454961_1 hexokinase [Brassica oleracea]
Length=499

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+S G+W + + +LK  EE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSCGKWGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP  LM G+S+ LF
Sbjct  85   VDNLPSGDEQGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  EGEDFH+P  +QRELGFTFSFP +QTS+ 
Sbjct  145  NFIAEALAKFVATEGEDFHLPAGRQRELGFTFSFPVKQTSLC  186



>emb|CDY03331.1| BnaC09g10170D [Brassica napus]
Length=499

 Score =   244 bits (623),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+S G+W + + +LK  EE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSCGKWGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP  LM G+S+ LF
Sbjct  85   VDNLPSGDEQGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  EGEDFH+P  +QRELGFTFSFP +QTS+ 
Sbjct  145  NFIAEALARFVATEGEDFHLPAGRQRELGFTFSFPVKQTSLC  186



>ref|XP_010915379.1| PREDICTED: hexokinase-2-like [Elaeis guineensis]
Length=507

 Score =   244 bits (622),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 137/162 (85%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  ++S  RWA+ V ++KELEE+C TP G L+QVA+AMA+EM AGLASEG SKLKMLISY
Sbjct  25   RRRIQSVVRWARAVEIVKELEERCATPIGLLKQVANAMAMEMQAGLASEGDSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ VV +ES EVSIP+HLMVGSS  LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVLRVQLGGKERHVVKQESTEVSIPQHLMVGSSAELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA EL+ FV  EG+DFH+    QRE+GFTFSFP +Q+SIA
Sbjct  145  EFIAAELSKFVASEGDDFHLSVGSQREIGFTFSFPVKQSSIA  186



>gb|KFK40349.1| hypothetical protein AALP_AA3G362600 [Arabis alpina]
Length=500

 Score =   243 bits (621),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M S+G+W + + +LK LEE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLIS+
Sbjct  25   RRRMHSTGKWGRVIEILKVLEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISF  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSG E+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGHEKGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPHLMTGGSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA F+  EGEDFH+P  +QRELGFTFSFP +QTS++
Sbjct  145  DFIAEALAKFIATEGEDFHLPEGRQRELGFTFSFPVKQTSLS  186



>gb|KFK29465.1| hypothetical protein AALP_AA7G137600 [Arabis alpina]
Length=498

 Score =   243 bits (619),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+W + +A+LK  EE C TP  KL+QVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVLAILKAFEEDCATPISKLKQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP HLM   S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPHLMTSGSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  EGEDFH+P  +QRELGFTFSFP  QTS++
Sbjct  145  NFIAEALAKFVATEGEDFHLPAGRQRELGFTFSFPVWQTSLS  186



>ref|XP_003627048.1| Hexokinase [Medicago truncatula]
 gb|AET01524.1| hexokinase [Medicago truncatula]
Length=494

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 137/160 (86%), Gaps = 1/160 (1%)
 Frame = +2

Query  182  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  361
            +++ S RW K +A+LKE EEKC TP  KL+QVADAM VEMHAGLAS+GGSKLKMLIS+VD
Sbjct  27   YVKKSKRWGKAIAILKEFEEKCATPTLKLKQVADAMTVEMHAGLASDGGSKLKMLISFVD  86

Query  362  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  541
            NLP+G+EEGLFYALDLGGTNFRV+RVQLGGK+ GVV +E  EVSIP +LMVG+S  LFD+
Sbjct  87   NLPTGNEEGLFYALDLGGTNFRVLRVQLGGKD-GVVGQEFTEVSIPPNLMVGTSHELFDY  145

Query  542  IAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            IA EL+ FV +E EDF +PP ++RELGFTFSFP +QTSI+
Sbjct  146  IAAELSKFVNEESEDFKVPPGRKRELGFTFSFPVKQTSIS  185



>gb|KJB56835.1| hypothetical protein B456_009G137700 [Gossypium raimondii]
Length=498

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/158 (73%), Positives = 134/158 (85%), Gaps = 0/158 (0%)
 Frame = +2

Query  188  RSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNL  367
            + SGRW K + +LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKMLISYVD+L
Sbjct  29   KKSGRWVKAMEILKEFEEKCGTPIPKLKQVADAMIVEMHAGLASEGGSKLKMLISYVDHL  88

Query  368  PSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  547
            P+G E+GLFYALDLGGTNFRV+RVQLGGK +G+VN++ +EVSIP  LM GSS+ALFD+IA
Sbjct  89   PTGREKGLFYALDLGGTNFRVLRVQLGGKGRGIVNQQFEEVSIPPSLMTGSSDALFDYIA  148

Query  548  HELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             ELA FV +EG DF   P +QRELGFTFSFP  Q+SIA
Sbjct  149  AELAKFVAQEGSDFKQSPGRQRELGFTFSFPVMQSSIA  186



>ref|XP_006585566.1| PREDICTED: hexokinase-1-like isoform X3 [Glycine max]
Length=375

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = +2

Query  182  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  361
            + R   RWAK + +LKELEEKC TP  KL+ VADAM VEMHAGLASEGGSKLKMLI+YVD
Sbjct  24   YARKCRRWAKAIEILKELEEKCATPTWKLKLVADAMNVEMHAGLASEGGSKLKMLITYVD  83

Query  362  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  541
             LP+G+EEGL+YALDLGGTNFRV+RVQLGGK  G++++E  EVSIP +LMVG+S+ LFD+
Sbjct  84   KLPTGNEEGLYYALDLGGTNFRVLRVQLGGKYGGIISQEFTEVSIPPNLMVGTSDELFDY  143

Query  542  IAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            IA ELA FV +E +DF + P +QRELGFTFSFP  QTS+A
Sbjct  144  IAAELAKFVAQENQDFQVSPGRQRELGFTFSFPVMQTSLA  183



>ref|XP_006343033.1| PREDICTED: hexokinase-1-like [Solanum tuberosum]
Length=497

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
             H MR S +W + +A+L+E EEKC T   KL+QVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   NHRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVADAMTVEMHAGLASEGGSKLKMLITY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP  LMVG+S+ALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPSLMVGTSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV  E E FH PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVAAEEEKFHQPPGKQRELGFTFSFPVMQTSI  185



>ref|XP_006585567.1| PREDICTED: hexokinase-1-like isoform X4 [Glycine max]
Length=360

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  179  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  358
             + R   RWAK + +LKELEEKC TP  KL+ VADAM VEMHAGLASEGGSKLKMLI+YV
Sbjct  23   RYARKCRRWAKAIEILKELEEKCATPTWKLKLVADAMNVEMHAGLASEGGSKLKMLITYV  82

Query  359  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  538
            D LP+G+EEGL+YALDLGGTNFRV+RVQLGGK  G++++E  EVSIP +LMVG+S+ LFD
Sbjct  83   DKLPTGNEEGLYYALDLGGTNFRVLRVQLGGKYGGIISQEFTEVSIPPNLMVGTSDELFD  142

Query  539  FIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +IA ELA FV +E +DF + P +QRELGFTFSFP  QTS+A
Sbjct  143  YIAAELAKFVAQENQDFQVSPGRQRELGFTFSFPVMQTSLA  183



>gb|AAT77515.1| hexokinase 7 [Nicotiana tabacum]
Length=497

 Score =   242 bits (617),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
             H MR S +W + +A+L+E EEKC T   KL+QVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   NHRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVADAMTVEMHAGLASEGGSKLKMLITY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP  LMVG+S+ALF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPSLMVGTSDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV  E E FH PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVAAEEEKFHQPPGKQRELGFTFSFPVMQTSI  185



>sp|Q2KNB9.1|HXK2_ORYSJ RecName: Full=Hexokinase-2; AltName: Full=Hexokinase-3 [Oryza 
sativa Japonica Group]
 gb|AAX68419.1| hexokinase 3 [Oryza sativa Japonica Group]
 gb|AAZ93619.1| hexokinase 2 [Oryza sativa Japonica Group]
 gb|EEE64471.1| hypothetical protein OsJ_19321 [Oryza sativa Japonica Group]
Length=494

 Score =   241 bits (615),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  +R + RW +  A+L+ELEE+C  P G+LRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  22   RRQLREAKRWGRADAVLRELEERCAAPPGRLRQVADAMAVEMHAGLASEGGSKLKMIISY  81

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD LPSG+E+G+FYALDLGGTNFRV+RVQLGGKE  V+ +E  E+SIP HLM G S  LF
Sbjct  82   VDALPSGEEKGVFYALDLGGTNFRVLRVQLGGKEGRVIKQEHDEISIPPHLMTGGSNELF  141

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGEDFH+   +QRELGFTFSFP +QTSIA
Sbjct  142  DFIASSLAKFVASEGEDFHLAEGRQRELGFTFSFPVKQTSIA  183



>ref|XP_006585565.1| PREDICTED: hexokinase-1-like isoform X2 [Glycine max]
Length=381

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = +2

Query  182  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  361
            + R   RWAK + +LKELEEKC TP  KL+ VADAM VEMHAGLASEGGSKLKMLI+YVD
Sbjct  24   YARKCRRWAKAIEILKELEEKCATPTWKLKLVADAMNVEMHAGLASEGGSKLKMLITYVD  83

Query  362  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  541
             LP+G+EEGL+YALDLGGTNFRV+RVQLGGK  G++++E  EVSIP +LMVG+S+ LFD+
Sbjct  84   KLPTGNEEGLYYALDLGGTNFRVLRVQLGGKYGGIISQEFTEVSIPPNLMVGTSDELFDY  143

Query  542  IAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            IA ELA FV +E +DF + P +QRELGFTFSFP  QTS+A
Sbjct  144  IAAELAKFVAQENQDFQVSPGRQRELGFTFSFPVMQTSLA  183



>gb|KDO51805.1| hypothetical protein CISIN_1g0115051mg, partial [Citrus sinensis]
Length=190

 Score =   231 bits (590),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 109/158 (69%), Positives = 130/158 (82%), Gaps = 0/158 (0%)
 Frame = +2

Query  185  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  364
            ++  G+  K   ++KE EEKC TPA KL+QVADAM VEMHAGLASEGGSKLKM+ISYVDN
Sbjct  28   VKRGGKCGKANGIMKEFEEKCRTPAAKLKQVADAMTVEMHAGLASEGGSKLKMIISYVDN  87

Query  365  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  544
            LP+GDE+G +YALDLGGTNFRV+RV LGGK  G++N+E  EVSIP HLM G+S+ALFD+I
Sbjct  88   LPTGDEKGTYYALDLGGTNFRVLRVHLGGKGVGLINQEFAEVSIPPHLMTGTSDALFDYI  147

Query  545  AHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            A ELA FV +E E+F + P +QRELGFTFSFP  QTSI
Sbjct  148  AAELAKFVSQESEEFKLSPGRQRELGFTFSFPVMQTSI  185



>pdb|4QS7|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure In Glucose-bound 
Form
 pdb|4QS8|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Structure In Ligand-free 
Form
Length=474

 Score =   240 bits (613),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +2

Query  191  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  370
            SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISYVDNLP
Sbjct  8    SSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISYVDNLP  67

Query  371  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  550
            SGDE+GLFYALDLGGTNFRVMRV LGGK++ VV +E +EVSIP HLM G S+ LF+FIA 
Sbjct  68   SGDEKGLFYALDLGGTNFRVMRVLLGGKQERVVKQEFEEVSIPPHLMTGGSDELFNFIAE  127

Query  551  ELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             LA FV  E EDFH+P  +QRELGFTFSFP +QTS++
Sbjct  128  ALAKFVATECEDFHLPEGRQRELGFTFSFPVKQTSLS  164



>gb|KHG28915.1| Hexokinase-1 [Gossypium arboreum]
Length=497

 Score =   241 bits (615),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +2

Query  185  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  364
            M+ SG+W K + ++KE EEKC TP  KLRQVADAM VEMHAGLASEGGSKLKMLISYVDN
Sbjct  28   MKKSGKWEKAMEIVKEFEEKCATPISKLRQVADAMLVEMHAGLASEGGSKLKMLISYVDN  87

Query  365  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  544
            LP+G+E+GLFYALDLGGTNFRV+R+ LGGK +G+V+++ +EVSIPR LM G+S+ALFDFI
Sbjct  88   LPTGNEKGLFYALDLGGTNFRVLRLHLGGKGRGIVSKQFEEVSIPRSLMTGTSDALFDFI  147

Query  545  AHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
              ELA FV +EG DF + P +QRELGFTFSFP  Q+SI+
Sbjct  148  VAELAKFVAQEGMDFELRPGRQRELGFTFSFPVLQSSIS  186



>gb|KJB70380.1| hypothetical protein B456_011G070700 [Gossypium raimondii]
Length=497

 Score =   241 bits (614),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 112/159 (70%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +2

Query  185  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  364
            M+ SG+W K + ++KE EEKC TP  KLRQVADAM VEMHAGLASEGGSKLKMLISYVDN
Sbjct  28   MKKSGKWEKAMEIVKEFEEKCATPISKLRQVADAMLVEMHAGLASEGGSKLKMLISYVDN  87

Query  365  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  544
            LP+G+E+GLFYALDLGGTNFRV+R+ LGGK +G+V+++ +EVSIPR LM G+S+ALFDFI
Sbjct  88   LPTGNEKGLFYALDLGGTNFRVLRLHLGGKGRGIVSKQFEEVSIPRSLMTGTSDALFDFI  147

Query  545  AHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
              ELA FV +EG DF + P +QRELGFTFSFP  Q+SI+
Sbjct  148  VAELAKFVAQEGMDFELRPGRQRELGFTFSFPVLQSSIS  186



>emb|CDY48733.1| BnaA09g10080D [Brassica napus]
Length=499

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+S G+W + + +LK  EE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSCGKWGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP  LM G+S+ LF
Sbjct  85   VDNLPSGDEQGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  EGEDFH+   +QRELGFTFSFP +QTS+ 
Sbjct  145  NFIAEALAKFVATEGEDFHLQAGRQRELGFTFSFPVKQTSLC  186



