BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig8823

Length=721
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009588400.1|  PREDICTED: histidine protein methyltransfera...    280   1e-89   Nicotiana tomentosiformis
ref|XP_007034061.1|  S-adenosyl-L-methionine-dependent methyltran...    280   2e-89   
ref|XP_008372076.1|  PREDICTED: histidine protein methyltransfera...    278   8e-89   Malus domestica [apple tree]
ref|XP_009363653.1|  PREDICTED: histidine protein methyltransfera...    278   1e-88   Pyrus x bretschneideri [bai li]
ref|XP_009344374.1|  PREDICTED: histidine protein methyltransfera...    277   2e-88   Pyrus x bretschneideri [bai li]
ref|XP_011037077.1|  PREDICTED: uncharacterized protein LOC105134384    277   4e-88   Populus euphratica
ref|XP_002264228.1|  PREDICTED: histidine protein methyltransfera...    276   8e-88   Vitis vinifera
ref|XP_009781246.1|  PREDICTED: uncharacterized protein LOC104230205    276   8e-88   Nicotiana sylvestris
ref|XP_010097465.1|  hypothetical protein L484_024670                   275   1e-87   Morus notabilis
ref|XP_006372889.1|  hypothetical protein POPTR_0017s06020g             275   2e-87   Populus trichocarpa [western balsam poplar]
ref|XP_002534114.1|  conserved hypothetical protein                     275   3e-87   Ricinus communis
ref|XP_006443065.1|  hypothetical protein CICLE_v10020882mg             275   3e-87   Citrus clementina [clementine]
ref|XP_012066171.1|  PREDICTED: uncharacterized protein LOC105629230    274   5e-87   Jatropha curcas
gb|KJB27983.1|  hypothetical protein B456_005G020100                    272   6e-87   Gossypium raimondii
ref|XP_008222628.1|  PREDICTED: uncharacterized protein LOC103322485    273   1e-86   Prunus mume [ume]
gb|KJB27982.1|  hypothetical protein B456_005G020100                    273   1e-86   Gossypium raimondii
ref|XP_008453987.1|  PREDICTED: uncharacterized protein LOC103494545    272   3e-86   Cucumis melo [Oriental melon]
ref|XP_004152105.1|  PREDICTED: uncharacterized protein LOC101212594    270   2e-85   Cucumis sativus [cucumbers]
gb|KHG16096.1|  Histidine methyltransferase 1                           269   3e-85   Gossypium arboreum [tree cotton]
ref|XP_004309612.1|  PREDICTED: histidine protein methyltransfera...    268   1e-84   Fragaria vesca subsp. vesca
gb|KJB71894.1|  hypothetical protein B456_011G146300                    267   2e-84   Gossypium raimondii
ref|XP_006858675.1|  PREDICTED: histidine protein methyltransfera...    266   4e-84   Amborella trichopoda
ref|XP_008791776.1|  PREDICTED: histidine protein methyltransfera...    265   8e-84   Phoenix dactylifera
ref|XP_010930203.1|  PREDICTED: histidine protein methyltransfera...    263   5e-83   Elaeis guineensis
ref|XP_006347281.1|  PREDICTED: histidine protein methyltransfera...    262   1e-82   Solanum tuberosum [potatoes]
ref|XP_008799945.1|  PREDICTED: histidine protein methyltransfera...    262   2e-82   Phoenix dactylifera
ref|XP_010912793.1|  PREDICTED: uncharacterized protein LOC105038627    262   2e-82   
ref|XP_010043656.1|  PREDICTED: uncharacterized protein LOC104432789    261   3e-82   Eucalyptus grandis [rose gum]
gb|KHG29074.1|  Histidine methyltransferase 1                           261   5e-82   Gossypium arboreum [tree cotton]
ref|XP_002310441.1|  hypothetical protein POPTR_0007s02090g             259   4e-81   Populus trichocarpa [western balsam poplar]
ref|XP_004241398.1|  PREDICTED: histidine protein methyltransfera...    258   9e-81   
ref|XP_009416014.1|  PREDICTED: histidine protein methyltransfera...    254   1e-79   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011026390.1|  PREDICTED: uncharacterized protein LOC105127016    254   3e-79   Populus euphratica
ref|XP_010242753.1|  PREDICTED: histidine protein methyltransfera...    250   9e-78   Nelumbo nucifera [Indian lotus]
ref|XP_010525954.1|  PREDICTED: uncharacterized protein LOC104803653    250   1e-77   Tarenaya hassleriana [spider flower]
ref|XP_008798999.1|  PREDICTED: histidine protein methyltransfera...    247   2e-76   Phoenix dactylifera
ref|XP_009401143.1|  PREDICTED: histidine protein methyltransfera...    246   2e-76   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907676.1|  PREDICTED: histidine protein methyltransfera...    245   6e-76   Elaeis guineensis
ref|XP_010520847.1|  PREDICTED: uncharacterized protein LOC104799618    245   7e-76   Tarenaya hassleriana [spider flower]
ref|XP_009405561.1|  PREDICTED: uncharacterized protein LOC103988679    240   5e-74   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010907675.1|  PREDICTED: histidine protein methyltransfera...    239   2e-73   Elaeis guineensis
gb|KDO43477.1|  hypothetical protein CISIN_1g018716mg                   236   9e-73   Citrus sinensis [apfelsine]
ref|XP_003580042.1|  PREDICTED: histidine protein methyltransfera...    232   8e-71   Brachypodium distachyon [annual false brome]
ref|XP_002446718.1|  hypothetical protein SORBIDRAFT_06g021130          231   1e-70   Sorghum bicolor [broomcorn]
ref|NP_001242428.1|  uncharacterized protein LOC100786056               231   1e-70   
ref|XP_010671826.1|  PREDICTED: uncharacterized protein LOC104888516    231   2e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006597006.1|  PREDICTED: uncharacterized protein LOC100786...    231   2e-70   Glycine max [soybeans]
ref|XP_004976058.1|  PREDICTED: uncharacterized protein LOC101755614    230   4e-70   Setaria italica
emb|CAH67536.1|  H0425E08.4                                             229   8e-70   Oryza sativa [red rice]
ref|NP_001053176.1|  Os04g0492400                                       229   8e-70   
ref|XP_008667701.1|  PREDICTED: uncharacterized protein LOC100277...    229   1e-69   Zea mays [maize]
gb|KHN30105.1|  Histidine protein methyltransferase 1 like              228   2e-69   Glycine soja [wild soybean]
ref|XP_006652451.1|  PREDICTED: uncharacterized protein LOC102711251    228   2e-69   Oryza brachyantha
ref|XP_003543558.1|  PREDICTED: uncharacterized protein LOC100810...    228   2e-69   Glycine max [soybeans]
gb|KHN33316.1|  Histidine protein methyltransferase 1 like              228   3e-69   Glycine soja [wild soybean]
ref|XP_004957334.1|  PREDICTED: histidine protein methyltransfera...    227   6e-69   Setaria italica
ref|NP_001144579.1|  uncharacterized protein LOC100277589               226   2e-68   Zea mays [maize]
emb|CDY23358.1|  BnaC04g48860D                                          226   2e-68   Brassica napus [oilseed rape]
ref|XP_006397494.1|  hypothetical protein EUTSA_v10001523mg             226   3e-68   Eutrema salsugineum [saltwater cress]
ref|XP_010508446.1|  PREDICTED: histidine protein methyltransfera...    225   4e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010506201.1|  PREDICTED: histidine protein methyltransfera...    225   4e-68   Camelina sativa [gold-of-pleasure]
emb|CAN69477.1|  hypothetical protein VITISV_017347                     224   6e-68   Vitis vinifera
ref|XP_010517889.1|  PREDICTED: histidine protein methyltransfera...    224   8e-68   Camelina sativa [gold-of-pleasure]
ref|XP_009142187.1|  PREDICTED: uncharacterized protein LOC103866064    224   8e-68   Brassica rapa
ref|XP_006294500.1|  hypothetical protein CARUB_v10023531mg             224   9e-68   Capsella rubella
ref|NP_565997.1|  S-adenosyl-L-methionine-dependent methyltransfe...    224   1e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CDY30401.1|  BnaA04g25020D                                          223   2e-67   Brassica napus [oilseed rape]
gb|EEE70043.1|  hypothetical protein OsJ_29997                          223   4e-67   Oryza sativa Japonica Group [Japonica rice]
gb|AAL16294.1|AF428364_1  At2g43320/T1O24.6                             222   6e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006660841.1|  PREDICTED: uncharacterized protein LOC102708742    222   6e-67   Oryza brachyantha
ref|NP_001159150.1|  hypothetical protein                               222   7e-67   Zea mays [maize]
ref|XP_007150422.1|  hypothetical protein PHAVU_005G152300g             219   5e-66   Phaseolus vulgaris [French bean]
gb|EMT24897.1|  hypothetical protein F775_32531                         219   1e-65   
gb|EMS59379.1|  hypothetical protein TRIUR3_33843                       219   2e-64   Triticum urartu
ref|XP_004486926.1|  PREDICTED: uncharacterized protein LOC101511...    215   2e-64   Cicer arietinum [garbanzo]
ref|XP_009133591.1|  PREDICTED: histidine protein methyltransfera...    216   2e-64   Brassica rapa
emb|CDY44218.1|  BnaC03g24100D                                          215   4e-64   Brassica napus [oilseed rape]
ref|XP_003597493.1|  hypothetical protein MTR_2g098630                  215   6e-64   
gb|EEC84878.1|  hypothetical protein OsI_32028                          212   6e-63   Oryza sativa Indica Group [Indian rice]
ref|XP_010238357.1|  PREDICTED: uncharacterized protein LOC100830260    211   8e-63   Brachypodium distachyon [annual false brome]
ref|XP_003597492.1|  hypothetical protein MTR_2g098630                  209   6e-62   Medicago truncatula
ref|XP_002881896.1|  hypothetical protein ARALYDRAFT_483439             209   8e-62   
gb|KDO43480.1|  hypothetical protein CISIN_1g018716mg                   160   5e-44   Citrus sinensis [apfelsine]
gb|ABR16574.1|  unknown                                                 159   2e-42   Picea sitchensis
gb|ABK25033.1|  unknown                                                 157   1e-41   Picea sitchensis
ref|NP_001063658.2|  Os09g0514300                                       147   1e-38   
emb|CDP20792.1|  unnamed protein product                                147   1e-38   Coffea canephora [robusta coffee]
ref|XP_009373561.1|  PREDICTED: histidine protein methyltransfera...    144   1e-37   Pyrus x bretschneideri [bai li]
dbj|BAD34426.1|  hypothetical protein                                   141   2e-36   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002269192.1|  PREDICTED: histidine protein methyltransfera...    140   5e-36   Vitis vinifera
ref|XP_007222358.1|  hypothetical protein PRUPE_ppa009767mg             139   5e-36   
ref|XP_007223424.1|  hypothetical protein PRUPE_ppa010155mg             139   6e-36   
ref|XP_011073784.1|  PREDICTED: histidine protein methyltransfera...    140   6e-36   Sesamum indicum [beniseed]
ref|XP_008222747.1|  PREDICTED: histidine protein methyltransfera...    140   7e-36   Prunus mume [ume]
emb|CBI39376.3|  unnamed protein product                                135   1e-35   Vitis vinifera
ref|XP_009625430.1|  PREDICTED: histidine protein methyltransfera...    139   1e-35   Nicotiana tomentosiformis
gb|EYU32714.1|  hypothetical protein MIMGU_mgv1a010754mg                139   1e-35   Erythranthe guttata [common monkey flower]
ref|XP_010673378.1|  PREDICTED: histidine protein methyltransfera...    139   1e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB71877.1|  hypothetical protein B456_011G152100                    137   1e-35   Gossypium raimondii
ref|XP_007163808.1|  hypothetical protein PHAVU_001G266000g             139   2e-35   Phaseolus vulgaris [French bean]
ref|XP_010673377.1|  PREDICTED: histidine protein methyltransfera...    139   2e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009764705.1|  PREDICTED: histidine protein methyltransfera...    139   2e-35   Nicotiana sylvestris
ref|XP_006349911.1|  PREDICTED: histidine protein methyltransfera...    138   3e-35   Solanum tuberosum [potatoes]
ref|XP_007034208.1|  Methyltransferase family protein                   138   4e-35   
ref|XP_002300145.1|  hypothetical protein POPTR_0001s32830g             138   4e-35   Populus trichocarpa [western balsam poplar]
gb|KJB71879.1|  hypothetical protein B456_011G152100                    137   4e-35   Gossypium raimondii
gb|KJB71880.1|  hypothetical protein B456_011G152100                    137   4e-35   Gossypium raimondii
ref|XP_010258579.1|  PREDICTED: histidine protein methyltransfera...    138   4e-35   Nelumbo nucifera [Indian lotus]
ref|XP_010314745.1|  PREDICTED: histidine protein methyltransfera...    138   4e-35   
gb|KJB71876.1|  hypothetical protein B456_011G152100                    137   5e-35   Gossypium raimondii
gb|KJB71878.1|  hypothetical protein B456_011G152100                    137   6e-35   Gossypium raimondii
gb|KHG01813.1|  Histidine protein methyltransferase 1                   137   6e-35   Gossypium arboreum [tree cotton]
ref|XP_004252981.2|  PREDICTED: histidine protein methyltransfera...    137   7e-35   Solanum lycopersicum
ref|XP_001760682.1|  predicted protein                                  137   7e-35   
ref|XP_006841538.1|  PREDICTED: histidine protein methyltransfera...    137   1e-34   Amborella trichopoda
gb|KHG01812.1|  Histidine protein methyltransferase 1                   137   1e-34   Gossypium arboreum [tree cotton]
ref|XP_008358052.1|  PREDICTED: histidine protein methyltransfera...    136   2e-34   Malus domestica [apple tree]
ref|XP_002532519.1|  conserved hypothetical protein                     134   6e-34   Ricinus communis
gb|EPS60086.1|  hypothetical protein M569_14718                         134   6e-34   Genlisea aurea
ref|XP_006601885.1|  PREDICTED: histidine protein methyltransfera...    134   1e-33   Glycine max [soybeans]
ref|XP_003552281.1|  PREDICTED: histidine protein methyltransfera...    134   1e-33   Glycine max [soybeans]
ref|XP_010068986.1|  PREDICTED: histidine protein methyltransfera...    133   2e-33   Eucalyptus grandis [rose gum]
gb|KHN44473.1|  Histidine protein methyltransferase 1 like              132   2e-33   Glycine soja [wild soybean]
ref|XP_010258580.1|  PREDICTED: histidine protein methyltransfera...    133   4e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010258577.1|  PREDICTED: histidine protein methyltransfera...    133   6e-33   Nelumbo nucifera [Indian lotus]
gb|KDP32603.1|  hypothetical protein JCGZ_13153                         131   1e-32   Jatropha curcas
ref|XP_002984087.1|  hypothetical protein SELMODRAFT_180720             130   1e-32   
ref|XP_012078462.1|  PREDICTED: histidine protein methyltransfera...    132   1e-32   Jatropha curcas
ref|XP_002960051.1|  hypothetical protein SELMODRAFT_73463              130   2e-32   
ref|XP_004296995.1|  PREDICTED: histidine protein methyltransfera...    130   2e-32   Fragaria vesca subsp. vesca
ref|XP_004489175.1|  PREDICTED: histidine protein methyltransfera...    130   3e-32   Cicer arietinum [garbanzo]
ref|XP_004489174.1|  PREDICTED: histidine protein methyltransfera...    130   3e-32   Cicer arietinum [garbanzo]
gb|KDO47442.1|  hypothetical protein CISIN_1g030031mg                   127   4e-32   Citrus sinensis [apfelsine]
gb|AFK36874.1|  unknown                                                 129   1e-31   Medicago truncatula
ref|XP_011003636.1|  PREDICTED: histidine protein methyltransfera...    129   1e-31   Populus euphratica
ref|XP_009392918.1|  PREDICTED: histidine protein methyltransfera...    128   2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004147645.1|  PREDICTED: histidine protein methyltransfera...    127   3e-31   Cucumis sativus [cucumbers]
ref|XP_004956645.1|  PREDICTED: histidine protein methyltransfera...    127   4e-31   Setaria italica
gb|KFK36305.1|  hypothetical protein AALP_AA4G105100                    126   5e-31   Arabis alpina [alpine rockcress]
ref|XP_010527454.1|  PREDICTED: histidine protein methyltransfera...    127   5e-31   Tarenaya hassleriana [spider flower]
ref|XP_010910923.1|  PREDICTED: histidine protein methyltransfera...    127   6e-31   Elaeis guineensis
ref|XP_006421030.1|  hypothetical protein CICLE_v10005461mg             127   7e-31   
ref|NP_567417.1|  putative methyltransferase family protein             126   8e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_012078461.1|  PREDICTED: histidine protein methyltransfera...    127   1e-30   
ref|XP_008439038.1|  PREDICTED: histidine protein methyltransfera...    126   1e-30   Cucumis melo [Oriental melon]
ref|XP_008668398.1|  PREDICTED: uncharacterized protein LOC100383...    124   1e-30   Zea mays [maize]
ref|XP_003578016.1|  PREDICTED: histidine protein methyltransfera...    125   2e-30   Brachypodium distachyon [annual false brome]
ref|XP_009139570.1|  PREDICTED: histidine protein methyltransfera...    125   2e-30   Brassica rapa
ref|XP_010450119.1|  PREDICTED: histidine protein methyltransfera...    124   4e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006414825.1|  hypothetical protein EUTSA_v10025872mg             124   5e-30   Eutrema salsugineum [saltwater cress]
ref|NP_001169409.1|  uncharacterized protein LOC100383278               124   5e-30   Zea mays [maize]
gb|AAM63649.1|  unknown                                                 123   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450136.1|  PREDICTED: histidine protein methyltransfera...    123   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_002460101.1|  hypothetical protein SORBIDRAFT_02g022780          125   1e-29   
ref|XP_008792354.1|  PREDICTED: histidine protein methyltransfera...    123   1e-29   Phoenix dactylifera
ref|XP_006492532.1|  PREDICTED: histidine protein methyltransfera...    122   1e-29   Citrus sinensis [apfelsine]
ref|XP_006284234.1|  hypothetical protein CARUB_v10005396mg             122   1e-29   Capsella rubella
ref|NP_001062976.1|  Os09g0359900                                       123   2e-29   
ref|XP_010435209.1|  PREDICTED: histidine protein methyltransfera...    121   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006661157.1|  PREDICTED: histidine protein methyltransfera...    121   7e-29   Oryza brachyantha
gb|EAZ08782.1|  hypothetical protein OsI_31043                          122   8e-29   Oryza sativa Indica Group [Indian rice]
ref|XP_002870342.1|  hypothetical protein ARALYDRAFT_493511             120   9e-29   
ref|XP_001769361.1|  predicted protein                                  119   1e-28   
emb|CDY01181.1|  BnaA04g06380D                                          120   1e-28   
emb|CDY12725.1|  BnaC04g29160D                                          120   2e-28   Brassica napus [oilseed rape]
ref|XP_008792356.1|  PREDICTED: histidine protein methyltransfera...    119   2e-28   
dbj|BAK04918.1|  predicted protein                                      117   2e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS67427.1|  hypothetical protein TRIUR3_02638                       117   3e-28   Triticum urartu
ref|XP_002965969.1|  hypothetical protein SELMODRAFT_84048              118   3e-28   
ref|XP_008222847.1|  PREDICTED: LOW QUALITY PROTEIN: histidine pr...    110   9e-26   
emb|CAB10179.1|  hypothetical protein                                   106   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010097970.1|  hypothetical protein L484_026863                   103   2e-22   
gb|EMT16017.1|  hypothetical protein F775_04000                       92.0    2e-18   
ref|XP_008222771.1|  PREDICTED: uncharacterized protein LOC103322619  92.0    5e-18   
ref|XP_009048112.1|  hypothetical protein LOTGIDRAFT_139771           79.3    2e-14   Lottia gigantea
ref|XP_002952933.1|  hypothetical protein VOLCADRAFT_105747           79.0    5e-14   Volvox carteri f. nagariensis
ref|XP_001626383.1|  predicted protein                                77.0    8e-14   Nematostella vectensis
emb|CCD81669.1|  hypothetical protein Smp_171890.2                    76.6    2e-13   Schistosoma mansoni
ref|XP_011682939.1|  PREDICTED: histidine protein methyltransfera...  77.0    2e-13   Strongylocentrotus purpuratus [purple urchin]
emb|CCD81668.1|  hypothetical protein Smp_171890.1                    77.0    2e-13   Schistosoma mansoni
emb|CAX70551.1|  hypothetical protein                                 73.9    3e-13   Schistosoma japonicum
gb|KDO33764.1|  hypothetical protein SPRG_01645                       76.3    3e-13   Saprolegnia parasitica CBS 223.65
ref|XP_009030975.1|  hypothetical protein HELRODRAFT_90686            75.1    4e-13   Helobdella robusta
ref|XP_006630366.1|  PREDICTED: histidine protein methyltransfera...  75.1    2e-12   
ref|XP_011344984.1|  PREDICTED: histidine protein methyltransfera...  73.6    2e-12   Ooceraea biroi
ref|XP_002605872.1|  hypothetical protein BRAFLDRAFT_90801            72.8    2e-12   Branchiostoma floridae
ref|XP_004352569.1|  methyltransferase domain containing protein      73.6    2e-12   Acanthamoeba castellanii str. Neff
gb|KGB40186.1|  Histidine protein methyltransferase 1-like protein    73.6    3e-12   Schistosoma haematobium
emb|CAX70552.1|  hypothetical protein                                 73.9    3e-12   Schistosoma japonicum
ref|XP_005940719.1|  PREDICTED: histidine protein methyltransfera...  74.7    3e-12   Haplochromis burtoni
ref|XP_006808038.1|  PREDICTED: histidine protein methyltransfera...  74.7    3e-12   Neolamprologus brichardi [lyretail cichlid]
ref|XP_011344983.1|  PREDICTED: histidine protein methyltransfera...  73.2    5e-12   Ooceraea biroi
ref|XP_011344982.1|  PREDICTED: histidine protein methyltransfera...  73.2    5e-12   Ooceraea biroi
ref|XP_008198493.1|  PREDICTED: histidine protein methyltransfera...  72.8    5e-12   Tribolium castaneum [rust-red flour beetle]
ref|XP_008198492.1|  PREDICTED: histidine protein methyltransfera...  73.2    5e-12   
ref|XP_001310816.1|  hypothetical protein                             71.6    8e-12   Trichomonas vaginalis G3
ref|NP_001135719.1|  methyltransferase like 18                        73.6    9e-12   Xenopus tropicalis [western clawed frog]
ref|NP_001088691.1|  methyltransferase like 18                        73.2    1e-11   Xenopus laevis [clawed frog]
ref|XP_008320195.1|  PREDICTED: histidine protein methyltransfera...  73.2    1e-11   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008320194.1|  PREDICTED: histidine protein methyltransfera...  73.2    1e-11   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008320196.1|  PREDICTED: histidine protein methyltransfera...  73.2    1e-11   Cynoglossus semilaevis [half-smooth tongue sole]
gb|EFN78549.1|  UPF0558 protein C1orf156-like protein                 72.0    1e-11   Harpegnathos saltator
ref|XP_008320198.1|  PREDICTED: histidine protein methyltransfera...  73.2    1e-11   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003694546.1|  PREDICTED: histidine protein methyltransfera...  72.0    1e-11   
ref|XP_005743935.1|  PREDICTED: histidine protein methyltransfera...  73.2    1e-11   Pundamilia nyererei
ref|XP_008607032.1|  hypothetical protein SDRG_03186                  72.0    1e-11   Saprolegnia diclina VS20
ref|XP_011148494.1|  PREDICTED: histidine protein methyltransfera...  72.0    1e-11   Harpegnathos saltator
ref|XP_004555913.1|  PREDICTED: histidine protein methyltransfera...  72.8    1e-11   
ref|XP_005474206.1|  PREDICTED: histidine protein methyltransfera...  72.8    1e-11   
gb|KDR07955.1|  hypothetical protein L798_01609                       72.0    2e-11   Zootermopsis nevadensis
ref|XP_001606727.1|  PREDICTED: histidine protein methyltransfera...  71.6    2e-11   Nasonia vitripennis
ref|XP_009163918.1|  hypothetical protein T265_01595                  71.2    2e-11   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_011258559.1|  PREDICTED: histidine protein methyltransfera...  71.2    3e-11   Camponotus floridanus
ref|XP_646119.1|  UPF0558 protein                                     71.2    3e-11   Dictyostelium discoideum AX4
ref|XP_006677634.1|  hypothetical protein BATDEDRAFT_86828            71.2    3e-11   Batrachochytrium dendrobatidis JAM81
ref|XP_008558586.1|  PREDICTED: histidine protein methyltransfera...  70.9    3e-11   Microplitis demolitor
gb|EKC42353.1|  hypothetical protein CGI_10018264                     70.5    5e-11   Crassostrea gigas
dbj|GAA51749.1|  histidine protein methyltransferase 1 homolog        70.9    5e-11   Clonorchis sinensis [oriental liver fluke]
ref|XP_002740457.1|  PREDICTED: histidine protein methyltransfera...  70.5    5e-11   Saccoglossus kowalevskii
ref|XP_010735869.1|  PREDICTED: histidine protein methyltransfera...  70.9    6e-11   
ref|XP_010780704.1|  PREDICTED: histidine protein methyltransfera...  70.9    8e-11   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008280611.1|  PREDICTED: histidine protein methyltransfera...  70.5    8e-11   Stegastes partitus
ref|XP_010867134.1|  PREDICTED: histidine protein methyltransfera...  70.9    8e-11   Esox lucius
ref|XP_011456011.1|  PREDICTED: histidine protein methyltransfera...  69.7    9e-11   Crassostrea gigas
ref|XP_006369821.1|  hypothetical protein POPTR_0001s32830g           68.6    9e-11   
ref|XP_007240450.1|  PREDICTED: histidine protein methyltransfera...  70.1    9e-11   
ref|XP_011482787.1|  PREDICTED: histidine protein methyltransfera...  70.1    1e-10   Oryzias latipes [Japanese rice fish]