>ref|XP_009112637.1| PREDICTED: hexokinase-1-like [Brassica rapa]
Length=499

 Score =   241 bits (614),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+S G+W + + +LK  EE C TP GKLRQVADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMKSCGKWGRVIEILKVFEEDCATPIGKLRQVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+G FYALDLGGTNFRVMRV LGGK+  VV +E +EVSIP  LM G+S+ LF
Sbjct  85   VDNLPSGDEQGFFYALDLGGTNFRVMRVLLGGKQDRVVKQEFEEVSIPPPLMTGASDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  EGEDFH+   +QRELGFTFSFP +QTS+ 
Sbjct  145  NFIAEALAKFVATEGEDFHLQAGRQRELGFTFSFPVKQTSLC  186



>gb|AIX02984.1| hexokinase [Morella rubra]
Length=497

 Score =   240 bits (613),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 133/162 (82%), Gaps = 1/162 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRSSG+WA+   +LK+ EEKC TP GKLR VADAM VEMHAGLASEGGSKLK+LIS+
Sbjct  25   RHRMRSSGKWARVTEILKDFEEKCATPDGKLRHVADAMTVEMHAGLASEGGSKLKILISF  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG ++ V+ +E QEVSIP HLM  +SEALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGXDQRVIKQEFQEVSIPPHLMTETSEALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D IA  LA FV  E E  H PP +QRELGFTFSFP RQ S++
Sbjct  145  DNIAKALANFVATEDEGVH-PPGRQRELGFTFSFPVRQLSLS  185



>pdb|4QS9|A Chain A, Arabidopsis Hexokinase 1 (athxk1) Mutant S177a Structure 
In Glucose- Bound Form
Length=474

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 131/157 (83%), Gaps = 0/157 (0%)
 Frame = +2

Query  191  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  370
            SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISYVDNLP
Sbjct  8    SSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISYVDNLP  67

Query  371  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  550
            SGDE+GLFYALDLGGTNFRVMRV LGGK++ VV +E +EVSIP HLM G S+ LF+FIA 
Sbjct  68   SGDEKGLFYALDLGGTNFRVMRVLLGGKQERVVKQEFEEVSIPPHLMTGGSDELFNFIAE  127

Query  551  ELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             LA FV  E EDFH+P  +QRELGFTF+FP +QTS++
Sbjct  128  ALAKFVATECEDFHLPEGRQRELGFTFAFPVKQTSLS  164



>ref|NP_001233957.1| hexokinase [Solanum lycopersicum]
 emb|CAC81350.1| hexokinase [Solanum lycopersicum]
Length=498

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 131/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
             H MR S +W + +A+L+E EEKC T   KL+QVADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   NHRMRKSSKWGRAMAILREFEEKCKTQDAKLKQVADAMTVEMHAGLASEGGSKLKMLITY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE G+FYALDLGGTNFRV+RVQLGGK+ G++++E  E SIP  LMVG+S+ LF
Sbjct  85   VDNLPTGDEAGVFYALDLGGTNFRVLRVQLGGKDGGIIHQEFAEASIPPSLMVGTSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV  E E FH PP KQRELGFTFSFP  QTSI
Sbjct  145  DYIAAELAKFVAAEEEKFHQPPGKQRELGFTFSFPVMQTSI  185



>gb|EYU21451.1| hypothetical protein MIMGU_mgv1a005070mg [Erythranthe guttata]
Length=498

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/161 (68%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M++SGRWA+ + ++KE EEKCGTP GKL+QVADA+ VEMHAGLASEGGSKLKMLISY
Sbjct  29   RQRMKTSGRWARAMGIVKEFEEKCGTPEGKLKQVADALTVEMHAGLASEGGSKLKMLISY  88

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD+LP+G+E+G+FYALDLGGTNFRV+RV+LGG+E+G++++E  E SIP  LM G+S+ALF
Sbjct  89   VDSLPTGNEKGVFYALDLGGTNFRVLRVELGGREEGIIHQEFAEASIPPALMCGNSDALF  148

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA +LA F+ +E + FH P  +QRELGFTFSFP  QTSI
Sbjct  149  DYIAEKLASFIDEEEQRFHQPAGRQRELGFTFSFPVMQTSI  189



>gb|EAY98804.1| hypothetical protein OsI_20748 [Oryza sativa Indica Group]
Length=494

 Score =   239 bits (611),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  +R + RW +  A+L+ELEE+C  P  +LRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  22   RRQLREAKRWGRADAVLRELEERCAAPPARLRQVADAMAVEMHAGLASEGGSKLKMIISY  81

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD LPSG+E+G+FYALDLGGTNFRV+RVQLGGKE  V+ +E  E+SIP HLM G S  LF
Sbjct  82   VDALPSGEEKGVFYALDLGGTNFRVLRVQLGGKEGRVIKQEHDEISIPPHLMTGGSNELF  141

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGEDFH+   +QRELGFTFSFP +QTSIA
Sbjct  142  DFIASSLAKFVASEGEDFHLAEGRQRELGFTFSFPVKQTSIA  183



>ref|XP_006285258.1| hypothetical protein CARUB_v10006629mg [Capsella rubella]
 gb|EOA18156.1| hypothetical protein CARUB_v10006629mg [Capsella rubella]
Length=496

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSG+W + +A+LK  EE C TP  KLRQVADAM VEMHAGLAS+GGSKLKMLISY
Sbjct  25   RRRMQSSGKWGRVLAILKAFEEDCATPISKLRQVADAMTVEMHAGLASDGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLPSGDE+GLFYALDLGGTNFRVMRV LGGKE+ V  +E +EVSIP HLM G S+ LF
Sbjct  85   VDNLPSGDEKGLFYALDLGGTNFRVMRVLLGGKEERVAKQEFEEVSIPPHLMTGGSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +FIA  LA FV  E E+F +P  +QRELGFTFSFP +QTS++
Sbjct  145  NFIAEALAKFVATECEEFRLPEGRQRELGFTFSFPVKQTSLS  186



>ref|XP_003533038.1| PREDICTED: hexokinase-1-like isoform X1 [Glycine max]
 gb|KHN05328.1| Hexokinase-1 [Glycine soja]
Length=492

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 133/160 (83%), Gaps = 0/160 (0%)
 Frame = +2

Query  182  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  361
            + R   RWAK + +LKELEEKC TP  KL+ VADAM VEMHAGLASEGGSKLKMLI+YVD
Sbjct  24   YARKCRRWAKAIEILKELEEKCATPTWKLKLVADAMNVEMHAGLASEGGSKLKMLITYVD  83

Query  362  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  541
             LP+G+EEGL+YALDLGGTNFRV+RVQLGGK  G++++E  EVSIP +LMVG+S+ LFD+
Sbjct  84   KLPTGNEEGLYYALDLGGTNFRVLRVQLGGKYGGIISQEFTEVSIPPNLMVGTSDELFDY  143

Query  542  IAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            IA ELA FV +E +DF + P +QRELGFTFSFP  QTS+A
Sbjct  144  IAAELAKFVAQENQDFQVSPGRQRELGFTFSFPVMQTSLA  183



>ref|XP_012069075.1| PREDICTED: hexokinase-1-like isoform X2 [Jatropha curcas]
Length=468

 Score =   238 bits (606),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  MR  G+ AK + ++KEL+E+C TP  KL+QV DAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRKMRRDGKLAKAMEIVKELKEQCATPIAKLKQVGDAMVVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE GLFYALDLGGTNFRV+RV LGGK+  +VN+E  EV IP +LM G+S+ALF
Sbjct  86   VDNLPTGDENGLFYALDLGGTNFRVLRVHLGGKDGRLVNQEFAEVPIPPNLMTGTSDALF  145

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA ELA FV +E E F +PP K+RELGFTFSFP  QTSIA
Sbjct  146  DYIAAELAKFVAQEDEKFQLPPGKKRELGFTFSFPVTQTSIA  187



>gb|KCW79624.1| hypothetical protein EUGRSUZ_C00983 [Eucalyptus grandis]
Length=456

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 128/147 (87%), Gaps = 0/147 (0%)
 Frame = +2

Query  221  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  400
            ++KELEEKCGTP  KLRQVA+AM VEMHAGLAS+GGSKLKMLISYVD+LP+GDE+GL+YA
Sbjct  1    MVKELEEKCGTPVWKLRQVAEAMVVEMHAGLASDGGSKLKMLISYVDSLPTGDEKGLYYA  60

Query  401  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEG  580
            LDLGGTNFR++RV LGGKEKG++ RE +EVSIP HLM GSS  LFDFIA  LA FV  EG
Sbjct  61   LDLGGTNFRILRVHLGGKEKGIIKREYEEVSIPPHLMTGSSNELFDFIAMALAKFVATEG  120

Query  581  EDFHIPPDKQRELGFTFSFPTRQTSIA  661
            ED H+ P +QRELGFTFSFP RQ+SIA
Sbjct  121  EDSHLYPGRQRELGFTFSFPVRQSSIA  147



>ref|XP_006853711.1| PREDICTED: hexokinase-1 [Amborella trichopoda]
 gb|ERN15178.1| hypothetical protein AMTR_s00056p00151260 [Amborella trichopoda]
Length=500

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH ++SS +W +  A+LKE E++C TP  KLRQVADAM VEMHAGLASEGGSKLKM++SY
Sbjct  25   RHRLKSSRQWGRVSAILKETEDQCATPIQKLRQVADAMHVEMHAGLASEGGSKLKMILSY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+GLFYALDLGGTNFRV+RVQLGGKE  V  +E  EVSIP +LMVG+S  LF
Sbjct  85   VDNLPTGNEKGLFYALDLGGTNFRVLRVQLGGKEGRVAKQEFTEVSIPPNLMVGTSYELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA ELA FV  EG++F +P  +QRELGFTFSFP +QTSI+
Sbjct  145  DYIAAELAKFVATEGDEFQLPVGRQRELGFTFSFPVKQTSIS  186



>ref|XP_011072439.1| PREDICTED: hexokinase-1-like [Sesamum indicum]
Length=514

 Score =   238 bits (607),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 132/161 (82%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M++S RWA+ +A+LKE EEKC TP  KLRQVADA+ VEMHAGLASEGGSKLKMLISY
Sbjct  29   RQRMKNSSRWARAMAILKEFEEKCATPEAKLRQVADALTVEMHAGLASEGGSKLKMLISY  88

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD+LP+G+EEG FYALDLGGTNFRV+RVQLGGK  G+V++E  EVSIP  LM G+S+ALF
Sbjct  89   VDSLPTGNEEGAFYALDLGGTNFRVLRVQLGGKTGGIVHQEFAEVSIPPALMSGTSDALF  148

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+I   LA FV +E   F  PPD+Q+ELGFTFSFP  QTS+
Sbjct  149  DYIVENLASFVAEEEHRFQQPPDRQKELGFTFSFPVMQTSL  189



>ref|XP_012069074.1| PREDICTED: hexokinase-1-like isoform X1 [Jatropha curcas]
 gb|KDP40854.1| hypothetical protein JCGZ_24853 [Jatropha curcas]
Length=501

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  MR  G+ AK + ++KEL+E+C TP  KL+QV DAM VEMHAGLASEGGSKLKMLISY
Sbjct  26   RRKMRRDGKLAKAMEIVKELKEQCATPIAKLKQVGDAMVVEMHAGLASEGGSKLKMLISY  85

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE GLFYALDLGGTNFRV+RV LGGK+  +VN+E  EV IP +LM G+S+ALF
Sbjct  86   VDNLPTGDENGLFYALDLGGTNFRVLRVHLGGKDGRLVNQEFAEVPIPPNLMTGTSDALF  145

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            D+IA ELA FV +E E F +PP K+RELGFTFSFP  QTSIA
Sbjct  146  DYIAAELAKFVAQEDEKFQLPPGKKRELGFTFSFPVTQTSIA  187



>ref|XP_010047255.1| PREDICTED: hexokinase-2-like [Eucalyptus grandis]
Length=244

 Score =   228 bits (582),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  191  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  370
            + G+W +   ++KELEEKCGTP  KLRQVADAM VEMHAGLA +GGSKLKMLISYVD+LP
Sbjct  42   TDGKWERAAEMVKELEEKCGTPVWKLRQVADAMVVEMHAGLAYDGGSKLKMLISYVDSLP  101

Query  371  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  550
            +GDE+GL+YALDLGGT+F V+ V L  KEKG+V RE +EVS P HLM GSS  LFDFIA 
Sbjct  102  TGDEKGLYYALDLGGTDFCVLHVHLSRKEKGIVKREFEEVSTPPHLMTGSSNELFDFIAM  161

Query  551  ELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             L  FV  EGED H+ P +QRELGFTFSFP RQ+SIA
Sbjct  162  ALTKFVATEGEDSHLYPGRQRELGFTFSFPVRQSSIA  198



>gb|EPS70676.1| hexokinase 1a, partial [Genlisea aurea]
Length=490

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 133/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+SSGRWA+  ++LKE EE+C TP GKL+Q+ADAM VEMHAGL SEGGSKLKMLISY
Sbjct  25   RQRMKSSGRWARVSSILKEFEERCDTPEGKLKQIADAMTVEMHAGLVSEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDEEG+FYALDLGGTNFRV+RVQLGGK+ G+V++E  E SIP  LM  +S++LF
Sbjct  85   VDNLPTGDEEGVFYALDLGGTNFRVLRVQLGGKDGGIVHQEFAEASIPPPLMSATSDSLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            DFIA +LA FV++E   +  P  K+RELGFTFSFP  QTSI
Sbjct  145  DFIAEKLAKFVEEEEHVYQQPDGKKRELGFTFSFPVMQTSI  185



>dbj|BAJ89593.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  MR + RW +  A+L+ L+E+C  P  +LRQVADA+AVEMHAGLASEGGSKL M+ISY
Sbjct  24   RRQMREAKRWGRADAVLRGLDERCAAPPARLRQVADAVAVEMHAGLASEGGSKLGMIISY  83

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD+LPSG E+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +E+SIP HLM G+S+ LF
Sbjct  84   VDSLPSGQEKGLFYALDLGGTNFRVLRVQLGGKEGRVVKQECEEISIPAHLMTGTSQELF  143

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGEDFH+   +QRELGFTFSFP +Q+SIA
Sbjct  144  DFIAAALAKFVSSEGEDFHLLEGRQRELGFTFSFPVKQSSIA  185



>ref|XP_004135675.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 ref|XP_011659954.1| PREDICTED: hexokinase-1-like [Cucumis sativus]
 gb|KGN66181.1| hypothetical protein Csa_1G574970 [Cucumis sativus]
Length=498

 Score =   235 bits (600),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/162 (70%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M++ G+W+K + +LKE E+KC T   K++Q+A+AMAVEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKNCGKWSKAMGILKEFEDKCRTSTEKMKQLAEAMAVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+  V  +E  EVSIP HLM GSSE LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDDRVARQEFVEVSIPPHLMTGSSEDLF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             FIA  LA FV++EG+ +H    +QRELGFTFSFP RQTSIA
Sbjct  145  GFIAEALAKFVEEEGDGYHPVSGRQRELGFTFSFPVRQTSIA  186



>gb|EMT07302.1| Hexokinase-2 [Aegilops tauschii]
Length=446

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  MR + RW +  A+L+ LEE+   P  +LRQVADAMAVEMHAGLASEGGSKL M+ISY
Sbjct  22   RRQMREAKRWGRADAVLRGLEERSAAPPARLRQVADAMAVEMHAGLASEGGSKLGMIISY  81

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD+LPSG E+GLFYALDLGGTNFRV+RVQLGGKE  VV +E  E+SIP HLM G+S+ LF
Sbjct  82   VDSLPSGQEKGLFYALDLGGTNFRVLRVQLGGKEGRVVKQECDEISIPAHLMTGTSQELF  141

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGEDFH+   +QRELGFTFSFP +Q+SIA
Sbjct  142  DFIAAALAKFVASEGEDFHLLEGRQRELGFTFSFPVKQSSIA  183



>gb|AAT47078.1| unknown protein [Oryza sativa Japonica Group]
Length=1142

 Score =   243 bits (620),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  +R + RW +  A+L+ELEE+C  P G+LRQVADAMAVEMHAGLASEGGSKLKM+ISY
Sbjct  22   RRQLREAKRWGRADAVLRELEERCAAPPGRLRQVADAMAVEMHAGLASEGGSKLKMIISY  81

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD LPSG+E+G+FYALDLGGTNFRV+RVQLGGKE  V+ +E  E+SIP HLM G S  LF
Sbjct  82   VDALPSGEEKGVFYALDLGGTNFRVLRVQLGGKEGRVIKQEHDEISIPPHLMTGGSNELF  141

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGEDFH+   +QRELGFTFSFP +QTSIA
Sbjct  142  DFIASSLAKFVASEGEDFHLAEGRQRELGFTFSFPVKQTSIA  183



>ref|NP_001284452.1| hexokinase-1-like [Cucumis melo]
 ref|XP_008450786.1| PREDICTED: hexokinase-1-like [Cucumis melo]
 gb|ACJ04705.1| hexokinase 2 [Cucumis melo]
Length=498

 Score =   234 bits (598),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M++ G+W+K + +LKE EEKC T   K++Q+A+AMAVEMHAGLASEGGSKLKMLISY
Sbjct  25   RHRMKNCGKWSKAMGILKEFEEKCRTSTEKMKQLAEAMAVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+  V  +E  EVSIP H+M G+SE LF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDDRVARQEFVEVSIPPHVMTGTSEELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             FIA  LA FV++EG+ +H    +QRELGFTFSFP RQTSIA
Sbjct  145  GFIAEALAKFVEEEGDGYHPVSGRQRELGFTFSFPVRQTSIA  186



>ref|XP_008789199.1| PREDICTED: hexokinase-2-like [Phoenix dactylifera]
Length=493

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 134/161 (83%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  +RS  R A+ V +++ELEE+C TP G L++VA+AMA+EM AGLASEG SKLKML+SY
Sbjct  21   RRRLRSVARSARAVEMVRELEERCATPIGLLKEVANAMAMEMQAGLASEGDSKLKMLLSY  80

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ VV RES EVSIP HLMVG+S  LF
Sbjct  81   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKERHVVKRESTEVSIPPHLMVGNSAELF  140

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            +FIA ELA FV  EG+DFH+    QRE+GFTFSFP +Q+SI
Sbjct  141  EFIAAELAKFVASEGDDFHLSVGSQREIGFTFSFPVKQSSI  181



>gb|KCW79126.1| hypothetical protein EUGRSUZ_C005691, partial [Eucalyptus grandis]
Length=320

 Score =   228 bits (581),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  191  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  370
            + G+W +   ++KELEEKCGTP  KLRQVADAM VEMHAGLA +GGSKLKMLISYVD+LP
Sbjct  42   TDGKWERAAEMVKELEEKCGTPVWKLRQVADAMVVEMHAGLAYDGGSKLKMLISYVDSLP  101

Query  371  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  550
            +GDE+GL+YALDLGGT+F V+ V L  KEKG+V RE +EVS P HLM GSS  LFDFIA 
Sbjct  102  TGDEKGLYYALDLGGTDFCVLHVHLSRKEKGIVKREFEEVSTPPHLMTGSSNELFDFIAM  161

Query  551  ELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             L  FV  EGED H+ P +QRELGFTFSFP RQ+SIA
Sbjct  162  ALTKFVATEGEDSHLYPGRQRELGFTFSFPVRQSSIA  198



>ref|XP_004503490.1| PREDICTED: hexokinase-1-like isoform X1 [Cicer arietinum]
Length=526

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 135/190 (71%), Gaps = 28/190 (15%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH M +S +W++ ++++KE EEKCGTP GKLRQ+ DAM VEMHAGLASEGGSKL MLISY
Sbjct  25   RHRMINSRKWSRALSIVKEFEEKCGTPIGKLRQLGDAMDVEMHAGLASEGGSKLSMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEA--  529
            VDNLP+GDEEGLFYALDLGGTNFRV+RV LGGKEKGV+ +E  EVSIP HLM GSSE   
Sbjct  85   VDNLPTGDEEGLFYALDLGGTNFRVLRVHLGGKEKGVIGQEFDEVSIPPHLMTGSSEVSV  144

Query  530  --------------------------LFDFIAHELAMFVKKEGEDFHIPPDKQRELGFTF  631
                                      LFDFIA  LA FV+ E E FH P  K RELGFTF
Sbjct  145  LRENHYRAIESANTLIYKLFQCLLQGLFDFIAAALAKFVESEPEVFHPPSGKLRELGFTF  204

Query  632  SFPTRQTSIA  661
            SFP +QTSI+
Sbjct  205  SFPVKQTSIS  214



>ref|XP_003568034.1| PREDICTED: hexokinase-2 isoform X1 [Brachypodium distachyon]
Length=494

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/162 (67%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  +R + RWA+  A+L+ELEE+C     +LRQVADA+AVEMHAGLASEGGSKL M+IS+
Sbjct  22   RRQIREAKRWARAAAVLRELEERCAATPARLRQVADAVAVEMHAGLASEGGSKLGMIISH  81

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            V++LPSG E+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +E+SIP +LM G+S  LF
Sbjct  82   VESLPSGQEKGLFYALDLGGTNFRVLRVQLGGKEGRVVKQECEEISIPTNLMTGNSHDLF  141

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGEDFH+P  +QRELGFTFSFP +Q+SI+
Sbjct  142  DFIAAALAKFVASEGEDFHLPEGRQRELGFTFSFPVKQSSIS  183



>ref|XP_009394175.1| PREDICTED: hexokinase-2-like [Musa acuminata subsp. malaccensis]
Length=493

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH MRS+ RWA+  A+L+ELEEKC TP  KL +VADAM  EMHAGL SE  SKLKM+ISY
Sbjct  25   RHRMRSAERWARAAAVLRELEEKCATPVEKLWEVADAMTKEMHAGLESEDVSKLKMIISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD LP+GDE GLFYALDLGGTNFRV+RVQLGG+E  VV +E++EVSIP  LMVG S+ LF
Sbjct  85   VDKLPTGDERGLFYALDLGGTNFRVLRVQLGGREGRVVRQEAKEVSIPHDLMVGRSDELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  L  FV  EGE+FH+   +QRELGFTFSFP +QTS+A
Sbjct  145  DFIASALVKFVDLEGEEFHLHSGRQRELGFTFSFPVKQTSVA  186



>ref|XP_007135629.1| hypothetical protein PHAVU_010G144900g [Phaseolus vulgaris]
 gb|ESW07623.1| hypothetical protein PHAVU_010G144900g [Phaseolus vulgaris]
Length=495

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/160 (66%), Positives = 132/160 (83%), Gaps = 0/160 (0%)
 Frame = +2

Query  182  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  361
            ++R   RW +   +L+ELEEKC TP+ KL+++ADAM VEMHAGLASEGGSKLKMLI+YVD
Sbjct  27   YVRKCRRWGRVTEILQELEEKCATPSWKLKRIADAMNVEMHAGLASEGGSKLKMLITYVD  86

Query  362  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  541
             LP+G EEGL+YALDLGGTNFRV+RVQLGGK+ G++++ES EVSIP +LMVG+S  LFD+
Sbjct  87   KLPTGYEEGLYYALDLGGTNFRVLRVQLGGKDGGIISQESTEVSIPPNLMVGTSAELFDY  146

Query  542  IAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            IA EL  FV +E +DF + P +QRE+GFTFSFP  QT IA
Sbjct  147  IAAELGKFVAQENQDFEVAPGRQREIGFTFSFPVMQTLIA  186



>ref|XP_002283574.1| PREDICTED: hexokinase-2 [Vitis vinifera]
Length=498

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  MR +    K + ++K+ EE C T   KL+ VADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMRCANGRVKAMEIVKDFEEDCATSYSKLKHVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG++  +VN+E  EVSIP +LMV S++ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGRDGRIVNQEFVEVSIPPNLMVKSTDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV KEG  FH+PP +QRELGFTFSFP  QTSI
Sbjct  145  DYIATELAKFVAKEGPGFHLPPGRQRELGFTFSFPVMQTSI  185



>ref|XP_010041948.1| PREDICTED: hexokinase-1-like [Eucalyptus grandis]
Length=232

 Score =   223 bits (567),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +2

Query  191  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  370
            + G+W +   ++KELEEKCGTP  K RQVA+AM V+MHAGL  +GGSKLKMLISYVD+LP
Sbjct  43   TDGKWERAAEMVKELEEKCGTPVWKPRQVAEAMVVKMHAGLTYDGGSKLKMLISYVDSLP  102

Query  371  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  550
            +GDE+GL+YALDLGGTNF ++RV L  KEKG+V RE +EVSIP HLM GS   LFDFIA 
Sbjct  103  TGDEKGLYYALDLGGTNFCILRVHLSRKEKGIVKREFEEVSIPPHLMTGSLNELFDFIAM  162

Query  551  ELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             L  FV  EGED H+ P +QRELGFTFSFP RQ+ IA
Sbjct  163  ALTKFVATEGEDLHLYPGRQRELGFTFSFPVRQSLIA  199



>ref|XP_010232254.1| PREDICTED: hexokinase-9-like isoform X2 [Brachypodium distachyon]
Length=471

 Score =   229 bits (585),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  +R + RWA+  A+L +L+E+C  PA +LR VADAM VEM AGLASE GSKLKML++Y
Sbjct  22   RQRLREAKRWARAAAVLCDLQERCAAPAARLRMVADAMDVEMRAGLASEDGSKLKMLVTY  81

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ V+ +ES  VSIP+HLM GS   LF
Sbjct  82   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKEQRVIKQESVGVSIPQHLMSGSPHELF  141

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  L  FV  EG D+H+P   QRELGFTFSFP +QTSI+
Sbjct  142  DFIAAALTKFVASEGVDYHLPEGTQRELGFTFSFPVKQTSIS  183



>ref|XP_006426867.1| hypothetical protein CICLE_v10025452mg [Citrus clementina]
 gb|ESR40107.1| hypothetical protein CICLE_v10025452mg [Citrus clementina]
Length=496

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +2

Query  185  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  364
            ++  G+  K   ++KE EEKC TPA KL+QVADAM VEMHAGLASEGGSKLKM+ISYVDN
Sbjct  28   VKRGGKCGKANGIMKEFEEKCRTPAAKLKQVADAMTVEMHAGLASEGGSKLKMIISYVDN  87

Query  365  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  544
            LP+GDE+G +YALDLGGTNFRV+RV LGGK  G++N+E  EVSIP HLM G+S+ALFD+I
Sbjct  88   LPTGDEKGTYYALDLGGTNFRVLRVHLGGKGVGLINQEFAEVSIPPHLMTGTSDALFDYI  147

Query  545  AHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            A EL  FV +E E+F + P +QRELGFTFSFP  QTSI
Sbjct  148  AAELGKFVSQESEEFKLSPGRQRELGFTFSFPVMQTSI  185



>ref|XP_003567061.1| PREDICTED: hexokinase-9-like isoform X1 [Brachypodium distachyon]
Length=496

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/162 (67%), Positives = 129/162 (80%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  +R + RWA+  A+L +L+E+C  PA +LR VADAM VEM AGLASE GSKLKML++Y
Sbjct  22   RQRLREAKRWARAAAVLCDLQERCAAPAARLRMVADAMDVEMRAGLASEDGSKLKMLVTY  81

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ V+ +ES  VSIP+HLM GS   LF
Sbjct  82   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKEQRVIKQESVGVSIPQHLMSGSPHELF  141