ref|XP_012140462.1|  PREDICTED: histidine protein methyltransfera...  69.3    1e-10   Megachile rotundata
ref|XP_006614595.1|  PREDICTED: histidine protein methyltransfera...  69.3    1e-10   Apis dorsata [rock honeybee]
emb|CAG09364.1|  unnamed protein product                              68.6    1e-10   Tetraodon nigroviridis
ref|XP_011563419.1|  PREDICTED: histidine protein methyltransfera...  68.6    2e-10   Plutella xylostella [cabbage moth]
ref|XP_009494562.1|  hypothetical protein H696_02386                  68.9    3e-10   Fonticula alba
gb|EFA10806.1|  hypothetical protein TcasGA2_TC030563                 67.8    3e-10   
gb|EFX87694.1|  hypothetical protein DAPPUDRAFT_207481                68.2    3e-10   Daphnia pulex
ref|XP_001372447.1|  PREDICTED: histidine protein methyltransfera...  68.6    4e-10   Monodelphis domestica
ref|XP_004932074.1|  PREDICTED: histidine protein methyltransfera...  67.8    4e-10   Bombyx mori [silk moth]
ref|XP_003382692.1|  PREDICTED: histidine protein methyltransfera...  67.8    5e-10   Amphimedon queenslandica
ref|XP_008102223.1|  PREDICTED: LOW QUALITY PROTEIN: histidine pr...  67.4    6e-10   
ref|XP_004756724.1|  PREDICTED: histidine protein methyltransfera...  68.2    6e-10   Mustela putorius furo [black ferret]
ref|XP_006564114.1|  PREDICTED: histidine protein methyltransfera...  67.4    6e-10   Apis mellifera [bee]
ref|XP_003767458.1|  PREDICTED: histidine protein methyltransfera...  68.2    7e-10   Sarcophilus harrisii
ref|XP_011300889.1|  PREDICTED: histidine protein methyltransfera...  67.0    7e-10   Fopius arisanus
ref|XP_004365652.1|  hypothetical protein CAOG_00781                  68.2    7e-10   Capsaspora owczarzaki ATCC 30864
ref|NP_001139089.1|  histidine protein methyltransferase 1 homolog    67.4    9e-10   Danio rerio [leopard danio]
ref|XP_010835009.1|  PREDICTED: histidine protein methyltransfera...  67.8    9e-10   Bison bison bison
ref|XP_011872314.1|  PREDICTED: histidine protein methyltransfera...  67.0    9e-10   Vollenhovia emeryi
ref|XP_005902446.1|  PREDICTED: histidine protein methyltransfera...  67.8    9e-10   Bos mutus
gb|AAI55788.1|  Unknown (protein for IMAGE:7142884)                   67.4    1e-09   Danio rerio [leopard danio]
ref|XP_010952146.1|  PREDICTED: histidine protein methyltransfera...  67.4    1e-09   Camelus bactrianus [camel]
ref|XP_011222402.1|  PREDICTED: histidine protein methyltransfera...  67.4    1e-09   Ailuropoda melanoleuca
ref|XP_006173299.1|  PREDICTED: histidine protein methyltransfera...  67.4    1e-09   Camelus ferus
gb|EPY89558.1|  histidine protein methyltransferase 1-like protein    67.4    1e-09   Camelus ferus
ref|XP_011631531.1|  PREDICTED: histidine protein methyltransfera...  66.6    1e-09   Pogonomyrmex barbatus
ref|XP_011631528.1|  PREDICTED: histidine protein methyltransfera...  66.6    1e-09   Pogonomyrmex barbatus
gb|KHN00212.1|  hypothetical protein glysoja_047383                   64.7    1e-09   Glycine soja [wild soybean]
ref|XP_011056005.1|  PREDICTED: histidine protein methyltransfera...  66.2    1e-09   Acromyrmex echinatior
ref|XP_011056006.1|  PREDICTED: histidine protein methyltransfera...  66.2    1e-09   Acromyrmex echinatior
ref|XP_005106450.1|  PREDICTED: histidine protein methyltransfera...  66.2    2e-09   
ref|XP_008580290.1|  PREDICTED: histidine protein methyltransfera...  66.6    2e-09   Galeopterus variegatus [Malayan flying lemur]
gb|ESA23413.1|  hypothetical protein GLOINDRAFT_342180                66.2    2e-09   
ref|XP_004013727.1|  PREDICTED: histidine protein methyltransfera...  66.2    2e-09   Ovis aries [domestic sheep]
gb|EFA78079.1|  UPF0558 protein                                       65.9    2e-09   Heterostelium album PN500
ref|XP_011056007.1|  PREDICTED: histidine protein methyltransfera...  64.7    3e-09   Acromyrmex echinatior
ref|XP_006872719.1|  PREDICTED: histidine protein methyltransfera...  66.2    3e-09   Chrysochloris asiatica
ref|XP_005973460.1|  PREDICTED: histidine protein methyltransfera...  65.9    3e-09   Pantholops hodgsonii [Tibetan antelope]
ref|XP_012059702.1|  PREDICTED: histidine protein methyltransfera...  65.5    3e-09   Atta cephalotes
ref|XP_003396547.1|  PREDICTED: histidine protein methyltransfera...  65.1    3e-09   
ref|NP_001073825.1|  histidine protein methyltransferase 1 homolog    65.9    3e-09   Bos taurus [bovine]
ref|XP_006073170.1|  PREDICTED: histidine protein methyltransfera...  65.9    3e-09   Bubalus bubalis [domestic water buffalo]
ref|XP_004384153.1|  PREDICTED: histidine protein methyltransfera...  65.9    3e-09   Trichechus manatus latirostris
ref|XP_003964181.2|  PREDICTED: histidine protein methyltransfera...  65.9    4e-09   Takifugu rubripes [tiger puffer]
ref|XP_002904631.1|  conserved hypothetical protein                   65.9    4e-09   Phytophthora infestans T30-4
ref|XP_008427922.1|  PREDICTED: histidine protein methyltransfera...  65.5    4e-09   Poecilia reticulata
ref|XP_006115945.1|  PREDICTED: histidine protein methyltransfera...  65.9    4e-09   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_005690684.1|  PREDICTED: histidine protein methyltransfera...  65.9    4e-09   Capra hircus [domestic goat]
ref|XP_010632298.1|  PREDICTED: histidine protein methyltransfera...  65.5    4e-09   Fukomys damarensis [Damara mole rat]
ref|XP_006150172.1|  PREDICTED: histidine protein methyltransfera...  65.5    4e-09   Tupaia chinensis
ref|XP_005800472.1|  PREDICTED: histidine protein methyltransfera...  65.5    5e-09   
ref|XP_005646641.1|  hypothetical protein COCSUDRAFT_83488            65.1    5e-09   Coccomyxa subellipsoidea C-169
ref|XP_001944925.1|  PREDICTED: histidine protein methyltransfera...  64.3    5e-09   
ref|XP_005856090.1|  hypothetical protein NGA_2078500                 64.7    5e-09   
ref|XP_011396380.1|  Histidine protein methyltransferase 1-like p...  63.5    5e-09   
ref|XP_011690635.1|  PREDICTED: histidine protein methyltransfera...  64.7    6e-09   
ref|XP_006942739.1|  PREDICTED: histidine protein methyltransfera...  65.1    6e-09   
ref|XP_004408946.1|  PREDICTED: histidine protein methyltransfera...  65.1    6e-09   
gb|EHJ63617.1|  hypothetical protein KGM_19911                        64.7    6e-09   
ref|XP_007531845.1|  PREDICTED: histidine protein methyltransfera...  65.1    7e-09   
ref|XP_004706801.1|  PREDICTED: histidine protein methyltransfera...  65.1    7e-09   
ref|XP_001514509.1|  PREDICTED: histidine protein methyltransfera...  65.1    7e-09   
ref|XP_002760452.1|  PREDICTED: histidine protein methyltransfera...  65.1    7e-09   
gb|EWM22047.1|  Nicotinamide N-methyltransferase, putative            64.3    8e-09   
ref|XP_004658860.1|  PREDICTED: histidine protein methyltransfera...  64.7    8e-09   
gb|KGL73216.1|  Histidine protein methyltransferase 1                 64.3    8e-09   
ref|XP_004989965.1|  hypothetical protein PTSG_09536                  63.2    8e-09   
gb|KIZ00645.1|  hypothetical protein MNEG_7316                        64.7    8e-09   
ref|XP_008061452.1|  PREDICTED: histidine protein methyltransfera...  64.7    8e-09   
ref|XP_007572694.1|  PREDICTED: histidine protein methyltransfera...  64.7    9e-09   
ref|XP_007077080.1|  PREDICTED: histidine protein methyltransfera...  64.7    9e-09   
ref|XP_009824655.1|  hypothetical protein, variant                    63.2    1e-08   
ref|XP_010982787.1|  PREDICTED: histidine protein methyltransfera...  64.3    1e-08   
ref|XP_006211164.1|  PREDICTED: histidine protein methyltransfera...  64.3    1e-08   
ref|XP_003785763.1|  PREDICTED: histidine protein methyltransfera...  64.3    1e-08   
gb|KHJ90206.1|  hypothetical protein OESDEN_09955                     61.6    1e-08   
ref|XP_008694128.1|  PREDICTED: histidine protein methyltransfera...  64.3    1e-08   
ref|XP_003258900.1|  PREDICTED: histidine protein methyltransfera...  64.3    1e-08   
emb|CDP21396.1|  unnamed protein product                              60.1    1e-08   
ref|XP_010220188.1|  PREDICTED: histidine protein methyltransfera...  63.9    1e-08   
ref|XP_004688172.1|  PREDICTED: histidine protein methyltransfera...  63.9    1e-08   
ref|XP_003492990.1|  PREDICTED: histidine protein methyltransfera...  63.5    2e-08   
ref|XP_003112871.1|  hypothetical protein CRE_25466                   63.2    2e-08   
ref|XP_006740384.1|  PREDICTED: histidine protein methyltransfera...  63.9    2e-08   
ref|NP_001020839.1|  histidine protein methyltransferase 1 homolog    63.9    2e-08   
gb|ETM50979.1|  hypothetical protein L914_05081                       63.2    2e-08   
ref|XP_009824654.1|  hypothetical protein H257_02629                  63.2    2e-08   
gb|ETI51368.1|  hypothetical protein F443_05262                       63.2    2e-08   
gb|ETP49064.1|  hypothetical protein F442_05314                       63.2    2e-08   
gb|ETL97816.1|  hypothetical protein L917_04968                       63.2    2e-08   
ref|XP_003125680.1|  PREDICTED: LOW QUALITY PROTEIN: histidine pr...  63.5    2e-08   
gb|ETO80110.1|  hypothetical protein F444_05308                       63.2    2e-08   
ref|XP_008902696.1|  hypothetical protein PPTG_09456                  63.2    2e-08   
gb|ETK91247.1|  hypothetical protein L915_05127                       63.2    2e-08   
gb|EHB03009.1|  hypothetical protein GW7_03493                        63.2    2e-08   
ref|XP_005398239.1|  PREDICTED: histidine protein methyltransfera...  63.5    2e-08   
ref|XP_003508324.1|  PREDICTED: histidine protein methyltransfera...  63.5    2e-08   
ref|XP_002715426.1|  PREDICTED: histidine protein methyltransfera...  63.5    2e-08   
ref|XP_004425114.1|  PREDICTED: histidine protein methyltransfera...  63.5    2e-08   
ref|XP_009857802.1|  PREDICTED: histidine protein methyltransfera...  63.2    2e-08   
dbj|BAE90588.1|  unnamed protein product                              62.8    2e-08   
gb|KFQ28642.1|  Histidine protein methyltransferase 1                 62.8    3e-08   
ref|XP_002505824.1|  predicted protein                                61.6    3e-08   
ref|XP_004269788.1|  PREDICTED: histidine protein methyltransfera...  63.2    3e-08   
emb|CCA14269.1|  conserved hypothetical protein                       63.2    3e-08   
ref|XP_004027921.1|  PREDICTED: histidine protein methyltransfera...  63.2    3e-08   
ref|XP_008176282.1|  PREDICTED: histidine protein methyltransfera...  63.2    3e-08   
ref|XP_004316241.1|  PREDICTED: histidine protein methyltransfera...  63.2    3e-08   
ref|XP_007436671.1|  PREDICTED: histidine protein methyltransfera...  63.2    3e-08   
ref|XP_007935898.1|  PREDICTED: histidine protein methyltransfera...  63.2    3e-08   
ref|XP_007458190.1|  PREDICTED: LOW QUALITY PROTEIN: histidine pr...  63.2    3e-08   
gb|AEB61434.1|  UPF0558                                               62.0    3e-08   
ref|XP_007102117.1|  PREDICTED: histidine protein methyltransfera...  63.2    3e-08   
ref|XP_004884785.1|  PREDICTED: histidine protein methyltransfera...  63.2    3e-08   
ref|XP_003435036.1|  PREDICTED: histidine protein methyltransfera...  62.8    3e-08   
ref|XP_002809854.1|  PREDICTED: histidine protein methyltransfera...  62.8    4e-08   
ref|XP_003415104.1|  PREDICTED: histidine protein methyltransfera...  62.8    4e-08   
ref|XP_007061246.1|  PREDICTED: histidine protein methyltransfera...  62.8    4e-08   
ref|XP_007172561.1|  PREDICTED: histidine protein methyltransfera...  62.8    4e-08   
ref|XP_008469443.1|  PREDICTED: histidine protein methyltransfera...  62.0    4e-08   
emb|CCI40587.1|  unnamed protein product                              60.8    5e-08   
gb|KFV39745.1|  Histidine protein methyltransferase 1                 62.0    5e-08   
ref|XP_006011932.1|  PREDICTED: histidine protein methyltransfera...  62.4    5e-08   
ref|XP_008523753.1|  PREDICTED: histidine protein methyltransfera...  62.4    5e-08   
ref|XP_005609704.1|  PREDICTED: histidine protein methyltransfera...  62.4    5e-08   
gb|ETE68684.1|  Histidine protein methyltransferase 1-like protein    61.6    5e-08   
ref|XP_008523755.1|  PREDICTED: histidine protein methyltransfera...  62.4    5e-08   
ref|XP_010192136.1|  PREDICTED: histidine protein methyltransfera...  62.4    6e-08   
dbj|BAB28672.1|  unnamed protein product                              62.4    6e-08   
gb|KFB39817.1|  AGAP009532-PA-like protein                            62.0    6e-08   
ref|NP_081555.2|  histidine protein methyltransferase 1 homolog       62.4    6e-08   
gb|KFQ75261.1|  Histidine protein methyltransferase 1                 61.6    6e-08   
ref|XP_011497212.1|  PREDICTED: histidine protein methyltransfera...  61.6    6e-08   
gb|KFP59763.1|  Histidine protein methyltransferase 1                 61.6    6e-08   
gb|KFV39009.1|  Histidine protein methyltransferase 1                 61.6    6e-08   
ref|XP_006974821.1|  PREDICTED: histidine protein methyltransfera...  62.0    7e-08   
ref|XP_003925439.1|  PREDICTED: histidine protein methyltransfera...  62.0    7e-08   
ref|XP_005071424.1|  PREDICTED: histidine protein methyltransfera...  62.0    7e-08   
ref|XP_004634885.1|  PREDICTED: histidine protein methyltransfera...  62.0    7e-08   
gb|KFQ52401.1|  Histidine protein methyltransferase 1                 61.6    8e-08   
ref|XP_009808738.1|  PREDICTED: histidine protein methyltransfera...  62.0    8e-08   
ref|XP_524959.1|  PREDICTED: histidine protein methyltransferase ...  62.0    8e-08   
ref|XP_422244.1|  PREDICTED: histidine protein methyltransferase ...  61.6    8e-08   
ref|NP_219486.1|  histidine protein methyltransferase 1 homolog       62.0    8e-08   
gb|KFP32943.1|  Histidine protein methyltransferase 1                 61.2    8e-08   
emb|CCI40586.1|  unnamed protein product                              61.6    1e-07   
gb|EPZ35846.1|  hypothetical protein O9G_003564                       60.8    1e-07   
gb|AEE63248.1|  unknown                                               61.2    1e-07   
ref|XP_011370028.1|  PREDICTED: histidine protein methyltransfera...  61.6    1e-07   
gb|ERL89053.1|  hypothetical protein D910_06431                       61.2    1e-07   
ref|XP_006907879.1|  PREDICTED: histidine protein methyltransfera...  61.6    1e-07   
ref|XP_009974444.1|  PREDICTED: histidine protein methyltransfera...  61.2    1e-07   
ref|XP_005364046.1|  PREDICTED: histidine protein methyltransfera...  61.2    1e-07   
ref|XP_002678332.1|  predicted protein                                59.7    1e-07   
ref|XP_009482850.1|  PREDICTED: histidine protein methyltransfera...  61.2    1e-07   
ref|XP_002432071.1|  conserved hypothetical protein                   60.5    1e-07   
ref|XP_005319884.1|  PREDICTED: histidine protein methyltransfera...  61.2    1e-07   
ref|XP_008694139.1|  PREDICTED: histidine protein methyltransfera...  60.5    1e-07   
ref|XP_001961791.1|  GF15142                                          61.2    1e-07   
ref|XP_009703328.1|  PREDICTED: histidine protein methyltransfera...  61.2    1e-07   
ref|XP_010714039.1|  PREDICTED: histidine protein methyltransfera...  61.2    1e-07   
ref|XP_004599229.1|  PREDICTED: histidine protein methyltransfera...  61.2    1e-07   
ref|XP_010203212.1|  PREDICTED: histidine protein methyltransfera...  61.2    1e-07   
ref|XP_010714040.1|  PREDICTED: histidine protein methyltransfera...  61.2    1e-07   
ref|XP_002641568.1|  Hypothetical protein CBG09867                    60.1    2e-07   
ref|XP_011189474.1|  PREDICTED: histidine protein methyltransfera...  60.8    2e-07   
gb|KFW76303.1|  Histidine protein methyltransferase 1                 60.5    2e-07   
ref|XP_005492317.1|  PREDICTED: histidine protein methyltransfera...  60.8    2e-07   
gb|KFP36009.1|  Histidine protein methyltransferase 1                 60.5    2e-07   
ref|XP_011156661.1|  PREDICTED: histidine protein methyltransfera...  60.5    2e-07   
gb|EMC79180.1|  UPF0558 protein C1orf156 like protein                 60.1    2e-07   
ref|XP_003468663.1|  PREDICTED: histidine protein methyltransfera...  60.8    2e-07   
ref|XP_008823119.1|  PREDICTED: histidine protein methyltransfera...  60.8    2e-07   
ref|XP_009096691.1|  PREDICTED: histidine protein methyltransfera...  60.5    2e-07   
ref|XP_011156662.1|  PREDICTED: histidine protein methyltransfera...  60.5    2e-07   
ref|XP_001356830.2|  GA14398                                          60.5    2e-07   
gb|KFQ20631.1|  Histidine protein methyltransferase 1                 60.1    2e-07   
ref|XP_009534356.1|  hypothetical protein PHYSODRAFT_318220           60.1    2e-07   
ref|XP_008932152.1|  PREDICTED: histidine protein methyltransfera...  60.5    2e-07   
pdb|4RFQ|A  Chain A, Human Methyltransferase-like 18                  60.1    3e-07   
ref|XP_008863780.1|  hypothetical protein H310_02144                  60.1    3e-07   
ref|XP_008665720.1|  PREDICTED: uncharacterized protein LOC103644290  58.2    3e-07   
ref|XP_005540010.1|  PREDICTED: histidine protein methyltransfera...  60.1    3e-07   
gb|KFR14455.1|  Histidine protein methyltransferase 1                 60.1    3e-07   
gb|KFV95478.1|  Histidine protein methyltransferase 1                 59.7    3e-07   
gb|KFU98759.1|  Histidine protein methyltransferase 1                 59.7    3e-07   
ref|XP_005426747.1|  PREDICTED: histidine protein methyltransfera...  60.1    3e-07   
gb|KFM03473.1|  Histidine protein methyltransferase 1                 59.7    3e-07   
ref|XP_005499138.1|  PREDICTED: histidine protein methyltransfera...  60.1    3e-07   
ref|XP_010118115.1|  PREDICTED: LOW QUALITY PROTEIN: histidine pr...  60.1    3e-07   
gb|KFZ47315.1|  Histidine protein methyltransferase 1                 59.7    3e-07   
ref|XP_011946415.1|  PREDICTED: histidine protein methyltransfera...  60.1    3e-07   
ref|XP_011835344.1|  PREDICTED: histidine protein methyltransfera...  60.1    3e-07   
gb|KFQ78294.1|  Histidine protein methyltransferase 1                 59.7    3e-07   
ref|XP_003893585.1|  PREDICTED: histidine protein methyltransfera...  60.1    3e-07   
ref|NP_001253191.1|  histidine protein methyltransferase 1 homolog    60.1    3e-07   
ref|XP_004613907.1|  PREDICTED: histidine protein methyltransfera...  60.1    4e-07   
gb|KFO75385.1|  Histidine protein methyltransferase 1                 59.7    4e-07   
gb|KFV94719.1|  Histidine protein methyltransferase 1                 59.7    4e-07   
ref|XP_002015195.1|  GL18544                                          59.7    4e-07   
ref|XP_011817653.1|  PREDICTED: histidine protein methyltransfera...  60.1    4e-07   
ref|XP_007851930.1|  hypothetical protein Moror_17144                 60.1    4e-07   
ref|XP_007987745.1|  PREDICTED: histidine protein methyltransfera...  59.7    4e-07   
ref|XP_010288747.1|  PREDICTED: histidine protein methyltransfera...  59.7    4e-07   
ref|XP_008944627.1|  PREDICTED: histidine protein methyltransfera...  59.7    4e-07   
gb|KFP70583.1|  Histidine protein methyltransferase 1                 59.3    4e-07   
gb|EOA97190.1|  UPF0558 protein C1orf156-like protein                 59.3    4e-07   
ref|XP_010075002.1|  PREDICTED: histidine protein methyltransfera...  59.7    4e-07   
ref|XP_009937552.1|  PREDICTED: histidine protein methyltransfera...  59.7    4e-07   
gb|KFU99138.1|  Histidine protein methyltransferase 1                 59.3    5e-07   
ref|XP_011758780.1|  PREDICTED: histidine protein methyltransfera...  59.7    5e-07   
ref|XP_009271563.1|  PREDICTED: histidine protein methyltransfera...  59.7    5e-07   
ref|XP_010359313.1|  PREDICTED: histidine protein methyltransfera...  59.7    5e-07   
ref|XP_005435943.1|  PREDICTED: histidine protein methyltransfera...  59.7    5e-07   
ref|XP_003291276.1|  hypothetical protein DICPUDRAFT_89318            59.3    5e-07   
ref|XP_005241299.1|  PREDICTED: histidine protein methyltransfera...  59.7    5e-07   
ref|XP_009271564.1|  PREDICTED: histidine protein methyltransfera...  59.3    5e-07   
ref|XP_011205631.1|  PREDICTED: histidine protein methyltransfera...  59.3    5e-07   
ref|XP_009581376.1|  PREDICTED: histidine protein methyltransfera...  59.3    5e-07   
ref|XP_005147130.1|  PREDICTED: histidine protein methyltransfera...  59.3    5e-07   
ref|XP_010167288.1|  PREDICTED: histidine protein methyltransfera...  59.3    5e-07   
ref|XP_009074966.1|  PREDICTED: histidine protein methyltransfera...  59.3    5e-07   
ref|XP_010155218.1|  PREDICTED: histidine protein methyltransfera...  59.3    5e-07   
ref|XP_005528733.1|  PREDICTED: histidine protein methyltransfera...  59.3    5e-07   
ref|XP_005049853.1|  PREDICTED: histidine protein methyltransfera...  59.3    6e-07   
ref|XP_009991112.1|  PREDICTED: histidine protein methyltransfera...  59.3    6e-07   
gb|KFQ94991.1|  Histidine protein methyltransferase 1                 58.9    6e-07   
emb|CDS34085.1|  histidine protein methyltransferase 1                58.9    6e-07   
ref|XP_005025410.1|  PREDICTED: histidine protein methyltransfera...  59.3    6e-07   
ref|XP_001879852.1|  predicted protein                                59.3    6e-07   
ref|XP_009558152.1|  PREDICTED: histidine protein methyltransfera...  59.3    6e-07   
ref|XP_011758783.1|  PREDICTED: histidine protein methyltransfera...  58.9    6e-07   
ref|XP_001008448.1|  hypothetical protein TTHERM_00019660             58.9    7e-07   
gb|KIK06010.1|  hypothetical protein K443DRAFT_674583                 59.3    7e-07   
gb|KFW95892.1|  Histidine protein methyltransferase 1                 58.9    7e-07   
ref|XP_310157.4|  AGAP009532-PA                                       58.9    7e-07   
gb|AAL48976.1|  RE38979p                                              57.4    8e-07   
gb|KFV80117.1|  Histidine protein methyltransferase 1                 58.5    8e-07   
gb|KFQ43774.1|  Histidine protein methyltransferase 1                 58.5    8e-07   
ref|XP_002190379.1|  PREDICTED: histidine protein methyltransfera...  58.9    8e-07   
gb|KFP48293.1|  Histidine protein methyltransferase 1                 58.5    8e-07   
tpg|DAA52324.1|  TPA: putative RNA-binding zinc finger family pro...  58.9    9e-07   
gb|KFZ65111.1|  Histidine protein methyltransferase 1                 58.5    9e-07   
gb|KFO56446.1|  Histidine protein methyltransferase 1                 58.5    9e-07   
gb|EUB62694.1|  hypothetical protein EGR_02490                        57.4    9e-07   
gb|KGL99544.1|  Histidine protein methyltransferase 1                 58.5    9e-07   
gb|KFO08872.1|  Histidine protein methyltransferase 1                 58.5    9e-07   
emb|CDI99985.1|  histidine protein methyltransferase 1                58.5    9e-07   
ref|XP_009460775.1|  PREDICTED: histidine protein methyltransfera...  58.5    1e-06   
gb|KFP94066.1|  Histidine protein methyltransferase 1                 58.2    1e-06   
ref|XP_009671072.1|  PREDICTED: histidine protein methyltransfera...  58.5    1e-06   
ref|XP_009512151.1|  PREDICTED: histidine protein methyltransfera...  58.5    1e-06   
gb|KFP99108.1|  Histidine protein methyltransferase 1                 58.2    1e-06   
gb|KFH65686.1|  hypothetical protein MVEG_09159                       58.5    1e-06   
ref|XP_010021108.1|  PREDICTED: histidine protein methyltransfera...  58.5    1e-06   
ref|XP_010407660.1|  PREDICTED: histidine protein methyltransfera...  58.5    1e-06   
ref|XP_006957306.1|  hypothetical protein WALSEDRAFT_27897            58.2    1e-06   
ref|XP_008628391.1|  PREDICTED: histidine protein methyltransfera...  58.2    1e-06   
gb|KFM82279.1|  Histidine protein methyltransferase 1-like protein    58.2    1e-06   
gb|KFW64788.1|  Histidine protein methyltransferase 1                 58.2    1e-06   
ref|XP_009891129.1|  PREDICTED: histidine protein methyltransfera...  58.2    1e-06   
gb|KFP21337.1|  Histidine protein methyltransferase 1                 57.8    1e-06   
ref|XP_011591896.1|  PREDICTED: histidine protein methyltransfera...  58.2    1e-06   
ref|XP_009950825.1|  PREDICTED: histidine protein methyltransfera...  58.2    1e-06   
gb|KFP02360.1|  Histidine protein methyltransferase 1                 57.8    1e-06   
ref|XP_010296611.1|  PREDICTED: histidine protein methyltransfera...  58.2    2e-06   
ref|XP_010579883.1|  PREDICTED: histidine protein methyltransfera...  58.2    2e-06   
ref|XP_009916125.1|  PREDICTED: histidine protein methyltransfera...  58.2    2e-06   
gb|KFV68471.1|  Histidine protein methyltransferase 1                 57.8    2e-06   
ref|NP_608740.2|  CG17219                                             57.8    2e-06   
gb|KFV61038.1|  Histidine protein methyltransferase 1                 57.8    2e-06   
ref|NP_497707.1|  Protein K01A11.2                                    57.0    2e-06   
gb|KFP76324.1|  Histidine protein methyltransferase 1                 57.4    2e-06   