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  L  FV  EG D+H+P   QRELGFTFSFP +QTSI+
Sbjct  142  DFIAAALTKFVASEGVDYHLPEGTQRELGFTFSFPVKQTSIS  183



>emb|CAN74362.1| hypothetical protein VITISV_016381 [Vitis vinifera]
Length=533

 Score =   230 bits (586),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 111/161 (69%), Positives = 130/161 (81%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  MR +    K + ++K+ EE C T   KL+ VADAM VEMHAGLASEGGSKLKMLISY
Sbjct  25   RRRMRCANGRVKAMEIVKDFEEDCATSYSKLKHVADAMTVEMHAGLASEGGSKLKMLISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG++  +VN+E  EVSIP +LMV S++ALF
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGRDGHIVNQEFVEVSIPPNLMVKSTDALF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA ELA FV KEG  FH+PP +QRELGFTFSFP  QTSI
Sbjct  145  DYIATELAKFVAKEGPGFHLPPGRQRELGFTFSFPVMQTSI  185



>ref|XP_006465701.1| PREDICTED: hexokinase-1-like [Citrus sinensis]
Length=496

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +2

Query  185  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  364
            ++  G+  K   ++KE EEKC TPA KL+ VADAM VEMHAGLASEGGSKLKM+ISYVDN
Sbjct  28   VKRGGKCGKANGIMKEFEEKCRTPAAKLKLVADAMTVEMHAGLASEGGSKLKMIISYVDN  87

Query  365  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  544
            LP+GDE+G +YALDLGGTNFRV+RV LGGK  G++N+E  EVSIP HLM G+S+ALFD+I
Sbjct  88   LPTGDEKGTYYALDLGGTNFRVLRVHLGGKGVGLINQEFAEVSIPPHLMTGTSDALFDYI  147

Query  545  AHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            A ELA FV +E E+F + P +QRELGFTFSFP  QTSI
Sbjct  148  AAELAKFVSQESEEFKLSPGRQRELGFTFSFPVMQTSI  185



>ref|XP_004513053.1| PREDICTED: hexokinase-1-like [Cicer arietinum]
Length=499

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +2

Query  191  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  370
            SSG+W     ++K   E+CGTP  KL++VA+AM  EM+ GLASEGGSKLKMLIS+VDNLP
Sbjct  31   SSGKWGMAEDIVKRFGEECGTPIEKLKKVAEAMVFEMNKGLASEGGSKLKMLISFVDNLP  90

Query  371  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  550
            SG+E+G+FYALDLGGTNFR +RVQLGGKEKGV N ES+EVSIP HLM GS+  LFDFIA 
Sbjct  91   SGNEKGMFYALDLGGTNFRALRVQLGGKEKGVANVESEEVSIPPHLMTGSAHELFDFIAT  150

Query  551  ELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             LA FV  E E+FH PP ++RELGFTFSFP RQTSI+
Sbjct  151  SLAKFVNSEPEEFHPPPGRKRELGFTFSFPIRQTSIS  187



>ref|XP_011080413.1| PREDICTED: hexokinase-1-like [Sesamum indicum]
Length=489

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 130/161 (81%), Gaps = 1/161 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M+  G+WA+ +ALLKE EEKC TP  KL+QVADA+ VEMHAGLASEGGSKLKMLIS+
Sbjct  25   RQRMKRCGKWARAMALLKEFEEKCATPEAKLKQVADALTVEMHAGLASEGGSKLKMLISF  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            + NLP+GDE+G+FYALDLGGTNFRV+RVQL G+  GVV++E  EVSIP  L  G+S+ LF
Sbjct  85   IANLPTGDEDGIFYALDLGGTNFRVLRVQLRGR-GGVVHQEIAEVSIPPALTGGTSDELF  143

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            D+IA +LA FV +E   FH PP KQRELGFTFSFP  QTSI
Sbjct  144  DYIAEKLANFVAEEERLFHQPPVKQRELGFTFSFPVMQTSI  184



>gb|KJB35042.1| hypothetical protein B456_006G096800 [Gossypium raimondii]
Length=430

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  185  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  364
            M+ SG+W K + ++KE EE C TP  KL+QVADAM VEMHAGLASEGGSKLKMLI+YVD+
Sbjct  28   MKKSGKWVKAMEIVKEFEESCRTPISKLKQVADAMTVEMHAGLASEGGSKLKMLITYVDS  87

Query  365  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  544
            LP+GDE+GLFYALDLGGTNFRV+RV LGGK+ G++ ++ +EVSIP + M GSS ALFD+I
Sbjct  88   LPTGDEKGLFYALDLGGTNFRVLRVLLGGKDGGILKQQFKEVSIPPNKMTGSSAALFDYI  147

Query  545  AHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            A ELA FV +E +DF     + RELGFTFSFP  QTSIA
Sbjct  148  AAELAKFVAQEEDDFKPTSGRPRELGFTFSFPVMQTSIA  186



>dbj|BAP47497.1| hexokinase [Gentiana triflora]
Length=497

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 132/162 (81%), Gaps = 1/162 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RHHM++S +W K + +L+ELEE C T   KL+Q+ADAM VEMHAGLASEGGSKLKMLI+Y
Sbjct  25   RHHMKNSAKWGKALEILEELEENCATSTWKLKQIADAMTVEMHAGLASEGGSKLKMLITY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+G+FYALDLGGTNFRVMRV  G  E+ +VN E    SIP HLMVG+S+ALF
Sbjct  85   VDNLPTGEEKGVFYALDLGGTNFRVMRVHFGEAEEQIVNEEVH-TSIPLHLMVGTSDALF  143

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV +EGED H+P  +QRELGFTFSFP +Q SIA
Sbjct  144  DFIASTLAKFVAEEGEDVHLPAGRQRELGFTFSFPVKQLSIA  185



>gb|KJB35041.1| hypothetical protein B456_006G096800 [Gossypium raimondii]
Length=496

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/159 (67%), Positives = 129/159 (81%), Gaps = 0/159 (0%)
 Frame = +2

Query  185  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  364
            M+ SG+W K + ++KE EE C TP  KL+QVADAM VEMHAGLASEGGSKLKMLI+YVD+
Sbjct  28   MKKSGKWVKAMEIVKEFEESCRTPISKLKQVADAMTVEMHAGLASEGGSKLKMLITYVDS  87

Query  365  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  544
            LP+GDE+GLFYALDLGGTNFRV+RV LGGK+ G++ ++ +EVSIP + M GSS ALFD+I
Sbjct  88   LPTGDEKGLFYALDLGGTNFRVLRVLLGGKDGGILKQQFKEVSIPPNKMTGSSAALFDYI  147

Query  545  AHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            A ELA FV +E +DF     + RELGFTFSFP  QTSIA
Sbjct  148  AAELAKFVAQEEDDFKPTSGRPRELGFTFSFPVMQTSIA  186



>ref|XP_002988103.1| hypothetical protein SELMODRAFT_269350 [Selaginella moellendorffii]
 gb|EFJ10895.1| hypothetical protein SELMODRAFT_269350 [Selaginella moellendorffii]
Length=513

 Score =   221 bits (562),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = +2

Query  179  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  358
              +R    W +   ++ E    C TP  +LRQ+ D M VEMHAGLA +GGSKLKM++SYV
Sbjct  28   RRLRQRTSWKRAQCIVDEFRGGCSTPLSRLRQIVDNMVVEMHAGLAIDGGSKLKMVLSYV  87

Query  359  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  538
            DNLP+G+EEGLFYALDLGGTNFRV+RVQLGGKEK ++N+E +EVSIP  +MVGS+E LFD
Sbjct  88   DNLPTGNEEGLFYALDLGGTNFRVLRVQLGGKEKRIMNQEYKEVSIPPKVMVGSNEDLFD  147

Query  539  FIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            FIA ELA FV  EGE F++ P +QRELGFTFSFP +QTSI
Sbjct  148  FIATELASFVASEGEGFYLLPGQQRELGFTFSFPVKQTSI  187



>ref|XP_010665885.1| PREDICTED: hexokinase-1-like isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=513

 Score =   220 bits (561),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 129/158 (82%), Gaps = 0/158 (0%)
 Frame = +2

Query  185  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  364
            M++   W +T+ +L++ EEKCGTP  KL+QVADAM +EMHAGLAS+ GS +KMLISYVDN
Sbjct  28   MKNGANWRRTMEILRDFEEKCGTPIEKLKQVADAMVMEMHAGLASDDGSSIKMLISYVDN  87

Query  365  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  544
            LP+GDE+GLFYALDLGGTNFRV+RVQLGGK+ G+ ++E  EV IP  LM+G+S+ LF +I
Sbjct  88   LPTGDEDGLFYALDLGGTNFRVLRVQLGGKDGGIKHQEFAEVPIPVELMIGTSDDLFGYI  147

Query  545  AHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            A E+A F+ +EG +F +P  ++RELGFTFSFP  QTSI
Sbjct  148  ASEVAKFIAQEGPEFQLPSGRERELGFTFSFPVMQTSI  185



>ref|XP_002972691.1| hypothetical protein SELMODRAFT_441916 [Selaginella moellendorffii]
 gb|EFJ25912.1| hypothetical protein SELMODRAFT_441916 [Selaginella moellendorffii]
Length=513

 Score =   218 bits (556),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = +2

Query  179  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  358
              +R    W +   ++ E    C TP  +LRQ+ D M VEMHAGLA +GGSKLKM++SYV
Sbjct  28   RRLRQRTSWKRAQCIVDEFRGGCSTPLSRLRQIVDNMVVEMHAGLAIDGGSKLKMVLSYV  87

Query  359  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  538
            DNLP+G+EEGLFYALDLGGTNFRV+RVQ+GGKEK ++N+E +EVSIP  +MVGS+E LFD
Sbjct  88   DNLPTGNEEGLFYALDLGGTNFRVLRVQMGGKEKRIMNQEYKEVSIPPKVMVGSNEDLFD  147

Query  539  FIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            FIA ELA FV  EGE F + P +QRELGFTFSFP +QTSI
Sbjct  148  FIATELASFVASEGEGFFLLPGQQRELGFTFSFPVKQTSI  187



>ref|XP_010246625.1| PREDICTED: hexokinase-3-like [Nelumbo nucifera]
Length=511

 Score =   216 bits (549),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 126/161 (78%), Gaps = 0/161 (0%)
 Frame = +2

Query  179  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  358
              ++S  +W + V +L+ELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML+++V
Sbjct  26   RRVKSRRKWNRVVGVLRELEEGCSTSIGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFV  85

Query  359  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  538
            DNLP+G+E+G +YALDLGGTNFRV+RVQLGGK   ++  E +   IP HLM  +SE LFD
Sbjct  86   DNLPNGNEKGTYYALDLGGTNFRVLRVQLGGKNSLILGHEVERQPIPEHLMTSTSEDLFD  145

Query  539  FIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FIA  L  FV+KEG  + +P D++RELGFTFSFP +QTS++
Sbjct  146  FIASTLEKFVEKEGNGYIVPLDRRRELGFTFSFPVKQTSVS  186



>gb|KDO50431.1| hypothetical protein CISIN_1g0104561mg, partial [Citrus sinensis]
 gb|KDO50432.1| hypothetical protein CISIN_1g0104561mg, partial [Citrus sinensis]
Length=229

 Score =   207 bits (527),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = +2

Query  179  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  358
              ++S  +W + + +L+ELEE C T   +LRQV DAMAVEMHAGLASEGGSKLKML+++V
Sbjct  28   KRVKSRRKWKRVMGVLRELEEGCETTVSRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFV  87

Query  359  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  538
            DNLP+G E+G++YALDLGGTNFRV+RVQLGG+   +++ + +   IP  LM G+SE LFD
Sbjct  88   DNLPTGSEKGIYYALDLGGTNFRVLRVQLGGQRSSILSSDVERQPIPPELMTGTSEDLFD  147

Query  539  FIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FIA  L  FV+KEG     PP ++RELGFTFSFP +QTS++
Sbjct  148  FIASALQQFVEKEGNGSEPPPIRRRELGFTFSFPVKQTSVS  188



>ref|NP_001044102.1| Os01g0722700 [Oryza sativa Japonica Group]
 dbj|BAF06016.1| Os01g0722700 [Oryza sativa Japonica Group]
 dbj|BAG91675.1| unnamed protein product [Oryza sativa Japonica Group]
Length=294

 Score =   208 bits (530),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  221  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  400
            LL++L+E+C  P   LRQVADAMA EM AGLA+EGGS L+ML++YVD+LPSG E+G+FYA
Sbjct  42   LLRDLQERCAAPVELLRQVADAMAAEMRAGLAAEGGSDLQMLVTYVDSLPSGGEKGMFYA  101

Query  401  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEG  580
            LDLGGTNFRV+RVQLGGKE+ ++ ++S+ +SIP+HLM  SS  LFDF+A  LA FV  EG
Sbjct  102  LDLGGTNFRVLRVQLGGKERRIIKQDSEGISIPQHLMSSSSHELFDFVAVALAKFVASEG  161

Query  581  EDFHIPPDKQRELGFTFSFPTRQTSIA  661
            ED H+P   QRELGFTFSFP +Q S+A
Sbjct  162  EDCHLPEGTQRELGFTFSFPVKQKSLA  188



>gb|KEH27216.1| hexokinase [Medicago truncatula]
Length=496

 Score =   213 bits (542),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 123/163 (75%), Gaps = 3/163 (2%)
 Frame = +2

Query  182  HMRSSG---RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLIS  352
              RS G   +W K   +LK   E+C T   KL+ VA+AM VEMH GL +EGGS LKMLIS
Sbjct  22   QQRSKGGCEKWEKVEEILKVFGEECETSIEKLKSVAEAMVVEMHNGLENEGGSMLKMLIS  81

Query  353  YVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEAL  532
            +VDNLPSGDE+GLFYALDLGGTNFR +R+QLGGKEKGVV  E++EVSIP HLM GSS  L
Sbjct  82   FVDNLPSGDEKGLFYALDLGGTNFRALRIQLGGKEKGVVKVETEEVSIPPHLMTGSSHEL  141

Query  533  FDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FDFIA  LA FV  E E+F   P ++RELGFTFSFP RQTSIA
Sbjct  142  FDFIATSLAKFVSSEPEEFRPLPGRKRELGFTFSFPVRQTSIA  184



>tpg|DAA57818.1| TPA: hypothetical protein ZEAMMB73_547897 [Zea mays]
Length=371

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 127/169 (75%), Gaps = 7/169 (4%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLAS---EGGSK----  334
            R  +R + RWA+  A+L++L+E+C  P  +LRQVADAM  EM AGLAS   EG S     
Sbjct  25   RQRLREARRWARAGAVLRDLQERCAAPVERLRQVADAMVAEMRAGLASNDSEGDSGSSVL  84

Query  335  LKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMV  514
            LKML++YVD+LPSGDE+GLFYALDLGGTNFRV+R+Q GGKE+ +V +ES+ VSIP+HLM 
Sbjct  85   LKMLVTYVDSLPSGDEKGLFYALDLGGTNFRVLRIQFGGKEQRIVKQESKTVSIPQHLMS  144

Query  515  GSSEALFDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
              S  LFDFIA  LA F+  EGE F++P   QR+LGFTFSFP +Q S+A
Sbjct  145  RGSNELFDFIAAALAKFIASEGEGFYLPEGMQRQLGFTFSFPVKQNSVA  193



>tpg|DAA57819.1| TPA: hypothetical protein ZEAMMB73_547897 [Zea mays]
Length=400

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 127/169 (75%), Gaps = 7/169 (4%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLAS---EGGSK----  334
            R  +R + RWA+  A+L++L+E+C  P  +LRQVADAM  EM AGLAS   EG S     
Sbjct  25   RQRLREARRWARAGAVLRDLQERCAAPVERLRQVADAMVAEMRAGLASNDSEGDSGSSVL  84

Query  335  LKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMV  514
            LKML++YVD+LPSGDE+GLFYALDLGGTNFRV+R+Q GGKE+ +V +ES+ VSIP+HLM 
Sbjct  85   LKMLVTYVDSLPSGDEKGLFYALDLGGTNFRVLRIQFGGKEQRIVKQESKTVSIPQHLMS  144

Query  515  GSSEALFDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
              S  LFDFIA  LA F+  EGE F++P   QR+LGFTFSFP +Q S+A
Sbjct  145  RGSNELFDFIAAALAKFIASEGEGFYLPEGMQRQLGFTFSFPVKQNSVA  193



>emb|CDM84160.1| unnamed protein product [Triticum aestivum]
Length=358

 Score =   207 bits (526),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 123/162 (76%), Gaps = 13/162 (8%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  +R + RWA+  A+L +L+E+C  PA +L QV+DAM VEM AGLASE GSKLKML++Y
Sbjct  22   RQRLREAKRWARVAAVLSDLQERCVAPAARLLQVSDAMDVEMRAGLASEDGSKLKMLVTY  81

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+ V+ +ES          VG    LF
Sbjct  82   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKEQRVIKQES----------VGE---LF  128

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV  EGED+H+P   QRELGFTFSFP +QTSI+
Sbjct  129  DFIAAALAKFVASEGEDYHLPEGTQRELGFTFSFPVKQTSIS  170



>gb|AAL16967.1|AF367451_1 hexokinase [Prunus persica]
Length=224

 Score =   202 bits (515),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/125 (80%), Positives = 107/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  MAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGV  466
            M VEMHAGLASEGGSKLKMLISYVDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKEK V
Sbjct  1    MTVEMHAGLASEGGSKLKMLISYVDNLPTGDEQGLFYALDLGGTNFRVIRVQLGGKEKRV  60

Query  467  VNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTR  646
            V +E  EVSIP +LM G+SEALFDFIA  LA FV  EGE FH  P +QRELGFTFSFP  
Sbjct  61   VKQEFDEVSIPPNLMTGTSEALFDFIAEALAKFVATEGEGFHPAPGRQRELGFTFSFPVW  120

Query  647  QTSIA  661
            QTSIA
Sbjct  121  QTSIA  125



>gb|ACN29323.1| unknown [Zea mays]
Length=482

 Score =   209 bits (531),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 127/169 (75%), Gaps = 7/169 (4%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLAS---EGGSK----  334
            R  +R + RWA+  A+L++L+E+C  P  +LRQVADAM  EM AGLAS   EG S     
Sbjct  3    RQRLREARRWARAGAVLRDLQERCAAPVERLRQVADAMVAEMRAGLASNDSEGDSGSSVL  62

Query  335  LKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMV  514
            LKML++YVD+LPSGDE+GLFYALDLGGTNFRV+R+Q GGKE+ +V +ES+ VSIP+HLM 
Sbjct  63   LKMLVTYVDSLPSGDEKGLFYALDLGGTNFRVLRIQFGGKEQRIVKQESKTVSIPQHLMS  122

Query  515  GSSEALFDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
              S  LFDFIA  LA F+  EGE F++P   QR+LGFTFSFP +Q S+A
Sbjct  123  RGSNELFDFIAAALAKFIASEGEGFYLPEGMQRQLGFTFSFPVKQNSVA  171



>ref|NP_001146056.1| hypothetical protein [Zea mays]
 gb|ACL53123.1| unknown [Zea mays]
 tpg|DAA57820.1| TPA: hypothetical protein ZEAMMB73_547897 [Zea mays]
Length=504

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 127/169 (75%), Gaps = 7/169 (4%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLAS---EGGSK----  334
            R  +R + RWA+  A+L++L+E+C  P  +LRQVADAM  EM AGLAS   EG S     
Sbjct  25   RQRLREARRWARAGAVLRDLQERCAAPVERLRQVADAMVAEMRAGLASNDSEGDSGSSVL  84

Query  335  LKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMV  514
            LKML++YVD+LPSGDE+GLFYALDLGGTNFRV+R+Q GGKE+ +V +ES+ VSIP+HLM 
Sbjct  85   LKMLVTYVDSLPSGDEKGLFYALDLGGTNFRVLRIQFGGKEQRIVKQESKTVSIPQHLMS  144

Query  515  GSSEALFDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
              S  LFDFIA  LA F+  EGE F++P   QR+LGFTFSFP +Q S+A
Sbjct  145  RGSNELFDFIAAALAKFIASEGEGFYLPEGMQRQLGFTFSFPVKQNSVA  193



>sp|Q2KNB7.1|HXK9_ORYSJ RecName: Full=Hexokinase-9; AltName: Full=Hexokinase-5 [Oryza 
sativa Japonica Group]
 gb|AAX68421.1| hexokinase 5 [Oryza sativa Japonica Group]
 gb|AAZ93626.1| hexokinase 9 [Oryza sativa Japonica Group]
 gb|EAZ13381.1| hypothetical protein OsJ_03300 [Oryza sativa Japonica Group]
Length=502

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  221  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  400
            LL++L+E+C  P   LRQVADAMA EM AGLA+EGGS L+ML++YVD+LPSG E+G+FYA
Sbjct  42   LLRDLQERCAAPVELLRQVADAMAAEMRAGLAAEGGSDLQMLVTYVDSLPSGGEKGMFYA  101

Query  401  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEG  580
            LDLGGTNFRV+RVQLGGKE+ ++ ++S+ +SIP+HLM  SS  LFDF+A  LA FV  EG
Sbjct  102  LDLGGTNFRVLRVQLGGKERRIIKQDSEGISIPQHLMSSSSHELFDFVAVALAKFVASEG  161

Query  581  EDFHIPPDKQRELGFTFSFPTRQTSIA  661
            ED H+P   QRELGFTFSFP +Q S+A
Sbjct  162  EDCHLPEGTQRELGFTFSFPVKQKSLA  188



>ref|XP_004969912.1| PREDICTED: hexokinase-6-like [Setaria italica]
Length=505

 Score =   209 bits (531),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 121/154 (79%), Gaps = 0/154 (0%)
 Frame = +2

Query  200  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  379
            R  K  A+++E+E+   TP   LR +ADAM VEM  GL ++  + LKMLISYVDNLP+GD
Sbjct  41   RKRKAAAVIEEVEQAFSTPTALLRGIADAMVVEMERGLRADPHAPLKMLISYVDNLPTGD  100

Query  380  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  559
            E GLFYALDLGGTNFRV+RVQLGG+EK VV ++ +EVSIP HLMVG+S  LFDFIA EL 
Sbjct  101  EHGLFYALDLGGTNFRVIRVQLGGREKRVVKQQYEEVSIPPHLMVGTSTELFDFIAAELE  160

Query  560  MFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             FV+ EGEDFH+P  KQRELGFTFSFP  QTSI+
Sbjct  161  KFVRTEGEDFHLPDGKQRELGFTFSFPVHQTSIS  194



>ref|XP_002458467.1| hypothetical protein SORBIDRAFT_03g034230 [Sorghum bicolor]
 gb|EES03587.1| hypothetical protein SORBIDRAFT_03g034230 [Sorghum bicolor]
Length=506

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = +2

Query  209  KTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEG  388
            K  A+++E+E++  TP   LR +ADAM  EM  GL +E  + LKMLISYVDNLP+GDE+G
Sbjct  45   KAAAVIEEVEQRFSTPTALLRGIADAMVEEMERGLRAEPHAPLKMLISYVDNLPTGDEQG  104

Query  389  LFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFV  568
            LFYALDLGGTNFRV+RVQLGG++K VV ++ +EVSIP HLMVG+S  LFDFIA EL  FV
Sbjct  105  LFYALDLGGTNFRVIRVQLGGRDKRVVKQQYEEVSIPPHLMVGTSTELFDFIAAELEKFV  164

Query  569  KKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            + EGEDFH+P  KQRELGFTFSFP  QTSI+
Sbjct  165  RTEGEDFHLPNGKQRELGFTFSFPVHQTSIS  195



>gb|EAY75659.1| hypothetical protein OsI_03566 [Oryza sativa Indica Group]
Length=502

 Score =   207 bits (528),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 120/147 (82%), Gaps = 0/147 (0%)
 Frame = +2

Query  221  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  400
            LL++L+++C  P   LRQVADAMA EM AGLA+EGGS L+ML++YVD+LPSG E+G+FYA
Sbjct  42   LLRDLQKRCAAPVELLRQVADAMAAEMRAGLAAEGGSDLQMLVTYVDSLPSGGEKGMFYA  101

Query  401  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEG  580
            LDLGGTNFRV+RVQLGGKE+ ++ ++S+ +SIP+HLM  SS  LFDF+A  LA FV  EG
Sbjct  102  LDLGGTNFRVLRVQLGGKERRIIKQDSEGISIPQHLMSSSSHELFDFVAAALAKFVASEG  161

Query  581  EDFHIPPDKQRELGFTFSFPTRQTSIA  661
            ED H+P   QRELGFTFSFP +Q S+A
Sbjct  162  EDCHLPEGTQRELGFTFSFPVKQKSLA  188



>gb|AIT55904.1| hexokinase [Ipomoea batatas]
Length=496

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 121/155 (78%), Gaps = 0/155 (0%)
 Frame = +2

Query  194  SGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPS  373
            SG       +L +LE+ C TP   LR VADAMA ++ AGLA +GGS LKM++SYVD LP+
Sbjct  34   SGVSVGVAPILTKLEKDCATPLPVLRHVADAMAADVRAGLAVDGGSDLKMILSYVDTLPT  93

Query  374  GDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHE  553
            G+E+GLFYALDLGGTNFRV+RVQLGGKE+ VV  E ++VSIP+ LM G+SE LFDFIA  
Sbjct  94   GNEKGLFYALDLGGTNFRVLRVQLGGKEERVVATEFEQVSIPQELMFGTSEELFDFIASA  153

Query  554  LAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            LA F +KEGE FH+PP + RE+GFTFSFP +QTSI
Sbjct  154  LAKFAQKEGEKFHLPPGRTREIGFTFSFPVKQTSI  188



>ref|XP_008675068.1| PREDICTED: hexokinase-6 [Zea mays]
 tpg|DAA57704.1| TPA: hypothetical protein ZEAMMB73_919197 [Zea mays]
Length=506

 Score =   207 bits (526),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 99/151 (66%), Positives = 120/151 (79%), Gaps = 0/151 (0%)
 Frame = +2

Query  209  KTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEG  388
            K  A+++E+E++  TP   LR +ADAM  EM  GL +E  + LKMLISYVDNLP+GDE G
Sbjct  45   KAAAVIEEVEQRLSTPTALLRGIADAMVEEMERGLRAEPHAPLKMLISYVDNLPTGDEHG  104

Query  389  LFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFV  568
            LFYALDLGGTNFRV+RVQLGG+++ VV ++ +EVSIP HLMVG+S  LFDFIA EL  FV
Sbjct  105  LFYALDLGGTNFRVIRVQLGGRDRRVVKQQYEEVSIPPHLMVGTSTELFDFIAAELEKFV  164

Query  569  KKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            + EGEDFH+P  KQRELGFTFSFP  QTSI+
Sbjct  165  RTEGEDFHLPDSKQRELGFTFSFPVHQTSIS  195



>ref|XP_006470700.1| PREDICTED: hexokinase-3-like [Citrus sinensis]
Length=510

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = +2

Query  182  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  361
             ++S  +W + + +L+ELEE C T   +LRQV DAMAVEMHAGLASEGGSKLKML+++VD
Sbjct  29   RVKSRRKWKRVMGVLRELEEGCETTVSRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVD  88

Query  362  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  541
            NLP+G E+G++YALDLGGTNFRV+RVQLGG+   +++ + +   IP  LM G+SE LFDF
Sbjct  89   NLPTGSEKGIYYALDLGGTNFRVLRVQLGGQRSSILSSDVERQPIPPELMTGTSEDLFDF  148