>ref|XP_009588400.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nicotiana 
tomentosiformis]
Length=349

 Score =   280 bits (716),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 142/163 (87%), Gaps = 0/163 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MR  +LLAQCLPG IS DRGCH SVISDRD HLPSPAVEIVPSK AHPY YA E +DLQG
Sbjct  1    MRTKALLAQCLPGFISQDRGCHMSVISDRDVHLPSPAVEIVPSKAAHPYKYAGETIDLQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            IN+ KGR+SVADIIGFTG+E ISSK DG+LK WD S+DLVNVLKHEIRDGQLS RGKRV+
Sbjct  61   INLFKGRVSVADIIGFTGSEAISSKSDGHLKSWDSSIDLVNVLKHEIRDGQLSLRGKRVL  120

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL C +GLPGIFACLKGASTVHFQD +AE IRCTTIPNVL NL
Sbjct  121  ELGCSHGLPGIFACLKGASTVHFQDLSAETIRCTTIPNVLANL  163



>ref|XP_007034061.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007034062.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY04987.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY04988.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=350

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/164 (80%), Positives = 147/164 (90%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG  + S +S+RD HLPSPAVEI+PSKTAHPY YA +NVDLQ
Sbjct  1    MRAPSLLAQCLPGLVPQDRGSQSVSTVSERDVHLPSPAVEILPSKTAHPYKYAGDNVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGR+SVADIIGFTG+E+ISSKP+G+LK WD S+DLVNVLKHEIRDGQLSFRGKRV
Sbjct  61   GLNVFKGRVSVADIIGFTGSELISSKPEGFLKSWDSSIDLVNVLKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CGYGLPGIFACLKGA TVHFQD +AE IRCTTIPNVL NL
Sbjct  121  LELGCGYGLPGIFACLKGACTVHFQDLSAETIRCTTIPNVLANL  164



>ref|XP_008372076.1| PREDICTED: histidine protein methyltransferase 1 homolog [Malus 
domestica]
Length=348

 Score =   278 bits (711),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  D+G  + S IS+RD HLPSPAVEI+PSKTAHPY YA EN+DLQ
Sbjct  1    MRAPSLLAQCLPGLVPQDKGSQSVSSISERDSHLPSPAVEIIPSKTAHPYKYAGENIDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGR+SV+DIIGF G+EMIS KP G+LK WD S+DLVNVLKHEIRDGQ+SFRGKRV
Sbjct  61   GLNVFKGRVSVSDIIGFNGSEMISIKPYGHLKSWDSSIDLVNVLKHEIRDGQVSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CGYGLPGIFACLKGASTVHFQD NAE IRCTTIPNVL NL
Sbjct  121  LELGCGYGLPGIFACLKGASTVHFQDLNAETIRCTTIPNVLANL  164



>ref|XP_009363653.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
 ref|XP_009363654.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
Length=348

 Score =   278 bits (710),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  D+G H+ S IS+RD HLPSPAVEI+PSKTAHPY YA EN+DLQ
Sbjct  1    MRAPSLLAQCLPGLVPQDKGSHSVSSISERDSHLPSPAVEIIPSKTAHPYKYAGENIDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGR+SV+DIIGF G+EMIS KPDG+LK WD S++LVN LKH+IRDGQLSFRGKRV
Sbjct  61   GLNVFKGRVSVSDIIGFNGSEMISIKPDGHLKSWDSSIELVNGLKHDIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YGLPGIFACLKGASTVHFQD NAE IRCTTIPNVL NL
Sbjct  121  LELGCSYGLPGIFACLKGASTVHFQDLNAETIRCTTIPNVLANL  164



>ref|XP_009344374.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
 ref|XP_009344375.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
Length=348

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  D+G H+ S IS+RD HLPSPAVEI+PSKTAHPY YA EN+DLQ
Sbjct  1    MRAPSLLAQCLPGLVPQDKGSHSVSSISERDSHLPSPAVEIIPSKTAHPYKYAGENIDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGR+SV+DIIGF G+EMIS KPDG+LK WD S++LVN LKH+IRDGQLSFRGKRV
Sbjct  61   GLNVFKGRVSVSDIIGFNGSEMISIKPDGHLKSWDSSIELVNGLKHDIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YGLPGIFACLKGASTVHFQD NAE IRCTTIPNVL NL
Sbjct  121  LELGCSYGLPGIFACLKGASTVHFQDLNAETIRCTTIPNVLANL  164



>ref|XP_011037077.1| PREDICTED: uncharacterized protein LOC105134384 [Populus euphratica]
Length=356

 Score =   277 bits (708),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL   DRG H+ S +S+RD +LP+PAVEI+PSK  HPY YA ENV+ Q
Sbjct  7    MRAPSLLAQCLPGLAPQDRGSHSMSAVSERDMNLPTPAVEILPSKMVHPYKYAGENVEFQ  66

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGR++VADIIGFTG+EMISSK DGYLK WD S+DLVNVLKHEIRDGQLSFRGKRV
Sbjct  67   GLNVFKGRVNVADIIGFTGSEMISSKTDGYLKSWDSSIDLVNVLKHEIRDGQLSFRGKRV  126

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YG+PGIFACLKGASTVHFQD+NAE IRCTTIPNVL NL
Sbjct  127  LELGCSYGIPGIFACLKGASTVHFQDQNAETIRCTTIPNVLANL  170



>ref|XP_002264228.1| PREDICTED: histidine protein methyltransferase 1 homolog [Vitis 
vinifera]
 emb|CBI36649.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   276 bits (705),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 146/164 (89%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL++ D+G H+ S IS+RD HL SPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSLLAQCLPGLVAHDKGSHSMSSISERDVHLCSPAVEILPSKMAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+++ KGR+SVADIIGF G+EMISSKP+G LK WD S+DLVNVLKHEIRDGQLSFRGKRV
Sbjct  61   GLHVFKGRVSVADIIGFNGSEMISSKPEGSLKSWDSSIDLVNVLKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YGLPGIFACLKGASTVHFQD NAEAIRCTTIPNVL NL
Sbjct  121  LELGCTYGLPGIFACLKGASTVHFQDLNAEAIRCTTIPNVLANL  164



>ref|XP_009781246.1| PREDICTED: uncharacterized protein LOC104230205 [Nicotiana sylvestris]
Length=349

 Score =   276 bits (705),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MR  +LLAQCLPG IS DRGCH SVISDRD HLPSPAVEIVPSK AHPY YA E VDLQG
Sbjct  1    MRTKALLAQCLPGFISQDRGCHMSVISDRDVHLPSPAVEIVPSKAAHPYKYAGEAVDLQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            IN  KGR+SVADIIGFTG+E ISSK DG+LK WD S+DLVNVLKHEIRDGQLS RGKRV+
Sbjct  61   INFFKGRVSVADIIGFTGSEAISSKSDGHLKSWDSSIDLVNVLKHEIRDGQLSLRGKRVL  120

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL C +GLPGIFA LKGASTVHFQD +AE IRCTTIPNVL NL
Sbjct  121  ELGCSHGLPGIFAFLKGASTVHFQDLSAETIRCTTIPNVLANL  163



>ref|XP_010097465.1| hypothetical protein L484_024670 [Morus notabilis]
 gb|EXB68656.1| hypothetical protein L484_024670 [Morus notabilis]
Length=350

 Score =   275 bits (704),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 130/164 (79%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  D+G H+ + IS RD HLPSPAVEI+PSK+ HPY YA ENVDL 
Sbjct  1    MRAPSLLAQCLPGLVPNDKGSHSLTSISGRDLHLPSPAVEILPSKSVHPYKYAGENVDLH  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGR+SVADIIGF  +E ISSKP+GYLK WD S+DLVNVLKHEIRDGQLSFRGKRV
Sbjct  61   GLNVFKGRVSVADIIGFNSSESISSKPEGYLKSWDSSIDLVNVLKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CGYGLPGIFACLKGASTVHFQD NAE IRCTTIPNVL NL
Sbjct  121  LELGCGYGLPGIFACLKGASTVHFQDLNAETIRCTTIPNVLANL  164



>ref|XP_006372889.1| hypothetical protein POPTR_0017s06020g [Populus trichocarpa]
 gb|ERP50686.1| hypothetical protein POPTR_0017s06020g [Populus trichocarpa]
Length=356

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL   DRG H+ S +S+RD +LP+PAVEI+PSK  HPY Y+ ENV+ Q
Sbjct  7    MRAPSLLAQCLPGLAPQDRGSHSMSAVSERDVNLPTPAVEILPSKMVHPYKYSGENVEFQ  66

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGR++VADIIGFTG+EMISSK DGYLK WD S+DLVNVLKHEIRDGQLSFRGKRV
Sbjct  67   GLNVFKGRVNVADIIGFTGSEMISSKTDGYLKSWDSSIDLVNVLKHEIRDGQLSFRGKRV  126

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YG+PGIFACLKGASTVHFQD+NAE IRCTTIPNVL NL
Sbjct  127  LELGCSYGIPGIFACLKGASTVHFQDQNAETIRCTTIPNVLANL  170



>ref|XP_002534114.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28265.1| conserved hypothetical protein [Ricinus communis]
Length=350

 Score =   275 bits (702),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/164 (80%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DR   + S +SDRD HLPSPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSLLAQCLPGLVPHDRASVSISSVSDRDVHLPSPAVEILPSKMAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGR+SVADIIGFTG+EMISSKPDG LK WD S+DLVNVLKHEIRDGQLSFRGKRV
Sbjct  61   GLNVFKGRVSVADIIGFTGSEMISSKPDGSLKSWDSSIDLVNVLKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YGLPGIFACLKGA TVHFQD +AE IRCTTIPNVL NL
Sbjct  121  LELGCSYGLPGIFACLKGACTVHFQDMSAEMIRCTTIPNVLANL  164