Query  542  IAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            IA  L  FV+KEG     PP ++RELGFTFSFP +QTS++
Sbjct  149  IASALQQFVEKEGNGSEPPPIRRRELGFTFSFPVKQTSVS  188



>ref|XP_006446203.1| hypothetical protein CICLE_v10014962mg [Citrus clementina]
 gb|ESR59443.1| hypothetical protein CICLE_v10014962mg [Citrus clementina]
Length=510

 Score =   207 bits (526),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 124/160 (78%), Gaps = 0/160 (0%)
 Frame = +2

Query  182  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  361
             ++S  +W + + +L+ELEE C T   +LRQV DAMAVEMHAGLASEGGSKLKML+++VD
Sbjct  29   RVKSRRKWKRVMGVLRELEEGCETTVSRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVD  88

Query  362  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  541
            NLP+G E+G++YALDLGGTNFRV+RVQLGG+   +++ + +   IP  LM G+SE LFDF
Sbjct  89   NLPTGSEKGIYYALDLGGTNFRVLRVQLGGQRSSILSSDVERQPIPPELMTGTSEDLFDF  148

Query  542  IAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            IA  L  FV+KEG     PP ++RELGFTFSFP +QTS++
Sbjct  149  IASALQQFVEKEGNGSEPPPIRRRELGFTFSFPVKQTSVS  188



>gb|AAL16968.1|AF367452_1 hexokinase [Prunus persica]
Length=224

 Score =   199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 110/124 (89%), Gaps = 0/124 (0%)
 Frame = +2

Query  287  MAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGV  466
            M VEMHAGLASEGGSKLKM+ISYVDNLP+G E+GLFYALDLGGTNFRV+RVQLGGK +G+
Sbjct  1    MTVEMHAGLASEGGSKLKMIISYVDNLPTGTEKGLFYALDLGGTNFRVLRVQLGGKVRGI  60

Query  467  VNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTR  646
            +++E  EVSIP +LMVG+S+ALFD+IA E+A FV KEG+ + +PP +QRELGFTFSFP  
Sbjct  61   ISQEFTEVSIPENLMVGTSDALFDYIAAEVAKFVAKEGQXYQLPPGRQRELGFTFSFPVL  120

Query  647  QTSI  658
            Q+SI
Sbjct  121  QSSI  124



>ref|XP_004961448.1| PREDICTED: hexokinase-5-like [Setaria italica]
Length=507

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 119/154 (77%), Gaps = 0/154 (0%)
 Frame = +2

Query  200  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  379
            R  +  A+++E+E    TP   LR +ADAM  EM  GL ++  ++LKMLISYVDNLP+GD
Sbjct  42   RKRRAAAVIEEVERSLATPTALLRSIADAMVTEMERGLRADIHAQLKMLISYVDNLPTGD  101

Query  380  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  559
            E GLFYALDLGGTNFRV+RVQLGG+EK VV ++ +EVSIP HLMVG+S  LFDFIA  LA
Sbjct  102  EHGLFYALDLGGTNFRVLRVQLGGREKRVVKQQYEEVSIPPHLMVGTSLELFDFIAAALA  161

Query  560  MFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             FV  EGEDFH+P  +QRELGFTFSFP  QTSI+
Sbjct  162  KFVDTEGEDFHLPEGRQRELGFTFSFPVNQTSIS  195



>ref|XP_006646311.1| PREDICTED: hexokinase-6-like [Oryza brachyantha]
Length=513

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 122/154 (79%), Gaps = 0/154 (0%)
 Frame = +2

Query  200  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  379
            R  K  A+++E+E++  TP   LR +ADAM  EM  GL ++  + LKMLISYVDNLP+GD
Sbjct  48   RRRKAAAVIEEVEQRFSTPTALLRGIADAMVEEMERGLRADPHAPLKMLISYVDNLPTGD  107

Query  380  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  559
            E GLFYALDLGGTNFRV+RVQLGG+EK VV+++ +EV+IP HLMVG+S  LFDFIA EL 
Sbjct  108  EHGLFYALDLGGTNFRVIRVQLGGREKRVVSQQYEEVAIPPHLMVGTSMELFDFIAAELE  167

Query  560  MFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             FVK EGEDFH+P  +QRELGFTFSFP  QTSI+
Sbjct  168  SFVKTEGEDFHLPEGRQRELGFTFSFPVHQTSIS  201



>ref|XP_003540378.1| PREDICTED: hexokinase-3-like [Glycine max]
Length=504

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = +2

Query  179  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  358
              MRS G W +   +LKE+EE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML++YV
Sbjct  26   QRMRSRGNWKRVARVLKEVEEGCETSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYV  85

Query  359  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  538
             NLP+G E+G +YALDLGGTNFRV+RV L G++  V+  E +   IP++LM  +SE LFD
Sbjct  86   HNLPNGTEKGTYYALDLGGTNFRVLRVHLHGQQSSVLEHEVERQPIPQNLMTSTSEDLFD  145

Query  539  FIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FIA  L  F++KEG+   + PD++RELGFTFSFP +Q S++
Sbjct  146  FIASSLKEFIEKEGDGSELSPDRRRELGFTFSFPVKQMSVS  186



>emb|CBI27996.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   204 bits (518),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 110/125 (88%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  MAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGV  466
            M VEMHAGLASEGGSKLKM+ISYVDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGK+K V
Sbjct  1    MTVEMHAGLASEGGSKLKMIISYVDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKDKRV  60

Query  467  VNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTR  646
            V +E +EVSIP HLMVGSS+ALFD+IA  LA FV  EGE  H+ P +QRELGFTFSFP R
Sbjct  61   VKQEFEEVSIPPHLMVGSSDALFDYIAAALAKFVATEGEGLHVSPGRQRELGFTFSFPVR  120

Query  647  QTSIA  661
            Q+SI+
Sbjct  121  QSSIS  125



>gb|KHN09247.1| Hexokinase-3 [Glycine soja]
Length=477

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = +2

Query  185  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  364
            MRS G+W + V +L+E+EE C T  G+LRQV DAMAVEMHAGLASEGGSKLKMLI++V N
Sbjct  1    MRSRGKWKRVVRVLREVEEGCETSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLITFVHN  60

Query  365  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  544
            LP+G E+G +YALDLGGTNFRV+RV L G++  V+  E +   IP+HLM  +SE LFDFI
Sbjct  61   LPNGTEKGTYYALDLGGTNFRVLRVHLHGQQSSVLEHEVERQPIPQHLMTSTSEDLFDFI  120

Query  545  AHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            A  L  F++KEG    +  D++RELGFTFSFP +Q S++
Sbjct  121  ASSLKEFIEKEGNASELSLDRRRELGFTFSFPVKQMSVS  159



>gb|ABR18277.1| unknown [Picea sitchensis]
Length=551

 Score =   206 bits (523),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 122/154 (79%), Gaps = 1/154 (1%)
 Frame = +2

Query  203  WAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKL-KMLISYVDNLPSGD  379
            W +   ++KELE +C TP  +LR+V DAMA E+  GLASE  S L KM+ISYVD LP+GD
Sbjct  88   WKRAEGIVKELERQCSTPISRLREVVDAMAEELRVGLASEAKSNLLKMVISYVDTLPTGD  147

Query  380  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  559
            E+GLFYALDLGGTNFRV+RVQLGGKE  V+++E  EV+IP +LMVG+ + LFD+IA ELA
Sbjct  148  EKGLFYALDLGGTNFRVLRVQLGGKEGRVIDKEFTEVTIPANLMVGTEKELFDYIASELA  207

Query  560  MFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             FV  EG++F++ P +QRELGFTFSFP  QT+IA
Sbjct  208  KFVTSEGKNFYLEPGRQRELGFTFSFPVHQTAIA  241



>ref|XP_003537744.1| PREDICTED: hexokinase-3-like [Glycine max]
Length=504

 Score =   204 bits (520),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = +2

Query  185  MRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDN  364
            MRS G+W + V +L+E+EE C T  G+LRQV DAMAVEMHAGLASEGGSKLKMLI++V N
Sbjct  28   MRSRGKWKRVVRVLREVEEGCETSVGRLRQVVDAMAVEMHAGLASEGGSKLKMLITFVHN  87

Query  365  LPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFI  544
            LP+G E+G +YALDLGGTNFRV+RV L G++  V+  E +   IP+HLM  +SE LFDFI
Sbjct  88   LPNGTEKGTYYALDLGGTNFRVLRVHLHGQQSSVLEHEVERQPIPQHLMTSTSEDLFDFI  147

Query  545  AHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            A  L  F++KEG    +  D++RELGFTFSFP +Q S++
Sbjct  148  ASSLKEFIEKEGNASELSLDRRRELGFTFSFPVKQMSVS  186



>gb|AFW82531.1| hypothetical protein ZEAMMB73_000101 [Zea mays]
Length=291

 Score =   198 bits (504),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  221  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  400
            +++E+E    TP   LR +ADAM  EM  GL  +  ++LKMLISYVD+LP+GDE GLFYA
Sbjct  49   VIEEVESSLATPTALLRSIADAMVAEMERGLRGDIHAQLKMLISYVDSLPTGDEHGLFYA  108

Query  401  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEG  580
            LDLGGTNFRV+RVQLGGKEK VV ++ +EVSIP HLMVG+S  LFDFIA  LA FV  EG
Sbjct  109  LDLGGTNFRVLRVQLGGKEKRVVKQQYEEVSIPPHLMVGTSMELFDFIAAALAKFVGTEG  168

Query  581  EDFHIPPDKQRELGFTFSFPTRQTSIA  661
            EDF +P  +QRELGFTFSFP  QTSI+
Sbjct  169  EDFQLPEGRQRELGFTFSFPVNQTSIS  195



>gb|KHN41674.1| Hexokinase-1 [Glycine soja]
Length=437

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/125 (78%), Positives = 108/125 (86%), Gaps = 0/125 (0%)
 Frame = +2

Query  287  MAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGV  466
            M VEMHAGLASEGGSKL MLIS+VDNLP+GDEEGL+YALDLGGTNFRV+RV LGGK+KGV
Sbjct  1    MDVEMHAGLASEGGSKLNMLISFVDNLPTGDEEGLYYALDLGGTNFRVLRVHLGGKDKGV  60

Query  467  VNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTR  646
            + +E +EVSIP +LM GSSEALFDFIA  LA FV  E E FH PP +QRELGFTFSFP R
Sbjct  61   IGQEFEEVSIPPNLMTGSSEALFDFIAAALAKFVGSEPEGFHPPPGRQRELGFTFSFPVR  120

Query  647  QTSIA  661
            QTSIA
Sbjct  121  QTSIA  125



>ref|XP_006843448.1| PREDICTED: hexokinase-3 [Amborella trichopoda]
 gb|ERN05123.1| hypothetical protein AMTR_s00053p00173580 [Amborella trichopoda]
Length=504

 Score =   202 bits (515),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  +    +W++ V +L+E EE C T   +LRQV DAMAVEMHAGLASEGGSKLKML+++
Sbjct  25   RKGVERRAKWSRVVGVLREFEEGCSTSGHRLRQVVDAMAVEMHAGLASEGGSKLKMLLTF  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+G+E+GL+YALDLGGT+FRV+RV L G ++ +++ + ++ +IP HL+ G+SE LF
Sbjct  85   VDNLPNGNEKGLYYALDLGGTHFRVLRVHLKGTKQKILDHKVEKQAIPPHLLTGTSEELF  144

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             FIA  L  F++KEG+DF + P  +R+LGFTFSFP RQTS++
Sbjct  145  GFIALTLKRFIEKEGDDFELQPVSRRDLGFTFSFPVRQTSVS  186



>ref|XP_010273315.1| PREDICTED: hexokinase-3-like [Nelumbo nucifera]
Length=513

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = +2

Query  179  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  358
              ++S  +W++ V +LKELEE C T  G+L+QV DAMAVEMHAGLASEGGSKLKML+++V
Sbjct  26   RRVKSRRKWSRVVGVLKELEEGCSTSIGRLKQVVDAMAVEMHAGLASEGGSKLKMLLTFV  85

Query  359  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  538
            DNLP G+E+G +YAL LGGTNFRV+RVQLGG+   ++  E     IP+HLM  +SE LFD
Sbjct  86   DNLPDGNEKGTYYALHLGGTNFRVLRVQLGGENSLILGHEVDRQPIPQHLMTSTSEGLFD  145

Query  539  FIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FI  +L  FV++EG       DK+RELGFTFSFP +QTS++
Sbjct  146  FIVSKLEQFVEREGNGSMSMLDKRRELGFTFSFPVKQTSVS  186



>ref|XP_002440104.1| hypothetical protein SORBIDRAFT_09g026080 [Sorghum bicolor]
 gb|EES18534.1| hypothetical protein SORBIDRAFT_09g026080 [Sorghum bicolor]
Length=507

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 117/154 (76%), Gaps = 0/154 (0%)
 Frame = +2

Query  200  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  379
            R  +  A+++++E    TP   LR +ADAM  EM  GL  +  S+LKMLISYVDNLP+GD
Sbjct  42   RKRRAAAVIEDVESSLATPTALLRSIADAMVTEMERGLRGDIHSQLKMLISYVDNLPTGD  101

Query  380  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  559
            E GLFYALDLGGTNFRV+RVQLGG+EK VV ++ +EVSIP HLMVG+S  LFDFIA  LA
Sbjct  102  EHGLFYALDLGGTNFRVLRVQLGGREKRVVKQQYEEVSIPPHLMVGTSMELFDFIAAALA  161

Query  560  MFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             FV  EGEDFH+P  + RELGFTFSFP  QTSI+
Sbjct  162  KFVDTEGEDFHLPEGRLRELGFTFSFPVNQTSIS  195