>ref|XP_006443065.1| hypothetical protein CICLE_v10020882mg [Citrus clementina]
 ref|XP_006443066.1| hypothetical protein CICLE_v10020882mg [Citrus clementina]
 ref|XP_006494175.1| PREDICTED: uncharacterized protein LOC102618219 isoform X1 [Citrus 
sinensis]
 ref|XP_006494176.1| PREDICTED: uncharacterized protein LOC102618219 isoform X2 [Citrus 
sinensis]
 ref|XP_006494177.1| PREDICTED: uncharacterized protein LOC102618219 isoform X3 [Citrus 
sinensis]
 ref|XP_006494178.1| PREDICTED: uncharacterized protein LOC102618219 isoform X4 [Citrus 
sinensis]
 gb|ESR56305.1| hypothetical protein CICLE_v10020882mg [Citrus clementina]
 gb|ESR56306.1| hypothetical protein CICLE_v10020882mg [Citrus clementina]
 gb|KDO43478.1| hypothetical protein CISIN_1g018716mg [Citrus sinensis]
 gb|KDO43479.1| hypothetical protein CISIN_1g018716mg [Citrus sinensis]
Length=351

 Score =   275 bits (702),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 145/165 (88%), Gaps = 2/165 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA--SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MRAPSLLAQCLPGL   DRG H+  S IS++D HLP PAVEI+PSK AH Y YA +NVDL
Sbjct  1    MRAPSLLAQCLPGLAPQDRGNHSMSSTISEKDAHLPCPAVEILPSKVAHLYKYAGDNVDL  60

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKR  586
            Q I++ KG++SVADIIGFTG+EMISSKPDG+LKCW+ S+DLVNVLKHEIRDGQLSFRGKR
Sbjct  61   QAISMFKGKVSVADIIGFTGSEMISSKPDGFLKCWESSIDLVNVLKHEIRDGQLSFRGKR  120

Query  587  VIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            V+ELSCGYGLPGIFACLKGA TVHFQD +AE IRCTT+PNVL NL
Sbjct  121  VLELSCGYGLPGIFACLKGAGTVHFQDLSAETIRCTTVPNVLANL  165



>ref|XP_012066171.1| PREDICTED: uncharacterized protein LOC105629230 [Jatropha curcas]
 gb|KDP42809.1| hypothetical protein JCGZ_23751 [Jatropha curcas]
Length=350

 Score =   274 bits (700),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  D+   + S +S+RD HLPSPAVEI+PSK AHPY YA ENV++Q
Sbjct  1    MRAPSLLAQCLPGLVPQDKTSQSISSVSERDAHLPSPAVEILPSKMAHPYKYAGENVEVQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+++ KGR+SVADIIGFTG+EMISSKPDG LK WD S+DLVN+LKHEIRDGQLSFRGKRV
Sbjct  61   GLHVFKGRVSVADIIGFTGSEMISSKPDGSLKSWDNSIDLVNILKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YGLPGIFACLKGAS VHFQD NAE IRCTTIPNVLVNL
Sbjct  121  LELGCSYGLPGIFACLKGASIVHFQDLNAETIRCTTIPNVLVNL  164



>gb|KJB27983.1| hypothetical protein B456_005G020100 [Gossypium raimondii]
Length=314

 Score =   272 bits (696),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG  + S  S+RD HL SPAVEI+PSKTAHPY YA +NVDLQ
Sbjct  1    MRAPSLLAQCLPGLVPQDRGSQSMSTTSERDVHLSSPAVEILPSKTAHPYKYAGDNVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGRISVADIIGFTG+E+ISSKP+G+LK WD S+DLVN+LKHEIRDGQLSFRGKRV
Sbjct  61   GLNVFKGRISVADIIGFTGSELISSKPEGFLKSWDSSIDLVNILKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CGYGLPGIFACLKGA T+HFQD +AE IRC TIPNVL NL
Sbjct  121  LELGCGYGLPGIFACLKGACTMHFQDLSAETIRCATIPNVLANL  164



>ref|XP_008222628.1| PREDICTED: uncharacterized protein LOC103322485 [Prunus mume]
 ref|XP_008222629.1| PREDICTED: uncharacterized protein LOC103322485 [Prunus mume]
 ref|XP_008222630.1| PREDICTED: uncharacterized protein LOC103322485 [Prunus mume]
Length=348

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/164 (79%), Positives = 145/164 (88%), Gaps = 2/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  ++G H+ S IS+R+ HLPSPAVEIVPSKTAHPY YA EN++LQ
Sbjct  1    MRAPSLLAQCLPGLVPHEKGSHSVSSISEREPHLPSPAVEIVPSKTAHPYKYAGENIELQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGR+SV+DIIGF  +EMIS KPDG+LK WD S+DLVNVLKHEIRDGQLSFRGKRV
Sbjct  61   GLNVFKGRVSVSDIIGFNSSEMIS-KPDGHLKSWDSSIDLVNVLKHEIRDGQLSFRGKRV  119

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YGLPGIFACLKGASTVHFQD NAE IRCTTIPNVL NL
Sbjct  120  VELGCNYGLPGIFACLKGASTVHFQDLNAETIRCTTIPNVLANL  163



>gb|KJB27982.1| hypothetical protein B456_005G020100 [Gossypium raimondii]
Length=350

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG  + S  S+RD HL SPAVEI+PSKTAHPY YA +NVDLQ
Sbjct  1    MRAPSLLAQCLPGLVPQDRGSQSMSTTSERDVHLSSPAVEILPSKTAHPYKYAGDNVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGRISVADIIGFTG+E+ISSKP+G+LK WD S+DLVN+LKHEIRDGQLSFRGKRV
Sbjct  61   GLNVFKGRISVADIIGFTGSELISSKPEGFLKSWDSSIDLVNILKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CGYGLPGIFACLKGA T+HFQD +AE IRC TIPNVL NL
Sbjct  121  LELGCGYGLPGIFACLKGACTMHFQDLSAETIRCATIPNVLANL  164



>ref|XP_008453987.1| PREDICTED: uncharacterized protein LOC103494545 [Cucumis melo]
 ref|XP_008453988.1| PREDICTED: uncharacterized protein LOC103494545 [Cucumis melo]
 ref|XP_008453989.1| PREDICTED: uncharacterized protein LOC103494545 [Cucumis melo]
 ref|XP_008453990.1| PREDICTED: uncharacterized protein LOC103494545 [Cucumis melo]
Length=350

 Score =   272 bits (695),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHAS-VISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLL+QCLPGL+  D+G H+S  IS+RD HLPSPAVEI+PSKTAHPY YA ENVDLQ
Sbjct  1    MRAPSLLSQCLPGLLPQDKGSHSSPSISERDVHLPSPAVEILPSKTAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGR+SVADIIGF G+E  SSKP+G+LK WD S+DLVNVLKHEIRDGQLSFRGKRV
Sbjct  61   GLNVFKGRVSVADIIGFNGSESTSSKPEGHLKSWDSSIDLVNVLKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YGLPG+FACLKGAS VHFQD +AE +RCTTIPNVL NL
Sbjct  121  LELGCSYGLPGVFACLKGASIVHFQDLSAETVRCTTIPNVLANL  164



>ref|XP_004152105.1| PREDICTED: uncharacterized protein LOC101212594 [Cucumis sativus]
 ref|XP_011653052.1| PREDICTED: uncharacterized protein LOC101212594 [Cucumis sativus]
 gb|KGN53072.1| hypothetical protein Csa_4G015130 [Cucumis sativus]
Length=350

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHAS-VISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLL+QCLPGL+  D+G H+S  IS+RD HLPSPAVEI+PSKTAHPY YA ENVDLQ
Sbjct  1    MRAPSLLSQCLPGLLPQDKGSHSSPSISERDVHLPSPAVEILPSKTAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGR+SVADII F G+E  SSKP+G+LK WD S+DLVNVLKHEIRDGQLSFRGKRV
Sbjct  61   GLNVFKGRVSVADIIAFNGSESTSSKPEGHLKSWDSSIDLVNVLKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YGLPG+FACLKGAS VHFQD +AE +RCTTIPNVL NL
Sbjct  121  LELGCSYGLPGVFACLKGASIVHFQDLSAETVRCTTIPNVLANL  164



>gb|KHG16096.1| Histidine methyltransferase 1 [Gossypium arboreum]
Length=350

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/164 (77%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG  + S  S+RD HL SPAVEI+PSKTAHPY YA +NVDLQ
Sbjct  1    MRAPSLLAQCLPGLVPQDRGSQSMSTTSERDVHLSSPAVEILPSKTAHPYKYAGDNVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGRISVADIIGFTG+E I SKP+G+LK WD S+DLVN+LKHEIRDGQLSFRGKRV
Sbjct  61   GLNVFKGRISVADIIGFTGSETILSKPEGFLKSWDSSIDLVNILKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CGYGLPGIFACLKGA T+HFQD +AE IRC TIPNVL NL
Sbjct  121  LELGCGYGLPGIFACLKGACTMHFQDLSAETIRCATIPNVLANL  164



>ref|XP_004309612.1| PREDICTED: histidine protein methyltransferase 1 homolog [Fragaria 
vesca subsp. vesca]
 ref|XP_011470941.1| PREDICTED: histidine protein methyltransferase 1 homolog [Fragaria 
vesca subsp. vesca]
Length=349

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLL+QCLPGL+  D+   + S ISDR+ HL SPAVEI+PSK+AHPY +A EN+DLQ
Sbjct  1    MRAPSLLSQCLPGLVPHDKATSSLSSISDRESHLSSPAVEILPSKSAHPYKHAGENIDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N +KGR+SVADIIG  G+EMISSKPDGYLK WD S+DLVNVL HEIRDGQLSFRGKRV
Sbjct  61   GLNALKGRVSVADIIGSNGSEMISSKPDGYLKSWDNSIDLVNVLNHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YGLPGIFACLKGA TVHFQD NAE+IRCTTIPNVL NL
Sbjct  121  LELGCSYGLPGIFACLKGAGTVHFQDLNAESIRCTTIPNVLANL  164



>gb|KJB71894.1| hypothetical protein B456_011G146300 [Gossypium raimondii]
 gb|KJB71895.1| hypothetical protein B456_011G146300 [Gossypium raimondii]
Length=350

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/164 (78%), Positives = 143/164 (87%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG  + S +SDRD HLPS AVEI+PSKTAHP  YA +NVDLQ
Sbjct  1    MRAPSLLAQCLPGLVLYDRGSQSMSPVSDRDVHLPSLAVEILPSKTAHPCKYAGDNVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+++ KGR+SVADIIGFT TEM+SSKPDG+LK W+ S DLVNVLKHEIRDGQLSFRGKRV
Sbjct  61   GLDVFKGRVSVADIIGFTTTEMLSSKPDGFLKSWNSSFDLVNVLKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CGYG+PGIFACLKGA TVHFQD +AE IRCTTIPNVL NL
Sbjct  121  LELGCGYGVPGIFACLKGACTVHFQDLSAETIRCTTIPNVLANL  164



>ref|XP_006858675.1| PREDICTED: histidine protein methyltransferase 1 homolog [Amborella 
trichopoda]
 gb|ERN20142.1| hypothetical protein AMTR_s00066p00080930 [Amborella trichopoda]
Length=353

 Score =   266 bits (681),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 145/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG H+ + I+DRD HLPSPAVEI+PSK AHPY YA ENV+LQ
Sbjct  1    MRAPSLLAQCLPGLLPHDRGSHSLTSIADRDLHLPSPAVEIIPSKAAHPYKYAGENVNLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+++ KGR+SVADIIGF+ ++M+SS+ DG +K W+GSLDLVN LKHEIRDGQLSFRGKR+
Sbjct  61   GLHVFKGRVSVADIIGFSNSDMVSSRSDGGVKSWEGSLDLVNALKHEIRDGQLSFRGKRI  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CG+GLPGIFACLKGASTVHFQD +AE IRCTTIPNVL NL
Sbjct  121  LELGCGHGLPGIFACLKGASTVHFQDLSAEKIRCTTIPNVLANL  164



>ref|XP_008791776.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
 ref|XP_008791777.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
 ref|XP_008791778.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
Length=350

 Score =   265 bits (678),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 144/164 (88%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL++ D+  +  S++S+RD HLPSPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSLLAQCLPGLMTHDKNVYGISIVSERDLHLPSPAVEILPSKNAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+NI KGR+SVAD+IGF+ +E++SS+PDG LK W+ S+DLV+ LKHEIRDGQLSFRGKR+
Sbjct  61   GLNIFKGRVSVADMIGFSSSEVVSSRPDGSLKAWESSIDLVSTLKHEIRDGQLSFRGKRI  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CGYGL GIFACLKGASTVHFQD NAE IRCTTIPNVL NL
Sbjct  121  LELGCGYGLAGIFACLKGASTVHFQDPNAETIRCTTIPNVLANL  164



>ref|XP_010930203.1| PREDICTED: histidine protein methyltransferase 1 homolog [Elaeis 
guineensis]
 ref|XP_010930204.1| PREDICTED: histidine protein methyltransferase 1 homolog [Elaeis 
guineensis]
Length=350

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/164 (77%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MR PSLLAQC PGL+  D+  H  S++S+RD  LPSPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRTPSLLAQCFPGLMPHDKNGHGVSIVSERDLILPSPAVEILPSKNAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+NI KGR+SVAD+IGF G+EMISSK DG LK W+GS+DLVN LKHEIRDGQLSFRGKR+
Sbjct  61   GLNIFKGRVSVADMIGFPGSEMISSKHDGSLKYWEGSIDLVNTLKHEIRDGQLSFRGKRI  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CGYGL GIFACLKGASTVHFQD NAE IRCTTIPNVL NL
Sbjct  121  LELGCGYGLAGIFACLKGASTVHFQDPNAETIRCTTIPNVLANL  164



>ref|XP_006347281.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Solanum tuberosum]
 ref|XP_006347282.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Solanum tuberosum]
Length=346

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 137/163 (84%), Gaps = 3/163 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MR  SLLA CLPGLIS DRGCH SVISD+D HLPSPAVEIVPSK  HPY Y  E VDL  
Sbjct  1    MRTRSLLAHCLPGLISQDRGCHMSVISDKDVHLPSPAVEIVPSKATHPYKYVGETVDL--  58

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
             ++ KGR+SVADIIGFTG+E ISSK DG+LK WD S+DLVNVLKHEIRDGQLS RGKRV+
Sbjct  59   -DVFKGRVSVADIIGFTGSETISSKSDGHLKSWDISIDLVNVLKHEIRDGQLSLRGKRVL  117

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL C YGLPGIFACLKGASTVHFQD +AE IRCTTIPNVL N+
Sbjct  118  ELGCSYGLPGIFACLKGASTVHFQDFSAETIRCTTIPNVLANI  160



>ref|XP_008799945.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
 ref|XP_008799953.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
Length=350

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQC PGLI  D+  H  S++S+RD  LPSPAVEI+PSK AHPY YA ENVD+Q
Sbjct  1    MRAPSLLAQCFPGLIPHDKNGHGVSIVSERDLLLPSPAVEILPSKNAHPYKYAGENVDVQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+NI KGR+SVAD+IGF+ +EMISSK DG LK W+ S+DLVN+LKHEIRDGQLSFRGK++
Sbjct  61   GLNIFKGRVSVADMIGFSSSEMISSKHDGSLKSWESSMDLVNILKHEIRDGQLSFRGKQI  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CGYGL GIFACLKGASTVHFQD NAE IRCTTIPNVL NL
Sbjct  121  LELGCGYGLAGIFACLKGASTVHFQDPNAETIRCTTIPNVLANL  164



>ref|XP_010912793.1| PREDICTED: uncharacterized protein LOC105038627 [Elaeis guineensis]
Length=350

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/164 (76%), Positives = 140/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL++ D+  H  S++S+RD HLPSPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSLLAQCLPGLMTHDKNGHGISIVSERDLHLPSPAVEILPSKNAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+ I KGR+SVAD+IGF+  EMI SKPDG LK W+ S+DLVN LKHEIRDGQLSFRGK++
Sbjct  61   GLKIFKGRVSVADMIGFSSLEMILSKPDGSLKAWESSIDLVNTLKHEIRDGQLSFRGKQI  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CGYGL GIFA LKGASTVHFQD NAE IRCTTIPNVL NL
Sbjct  121  LELGCGYGLAGIFAFLKGASTVHFQDPNAETIRCTTIPNVLANL  164



>ref|XP_010043656.1| PREDICTED: uncharacterized protein LOC104432789 [Eucalyptus grandis]
 ref|XP_010043732.1| PREDICTED: uncharacterized protein LOC104432789 [Eucalyptus grandis]
 ref|XP_010043813.1| PREDICTED: uncharacterized protein LOC104432789 [Eucalyptus grandis]
 ref|XP_010059221.1| PREDICTED: uncharacterized protein LOC104447112 [Eucalyptus grandis]
 gb|KCW87686.1| hypothetical protein EUGRSUZ_A00073 [Eucalyptus grandis]
 gb|KCW87874.1| hypothetical protein EUGRSUZ_A00269 [Eucalyptus grandis]
Length=350

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 139/164 (85%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGC-HASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPG    DRG  +   I +RD  LPSPAVEI+PSKT HPY YA E+VD+Q
Sbjct  1    MRAPSLLAQCLPGFTPHDRGSQNVPSIPERDLGLPSPAVEILPSKTTHPYKYAGESVDMQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+ + KGR+SVADIIGFTG+EMISSKPDGYLK WD ++DLVNVLKHEIRDGQLSFRGKRV
Sbjct  61   GLTMFKGRVSVADIIGFTGSEMISSKPDGYLKSWDNTIDLVNVLKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YGLPGIFAC+KGA TVHFQD +AE IRCTTIPNVLV L
Sbjct  121  LELGCSYGLPGIFACMKGACTVHFQDLSAETIRCTTIPNVLVTL  164



>gb|KHG29074.1| Histidine methyltransferase 1 [Gossypium arboreum]
Length=350

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 125/164 (76%), Positives = 141/164 (86%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MR+PSLLAQCLPGL+  DRG  + S +SDRD HLPS AVEI+PSKTAHP  YA +NV LQ
Sbjct  1    MRSPSLLAQCLPGLVLYDRGSQSMSPVSDRDVHLPSLAVEILPSKTAHPCKYAGDNVYLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+++ KGR+ VADIIGFT TEM+SSKPDG+LK W+ S DLVNVLKHEIRDGQLSFRGKRV
Sbjct  61   GLDVFKGRVGVADIIGFTTTEMLSSKPDGFLKSWNSSFDLVNVLKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CGYG+PGIFACLKGA TVHFQD +AE IRCTTIPNVL NL
Sbjct  121  LELGCGYGVPGIFACLKGACTVHFQDLSAETIRCTTIPNVLANL  164



>ref|XP_002310441.1| hypothetical protein POPTR_0007s02090g [Populus trichocarpa]
 gb|EEE90891.1| hypothetical protein POPTR_0007s02090g [Populus trichocarpa]
Length=351

 Score =   259 bits (661),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 121/164 (74%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MR PSL AQCLPGL+  DRG ++ S + +RD  LP+PAVEI+PSK  HPY YA ENV+ Q
Sbjct  1    MRTPSLFAQCLPGLLPQDRGNNSVSTVLERDVVLPTPAVEILPSKMVHPYKYAGENVEFQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGR+SVADII F G+E ISSK DGYLK WD S+DLVNVLKHEIRDGQLSFRGKRV
Sbjct  61   GLNVFKGRVSVADIIAFVGSETISSKTDGYLKSWDSSIDLVNVLKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YG+PGIF+CLKGASTVHFQD NAE IRCTTIPNVL NL
Sbjct  121  LELGCSYGIPGIFSCLKGASTVHFQDLNAETIRCTTIPNVLANL  164



>ref|XP_004241398.1| PREDICTED: histidine protein methyltransferase 1 homolog [Solanum 
lycopersicum]
 ref|XP_010322471.1| PREDICTED: histidine protein methyltransferase 1 homolog [Solanum 
lycopersicum]
 ref|XP_010322472.1| PREDICTED: histidine protein methyltransferase 1 homolog [Solanum 
lycopersicum]
Length=346

 Score =   258 bits (658),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 136/163 (83%), Gaps = 3/163 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MR  SLLA CLPGLIS DRGCH SV+SD+D HLPSPAVEIVPSK  H Y YA E VDL  
Sbjct  1    MRTRSLLAHCLPGLISQDRGCHMSVVSDKDVHLPSPAVEIVPSKATHTYKYAGETVDL--  58

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
             ++ KG +SVADIIGFTG+E ISSK DG+LK WD S+DLVNVLKHEIRDGQLS RGKRV+
Sbjct  59   -DVFKGSVSVADIIGFTGSETISSKSDGHLKSWDISIDLVNVLKHEIRDGQLSLRGKRVL  117

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL C YGLPGIFACLKGASTVHFQD +AE IRCTTIPNVL N+
Sbjct  118  ELGCSYGLPGIFACLKGASTVHFQDFSAETIRCTTIPNVLANI  160



>ref|XP_009416014.1| PREDICTED: histidine protein methyltransferase 1 homolog [Musa 
acuminata subsp. malaccensis]
 ref|XP_009416015.1| PREDICTED: histidine protein methyltransferase 1 homolog [Musa 
acuminata subsp. malaccensis]
Length=351