>ref|NP_001044214.1| Os01g0742500 [Oryza sativa Japonica Group]
 sp|Q8LQ68.1|HXK6_ORYSJ RecName: Full=Hexokinase-6; AltName: Full=Hexokinase-2 [Oryza 
sativa Japonica Group]
 dbj|BAB91930.1| putative hexokinase [Oryza sativa Japonica Group]
 gb|AAX68418.1| hexokinase 2 [Oryza sativa Japonica Group]
 gb|AAZ93623.1| hexokinase 6 [Oryza sativa Japonica Group]
 dbj|BAF06128.1| Os01g0742500 [Oryza sativa Japonica Group]
 gb|EAY75775.1| hypothetical protein OsI_03691 [Oryza sativa Indica Group]
 dbj|BAG89607.1| unnamed protein product [Oryza sativa Japonica Group]
Length=506

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +2

Query  224  LKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYAL  403
            ++E+E++  TP   LR +ADAM  EM  GL ++  + LKMLISYVDNLP+GDE GLFYAL
Sbjct  49   IEEVEQRFSTPTALLRGIADAMVEEMERGLRADPHAPLKMLISYVDNLPTGDEHGLFYAL  108

Query  404  DLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEGE  583
            DLGGTNFRV+RVQLGG+EK VV+++ +EV+IP HLMVG+S  LFDFIA EL  FVK EGE
Sbjct  109  DLGGTNFRVIRVQLGGREKRVVSQQYEEVAIPPHLMVGTSMELFDFIAAELESFVKTEGE  168

Query  584  DFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFH+P  +QRELGFTFSFP  QTSI+
Sbjct  169  DFHLPEGRQRELGFTFSFPVHQTSIS  194



>ref|XP_011045448.1| PREDICTED: hexokinase-3-like [Populus euphratica]
Length=488

 Score =   201 bits (512),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 120/153 (78%), Gaps = 0/153 (0%)
 Frame = +2

Query  200  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  379
            +W + V++LKELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD+LP+G 
Sbjct  33   KWKRVVSVLKELEEACETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGS  92

Query  380  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  559
            E G +YALDLGGTNFRV+R+QLGG+   +++++ +   IP+HL+  +SE LFDFIA  L 
Sbjct  93   EIGTYYALDLGGTNFRVLRIQLGGRRSSILSQDVERQPIPQHLLTSTSEDLFDFIASTLK  152

Query  560  MFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
             FV+KE       P + RELGFTFSFP +Q+S+
Sbjct  153  QFVEKEESGSEPSPVRTRELGFTFSFPVKQSSL  185



>emb|CBI36049.3| unnamed protein product [Vitis vinifera]
Length=448

 Score =   200 bits (509),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 109/124 (88%), Gaps = 0/124 (0%)
 Frame = +2

Query  287  MAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGV  466
            M VEMHAGLASEGGSKLKMLISYVDNLP+GDE+GLFYALDLGGTNFRV+RVQLGG++  +
Sbjct  1    MTVEMHAGLASEGGSKLKMLISYVDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGRDGRI  60

Query  467  VNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTR  646
            VN+E  EVSIP +LMV S++ALFD+IA ELA FV KEG  FH+PP +QRELGFTFSFP  
Sbjct  61   VNQEFVEVSIPPNLMVKSTDALFDYIATELAKFVAKEGPGFHLPPGRQRELGFTFSFPVM  120

Query  647  QTSI  658
            QTSI
Sbjct  121  QTSI  124



>ref|XP_002456268.1| hypothetical protein SORBIDRAFT_03g033200 [Sorghum bicolor]
 gb|EES01388.1| hypothetical protein SORBIDRAFT_03g033200 [Sorghum bicolor]
Length=397

 Score =   199 bits (506),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 119/154 (77%), Gaps = 7/154 (5%)
 Frame = +2

Query  221  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLAS-----EGGSK--LKMLISYVDNLPSGD  379
            +L++L+E+C  PA +LRQVADAMA EM AGLAS     E GS   LKML++YVD+LPSG 
Sbjct  40   MLRDLQERCAAPAERLRQVADAMAAEMRAGLASNDSEGESGSTVLLKMLVTYVDSLPSGG  99

Query  380  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  559
            E+GLFYALDLGGTNFRV+R+Q GGKE+ +V +ES+ VSIP+HLM   S  LFDFIA  LA
Sbjct  100  EKGLFYALDLGGTNFRVLRIQFGGKEQRIVKQESKGVSIPQHLMSRGSNELFDFIAAALA  159

Query  560  MFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             FV  EGEDFH+P   QR+LGFTFSFP  Q S+A
Sbjct  160  KFVASEGEDFHLPEGMQRQLGFTFSFPVNQNSVA  193



>ref|XP_007013022.1| Hexokinase 2 isoform 3 [Theobroma cacao]
 gb|EOY30641.1| Hexokinase 2 isoform 3 [Theobroma cacao]
Length=437

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            RH ++SSG+WA+T+A+LKE EEKCGTP  KL+QVADAM VEMHAGLASEGGSKLKM+ISY
Sbjct  25   RHRIKSSGKWARTLAILKEFEEKCGTPISKLKQVADAMTVEMHAGLASEGGSKLKMIISY  84

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VDNLP+GDE+GLFYALDLGGTNFRV+RVQLGGKE  VV +E +EVSIP HLM GSS+   
Sbjct  85   VDNLPTGDEKGLFYALDLGGTNFRVLRVQLGGKESRVVKQEFEEVSIPPHLMTGSSDVGQ  144

Query  536  DFIAHELAMFVKKEGEDFHI  595
            D +  EL   +++ G D  +
Sbjct  145  DVVG-ELTKAMERVGLDMRV  163



>gb|AFW78822.1| hexokinase-2 [Zea mays]
Length=507

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  221  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  400
            +++E+E    TP   LR +ADAM  EM  GL  +  ++LKMLISYVDNLP+GDE GLFYA
Sbjct  49   VIEEVERSLATPTALLRGIADAMVAEMERGLRGDIHAQLKMLISYVDNLPTGDEHGLFYA  108

Query  401  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEG  580
            LDLGGTNFRV+RVQLGG+EK VV ++ +EVSIP HLMVG+S  LFDFIA  LA FV  EG
Sbjct  109  LDLGGTNFRVLRVQLGGREKRVVKQQYEEVSIPPHLMVGTSIELFDFIAAALAKFVDTEG  168

Query  581  EDFHIPPDKQRELGFTFSFPTRQTSIA  661
            EDFH+P  +QRELGFTFSFP  QTSI+
Sbjct  169  EDFHLPEGRQRELGFTFSFPVNQTSIS  195



>ref|XP_008800256.1| PREDICTED: hexokinase-3-like isoform X2 [Phoenix dactylifera]
Length=227

 Score =   193 bits (491),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/161 (56%), Positives = 122/161 (76%), Gaps = 0/161 (0%)
 Frame = +2

Query  179  HHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYV  358
               RS  +W + V +L+E E+ C T  G+L+QV DAMAVEMHAGLAS+GGSKLKML+S++
Sbjct  26   RRARSQRKWRRAVEVLREFEDGCATSIGRLKQVVDAMAVEMHAGLASDGGSKLKMLLSFI  85

Query  359  DNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFD  538
            D+LP+G+E G +YALDLGGTNFRV+RV+LGGK   + + + +  +IPR LM G+SE LFD
Sbjct  86   DSLPNGNEIGTYYALDLGGTNFRVLRVRLGGKGSMISSPQVERQAIPRELMSGTSEDLFD  145

Query  539  FIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            FIA +L  FV++E +     PD+++ LGFTFSFP RQ S++
Sbjct  146  FIAMKLKQFVEQEDDASEKKPDEEKVLGFTFSFPIRQMSVS  186



>ref|XP_006383739.1| hypothetical protein POPTR_0005s25980g [Populus trichocarpa]
 gb|ERP61536.1| hypothetical protein POPTR_0005s25980g [Populus trichocarpa]
Length=331

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +2

Query  218  ALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFY  397
            ++L +L++ C TP   +R VAD+M  +M AGLA +GGS LKM++SYVD+LPSG+E+GLFY
Sbjct  40   SILTKLQQDCATPLPVIRHVADSMTADMRAGLAVDGGSNLKMILSYVDSLPSGNEKGLFY  99

Query  398  ALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKE  577
            ALDLGGTNFR +RVQLGGKE+ VV  E +++SIP+ LM G+SE LFDFIA  LA F +KE
Sbjct  100  ALDLGGTNFRALRVQLGGKEERVVATEFEQLSIPQGLMFGTSEELFDFIASTLAGFAEKE  159

Query  578  GEDFHIPPDKQRELGFTFSFPTRQTSI  658
             + FH+P  +QRE+GFTFSFP +QTSI
Sbjct  160  SKKFHLPHGRQREIGFTFSFPVKQTSI  186



>ref|XP_002298298.1| hexokinase family protein [Populus trichocarpa]
 gb|EEE83103.1| hexokinase family protein [Populus trichocarpa]
Length=508

 Score =   201 bits (510),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +2

Query  200  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  379
            +W + V +L+ELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD+LP+G 
Sbjct  33   KWKRVVRVLEELEEACETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGS  92

Query  380  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  559
            E G +YALDLGGTNFRV+R+QLGG+   +++++ +   IP+HLM  +SE LFDFIA  L 
Sbjct  93   EIGTYYALDLGGTNFRVLRIQLGGRRSSILSQDVERQPIPQHLMTSTSEDLFDFIASTLK  152

Query  560  MFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
             FV+KE       P + RELGFTFSFP +Q+S+
Sbjct  153  QFVEKEESGSEPSPVRTRELGFTFSFPVKQSSL  185



>gb|EMT31348.1| Hexokinase-9 [Aegilops tauschii]
Length=732

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 121/162 (75%), Gaps = 13/162 (8%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  +R + RWA+  A+L +L+E+C  PA +L QV+DAM VEM AGLASE GSKLKML++Y
Sbjct  22   RQRLREAKRWARVAAVLSDLQERCAAPAAQLLQVSDAMDVEMRAGLASEDGSKLKMLVTY  81

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD+LPSGDE+GLFYALDLGGTNFRV+RVQLGGKE+GV+ +ES          VG    LF
Sbjct  82   VDSLPSGDEKGLFYALDLGGTNFRVLRVQLGGKEQGVIKQES----------VGE---LF  128

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            DFIA  LA FV   G D+H+P    RELGFTFSFP +QTSI+
Sbjct  129  DFIAAALAEFVASGGVDYHLPEGTHRELGFTFSFPVKQTSIS  170



>ref|XP_008466487.1| PREDICTED: hexokinase-2, chloroplastic [Cucumis melo]
Length=488

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 119/161 (74%), Gaps = 0/161 (0%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  M    +      +L + ++ C TP   LR VADAMA +M AGLA +GGS LKM++SY
Sbjct  22   RFTMAVGSKAVSVSPILTKFQKDCETPLPVLRHVADAMANDMRAGLAVDGGSDLKMILSY  81

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD LPSG+EEGLFYALDLGGTNFRV+RVQLGGKEK V+  E ++VSIP+HLM  +S+ LF
Sbjct  82   VDTLPSGNEEGLFYALDLGGTNFRVLRVQLGGKEKRVIATEFEQVSIPQHLMFATSQELF  141

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            DFIA  L  FV+ EG+ FH+ P ++RE GFTFSFP +QTSI
Sbjct  142  DFIASGLEKFVESEGDRFHLSPGRKRETGFTFSFPVKQTSI  182



>gb|ACG44289.1| hexokinase-2 [Zea mays]
Length=507

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  221  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  400
            +++E+E    TP   LR +ADAM  EM  GL  +  ++LKMLISYVDNLP+GDE GLFYA
Sbjct  49   VIEEVERSLATPTALLRGIADAMVAEMERGLRGDIHAQLKMLISYVDNLPTGDEHGLFYA  108

Query  401  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEG  580
            LDLGGTNFRV+RVQLGG+EK VV ++ +EVSIP HLMVG+S  LFDFIA  LA FV  EG
Sbjct  109  LDLGGTNFRVLRVQLGGREKRVVKQQYEEVSIPPHLMVGTSIELFDFIAAALAKFVDTEG  168

Query  581  EDFHIPPDKQRELGFTFSFPTRQTSIA  661
            +DFH+P  +QRELGFTFSFP  QTSI+
Sbjct  169  DDFHLPEGRQRELGFTFSFPVNQTSIS  195



>gb|KHN27811.1| Hexokinase-1 [Glycine soja]
Length=433

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +2

Query  299  MHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRE  478
            MHAGLASEGG KLKMLI+YVDNLPSGDE+GLFYALDLGGTNFR +RV LGGKEKGVV  E
Sbjct  1    MHAGLASEGGCKLKMLITYVDNLPSGDEKGLFYALDLGGTNFRTLRVHLGGKEKGVVKIE  60

Query  479  SQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            S+EVSIP HLM GSS+ LFDFIA +LA FV  E E+ H PP +QRELGFTFSFP +QTSI
Sbjct  61   SEEVSIPPHLMTGSSQELFDFIASKLAKFVSSEPEELHPPPGRQRELGFTFSFPVKQTSI  120

Query  659  A  661
            A
Sbjct  121  A  121



>ref|XP_007017793.1| Hexokinase 3 [Theobroma cacao]
 gb|EOY15018.1| Hexokinase 3 [Theobroma cacao]
Length=493

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/161 (59%), Positives = 123/161 (76%), Gaps = 2/161 (1%)
 Frame = +2

Query  176  RHHMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISY  355
            R  +RSS        +L +L+  C TP   L  VAD+M+ +MHAGLA +GGS LKM++SY
Sbjct  26   RMAVRSS--TISVAPMLTKLQSDCATPLPVLLHVADSMSTDMHAGLAVDGGSDLKMILSY  83

Query  356  VDNLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALF  535
            VD+LP+G+E+GLFYALDLGGTNFRV+RVQLGGKE+ V+  E ++V+IP  LM G+SE LF
Sbjct  84   VDSLPTGNEKGLFYALDLGGTNFRVLRVQLGGKEERVIATEFEQVTIPEKLMFGTSEELF  143