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 138/165 (84%), Gaps = 2/165 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA--SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MRAPSLLAQCLP L+  D+   A  S++S+RD HLPSPAVEI+PSK AHPY YA ENVDL
Sbjct  1    MRAPSLLAQCLPALVPHDKASQAGVSMVSERDLHLPSPAVEILPSKNAHPYKYAGENVDL  60

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKR  586
            QG+ I KGR+SV+D+IGF+ +EM SSK DG+LKCW+ S DLV++LK EIRDGQL+FRGKR
Sbjct  61   QGLKIFKGRVSVSDMIGFSNSEMASSKSDGFLKCWESSTDLVSILKLEIRDGQLTFRGKR  120

Query  587  VIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            ++EL CGYG+ G FACLKGASTVHF D NAE IRCTTIPNVL NL
Sbjct  121  ILELGCGYGIAGTFACLKGASTVHFHDLNAETIRCTTIPNVLANL  165



>ref|XP_011026390.1| PREDICTED: uncharacterized protein LOC105127016 [Populus euphratica]
 ref|XP_011026391.1| PREDICTED: uncharacterized protein LOC105127016 [Populus euphratica]
Length=349

 Score =   254 bits (648),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 136/163 (83%), Gaps = 1/163 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MR PSLLAQCLPGL+  DRG + SV +  D  LP+PAVE++PSK  HP  YA ENV+ QG
Sbjct  1    MRTPSLLAQCLPGLVPQDRGSN-SVSTVLDVVLPTPAVEVLPSKMFHPSKYAGENVEFQG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            +N+ KGR+SVADIIGF G+E ISSK DGYLK WD S+DLVNVLKHEIRDGQLSFRGKRV+
Sbjct  60   LNVFKGRVSVADIIGFVGSETISSKTDGYLKSWDNSIDLVNVLKHEIRDGQLSFRGKRVL  119

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL C YG+PGIF+CLKGASTVHFQD NAE IRCTTIPNVL NL
Sbjct  120  ELGCSYGIPGIFSCLKGASTVHFQDLNAETIRCTTIPNVLANL  162



>ref|XP_010242753.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nelumbo 
nucifera]
 ref|XP_010242754.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nelumbo 
nucifera]
Length=351

 Score =   250 bits (638),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 138/165 (84%), Gaps = 2/165 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DR  H  S I +RD  L SPAVE++PSKT HPY YA ENVDLQ
Sbjct  1    MRAPSLLAQCLPGLLPHDRSSHTISTIPERDVQLVSPAVEVLPSKTTHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFT-GTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKR  586
            G+NI KGR+SV+DIIGFT  ++MI SK +G LK W+ S+DLVN+LK+EIRDG+LSFRGKR
Sbjct  61   GLNIFKGRVSVSDIIGFTTNSDMIPSKSEGSLKSWESSIDLVNILKNEIRDGRLSFRGKR  120

Query  587  VIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            V+EL CGYGLPGIFAC+KGA TVHFQD NAE IRCTTIPNVL NL
Sbjct  121  VLELGCGYGLPGIFACVKGAYTVHFQDLNAETIRCTTIPNVLANL  165



>ref|XP_010525954.1| PREDICTED: uncharacterized protein LOC104803653 [Tarenaya hassleriana]
Length=349

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAPSLLAQCLPGL+  DR  + S +SDRD HLP+PAVEIVPSKTAHPY Y+ ENVD+ G
Sbjct  1    MRAPSLLAQCLPGLVPHDRD-NMSTLSDRDLHLPTPAVEIVPSKTAHPYKYSGENVDVHG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            +NI KG++SVAD+IG +G+E+   K DG L+ W+ S+DLV++LK+EIRDGQLSFRGKRV+
Sbjct  60   LNIFKGKVSVADLIGLSGSEIAPLKHDGSLRSWESSIDLVSILKNEIRDGQLSFRGKRVL  119

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CGYG+PGIFACLKGA TVHFQD NAE +RCTTIPNVL NL
Sbjct  120  ELGCGYGVPGIFACLKGAFTVHFQDLNAETVRCTTIPNVLANL  162



>ref|XP_008798999.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
 ref|XP_008799000.1| PREDICTED: histidine protein methyltransferase 1 homolog [Phoenix 
dactylifera]
Length=364

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 137/164 (84%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCH-ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPS+LAQC  GL+  DR  H A++I +RD HLPSPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSILAQCWSGLLLHDRESHGANLICERDIHLPSPAVEILPSKHAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGR+SV DI+G + +E +SSK +G LK W+ S+DLVN+LKHEIRDGQL+FRGKR+
Sbjct  61   GLNVFKGRVSVPDILGLSSSETLSSKTEGSLKSWESSIDLVNILKHEIRDGQLNFRGKRI  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CGYGLPG FACLKGASTVHFQD +AE IRC TIPNVL NL
Sbjct  121  LELGCGYGLPGTFACLKGASTVHFQDPSAETIRCKTIPNVLANL  164



>ref|XP_009401143.1| PREDICTED: histidine protein methyltransferase 1 homolog [Musa 
acuminata subsp. malaccensis]
 ref|XP_009401145.1| PREDICTED: histidine protein methyltransferase 1 homolog [Musa 
acuminata subsp. malaccensis]
Length=344

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA--SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MRAPSLL QC  GL+  D+  HA  S+ S+RD HLPSPAVEIVPSK AHPY YA ENVDL
Sbjct  1    MRAPSLLVQCWLGLMPHDKDSHAGVSIASERDLHLPSPAVEIVPSKNAHPYKYAGENVDL  60

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKR  586
            QG+ I KGR+S+ADIIGF+ +EM+SSK DG LK W+ S DL++ LK EIRDGQLSFRGKR
Sbjct  61   QGLKIFKGRVSMADIIGFSNSEMLSSKFDGSLKSWESSADLLSALKLEIRDGQLSFRGKR  120

Query  587  VIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            ++EL CGYGL G FACLKGASTVHF D NAE IRCTT+PNVL NL
Sbjct  121  ILELGCGYGLAGTFACLKGASTVHFHDLNAETIRCTTMPNVLANL  165



>ref|XP_010907676.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Elaeis guineensis]
Length=350

 Score =   245 bits (626),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 136/164 (83%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCH-ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPS+LAQC  GL+  DR  H A +IS+RD  LPSPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSILAQCWSGLLLHDREGHGAHLISERDILLPSPAVEILPSKHAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+N+ KGR+SV DI+G + +E +SSK +G LK W+ S+DLVN+LKHEIRDGQLSFRGKR+
Sbjct  61   GLNVFKGRVSVPDILGLSSSETLSSKTEGSLKSWESSIDLVNILKHEIRDGQLSFRGKRI  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CGYGLPG FACLKGASTVHFQD +AE IRC TIPNVL NL
Sbjct  121  LELGCGYGLPGTFACLKGASTVHFQDPSAETIRCKTIPNVLANL  164



>ref|XP_010520847.1| PREDICTED: uncharacterized protein LOC104799618 [Tarenaya hassleriana]
Length=349

 Score =   245 bits (625),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 137/163 (84%), Gaps = 1/163 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAPSLLAQCLPGL+  DRG   S +SDRD  LP+PAVEIVPSKTAHPY Y+ EN+D+QG
Sbjct  1    MRAPSLLAQCLPGLVPCDRGS-MSTLSDRDLQLPTPAVEIVPSKTAHPYKYSGENMDVQG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            ++I KG++SVADIIG +  E+   K D  L+ W+ S+DL++VLK+EIRDGQLSFRGKRV+
Sbjct  60   LHIFKGKVSVADIIGLSVAEITPLKHDASLRSWESSIDLLSVLKNEIRDGQLSFRGKRVL  119

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CGYG+PGIFACLKGASTVHFQD NAE +RCTTIPNVL NL
Sbjct  120  ELGCGYGVPGIFACLKGASTVHFQDLNAETVRCTTIPNVLANL  162



>ref|XP_009405561.1| PREDICTED: uncharacterized protein LOC103988679 [Musa acuminata 
subsp. malaccensis]
Length=352

 Score =   240 bits (613),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 132/166 (80%), Gaps = 3/166 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRG---CHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVD  403
            MR+PSLLAQCLP L+  D+       S++S+RD HLPSPA+EI+PSK AHPY YA ENVD
Sbjct  1    MRSPSLLAQCLPALVPRDKASLKADVSLVSERDLHLPSPAIEILPSKNAHPYKYAGENVD  60

Query  404  LQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGK  583
            LQG+ I KGR+ ++D+IGF+ +EM SSK DG LK W+ S DLVN +K EIRDG LSFRGK
Sbjct  61   LQGLKIFKGRVRLSDVIGFSNSEMASSKSDGSLKSWESSTDLVNSVKLEIRDGLLSFRGK  120

Query  584  RVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            RV+EL CGYG+ G FACLKGASTVHF D NAE IRCTTIPNVL N+
Sbjct  121  RVLELGCGYGIAGTFACLKGASTVHFHDLNAETIRCTTIPNVLANI  166



>ref|XP_010907675.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Elaeis guineensis]
Length=355

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 117/169 (69%), Positives = 136/169 (80%), Gaps = 6/169 (4%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCH-ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPS+LAQC  GL+  DR  H A +IS+RD  LPSPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSILAQCWSGLLLHDREGHGAHLISERDILLPSPAVEILPSKHAHPYKYAGENVDLQ  60

Query  410  GINIVK-----GRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSF  574
            G+N+ K     GR+SV DI+G + +E +SSK +G LK W+ S+DLVN+LKHEIRDGQLSF
Sbjct  61   GLNVFKLNVFQGRVSVPDILGLSSSETLSSKTEGSLKSWESSIDLVNILKHEIRDGQLSF  120

Query  575  RGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            RGKR++EL CGYGLPG FACLKGASTVHFQD +AE IRC TIPNVL NL
Sbjct  121  RGKRILELGCGYGLPGTFACLKGASTVHFQDPSAETIRCKTIPNVLANL  169



>gb|KDO43477.1| hypothetical protein CISIN_1g018716mg [Citrus sinensis]
Length=330

 Score =   236 bits (603),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 130/165 (79%), Gaps = 23/165 (14%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA--SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MRAPSLLAQCLPGL   DRG H+  S IS++D HLP PAVEI+PSK              
Sbjct  1    MRAPSLLAQCLPGLAPQDRGNHSMSSTISEKDAHLPCPAVEILPSK--------------  46

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKR  586
                   G++SVADIIGFTG+EMISSKPDG+LKCW+ S+DLVNVLKHEIRDGQLSFRGKR
Sbjct  47   -------GKVSVADIIGFTGSEMISSKPDGFLKCWESSIDLVNVLKHEIRDGQLSFRGKR  99

Query  587  VIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            V+ELSCGYGLPGIFACLKGA TVHFQD +AE IRCTT+PNVL NL
Sbjct  100  VLELSCGYGLPGIFACLKGAGTVHFQDLSAETIRCTTVPNVLANL  144



>ref|XP_003580042.1| PREDICTED: histidine protein methyltransferase 1 homolog [Brachypodium 
distachyon]
 ref|XP_010240064.1| PREDICTED: histidine protein methyltransferase 1 homolog [Brachypodium 
distachyon]
Length=344

 Score =   232 bits (591),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 128/163 (79%), Gaps = 0/163 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+APSLL QC PGL+         V+S+RD HLPSPAVEI+PSK+AHPY YA E VD QG
Sbjct  1    MKAPSLLVQCFPGLLPTKATSCVPVVSERDLHLPSPAVEIIPSKSAHPYKYAGEKVDFQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            ++I KG++SVAD+I F   E+ SSK DG LK W+ S+ LVN+LK+EIRDGQLSFRGKRV+
Sbjct  61   LDIFKGKVSVADMIAFPPCEVASSKHDGTLKYWESSITLVNILKNEIRDGQLSFRGKRVL  120

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG GL GIFACLKGAS VHFQD NAE IRC TIPNVL NL
Sbjct  121  ELGCGSGLAGIFACLKGASVVHFQDMNAETIRCRTIPNVLANL  163



>ref|XP_002446718.1| hypothetical protein SORBIDRAFT_06g021130 [Sorghum bicolor]
 gb|EES11046.1| hypothetical protein SORBIDRAFT_06g021130 [Sorghum bicolor]
Length=346

 Score =   231 bits (590),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+APSLL QC PGL+ +       +IS++D  LPSPAVEI+PSK+AHPY YA E VD+QG
Sbjct  1    MKAPSLLVQCFPGLLPSKATSCVPIISEKDLQLPSPAVEIIPSKSAHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            ++I KG++SVAD+I F+ +E+ SSK DG LK W+ S+ LVN+LK+EIRDGQLSFRGKRV+
Sbjct  61   LDIFKGKVSVADMIAFSPSEVASSKYDGTLKYWESSITLVNILKNEIRDGQLSFRGKRVL  120

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG GL GIFACLKGASTVHFQD NAE IRC TIPNVL NL
Sbjct  121  ELGCGSGLSGIFACLKGASTVHFQDINAETIRCRTIPNVLANL  163



>ref|NP_001242428.1| uncharacterized protein LOC100786056 [Glycine max]
 gb|ACU18508.1| unknown [Glycine max]
Length=330

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 132/164 (80%), Gaps = 6/164 (4%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP+LLAQCLPGL+  DRG  + S + ++D HLPSPAVEI+PSKT H      EN+D  
Sbjct  1    MRAPALLAQCLPGLVPHDRGSLSISSVPEKDFHLPSPAVEILPSKTVHTEKDNGENIDH-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
                 KG +SVADI+GF+G+E IS KPDGYLK W  S+DLV+VLKHEIRDGQL+FRGKRV
Sbjct  60   ----FKGLVSVADIVGFSGSETISLKPDGYLKSWTSSIDLVSVLKHEIRDGQLTFRGKRV  115

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +ELSC YGLPGIFACLKGAS VHFQD++AE +RCTTIPNVL NL
Sbjct  116  LELSCNYGLPGIFACLKGASVVHFQDQSAETVRCTTIPNVLANL  159



>ref|XP_010671826.1| PREDICTED: uncharacterized protein LOC104888516 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010671827.1| PREDICTED: uncharacterized protein LOC104888516 [Beta vulgaris 
subsp. vulgaris]
Length=352

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 128/164 (78%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MR PSLLAQCLPGL+  D+G H+ S +SDRD H   PAVEI+PSK         +N D Q
Sbjct  1    MRTPSLLAQCLPGLLPRDQGSHSISAVSDRDAHFTPPAVEILPSKVVQTSKSEGDNADGQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+++ KG+I+VADI+GF+G E I SK D  LK WD ++DLVNVLKHEIRDGQLSFRGKRV
Sbjct  61   GLHVFKGKINVADIVGFSGLETICSKTDVSLKSWDSAIDLVNVLKHEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +ELSC YGLPGIFACLKGA TVHFQD NAE +RC TIPNVL NL
Sbjct  121  LELSCSYGLPGIFACLKGAGTVHFQDINAETVRCATIPNVLANL  164



>ref|XP_006597006.1| PREDICTED: uncharacterized protein LOC100786056 isoform X1 [Glycine 
max]
 ref|XP_006597007.1| PREDICTED: uncharacterized protein LOC100786056 isoform X2 [Glycine 
max]
 ref|XP_006597008.1| PREDICTED: uncharacterized protein LOC100786056 isoform X3 [Glycine 
max]
 ref|XP_006597009.1| PREDICTED: uncharacterized protein LOC100786056 isoform X4 [Glycine 
max]
 ref|XP_006597010.1| PREDICTED: uncharacterized protein LOC100786056 isoform X5 [Glycine 
max]
 ref|XP_006597011.1| PREDICTED: uncharacterized protein LOC100786056 isoform X6 [Glycine 
max]
Length=346

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 132/164 (80%), Gaps = 6/164 (4%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP+LLAQCLPGL+  DRG  + S + ++D HLPSPAVEI+PSKT H      EN+D  
Sbjct  1    MRAPALLAQCLPGLVPHDRGSLSISSVPEKDFHLPSPAVEILPSKTVHTEKDNGENIDH-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
                 KG +SVADI+GF+G+E IS KPDGYLK W  S+DLV+VLKHEIRDGQL+FRGKRV
Sbjct  60   ----FKGLVSVADIVGFSGSETISLKPDGYLKSWTSSIDLVSVLKHEIRDGQLTFRGKRV  115

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +ELSC YGLPGIFACLKGAS VHFQD++AE +RCTTIPNVL NL
Sbjct  116  LELSCNYGLPGIFACLKGASVVHFQDQSAETVRCTTIPNVLANL  159



>ref|XP_004976058.1| PREDICTED: uncharacterized protein LOC101755614 [Setaria italica]
Length=346

 Score =   230 bits (587),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 132/163 (81%), Gaps = 0/163 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+APSLL QC PGL+ +       ++S++D  LPSPAVEI+PSK+AHPY YA E VD+QG
Sbjct  1    MKAPSLLVQCFPGLLPSKATSCVPIVSEKDLQLPSPAVEIIPSKSAHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            ++I KG++SVAD+I F+ +E+ S+K DG LK W+ S+ LVN+LK+EIRDGQLSFRGKRV+
Sbjct  61   LDIFKGKVSVADMIAFSPSEVASAKYDGTLKYWESSITLVNILKNEIRDGQLSFRGKRVL  120

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG GL GIFACLKGASTVHFQD NAE IRC TIPNVL NL
Sbjct  121  ELGCGSGLSGIFACLKGASTVHFQDINAETIRCRTIPNVLANL  163



>emb|CAH67536.1| H0425E08.4 [Oryza sativa Indica Group]
 gb|EAY94660.1| hypothetical protein OsI_16438 [Oryza sativa Indica Group]
Length=346

 Score =   229 bits (585),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+ PSLL QC PGL+ +       ++S+RD  LPSPAVEI+PSK+AHPY YA E VD+QG
Sbjct  1    MKTPSLLVQCFPGLLPSKATSCVPIVSERDLQLPSPAVEIIPSKSAHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            ++I KG++SVAD+I F+ +E+++SK DG LK W+ S+ LVN++K+EIRDGQLSFRGKRV+
Sbjct  61   LDIFKGKVSVADMIAFSPSEVVASKYDGSLKYWESSITLVNIIKNEIRDGQLSFRGKRVL  120

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG GL GIFACLKGASTVHFQD NAE IRC  IPNVL NL
Sbjct  121  ELGCGSGLAGIFACLKGASTVHFQDTNAETIRCRAIPNVLANL  163



>ref|NP_001053176.1| Os04g0492400 [Oryza sativa Japonica Group]
 emb|CAE02046.2| OJ990528_30.4 [Oryza sativa Japonica Group]
 dbj|BAF15090.1| Os04g0492400 [Oryza sativa Japonica Group]
 gb|EAZ31199.1| hypothetical protein OsJ_15298 [Oryza sativa Japonica Group]
 dbj|BAG93017.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94350.1| unnamed protein product [Oryza sativa Japonica Group]
Length=346

 Score =   229 bits (585),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+ PSLL QC PGL+ +       ++S+RD  LPSPAVEI+PSK+AHPY YA E VD+QG
Sbjct  1    MKTPSLLVQCFPGLLPSKATSCVPIVSERDLQLPSPAVEIIPSKSAHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            ++I KG++SVAD+I F+ +E+++SK DG LK W+ S+ LVN++K+EIRDGQLSFRGKRV+
Sbjct  61   LDIFKGKVSVADMIAFSPSEVVASKYDGSLKYWESSITLVNIIKNEIRDGQLSFRGKRVL  120

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG GL GIFACLKGASTVHFQD NAE IRC  IPNVL NL
Sbjct  121  ELGCGSGLAGIFACLKGASTVHFQDTNAETIRCRAIPNVLANL  163



>ref|XP_008667701.1| PREDICTED: uncharacterized protein LOC100277589 isoform X1 [Zea 
mays]
 gb|ACN34078.1| unknown [Zea mays]
 tpg|DAA37175.1| TPA: hypothetical protein ZEAMMB73_004311 [Zea mays]
Length=346

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+APSLL QC PGL+ +       ++S++D  LPSPAVEI+PSK+ HPY YA E VD+QG
Sbjct  1    MKAPSLLVQCFPGLLPSKATSCVPIVSEKDLQLPSPAVEIIPSKSVHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            +NI KG++SVAD+I  + +E+ SSK DG LK W+ S+ LV++LK+EIRDGQLSFRGKRV+
Sbjct  61   LNIFKGKVSVADMIVISPSEVASSKYDGTLKYWESSITLVDILKNEIRDGQLSFRGKRVL  120

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CGYGL GIFACLKGASTVHFQD NAE IRC TIPNVL NL
Sbjct  121  ELGCGYGLSGIFACLKGASTVHFQDINAETIRCRTIPNVLANL  163



>gb|KHN30105.1| Histidine protein methyltransferase 1 like [Glycine soja]
Length=346

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGC-HASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP+LLAQCLPGL+  DRG    S + ++D HLPSPAVEI+PSK  H      EN+D  
Sbjct  1    MRAPALLAQCLPGLVPHDRGSLSMSSVPEKDFHLPSPAVEILPSKAVHTDKDNGENIDH-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
                 KG ISVADI+GF+G+E IS KPDGYLK W  S+DLV+VLKHEIRDGQL+FRGKRV
Sbjct  60   ----FKGLISVADIVGFSGSETISLKPDGYLKYWTSSIDLVSVLKHEIRDGQLTFRGKRV  115

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +ELSC YGLPGIFACLKGAS VHFQD++AE +RCTTIPNVL NL
Sbjct  116  LELSCNYGLPGIFACLKGASVVHFQDQSAETVRCTTIPNVLANL  159



>ref|XP_006652451.1| PREDICTED: uncharacterized protein LOC102711251 [Oryza brachyantha]
Length=346

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/163 (64%), Positives = 131/163 (80%), Gaps = 0/163 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+ PSLL QC PGL+ +       ++S++D HL SPAVEI+PSK+AHPY YA E VD+QG
Sbjct  1    MKTPSLLVQCFPGLLPSKATSCVPIVSEKDLHLSSPAVEIIPSKSAHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            ++I KG++SVAD+I F+ +E+++SK DG LK W+ S+ LVN++K+EIRDGQLSFRGKRV+
Sbjct  61   LDIFKGKVSVADMIAFSPSEVVASKYDGSLKYWESSITLVNIIKNEIRDGQLSFRGKRVL  120

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG GL GIFACLKGASTVHFQD NAE IRC  IPNVL NL
Sbjct  121  ELGCGSGLAGIFACLKGASTVHFQDTNAETIRCRAIPNVLANL  163



>ref|XP_003543558.1| PREDICTED: uncharacterized protein LOC100810964 isoform X1 [Glycine 
max]
 ref|XP_006595055.1| PREDICTED: uncharacterized protein LOC100810964 isoform X2 [Glycine 
max]
 ref|XP_006595056.1| PREDICTED: uncharacterized protein LOC100810964 isoform X3 [Glycine 
max]
Length=346

 Score =   228 bits (581),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 130/164 (79%), Gaps = 6/164 (4%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGC-HASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP+LLAQCLPGL+  DRG    S + ++D HLPSPAVEI+PSK  H      EN+D  
Sbjct  1    MRAPALLAQCLPGLVPHDRGSLSMSSVPEKDFHLPSPAVEILPSKAVHTDKDNGENIDH-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
                 KG ISVADI+GF+G+E IS KPDGYLK W  S+DLV+VLKHEIRDGQL+FRGKRV
Sbjct  60   ----FKGLISVADIVGFSGSETISLKPDGYLKYWTSSIDLVSVLKHEIRDGQLTFRGKRV  115

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +ELSC YGLPGIFACLKGAS VHFQD++AE +RCTTIPNVL NL
Sbjct  116  LELSCNYGLPGIFACLKGASVVHFQDQSAETVRCTTIPNVLANL  159



>gb|KHN33316.1| Histidine protein methyltransferase 1 like [Glycine soja]
Length=346

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 131/164 (80%), Gaps = 6/164 (4%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP+LLAQCLPGL+  DRG  + S + ++D HLPSPAVEI+PSKT H      EN+D  
Sbjct  1    MRAPALLAQCLPGLVPHDRGSLSISSVPEKDFHLPSPAVEILPSKTVHTEKDNGENIDH-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
                 KG +SVADI+GF+G+E IS KPDGYLK W  S+DLV+VLKHEIRDGQL+FRGKRV
Sbjct  60   ----FKGLVSVADIVGFSGSETISLKPDGYLKSWTSSIDLVSVLKHEIRDGQLTFRGKRV  115

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +ELSC YGL GIFACLKGAS VHFQD++AE +RCTTIPNVL NL
Sbjct  116  LELSCNYGLSGIFACLKGASVVHFQDQSAETVRCTTIPNVLANL  159



>ref|XP_004957334.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Setaria italica]
 ref|XP_004957335.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Setaria italica]
Length=351

 Score =   227 bits (579),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/165 (65%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADR-GCH-ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MR+PSLL+QCL GL+S DR   H  +++ +R+ HLPS AVEIVPSK  HPY YA EN++L
Sbjct  1    MRSPSLLSQCLAGLLSHDRTAAHCVNIVPEREPHLPSLAVEIVPSKNVHPYKYAGENIEL  60

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKR  586
             G+NI KG+ISV DIIG + +++++SK +G LKCW+ S+DLVNVLK EIRDG L+FR K+
Sbjct  61   HGMNIFKGKISVVDIIGLSKSDIVTSKGEGPLKCWESSIDLVNVLKDEIRDGLLTFRSKQ  120

Query  587  VIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            V+EL CGYGLPGIFACLKGA+TVHFQD +AE +RC TIPNVL NL
Sbjct  121  VLELGCGYGLPGIFACLKGATTVHFQDPSAEVVRCKTIPNVLANL  165



>ref|NP_001144579.1| uncharacterized protein LOC100277589 [Zea mays]
 gb|ACG41515.1| hypothetical protein [Zea mays]
Length=346

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+APSLL QC PGL+ +       ++S++D  LPSPAVEI+PSK+ HPY YA E VD+QG
Sbjct  1    MKAPSLLVQCFPGLLPSKATSCVPIVSEKDLQLPSPAVEIIPSKSVHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            +NI KG++SVAD+I  + +E+ SSK DG  K W+ S+ LV++LK+EIRDGQLSFRGKRV+
Sbjct  61   LNIFKGKVSVADMIVISPSEVASSKYDGTPKYWESSITLVDILKNEIRDGQLSFRGKRVL  120

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CGYGL GIFACLKGASTVHFQD NAE IRC TIPNVL NL
Sbjct  121  ELGCGYGLSGIFACLKGASTVHFQDINAETIRCRTIPNVLANL  163



>emb|CDY23358.1| BnaC04g48860D [Brassica napus]
Length=350

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAP+L AQCLPGL+  DRG   S +S++D  LP+PAVEI+PSKT+    Y+ EN+D+ G
Sbjct  1    MRAPALFAQCLPGLLPQDRG-GVSALSEKDMQLPTPAVEIIPSKTSAHNRYSGENLDVLG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            + + KG++SVADIIG +G+E   SK +G LK WD S+ LV+VLK+EIRDGQLSFRGKRV+
Sbjct  60   LPVFKGKVSVADIIGLSGSETAPSKYEGSLKSWDSSIVLVDVLKNEIRDGQLSFRGKRVL  119

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL C YG+PGIFACLKGAS+VHFQD NAE IRCTTIPNVL NL
Sbjct  120  ELGCNYGVPGIFACLKGASSVHFQDLNAETIRCTTIPNVLANL  162



>ref|XP_006397494.1| hypothetical protein EUTSA_v10001523mg [Eutrema salsugineum]
 gb|ESQ38947.1| hypothetical protein EUTSA_v10001523mg [Eutrema salsugineum]
Length=351

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/163 (66%), Positives = 133/163 (82%), Gaps = 1/163 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAPSLLAQCLPGL+  DRG  A+ +SD+D  LP+PAVEI+PSKTA  + Y+ ENVD+ G
Sbjct  1    MRAPSLLAQCLPGLLPQDRGGVAA-LSDKDLQLPTPAVEIIPSKTAAHHRYSGENVDMLG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            + + KG++SVAD IG +G+E    K +G LK W+ ++ LV+VLK+EIRDGQLSFRGKRV+
Sbjct  60   LQVFKGKVSVADFIGLSGSETAPLKYEGSLKSWESAIVLVDVLKNEIRDGQLSFRGKRVL  119

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL C YG+PGIFACLKGAS+VHFQD +AE IRCTTIPNVL NL
Sbjct  120  ELGCNYGVPGIFACLKGASSVHFQDLSAETIRCTTIPNVLANL  162



>ref|XP_010508446.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=353

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRG-CHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG   A    ++D  LP+PAVEI+PSKTA  + Y+ EN+D+ 
Sbjct  1    MRAPSLLAQCLPGLLPQDRGGVSALSEKEKDLQLPTPAVEIIPSKTAAHHRYSGENLDVL  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+ + KG++SVAD+IG +G+E  S K +G LK W+ S+ LVNVLK+EIRDGQLSFRGKRV
Sbjct  61   GLQVFKGKVSVADMIGLSGSETASLKNEGSLKSWESSIVLVNVLKNEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YG+PGIFACLKGAS+VHFQD +AE IRCTTIPNVL NL
Sbjct  121  LELGCNYGVPGIFACLKGASSVHFQDLSAETIRCTTIPNVLANL  164



>ref|XP_010506201.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=353

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRG-CHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG   A    ++D  LP+PAVEI+PSKTA  + Y+ EN+D+ 
Sbjct  1    MRAPSLLAQCLPGLLPQDRGGVSALSEKEKDLQLPTPAVEIIPSKTAAHHRYSGENLDVL  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+ + KG++SVAD+IG +G+E  S K +G LK W+ S+ LVNVLK+EIRDGQLSFRGKRV
Sbjct  61   GLQVFKGKVSVADMIGLSGSETASLKNEGSLKSWESSIVLVNVLKNEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YG+PGIFACLKGAS+VHFQD +AE IRCTTIPNVL NL
Sbjct  121  LELGCNYGVPGIFACLKGASSVHFQDLSAETIRCTTIPNVLANL  164



>emb|CAN69477.1| hypothetical protein VITISV_017347 [Vitis vinifera]
Length=328

 Score =   224 bits (571),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 125/164 (76%), Gaps = 23/164 (14%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL++ D+G H+ S IS+RD HL SPAVEI+PSK AHPY YA ENVDLQ
Sbjct  1    MRAPSLLAQCLPGLVAHDKGSHSMSSISERDVHLCSPAVEILPSKMAHPYKYAGENVDLQ  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+++ +G                       LK WD S+DLVNVLKHEIRDGQLSFRGKRV
Sbjct  61   GLHVFQGS----------------------LKSWDSSIDLVNVLKHEIRDGQLSFRGKRV  98

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YGLPGIFACLKGASTVHFQD NAEAIRCTTIPNVL NL
Sbjct  99   LELGCTYGLPGIFACLKGASTVHFQDLNAEAIRCTTIPNVLANL  142



>ref|XP_010517889.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=353

 Score =   224 bits (572),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/164 (66%), Positives = 132/164 (80%), Gaps = 1/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRG-CHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQCLPGL+  DRG   A    ++D  LP+PAVEI+PSKTA  + Y+ EN+D+ 
Sbjct  1    MRAPSLLAQCLPGLLPHDRGGVSALSEKEKDLQLPTPAVEIIPSKTAAHHRYSGENLDVL  60

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+ + KG++SVAD+IG +G+E  S K +G LK W+ S+ LVNVLK+EIRDGQLSFRGKRV
Sbjct  61   GLQVFKGKVSVADMIGLSGSETASLKNEGSLKSWESSIVLVNVLKNEIRDGQLSFRGKRV  120

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YG+PGIFACLKGAS+VHFQD +AE IRCTTIPNVL NL
Sbjct  121  LELGCNYGVPGIFACLKGASSVHFQDLSAETIRCTTIPNVLANL  164



>ref|XP_009142187.1| PREDICTED: uncharacterized protein LOC103866064 [Brassica rapa]
Length=351

 Score =   224 bits (572),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAP+L AQCLPGL+  DRG   S +S++D  +P+PAVEI+PSKT+    Y+ EN+D+ G
Sbjct  1    MRAPALFAQCLPGLLPQDRG-GVSALSEKDLQVPTPAVEIIPSKTSAHNRYSGENLDVLG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            + + KG++SVADIIG +G+E   SK +G LK WD S+ LV+VLK+EIRDGQLSFRGKRV+
Sbjct  60   LPVFKGKVSVADIIGLSGSETAPSKYEGSLKSWDSSIVLVDVLKNEIRDGQLSFRGKRVL  119

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL C YG+PGIFACLKGAS+VHFQD NAE IRCTTIPNVL NL
Sbjct  120  ELGCNYGVPGIFACLKGASSVHFQDLNAETIRCTTIPNVLANL  162



>ref|XP_006294500.1| hypothetical protein CARUB_v10023531mg [Capsella rubella]
 gb|EOA27398.1| hypothetical protein CARUB_v10023531mg [Capsella rubella]
Length=351

 Score =   224 bits (571),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 133/163 (82%), Gaps = 1/163 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAPSLLAQCLPGL+  +RG   S +S++D  LP+PAVEI+PSKTA  + Y+ EN+D+ G
Sbjct  1    MRAPSLLAQCLPGLLPQERG-GVSALSEKDLQLPTPAVEIIPSKTAAHHRYSGENLDVLG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            + + KG++SV+D+IG +G+E    K +G LK W+ S+ LVNVLK+EIRDGQLSFRGKRV+
Sbjct  60   LQVFKGKVSVSDMIGLSGSESAPLKNEGSLKSWESSIVLVNVLKNEIRDGQLSFRGKRVL  119

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL C YG+PGIFACLKGAS+VHFQD +AE IRCTTIPNVL NL
Sbjct  120  ELGCNYGVPGIFACLKGASSVHFQDLSAETIRCTTIPNVLANL  162



>ref|NP_565997.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 ref|NP_001078045.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AAK62628.1| At2g43320/T1O24.6 [Arabidopsis thaliana]
 gb|AAB64311.2| expressed protein [Arabidopsis thaliana]
 gb|AAM14937.1| expressed protein [Arabidopsis thaliana]
 gb|AAM91070.1| At2g43320/T1O24.6 [Arabidopsis thaliana]
 gb|AEC10250.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 gb|AEC10251.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
Length=351

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 131/163 (80%), Gaps = 1/163 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAPSLLAQCLPGL+  DRG   S +S++D  LP+PAVEI+PSKT   + Y+ EN+D  G
Sbjct  1    MRAPSLLAQCLPGLLPQDRGG-VSALSEKDLQLPTPAVEIIPSKTVAHHRYSGENLDALG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            + + KG++SVADIIG +G+E    K +G LK W+ S+ LVNVLK+EIRDGQLSFRGKRV+
Sbjct  60   LQVFKGKVSVADIIGLSGSETAPLKNEGSLKSWESSVVLVNVLKNEIRDGQLSFRGKRVL  119

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL C +G+PGIFACLKGAS+VHFQD +AE IRCTTIPNVL NL
Sbjct  120  ELGCNFGVPGIFACLKGASSVHFQDLSAETIRCTTIPNVLANL  162



>emb|CDY30401.1| BnaA04g25020D [Brassica napus]
Length=351

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 132/163 (81%), Gaps = 1/163 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAP+L AQCLPGL+  DRG   S +S++D  LP+PAVEI+PSKT+    Y+ EN+D+ G
Sbjct  1    MRAPALFAQCLPGLLPQDRG-GVSALSEKDLQLPTPAVEIIPSKTSSHNRYSGENLDVLG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            + + KG++SVADIIG +G+E   SK +G LK WD S+ LV+VLK+EIRDGQLSFRGKRV+
Sbjct  60   LPVFKGKVSVADIIGISGSETAPSKYEGSLKSWDSSIVLVDVLKNEIRDGQLSFRGKRVL  119

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL C YG+PGIFACLKGAS+VHFQD +AE IRCTTIPNVL NL
Sbjct  120  ELGCNYGVPGIFACLKGASSVHFQDLSAETIRCTTIPNVLANL  162



>gb|EEE70043.1| hypothetical protein OsJ_29997 [Oryza sativa Japonica Group]
Length=351

 Score =   223 bits (567),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/165 (63%), Positives = 133/165 (81%), Gaps = 2/165 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCH--ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MR+PS+L+QCL G +S ++      +V+ +R+ H PSPAVEIVPSK  HPY YA EN+++
Sbjct  1    MRSPSILSQCLAGFLSHEKAAAHCVNVVPERESHPPSPAVEIVPSKNVHPYKYAGENIEM  60

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKR  586
             G+NI KG++SV DI+G +G+E+I+ K +G LKC + S+DLVNVLK+EIRDG L+FR K+
Sbjct  61   HGMNIFKGKVSVVDIVGLSGSEVITPKGEGPLKCCESSIDLVNVLKNEIRDGLLTFRSKQ  120

Query  587  VIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            V+EL CGYGLPGIFACLKGASTVHFQD +AE IRC TIPNVL NL
Sbjct  121  VLELGCGYGLPGIFACLKGASTVHFQDPSAEIIRCKTIPNVLANL  165



>gb|AAL16294.1|AF428364_1 At2g43320/T1O24.6 [Arabidopsis thaliana]
Length=351

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/163 (66%), Positives = 130/163 (80%), Gaps = 1/163 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            MRAPSLLAQCLPGL+  DRG   S +S++D  LP+PAVEI+PSKT   + Y+ EN+D  G
Sbjct  1    MRAPSLLAQCLPGLLPQDRG-GVSALSEKDLQLPTPAVEIIPSKTVAHHRYSGENLDALG  59

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            + + KG++SVADIIG +G+E    K +G LK W+ S+ LVNVLK+EIRDGQLSFRGKRV+
Sbjct  60   LQVFKGKVSVADIIGLSGSETAPLKNEGSLKSWESSVVLVNVLKNEIRDGQLSFRGKRVL  119

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL C  G+PGIFACLKGAS+VHFQD +AE IRCTTIPNVL NL
Sbjct  120  ELGCNLGVPGIFACLKGASSVHFQDLSAETIRCTTIPNVLANL  162



>ref|XP_006660841.1| PREDICTED: uncharacterized protein LOC102708742 [Oryza brachyantha]
Length=351

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/165 (62%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCH--ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MR+PS+L+QCL G +S ++      +V+ +R+ HLPSPAVEIVPSK  HPY YA +N+++
Sbjct  1    MRSPSILSQCLAGFLSHEKAAAHCVNVVPERETHLPSPAVEIVPSKNVHPYKYAGDNIEM  60

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKR  586
             G+NI KG++SV DI+G +G+E+++ K +G LKC + S+DLVNVLK+EIRDG L+FR K+
Sbjct  61   HGMNIFKGKVSVVDIVGLSGSEVVTPKGEGPLKCCESSIDLVNVLKNEIRDGLLTFRSKQ  120

Query  587  VIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            V+EL CGYGLPGIFACLKGASTVHFQD +AE IRC TIPNVL N+
Sbjct  121  VLELGCGYGLPGIFACLKGASTVHFQDPSAEIIRCKTIPNVLANI  165



>ref|NP_001159150.1| hypothetical protein [Zea mays]
 ref|XP_008662080.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN25233.1| unknown [Zea mays]
 gb|AFW58696.1| hypothetical protein ZEAMMB73_692053 [Zea mays]
Length=352

 Score =   222 bits (565),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLI-SADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            M+APSLL +C PGL+ S D  C   ++S++D  LPS AVEI+PSK+AHPY YA E VD+Q
Sbjct  1    MKAPSLLVRCFPGLLPSKDTSC-VPIVSEKDLQLPSLAVEIIPSKSAHPYKYAGEKVDVQ  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G +I KG++SVAD+I F+ +E+ SSK DG LK W+ S+ LVN++++EIRDGQLSFRGKRV
Sbjct  60   GFDIFKGKVSVADMISFSPSEVASSKYDGALKSWENSITLVNIIRNEIRDGQLSFRGKRV  119

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CG G+ GIF+CLKGASTVHFQD NAE IRC TIPNVL NL
Sbjct  120  LELGCGSGVSGIFSCLKGASTVHFQDMNAETIRCRTIPNVLANL  163



>ref|XP_007150422.1| hypothetical protein PHAVU_005G152300g [Phaseolus vulgaris]
 gb|ESW22416.1| hypothetical protein PHAVU_005G152300g [Phaseolus vulgaris]
Length=346

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 129/164 (79%), Gaps = 6/164 (4%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP+LLAQCLPGL+  DRG  + S + ++D HLPSPAVEI+PSK         EN+D  
Sbjct  1    MRAPALLAQCLPGLVPHDRGSLSISSVPEKDLHLPSPAVEILPSKAVLHDKDNGENMDY-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
                 KG +S+ADI+GF+G+E IS KPDG LK W  S+DLV+VLKHEIRDGQL+FRGKRV
Sbjct  60   ----FKGLVSIADIVGFSGSEAISLKPDGSLKSWTSSIDLVSVLKHEIRDGQLTFRGKRV  115

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +ELSC YGLPGIFACLKGAS VHFQD++AE +RCTTIPNVL NL
Sbjct  116  LELSCNYGLPGIFACLKGASVVHFQDQSAETVRCTTIPNVLANL  159



>gb|EMT24897.1| hypothetical protein F775_32531 [Aegilops tauschii]
Length=362

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 133/181 (73%), Gaps = 18/181 (10%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+APSLL QC PGL+ +       +IS+RD HLPSPAVE++PSK+AHPY YA E VD+QG
Sbjct  1    MKAPSLLVQCFPGLLPSKATSCVPIISERDLHLPSPAVELIPSKSAHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            +++ KG++SVAD+I F+ +E+ SSK DG LK W+ S+ +VN++K+EIRDGQLSFRGKRV+
Sbjct  61   LDVFKGKVSVADMIAFSPSEVASSKHDGSLKYWESSITIVNIIKNEIRDGQLSFRGKRVL  120

Query  593  ELS------------------CGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            E+S                  CG GL GIFACLKGAS VHFQD NAE IRC T+PNVL N
Sbjct  121  EVSGPDFASIEAECVPHGLLGCGSGLAGIFACLKGASIVHFQDTNAETIRCRTMPNVLAN  180

Query  719  L  721
            L
Sbjct  181  L  181



>gb|EMS59379.1| hypothetical protein TRIUR3_33843 [Triticum urartu]
Length=463

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 133/181 (73%), Gaps = 18/181 (10%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQG  412
            M+APSLL QC PGL+ +       +IS+RD HLPSPAVE++PSK+AHPY YA E VD+QG
Sbjct  1    MKAPSLLVQCFPGLLPSKATSCVPIISERDLHLPSPAVELIPSKSAHPYKYAGEKVDVQG  60