Query  536  DFIAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
            DFIA  LA F ++EG  FH+PP ++RE+GFTFSFP +QTSI
Sbjct  144  DFIASVLANFAQQEGGKFHLPPGRKREIGFTFSFPVKQTSI  184



>ref|XP_001754148.1| hexokinase protein HXK7 [Physcomitrella patens]
 gb|EDQ81049.1| hexokinase protein HXK7 [Physcomitrella patens]
Length=521

 Score =   200 bits (508),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +2

Query  221  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  400
            +L E +E C TP  +LRQV DAMAVEMHAGL SEGGSKLKML +Y+D LP G E GL+YA
Sbjct  42   ILLEFQEACYTPLARLRQVVDAMAVEMHAGLVSEGGSKLKMLPTYIDRLPDGHERGLYYA  101

Query  401  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEG  580
            +DLGGTNFRV+RVQLGG E  V+ +E +EV+IP  LM+G+SE LFDFIA EL  FV +EG
Sbjct  102  VDLGGTNFRVLRVQLGGLEGRVIKQEYEEVAIPPELMLGTSEQLFDFIAKELVSFVAREG  161

Query  581  EDFHIPPDKQRELGFTFSFPTRQTSI  658
            +DF +   + RE+GFTFSFP +QT++
Sbjct  162  QDFRLHAGQNREIGFTFSFPVKQTAV  187



>ref|XP_012090051.1| PREDICTED: hexokinase-3-like [Jatropha curcas]
 gb|KDP22128.1| hypothetical protein JCGZ_25959 [Jatropha curcas]
Length=499

 Score =   199 bits (507),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 119/156 (76%), Gaps = 0/156 (0%)
 Frame = +2

Query  191  SSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLP  370
            S  +W + + +LKELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML++YVD+LP
Sbjct  30   SRKKWRRVLGVLKELEESCETTIGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTYVDHLP  89

Query  371  SGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAH  550
            +G E G +YALDLG TNFRV+RVQLGG+E  +++++ ++  IP+HLM  SSE LFDFIA 
Sbjct  90   TGSEIGTYYALDLGDTNFRVLRVQLGGRESLMLSKDVEQQPIPQHLMTSSSEDLFDFIAS  149

Query  551  ELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
             L  FV+KE         + RELGFTFSFP +QTSI
Sbjct  150  TLKQFVEKEESGSEFASVRTRELGFTFSFPVKQTSI  185



>ref|XP_002306924.2| hypothetical protein POPTR_0005s25980g [Populus trichocarpa]
 gb|EEE93920.2| hypothetical protein POPTR_0005s25980g [Populus trichocarpa]
Length=362

 Score =   196 bits (498),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +2

Query  218  ALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFY  397
            ++L +L++ C TP   +R VAD+M  +M AGLA +GGS LKM++SYVD+LPSG+E+GLFY
Sbjct  40   SILTKLQQDCATPLPVIRHVADSMTADMRAGLAVDGGSNLKMILSYVDSLPSGNEKGLFY  99

Query  398  ALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKE  577
            ALDLGGTNFR +RVQLGGKE+ VV  E +++SIP+ LM G+SE LFDFIA  LA F +KE
Sbjct  100  ALDLGGTNFRALRVQLGGKEERVVATEFEQLSIPQGLMFGTSEELFDFIASTLAGFAEKE  159

Query  578  GEDFHIPPDKQRELGFTFSFPTRQTSI  658
             + FH+P  +QRE+GFTFSFP +QTSI
Sbjct  160  SKKFHLPHGRQREIGFTFSFPVKQTSI  186



>ref|XP_002510526.1| hexokinase, putative [Ricinus communis]
 gb|EEF52713.1| hexokinase, putative [Ricinus communis]
Length=495

 Score =   199 bits (506),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/146 (63%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +2

Query  221  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  400
            +L +L+++C TP   LR VAD+M+ +M AGLA++GGS LKM++SYVD+LPSG+E+GLFYA
Sbjct  41   ILTKLQKECATPLPVLRHVADSMSADMRAGLAADGGSDLKMILSYVDHLPSGNEKGLFYA  100

Query  401  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEG  580
            LDLGGTNFRV+RVQLGGKE+ V+  E ++VSIP+ LM G+++ LFDFIA  LA F KKEG
Sbjct  101  LDLGGTNFRVLRVQLGGKEERVIATEFEQVSIPQELMFGTNDQLFDFIASGLANFAKKEG  160

Query  581  EDFHIPPDKQRELGFTFSFPTRQTSI  658
              FH+P  ++RE+GFTFSFP +QTSI
Sbjct  161  GKFHLPHGRKREIGFTFSFPVKQTSI  186



>ref|XP_012073808.1| PREDICTED: hexokinase-2, chloroplastic [Jatropha curcas]
 gb|KDP36930.1| hypothetical protein JCGZ_08221 [Jatropha curcas]
Length=494

 Score =   199 bits (506),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +2

Query  221  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  400
            +L +L+++C TP   LRQVADAM  +M AGL ++G S LKM++SYVD+LPSG+E+GLFYA
Sbjct  40   ILTKLQKECATPLPVLRQVADAMTADMRAGLEADGASDLKMILSYVDSLPSGNEKGLFYA  99

Query  401  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEG  580
            LDLGGTNFRV+RVQLGGKE+ VV  E ++VSIP+ LM G+SE LFDFIA  LA F +KEG
Sbjct  100  LDLGGTNFRVLRVQLGGKEERVVATEFEQVSIPQELMFGTSEELFDFIASGLANFAQKEG  159

Query  581  EDFHIPPDKQRELGFTFSFPTRQTSI  658
              FH+P  ++RE+GFTFSFP +QTS+
Sbjct  160  GKFHLPHGREREIGFTFSFPVKQTSV  185



>ref|XP_003568072.1| PREDICTED: LOW QUALITY PROTEIN: hexokinase-5-like [Brachypodium 
distachyon]
Length=506

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 117/154 (76%), Gaps = 0/154 (0%)
 Frame = +2

Query  200  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  379
            R  K  A+++E+E    TP   LR ++DA+  EM  GL  +  S+LKMLI+YVDNLP+GD
Sbjct  41   RKRKVAAVIEEVERTLATPTALLRGISDALVSEMERGLRGDIHSQLKMLITYVDNLPTGD  100

Query  380  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  559
            E GLFYALDLGGTNFRV+RVQLGG+EK VV ++ +EVSIP HLMVG+S  LFDFIA  L+
Sbjct  101  EHGLFYALDLGGTNFRVLRVQLGGREKRVVKQQYEEVSIPPHLMVGTSMELFDFIAAALS  160

Query  560  MFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             FV  EG DFH+P  +QRELGFTFSFP  QTSI+
Sbjct  161  SFVDTEGADFHLPEGRQRELGFTFSFPVNQTSIS  194



>gb|AHY84733.1| hexokinase [Manihot esculenta]
Length=506

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 118/153 (77%), Gaps = 0/153 (0%)
 Frame = +2

Query  200  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  379
            +W++ V LL+ELEE C TP G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD+LP+G 
Sbjct  33   KWSRVVGLLRELEESCETPVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVDHLPTGS  92

Query  380  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  559
            E G +YALDLGGTNFRV+RVQLGG+   +++++ +   IP+HLM  + E LFDFIA  L 
Sbjct  93   EVGTYYALDLGGTNFRVIRVQLGGRRSSILSKDVELQPIPQHLMTSTREDLFDFIASTLK  152

Query  560  MFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSI  658
             F++KE         ++RELGFTFSFP +Q SI
Sbjct  153  QFIEKEENVSEFSSLRKRELGFTFSFPVKQMSI  185



>gb|EMT15586.1| Hexokinase-7 [Aegilops tauschii]
Length=430

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 114/147 (78%), Gaps = 1/147 (1%)
 Frame = +2

Query  221  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  400
            ++ +L E+C TPA +L  VA AM  EM AGL  EGGSK+KM+ISYVDNLP+G EEGLFYA
Sbjct  12   VVAQLREECATPATRLDGVATAMEEEMRAGLHQEGGSKIKMIISYVDNLPNGSEEGLFYA  71

Query  401  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEG  580
            LDLGGTNFRV+RVQL GK+K VV RES+EVSIP HLM GS+  LF FIA  LA FV  EG
Sbjct  72   LDLGGTNFRVLRVQLAGKDKRVVKRESREVSIPPHLMSGSAAELFGFIASALAKFVADEG  131

Query  581  EDFHIPPDKQRELGFTFSFPTRQTSIA  661
             D  +   KQRELGFTFSFP RQ+SIA
Sbjct  132  -DNKVLDGKQRELGFTFSFPVRQSSIA  157



>ref|XP_006646274.1| PREDICTED: LOW QUALITY PROTEIN: hexokinase-9-like [Oryza brachyantha]
Length=495

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 120/158 (76%), Gaps = 0/158 (0%)
 Frame = +2

Query  188  RSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNL  367
            R+  R  +  A+L+ LEE C  P   LRQVADAMA EM AGLASEG S L+ ++++VD+L
Sbjct  29   RAVKRLERAGAVLRGLEEGCAAPVELLRQVADAMAAEMRAGLASEGESDLQTIVTHVDSL  88

Query  368  PSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIA  547
            PSGDE G+FYALDLGGTNFRV+R+QLGGKE+ V+ ++S+ +SIP+HLM  SS  LFDF+A
Sbjct  89   PSGDETGMFYALDLGGTNFRVLRIQLGGKEQRVIKQDSKGMSIPQHLMSSSSHELFDFVA  148

Query  548  HELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
              LA FV  E ED  +P   QRELGFTFSFP +QTS+A
Sbjct  149  AALAKFVASESEDCCLPEGTQRELGFTFSFPVKQTSLA  186



>ref|NP_001123599.1| hexokinase2 [Zea mays]
 gb|ACD93189.1| hexokinase [Zea mays]
Length=507

 Score =   198 bits (504),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  221  LLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGDEEGLFYA  400
            +++E+E    TP   LR +ADAM  EM  GL  +  ++LKMLISYVDNLP+GDE GLFYA
Sbjct  49   VIEEVERSLATPTALLRGIADAMVAEMERGLRGDIHAQLKMLISYVDNLPTGDEHGLFYA  108

Query  401  LDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELAMFVKKEG  580
            LDLGGTNFRV+RVQLGG+EK VV ++ +EVSIP HLMVG+S  LFDFIA  LA FV  EG
Sbjct  109  LDLGGTNFRVLRVQLGGREKRVVKQQYEEVSIPPHLMVGTSMELFDFIAAALAKFVGTEG  168

Query  581  EDFHIPPDKQRELGFTFSFPTRQTSIA  661
            EDF +P  +QRELGFTFSFP  QTSI+
Sbjct  169  EDFQLPEGRQRELGFTFSFPVNQTSIS  195



>gb|KHN25630.1| Hexokinase-3 [Glycine soja]
Length=387

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 117/160 (73%), Gaps = 1/160 (1%)
 Frame = +2

Query  182  HMRSSGRWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVD  361
            H RS  +W K   +++ELEE C T  G+LRQV DAMAVEMHAGLASEGGSKLKML+++VD
Sbjct  33   HKRSRRKWKKVANVVRELEEGCATRVGRLRQVVDAMAVEMHAGLASEGGSKLKMLLTFVD  92

Query  362  NLPSGDEEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDF  541
            NLP+G E G +YAL LGGTNFRV+RVQL G+       E +   IP+H+M  +SE LFDF
Sbjct  93   NLPNGTERGTYYALHLGGTNFRVLRVQLNGQPSSDFEHEVERQPIPQHVMTSTSEDLFDF  152

Query  542  IAHELAMFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
            IA  L  F+ KEG+  +I  D+ RELGFTFSFP +Q S++
Sbjct  153  IASSLKEFIAKEGDGSNISQDR-RELGFTFSFPVKQMSVS  191



>ref|NP_001056082.1| Os05g0522500 [Oryza sativa Japonica Group]
 sp|Q5W676.1|HXK5_ORYSJ RecName: Full=Hexokinase-5; AltName: Full=Hexokinase I [Oryza 
sativa Japonica Group]
 gb|AAK51559.1|AF372831_1 hexokinase I [Oryza sativa]
 gb|AAV44032.1| hexokinase 1 [Oryza sativa Japonica Group]
 gb|AAV59322.1| hexokinase [Oryza sativa Japonica Group]
 gb|AAZ93622.1| hexokinase 5 [Oryza sativa Japonica Group]
 dbj|BAF17996.1| Os05g0522500 [Oryza sativa Japonica Group]
 gb|EEE64409.1| hypothetical protein OsJ_19253 [Oryza sativa Japonica Group]
Length=507

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 118/154 (77%), Gaps = 0/154 (0%)
 Frame = +2

Query  200  RWAKTVALLKELEEKCGTPAGKLRQVADAMAVEMHAGLASEGGSKLKMLISYVDNLPSGD  379
            R  K  A+++++E    TP   LR ++DAM  EM  GL  +  + +KMLI+YVDNLP+G+
Sbjct  42   RKRKVAAVIEDVEHALSTPTALLRGISDAMVTEMERGLRGDSHAMVKMLITYVDNLPTGN  101

Query  380  EEGLFYALDLGGTNFRVMRVQLGGKEKGVVNRESQEVSIPRHLMVGSSEALFDFIAHELA  559
            E+GLFYALDLGGTNFRV+RVQLGGKEK VV ++ +EVSIP HLMVG+S  LFDFIA  L+
Sbjct  102  EQGLFYALDLGGTNFRVLRVQLGGKEKRVVQQQYEEVSIPPHLMVGTSMELFDFIASALS  161

Query  560  MFVKKEGEDFHIPPDKQRELGFTFSFPTRQTSIA  661
             FV  EG+DFH+P  +QRELGFTFSFP  QTSI+
Sbjct  162  KFVDTEGDDFHLPEGRQRELGFTFSFPVSQTSIS  195



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1077441081409