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            +++ KG++SVAD+I F+ +E+ SSK DG LK W+ S+ +VN++K+EIRDGQLSFRGKRV+
Sbjct  61   LDVFKGKVSVADMIAFSPSEVASSKHDGSLKYWESSITIVNIIKNEIRDGQLSFRGKRVL  120

Query  593  ELS------------------CGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            E+S                  CG GL GIFACLKGAS VHFQD NAE IRC T+PNVL N
Sbjct  121  EVSVPDFASIEAECVPHGLLGCGSGLAGIFACLKGASIVHFQDTNAETIRCRTMPNVLAN  180

Query  719  L  721
            L
Sbjct  181  L  181



>ref|XP_004486926.1| PREDICTED: uncharacterized protein LOC101511699 isoform X1 [Cicer 
arietinum]
 ref|XP_004486927.1| PREDICTED: uncharacterized protein LOC101511699 isoform X2 [Cicer 
arietinum]
Length=346

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 109/164 (66%), Positives = 129/164 (79%), Gaps = 6/164 (4%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGC-HASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP++LAQCLPGL+  DRG  + S I ++D HLPS AVEI+PSK       A ENVD  
Sbjct  1    MRAPAILAQCLPGLVPYDRGSLNLSSIPEKDIHLPSLAVEILPSKAFLTDKEAGENVDH-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
                 KG +SVAD+IG +G+E ISS+ DGYLK W  S+DLV+VLK+EIRDGQL+FRGKRV
Sbjct  60   ----FKGIVSVADMIGLSGSETISSRADGYLKSWASSVDLVSVLKNEIRDGQLTFRGKRV  115

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +ELSC YGLPGIFACLKGAS VHFQD+NAE +RCTTIPNV+ NL
Sbjct  116  LELSCNYGLPGIFACLKGASMVHFQDQNAETVRCTTIPNVIANL  159



>ref|XP_009133591.1| PREDICTED: histidine protein methyltransferase 1-like [Brassica 
rapa]
 ref|XP_009133592.1| PREDICTED: histidine protein methyltransferase 1-like [Brassica 
rapa]
 emb|CDY69980.1| BnaA03g56760D [Brassica napus]
Length=351

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 130/164 (79%), Gaps = 3/164 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQC PGL+  D  C   S +S++D  LPSPAVEI+PSKTA  + Y+ EN+D+ 
Sbjct  1    MRAPSLLAQCWPGLMPQD--CSGVSALSEKDLQLPSPAVEILPSKTAAQHRYSGENLDVL  58

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+ I KG++SVAD+IG + +E    K +G +K W+ ++ LV+VLK+EIRDGQLSFRGKRV
Sbjct  59   GLPIFKGKVSVADMIGLSSSETAPFKYEGSMKSWESAIVLVDVLKNEIRDGQLSFRGKRV  118

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YG+PGIFACLKGAS+VHFQD NAE +RCTTIPNVL NL
Sbjct  119  LELGCNYGVPGIFACLKGASSVHFQDLNAETVRCTTIPNVLANL  162



>emb|CDY44218.1| BnaC03g24100D [Brassica napus]
Length=351

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/164 (63%), Positives = 130/164 (79%), Gaps = 3/164 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAPSLLAQC PGL+  D  C   S +S++D  LPSPAVEI+PSKT+  + Y+ EN+D+ 
Sbjct  1    MRAPSLLAQCWPGLMPQD--CSGVSALSEKDLQLPSPAVEILPSKTSAQHRYSGENLDVP  58

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G+ I KG++SVAD+IG + +E    K +G +K W+ ++ LV+VLK+EIRDGQLSFRGKRV
Sbjct  59   GLPIFKGKVSVADMIGLSSSETAPFKYEGSMKSWESAIVLVDVLKNEIRDGQLSFRGKRV  118

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL C YG+PGIFACLKGAS+VHFQD NAE IRCTTIPNVL NL
Sbjct  119  LELGCNYGVPGIFACLKGASSVHFQDLNAETIRCTTIPNVLANL  162



>ref|XP_003597493.1| hypothetical protein MTR_2g098630 [Medicago truncatula]
 gb|AES67744.1| histidine methyltransferase-like protein [Medicago truncatula]
Length=362

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 129/170 (76%), Gaps = 6/170 (4%)
 Frame = +2

Query  215  ILVPVIMRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYAS  391
             LVP  MRAP++L+QCLPGL+  D G  + S + ++  HL SPAVEI+PSK  H    A 
Sbjct  11   FLVPTAMRAPAILSQCLPGLVPRDHGSLSISSVPEKAIHLASPAVEILPSKAFHTDKEAG  70

Query  392  ENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLS  571
            EN D       KG +SVADIIGF G+E ISS+ DGY K W  S+DLV+VLK+EIRDGQL+
Sbjct  71   ENSDH-----FKGIVSVADIIGFGGSETISSRLDGYPKSWSSSIDLVSVLKNEIRDGQLT  125

Query  572  FRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            FRGKRV+ELSC YGLPGIFACLKGAS VHFQD+NAE +RCTT+PNVL NL
Sbjct  126  FRGKRVLELSCNYGLPGIFACLKGASIVHFQDQNAETVRCTTVPNVLGNL  175



>gb|EEC84878.1| hypothetical protein OsI_32028 [Oryza sativa Indica Group]
Length=366

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 133/180 (74%), Gaps = 17/180 (9%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCH--ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MR+PS+L+QCL G +S ++      +V+ +R+ H PSPAVEIVPSK  HPY YA EN+++
Sbjct  1    MRSPSILSQCLAGFLSHEKAAAHCVNVVPERESHPPSPAVEIVPSKNVHPYKYAGENIEM  60

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKR  586
             G+NI KG++SV DI+G +G+E+I+ K +G LKC + S+DLVNVLK+EIRDG L+FR K+
Sbjct  61   HGMNIFKGKVSVVDIVGLSGSEVITPKGEGPLKCCESSIDLVNVLKNEIRDGLLTFRSKQ  120

Query  587  VIELSCGYGLP---------------GIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            V+EL CGYGLP               GIFACLKGASTVHFQD +AE IRC TIPNVL NL
Sbjct  121  VLELGCGYGLPGIFACLKLGCGYGLPGIFACLKGASTVHFQDPSAEIIRCKTIPNVLANL  180



>ref|XP_010238357.1| PREDICTED: uncharacterized protein LOC100830260 [Brachypodium 
distachyon]
 ref|XP_010238358.1| PREDICTED: uncharacterized protein LOC100830260 [Brachypodium 
distachyon]
Length=353

 Score =   211 bits (538),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 129/166 (78%), Gaps = 3/166 (2%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA--SVISDRD-GHLPSPAVEIVPSKTAHPYTYASENVD  403
            MR PSLL+QCL G +S D+      +V+ +RD  HLPSPAVEIVPSK  HPY YA +N++
Sbjct  1    MRPPSLLSQCLAGFMSNDKAAAHCINVVPERDQSHLPSPAVEIVPSKIVHPYKYAGDNIE  60

Query  404  LQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGK  583
            + G+NI KG+ SV DI+G + +++ + K +G LKC + SL+L+N LK+EIRDG L+FR K
Sbjct  61   MHGMNIFKGKFSVVDIVGLSRSDIATPKGEGPLKCCESSLELINALKNEIRDGLLTFRSK  120

Query  584  RVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            RV+EL CGYGLPGIF+CLKGASTVHFQD +AE IRC TIPNVL NL
Sbjct  121  RVLELGCGYGLPGIFSCLKGASTVHFQDPSAEIIRCRTIPNVLANL  166



>ref|XP_003597492.1| hypothetical protein MTR_2g098630 [Medicago truncatula]
 gb|AES67743.1| histidine methyltransferase-like protein [Medicago truncatula]
Length=346

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 106/164 (65%), Positives = 126/164 (77%), Gaps = 6/164 (4%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHA-SVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQ  409
            MRAP++L+QCLPGL+  D G  + S + ++  HL SPAVEI+PSK  H    A EN D  
Sbjct  1    MRAPAILSQCLPGLVPRDHGSLSISSVPEKAIHLASPAVEILPSKAFHTDKEAGENSDH-  59

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
                 KG +SVADIIGF G+E ISS+ DGY K W  S+DLV+VLK+EIRDGQL+FRGKRV
Sbjct  60   ----FKGIVSVADIIGFGGSETISSRLDGYPKSWSSSIDLVSVLKNEIRDGQLTFRGKRV  115

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +ELSC YGLPGIFACLKGAS VHFQD+NAE +RCTT+PNVL NL
Sbjct  116  LELSCNYGLPGIFACLKGASIVHFQDQNAETVRCTTVPNVLGNL  159



>ref|XP_002881896.1| hypothetical protein ARALYDRAFT_483439 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58155.1| hypothetical protein ARALYDRAFT_483439 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score =   209 bits (532),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 132/174 (76%), Gaps = 13/174 (7%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVD---  403
            MRAPSLLAQCLPGL+  DRG   S +S++D  LP+PAVEI+PSKTA  + Y+ EN+D   
Sbjct  1    MRAPSLLAQCLPGLLPQDRGG-VSALSEKDLQLPTPAVEIIPSKTAAHHRYSGENLDDAR  59

Query  404  --------LQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRD  559
                     + + +  G++SVADI+G +G+E  + K +G LK W+ S+ LVNVLK+EIRD
Sbjct  60   FTSFQESREETLLVKHGKVSVADIMGLSGSE-TALKNEGSLKSWESSIVLVNVLKNEIRD  118

Query  560  GQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            GQLSFRGKRV+EL C YG+PGIFACLKGAS+VHFQD +AE IRCTTIPNVL NL
Sbjct  119  GQLSFRGKRVLELGCNYGVPGIFACLKGASSVHFQDLSAETIRCTTIPNVLANL  172



>gb|KDO43480.1| hypothetical protein CISIN_1g018716mg [Citrus sinensis]
Length=269

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +2

Query  473  MISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGAST  652
            MISSKPDG+LKCW+ S+DLVNVLKHEIRDGQLSFRGKRV+ELSCGYGLPGIFACLKGA T
Sbjct  1    MISSKPDGFLKCWESSIDLVNVLKHEIRDGQLSFRGKRVLELSCGYGLPGIFACLKGAGT  60

Query  653  VHFQDRNAEAIRCTTIPNVLVNL  721
            VHFQD +AE IRCTT+PNVL NL
Sbjct  61   VHFQDLSAETIRCTTVPNVLANL  83



>gb|ABR16574.1| unknown [Picea sitchensis]
Length=368

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 111/164 (68%), Gaps = 2/164 (1%)
 Frame = +2

Query  236  RAPSLLAQCLPGLI-SADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL-Q  409
            RAPSL A    GL  S D        S+     P P  E++PS+      Y +E V+L  
Sbjct  4    RAPSLFAGLPQGLFQSMDMLQSVCGFSENPPPHPPPCEEVLPSQVVQLEKYVAEPVNLPG  63

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G++++KGR++ AD+ G + ++++  K +G LK W+ S DLVN LKHEI+DGQLSF GK+V
Sbjct  64   GLSLLKGRVNTADVFGVSNSDLVPGKYEGGLKLWESSTDLVNALKHEIQDGQLSFNGKKV  123

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +EL CG+GLP IFACL+GASTVHFQD NAE +RC TIPNV +NL
Sbjct  124  LELGCGHGLPAIFACLEGASTVHFQDFNAEVLRCLTIPNVNLNL  167



>gb|ABK25033.1| unknown [Picea sitchensis]
 gb|ACN39918.1| unknown [Picea sitchensis]
Length=370

 Score =   157 bits (396),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 117/170 (69%), Gaps = 8/170 (5%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLI------SADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASE  394
            MR PSL A CLPGL       SAD+      + ++    P P+VE++PSK A    Y +E
Sbjct  1    MRVPSLFA-CLPGLSPQSLFQSADKPHSLLGVPEKPLPPPPPSVEVLPSKDAQSDKYVAE  59

Query  395  NVDLQG-INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLS  571
             V+L+G + ++K R++  DI G    +++  K +G LK W+ SLDLVN LK EI+DGQLS
Sbjct  60   PVNLRGGLTLLKSRVNTMDIFGVPYLDLVPGKYEGGLKLWESSLDLVNTLKREIQDGQLS  119

Query  572  FRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            FRGKRV+EL CG GLPGIFACLKGASTVHFQD NAE +RC TIPNV VNL
Sbjct  120  FRGKRVLELGCGNGLPGIFACLKGASTVHFQDFNAEVLRCLTIPNVYVNL  169



>ref|NP_001063658.2| Os09g0514300 [Oryza sativa Japonica Group]
 dbj|BAF25572.2| Os09g0514300 [Oryza sativa Japonica Group]
Length=285

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/98 (70%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = +2

Query  428  GRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCG  607
            G++SV DI+G +G+E+I+ K +G LKC + S+DLVNVLK+EIRDG L+FR K+V+EL CG
Sbjct  2    GKVSVVDIVGLSGSEVITPKGEGPLKCCESSIDLVNVLKNEIRDGLLTFRSKQVLELGCG  61

Query  608  YGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            YGLPGIFACLKGASTVHFQD +AE IRC TIPNVL NL
Sbjct  62   YGLPGIFACLKGASTVHFQDPSAEIIRCKTIPNVLANL  99



>emb|CDP20792.1| unnamed protein product [Coffea canephora]
Length=310

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 95/128 (74%), Gaps = 0/128 (0%)
 Frame = +2

Query  338  PAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDG  517
            P+VE++PS+ +    Y  E+VD+ GI ++KGR++  ++  F+  +++  K +G LK W+G
Sbjct  42   PSVEVLPSQVSSNVKYTVESVDIDGITLIKGRVNSKEVFAFSNLDLVPGKYEGGLKLWEG  101

Query  518  SLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTT  697
            S+DLV  L+ E++DG+LS  GKRV+EL CG+GLPGIFACL G+S+VHFQD NAE ++  T
Sbjct  102  SVDLVKTLQSEMQDGKLSLAGKRVLELGCGHGLPGIFACLMGSSSVHFQDFNAEVLQSLT  161

Query  698  IPNVLVNL  721
            IPNV  N+
Sbjct  162  IPNVNANI  169



>ref|XP_009373561.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pyrus 
x bretschneideri]
Length=301

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 92/127 (72%), Gaps = 0/127 (0%)
 Frame = +2

Query  341  AVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGS  520
            +V++ PS+ +    Y  E V+L G+ ++KGR+S  D+   + ++++  K +G LK W+GS
Sbjct  35   SVQVFPSEVSSSVKYTVEPVELGGLTLLKGRVSTQDVFTLSNSDLVPGKYEGGLKLWEGS  94

Query  521  LDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTI  700
            LDLV  L+ E+++G LSF GKRV+EL CG+GLPGIFA L+GA+ +HFQD NAE +RC TI
Sbjct  95   LDLVKALRSEVQNGHLSFAGKRVLELGCGHGLPGIFASLEGAAAIHFQDFNAEVLRCLTI  154

Query  701  PNVLVNL  721
            PNV  N+
Sbjct  155  PNVNSNI  161



>dbj|BAD34426.1| hypothetical protein [Oryza sativa Japonica Group]
Length=315

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 104/165 (63%), Gaps = 38/165 (23%)
 Frame = +2

Query  233  MRAPSLLAQCLPGLISADRGCH--ASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDL  406
            MR+PS+L+QCL G +S ++      +V+ +R+ H PSPAVEIVPSK              
Sbjct  1    MRSPSILSQCLAGFLSHEKAAAHCVNVVPERESHPPSPAVEIVPSK--------------  46

Query  407  QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKR  586
                   G++SV DI+G +G+E+I+ K +G LKC + S+DLVNVLK+EIRDG L+FR K+
Sbjct  47   -------GKVSVVDIVGLSGSEVITPKGEGPLKCCESSIDLVNVLKNEIRDGLLTFRSKQ  99

Query  587  VIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            V+E               GASTVHFQD +AE IRC TIPNVL NL
Sbjct  100  VLE---------------GASTVHFQDPSAEIIRCKTIPNVLANL  129



>ref|XP_002269192.1| PREDICTED: histidine protein methyltransferase 1 homolog [Vitis 
vinifera]
Length=308

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            Y  E V+L G+ ++KGR++  D+  F+ ++++  + +G LK W+GSLDLV  L+ E+++G
Sbjct  62   YTVERVNLNGLTLLKGRVNTQDVFAFSNSDLVPGQYEGGLKLWEGSLDLVKALRSEVQNG  121

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +LSF GKRV+E+ CG+G PGI ACL+GA+ VHFQD NAE +RC TIPNV  NL
Sbjct  122  RLSFTGKRVLEIGCGHGFPGILACLEGAAVVHFQDFNAEVLRCLTIPNVNANL  174



>ref|XP_007222358.1| hypothetical protein PRUPE_ppa009767mg [Prunus persica]
 gb|EMJ23557.1| hypothetical protein PRUPE_ppa009767mg [Prunus persica]
Length=278

 Score =   139 bits (351),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 89/125 (71%), Gaps = 5/125 (4%)
 Frame = +2

Query  347  EIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLD  526
            EI+PS       YA E V L G+ ++KGR+S  ++   + ++++  K +G LK W+GSLD
Sbjct  42   EILPS-----VKYAVEPVQLGGLTLLKGRVSTQEVFTLSNSDLVPGKYEGGLKLWEGSLD  96

Query  527  LVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPN  706
            LV  L  E+++G LSF GKRV+EL CG+GLPGIFACLKGA+ +HFQD NAE ++C TIPN
Sbjct  97   LVKALSSEVQNGHLSFTGKRVLELGCGHGLPGIFACLKGAAAIHFQDFNAEVLQCLTIPN  156

Query  707  VLVNL  721
            V  N+
Sbjct  157  VNSNV  161



>ref|XP_007223424.1| hypothetical protein PRUPE_ppa010155mg [Prunus persica]
 gb|EMJ24623.1| hypothetical protein PRUPE_ppa010155mg [Prunus persica]
Length=261

 Score =   139 bits (350),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  503  KCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEA  682
            + WD S+DLVNVLKHEIRDGQLSFRGKRV+EL C YGLPGIFACLKGASTVHFQD NAE 
Sbjct  4    ESWDSSIDLVNVLKHEIRDGQLSFRGKRVVELGCNYGLPGIFACLKGASTVHFQDLNAET  63

Query  683  IRCTTIPNVLVNL  721
            IRCTTIPNVL NL
Sbjct  64   IRCTTIPNVLANL  76



>ref|XP_011073784.1| PREDICTED: histidine protein methyltransferase 1 homolog [Sesamum 
indicum]
Length=308

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            +E++ S+ +    Y  E V++ G+ + KGR+S  ++   T ++++  K +G LK W+GSL
Sbjct  42   LEVLASEVSPSAKYTVEPVNIGGLTLFKGRVSTQEVFTLTNSDLVPGKYEGGLKLWEGSL  101

Query  524  DLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIP  703
            DL+  L  E++DG+LSF GKRV+EL CG+GLPGIFACLKGAS VHFQD N+E ++  TIP
Sbjct  102  DLITTLSSEMQDGRLSFTGKRVLELGCGHGLPGIFACLKGASLVHFQDFNSEVLQYLTIP  161

Query  704  NVLVNL  721
            NV VN+
Sbjct  162  NVAVNI  167



>ref|XP_008222747.1| PREDICTED: histidine protein methyltransferase 1 homolog [Prunus 
mume]
Length=301

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 90/126 (71%), Gaps = 0/126 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            VE++PS+      Y  E V+L G+ ++KG +S  ++   + ++++  K +G LK W+GSL
Sbjct  36   VEVLPSEILPSVKYTVEPVELGGLTLLKGCVSTQEVFTLSNSDLVPGKYEGGLKLWEGSL  95

Query  524  DLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIP  703
            DLV  L  E+++G LSF GKRV+EL CG+GLPGIFACLKGA+ +HFQD NAE ++C TIP
Sbjct  96   DLVKALSSEVQNGHLSFTGKRVLELGCGHGLPGIFACLKGAAAIHFQDFNAEVLQCLTIP  155

Query  704  NVLVNL  721
            NV  N+
Sbjct  156  NVNSNV  161



>emb|CBI39376.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            Y  E V+L G+ ++KGR++  D+  F+ ++++  + +G LK W+GSLDLV  L+ E+++G
Sbjct  62   YTVERVNLNGLTLLKGRVNTQDVFAFSNSDLVPGQYEGGLKLWEGSLDLVKALRSEVQNG  121

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNV  709
            +LSF GKRV+E+ CG+G PGI ACL+GA+ VHFQD NAE +RC TIPN 
Sbjct  122  RLSFTGKRVLEIGCGHGFPGILACLEGAAVVHFQDFNAEVLRCLTIPNT  170



>ref|XP_009625430.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nicotiana 
tomentosiformis]
Length=304

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 89/127 (70%), Gaps = 0/127 (0%)
 Frame = +2

Query  341  AVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGS  520
            +VE++ S+      +  E ++L G+ ++KGR+S  ++ G + ++++  K +G LK W+GS
Sbjct  43   SVEVLSSQVISNVEFNVEPINLDGLALLKGRVSTKEVFGLSNSDLVPGKYEGGLKLWEGS  102

Query  521  LDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTI  700
            LDLV  L  E++ GQLS  GKRV+EL CG+GLPGIFACLKGA  VHF D NAE ++C TI
Sbjct  103  LDLVKTLNSEMQSGQLSLTGKRVLELGCGHGLPGIFACLKGARAVHFHDFNAEVLQCLTI  162

Query  701  PNVLVNL  721
            PNV  N+
Sbjct  163  PNVNANI  169



>gb|EYU32714.1| hypothetical protein MIMGU_mgv1a010754mg [Erythranthe guttata]
Length=302

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 88/125 (70%), Gaps = 0/125 (0%)
 Frame = +2

Query  347  EIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLD  526
            E++ S+ +    Y  E V++ G+ + KGR+S  ++     ++++  K +G LK W+GS D
Sbjct  42   EVLSSEVSPNAQYTVEPVNVGGLTLFKGRVSTEEVFSLANSDLVPGKYEGGLKLWEGSFD  101

Query  527  LVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPN  706
            L+  L  E++DG+LSF GKRV+EL CG+GLPGIFACLKGA+ VHFQD NAE ++C TIPN
Sbjct  102  LIAALSSEMQDGKLSFTGKRVLELGCGHGLPGIFACLKGAAAVHFQDFNAEVLQCLTIPN  161

Query  707  VLVNL  721
            V  N+
Sbjct  162  VTANI  166



>ref|XP_010673378.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=284

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            YA E VDL  + ++KGR+S  ++   + ++++  K +G LK W+GSLDLV  L  EI+ G
Sbjct  73   YAVEQVDLGDVTLLKGRVSTREVFALSNSDLVPGKYEGGLKLWEGSLDLVKALHSEIQKG  132

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             LSF GK+V+EL CG+GLPGIFACLKGA +VHFQD NAE ++C T+PNV  NL
Sbjct  133  DLSFEGKKVLELGCGHGLPGIFACLKGAGSVHFQDFNAEVLKCLTLPNVNANL  185



>gb|KJB71877.1| hypothetical protein B456_011G152100 [Gossypium raimondii]
Length=251

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            Y  E V+L G+ ++KGR+S  +++G   ++++    +G LK W+GSLDLV  L+ EI++G
Sbjct  51   YTVEPVNLDGLTLLKGRVSTKEVLGLPNSDLVPGIYEGGLKLWEGSLDLVKALRSEIQNG  110

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             LSF GKRV+EL CG+GLPGIFACL+ A+ VHFQD NAE +RC TIPNV  NL
Sbjct  111  CLSFEGKRVLELGCGHGLPGIFACLESAAEVHFQDFNAEVLRCLTIPNVNANL  163



>ref|XP_007163808.1| hypothetical protein PHAVU_001G266000g [Phaseolus vulgaris]
 gb|ESW35802.1| hypothetical protein PHAVU_001G266000g [Phaseolus vulgaris]
Length=289

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 91/128 (71%), Gaps = 0/128 (0%)
 Frame = +2

Query  338  PAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDG  517
            P VE++ S+      +  E+V+L G+ ++KGR+S   + G + ++++  K +G LK W+G
Sbjct  31   PCVEVLASEAPSSANHNLESVNLDGLTLLKGRVSTQQVFGLSNSDLVPGKYEGGLKLWEG  90

Query  518  SLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTT  697
            SLDL+  L+ +IR G +SF GKRV+E+ CG+GLPGIFA L+GA+ VHFQD NAE +RC T
Sbjct  91   SLDLIKALRSDIRTGLISFGGKRVLEVGCGHGLPGIFALLEGAAAVHFQDFNAEVLRCLT  150

Query  698  IPNVLVNL  721
            IPN+  N+
Sbjct  151  IPNLHANI  158



>ref|XP_010673377.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=317

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            YA E VDL  + ++KGR+S  ++   + ++++  K +G LK W+GSLDLV  L  EI+ G
Sbjct  73   YAVEQVDLGDVTLLKGRVSTREVFALSNSDLVPGKYEGGLKLWEGSLDLVKALHSEIQKG  132

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             LSF GK+V+EL CG+GLPGIFACLKGA +VHFQD NAE ++C T+PNV  NL
Sbjct  133  DLSFEGKKVLELGCGHGLPGIFACLKGAGSVHFQDFNAEVLKCLTLPNVNANL  185



>ref|XP_009764705.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nicotiana 
sylvestris]
Length=305

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 88/126 (70%), Gaps = 0/126 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            VE++ S+ +    +  E +++ G+ ++KGR+S  ++ G + ++++  K +G LK W+GSL
Sbjct  44   VEVLSSQVSSNVEFNVEPINMDGLTLLKGRVSTKEVFGLSNSDLVPGKYEGGLKLWEGSL  103

Query  524  DLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIP  703
            DLV  L  E+  GQLS  GKRV+EL CG+GLPGIFACLKGA  VHF D NAE ++C TIP
Sbjct  104  DLVKTLNSEMLSGQLSLTGKRVLELGCGHGLPGIFACLKGAHAVHFHDFNAEVLQCLTIP  163

Query  704  NVLVNL  721
            NV  N+
Sbjct  164  NVNANI  169



>ref|XP_006349911.1| PREDICTED: histidine protein methyltransferase 1 homolog [Solanum 
tuberosum]
Length=309

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +    +  E +DL G+ ++KGR+S  ++ G + +++I  K +G LK W+GSLDLV  
Sbjct  53   SQVSSNVEFNVEPIDLDGLTLLKGRVSTKEVFGLSNSDLIPGKYEGGLKLWEGSLDLVKT  112

Query  539  LKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            L  E++ G+LS  GKRV+EL CG+GLPGIFACLKGA  VHFQD NAE ++C TIPNV  N
Sbjct  113  LSSEMQSGKLSLTGKRVLELGCGHGLPGIFACLKGARAVHFQDFNAEVLQCLTIPNVNAN  172

Query  719  L  721
            +
Sbjct  173  I  173



>ref|XP_007034208.1| Methyltransferase family protein [Theobroma cacao]
 gb|EOY05134.1| Methyltransferase family protein [Theobroma cacao]
Length=303

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/110 (55%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  392  ENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLS  571
            E V+L G  ++KGR+S  ++ G   ++++  K +G LK W+GSLDLV  L+ E+++G LS
Sbjct  54   EPVNLDGFTLLKGRVSTKEVFGLPNSDLVPGKYEGGLKLWEGSLDLVKALRSEVQNGHLS  113

Query  572  FRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
              GKRV+EL CG+GLPGIFACL+GA+ VHFQD NAE +RC TIPNV  NL
Sbjct  114  LEGKRVLELGCGHGLPGIFACLEGAAVVHFQDFNAEVLRCLTIPNVNANL  163



>ref|XP_002300145.1| hypothetical protein POPTR_0001s32830g [Populus trichocarpa]
 gb|EEE84950.1| hypothetical protein POPTR_0001s32830g [Populus trichocarpa]
Length=301

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 93/127 (73%), Gaps = 1/127 (1%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQ-GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGS  520
            VE++ S+ +     + E+V+L+ G+ ++KGR+S  ++ G   ++++    +G LK W+GS
Sbjct  35   VEVLSSEVSLNVKCSVESVNLEDGLTLLKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGS  94

Query  521  LDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTI  700
            LDL+N L+ E+R+G LSF GKRV+EL CG+GLPGIFA L+GAS VHFQD NAE ++C TI
Sbjct  95   LDLINALQAEVRNGHLSFSGKRVLELGCGHGLPGIFAFLEGASAVHFQDFNAEVLQCLTI  154

Query  701  PNVLVNL  721
            PNV  NL
Sbjct  155  PNVNANL  161



>gb|KJB71879.1| hypothetical protein B456_011G152100 [Gossypium raimondii]
Length=277

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            Y  E V+L G+ ++KGR+S  +++G   ++++    +G LK W+GSLDLV  L+ EI++G
Sbjct  51   YTVEPVNLDGLTLLKGRVSTKEVLGLPNSDLVPGIYEGGLKLWEGSLDLVKALRSEIQNG  110

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             LSF GKRV+EL CG+GLPGIFACL+ A+ VHFQD NAE +RC TIPNV  NL
Sbjct  111  CLSFEGKRVLELGCGHGLPGIFACLESAAEVHFQDFNAEVLRCLTIPNVNANL  163



>gb|KJB71880.1| hypothetical protein B456_011G152100 [Gossypium raimondii]
Length=286

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 85/112 (76%), Gaps = 0/112 (0%)
 Frame = +2

Query  386  ASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQ  565
            +SE V+L G+ ++KGR+S  +++G   ++++    +G LK W+GSLDLV  L+ EI++G 
Sbjct  42   SSEPVNLDGLTLLKGRVSTKEVLGLPNSDLVPGIYEGGLKLWEGSLDLVKALRSEIQNGC  101

Query  566  LSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            LSF GKRV+EL CG+GLPGIFACL+ A+ VHFQD NAE +RC TIPNV  NL
Sbjct  102  LSFEGKRVLELGCGHGLPGIFACLESAAEVHFQDFNAEVLRCLTIPNVNANL  153



>ref|XP_010258579.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Nelumbo nucifera]
Length=335

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 91/127 (72%), Gaps = 1/127 (1%)
 Frame = +2

Query  341  AVEIVPSKTAHPYTYASENVDL-QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDG  517
            +VE++ S+ +    Y  E+V+L  G+ ++KGR+S  ++   + ++++  K +G LK W+G
Sbjct  64   SVEVLTSEMSPTVKYTVESVNLGDGLTLLKGRVSTHEVFALSNSDLVPGKYEGGLKLWEG  123

Query  518  SLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTT  697
            SLDLV  L  EI+ GQLS +GK V+EL CG+GLPGIF+CL+GAS VHFQD NAE +RC T
Sbjct  124  SLDLVKALHSEIQGGQLSLKGKHVLELGCGHGLPGIFSCLEGASVVHFQDFNAEVLRCLT  183

Query  698  IPNVLVN  718
            IPNV  N
Sbjct  184  IPNVNAN  190



>ref|XP_010314745.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Solanum lycopersicum]
Length=326

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +    +  E +DL G+ ++KGR+S  ++ G + +++I  K +G LK W+GSLDLV  
Sbjct  53   SQVSSNVEFNVEPIDLDGLTLLKGRVSTKEVFGLSNSDLIPGKYEGGLKLWEGSLDLVKT  112

Query  539  LKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            L  E++ G+LS  GKRV+EL CG+GLPGIFACLKGA  VHFQD NAE ++C TIPNV  N
Sbjct  113  LSSEMQSGKLSLTGKRVLELGCGHGLPGIFACLKGARAVHFQDFNAEVLQCLTIPNVNAN  172

Query  719  L  721
            +
Sbjct  173  I  173



>gb|KJB71876.1| hypothetical protein B456_011G152100 [Gossypium raimondii]
Length=296

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            Y  E V+L G+ ++KGR+S  +++G   ++++    +G LK W+GSLDLV  L+ EI++G
Sbjct  51   YTVEPVNLDGLTLLKGRVSTKEVLGLPNSDLVPGIYEGGLKLWEGSLDLVKALRSEIQNG  110

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             LSF GKRV+EL CG+GLPGIFACL+ A+ VHFQD NAE +RC TIPNV  NL
Sbjct  111  CLSFEGKRVLELGCGHGLPGIFACLESAAEVHFQDFNAEVLRCLTIPNVNANL  163



>gb|KJB71878.1| hypothetical protein B456_011G152100 [Gossypium raimondii]
Length=291

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            Y  E V+L G+ ++KGR+S  +++G   ++++    +G LK W+GSLDLV  L+ EI++G
Sbjct  51   YTVEPVNLDGLTLLKGRVSTKEVLGLPNSDLVPGIYEGGLKLWEGSLDLVKALRSEIQNG  110

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             LSF GKRV+EL CG+GLPGIFACL+ A+ VHFQD NAE +RC TIPNV  NL
Sbjct  111  CLSFEGKRVLELGCGHGLPGIFACLESAAEVHFQDFNAEVLRCLTIPNVNANL  163



>gb|KHG01813.1| Histidine protein methyltransferase 1 [Gossypium arboreum]
Length=296

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            Y  E V+L G+ ++KGR+S  +++G   ++++    +G LK W+GSLDLV  L+ EI++G
Sbjct  51   YTVEPVNLDGLTLLKGRVSTKEVLGLPNSDLVPGIYEGGLKLWEGSLDLVKALRSEIQNG  110

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             LSF GKRV+EL CG+GLPGIFACL+ A+ VHFQD NAE +RC TIPNV  NL
Sbjct  111  CLSFEGKRVLELGCGHGLPGIFACLESAAEVHFQDFNAEVLRCLTIPNVNANL  163



>ref|XP_004252981.2| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Solanum lycopersicum]
Length=327

 Score =   137 bits (346),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +    +  E +DL G+ ++KGR+S  ++ G + +++I  K +G LK W+GSLDLV  
Sbjct  53   SQVSSNVEFNVEPIDLDGLTLLKGRVSTKEVFGLSNSDLIPGKYEGGLKLWEGSLDLVKT  112

Query  539  LKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            L  E++ G+LS  GKRV+EL CG+GLPGIFACLKGA  VHFQD NAE ++C TIPNV  N
Sbjct  113  LSSEMQSGKLSLTGKRVLELGCGHGLPGIFACLKGARAVHFQDFNAEVLQCLTIPNVNAN  172

Query  719  L  721
            +
Sbjct  173  I  173



>ref|XP_001760682.1| predicted protein [Physcomitrella patens]
 gb|EDQ74421.1| predicted protein [Physcomitrella patens]
Length=302

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/131 (50%), Positives = 92/131 (70%), Gaps = 1/131 (1%)
 Frame = +2

Query  332  PSPAVEIVPSKTAHPYTYASENVDLQG-INIVKGRISVADIIGFTGTEMISSKPDGYLKC  508
            P+P  E+ PS+     +   E V LQG + ++KGR++   ++    +++I  K +G LK 
Sbjct  43   PTPPEEVFPSEDEESASCVMEPVVLQGGLTLLKGRVNSQSVLKVANSDLIPGKYEGGLKL  102

Query  509  WDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIR  688
            W+ ++DLV +L+ EI+DGQLSFRGKRV+EL CG+GLPGIFACLKGAS+VHFQD N E ++
Sbjct  103  WECTIDLVEMLRREIQDGQLSFRGKRVLELGCGHGLPGIFACLKGASSVHFQDFNPEVLK  162

Query  689  CTTIPNVLVNL  721
              TI NV  NL
Sbjct  163  TLTIKNVQANL  173



>ref|XP_006841538.1| PREDICTED: histidine protein methyltransferase 1 homolog [Amborella 
trichopoda]
 gb|ERN03213.1| hypothetical protein AMTR_s00003p00162530 [Amborella trichopoda]
Length=318

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/129 (50%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = +2

Query  338  PAVEIVPSKTAHPYTYASENVDL-QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWD  514
            P  E++ ++ A    YA+E V+L +GI ++KGR+S +D+ G + +++I  K +G LK W+
Sbjct  44   PCTEVIFTEVAPSVKYATEPVNLNEGITLLKGRVSTSDVFGASNSDLIPGKYEGGLKLWE  103

Query  515  GSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCT  694
             SLDL+  L  EI++GQLS   K+V+E+ CG+GLPGIF  LKGA+TVHFQD NAE ++C 
Sbjct  104  CSLDLIKSLALEIQNGQLSLEEKKVLEIGCGHGLPGIFTYLKGAATVHFQDFNAEVLQCL  163

Query  695  TIPNVLVNL  721
            TIPNV  NL
Sbjct  164  TIPNVKANL  172



>gb|KHG01812.1| Histidine protein methyltransferase 1 [Gossypium arboreum]
Length=330

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/113 (55%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            Y  E V+L G+ ++KGR+S  +++G   ++++    +G LK W+GSLDLV  L+ EI++G
Sbjct  51   YTVEPVNLDGLTLLKGRVSTKEVLGLPNSDLVPGIYEGGLKLWEGSLDLVKALRSEIQNG  110

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             LSF GKRV+EL CG+GLPGIFACL+ A+ VHFQD NAE +RC TIPNV  NL
Sbjct  111  CLSFEGKRVLELGCGHGLPGIFACLESAAEVHFQDFNAEVLRCLTIPNVNANL  163



>ref|XP_008358052.1| PREDICTED: histidine protein methyltransferase 1 homolog [Malus 
domestica]
Length=301

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +    Y  E V+L G+ ++KGR+S  D+   + ++++  K +G LK W+GSLDLV  
Sbjct  41   SEVSSSVKYTVEPVELGGLTLLKGRVSTQDVFTLSNSDLVPGKYEGGLKLWEGSLDLVKA  100

Query  539  LKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            L  E+++G LSF GK V+EL CG+GLPGIFACL+GA+ +HFQD NAE +RC TIPNV  N
Sbjct  101  LSSEVQNGNLSFAGKCVLELGCGHGLPGIFACLEGAAAIHFQDFNAEVLRCLTIPNVNSN  160

Query  719  L  721
            +
Sbjct  161  I  161



>ref|XP_002532519.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF29871.1| conserved hypothetical protein [Ricinus communis]
Length=303

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 83/110 (75%), Gaps = 0/110 (0%)
 Frame = +2

Query  392  ENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLS  571
            E V L G+ ++KGR+S  ++ G   ++++    +G LK W+GSLDLV  L+ E+++G+LS
Sbjct  53   EPVHLDGLTLLKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGSLDLVKTLRREVQNGRLS  112

Query  572  FRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            F GKRV+EL CG+GLPGIFACL+GA+ VHFQD NAE +R  TIPNV +NL
Sbjct  113  FTGKRVLELGCGHGLPGIFACLEGAAAVHFQDFNAEVLRSLTIPNVNINL  162



>gb|EPS60086.1| hypothetical protein M569_14718, partial [Genlisea aurea]
Length=281

 Score =   134 bits (337),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 88/132 (67%), Gaps = 0/132 (0%)
 Frame = +2

Query  326  HLPSPAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLK  505
            H P    EI  S+ +    Y  E VD+ G+ ++KGR++  D+   + ++++  K +G LK
Sbjct  23   HPPPHCSEISVSEVSRDVNYTLEPVDVGGLTLLKGRVNTRDVFALSNSDLVPGKYEGGLK  82

Query  506  CWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAI  685
             W+ SLDL+  L  EI +G LSF GKRV+EL CG+GLPGIFACLKG++ VHFQD NAE +
Sbjct  83   LWECSLDLIAALNSEIHEGILSFTGKRVLELGCGHGLPGIFACLKGSAAVHFQDFNAEVL  142

Query  686  RCTTIPNVLVNL  721
            RC TI NV  N+
Sbjct  143  RCLTIRNVTHNV  154



>ref|XP_006601885.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Glycine max]
Length=302

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            VE++ S+      +  ++V+L G+ ++KGR++   + G + ++++  K +G LK W+GSL
Sbjct  44   VEVLASEVPSSLKHNVDSVNLDGVILLKGRVNTQQVFGLSNSDLVPGKYEGGLKLWEGSL  103

Query  524  DLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIP  703
            DL+  L+ +I++G +SF GKRV+E+ CG+GLPGIFA L+GA+ VHFQD NAE +RC TIP
Sbjct  104  DLIKALRSDIKNGLISFAGKRVLEVGCGHGLPGIFAFLEGAAAVHFQDFNAEVLRCLTIP  163

Query  704  NVLVNL  721
            N+  NL
Sbjct  164  NLKANL  169



>ref|XP_003552281.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Glycine max]
 gb|KHN24030.1| Histidine protein methyltransferase 1 like [Glycine soja]
Length=306

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/126 (46%), Positives = 91/126 (72%), Gaps = 0/126 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            VE++ S+      +  ++V+L G+ ++KGR++   + G + ++++  K +G LK W+GSL
Sbjct  48   VEVLASEVPSSLKHNVDSVNLDGVILLKGRVNTQQVFGLSNSDLVPGKYEGGLKLWEGSL  107

Query  524  DLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIP  703
            DL+  L+ +I++G +SF GKRV+E+ CG+GLPGIFA L+GA+ VHFQD NAE +RC TIP
Sbjct  108  DLIKALRSDIKNGLISFAGKRVLEVGCGHGLPGIFAFLEGAAAVHFQDFNAEVLRCLTIP  167

Query  704  NVLVNL  721
            N+  NL
Sbjct  168  NLKANL  173



>ref|XP_010068986.1| PREDICTED: histidine protein methyltransferase 1 homolog [Eucalyptus 
grandis]
 gb|KCW57204.1| hypothetical protein EUGRSUZ_H00019 [Eucalyptus grandis]
Length=299

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 89/126 (71%), Gaps = 0/126 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            VE++PS+ +    + +E V L  + ++KGR+S  ++   + ++++  K +G LK W+GS+
Sbjct  39   VEVLPSEVSENVKFTAEPVHLGELTLLKGRVSTQEVFSLSNSDLVPGKYEGGLKLWEGSM  98

Query  524  DLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIP  703
            DLV  L+ EI+ G LSF GKRV+EL CG+G+P IFA L+GA TVH QD NAE ++C TIP
Sbjct  99   DLVKALQSEIKAGILSFSGKRVLELGCGHGIPAIFASLEGAPTVHLQDFNAEVLQCLTIP  158

Query  704  NVLVNL  721
            N+ VNL
Sbjct  159  NMDVNL  164



>gb|KHN44473.1| Histidine protein methyltransferase 1 like [Glycine soja]
Length=279

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 90/130 (69%), Gaps = 0/130 (0%)
 Frame = +2

Query  332  PSPAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCW  511
            P P VE++ S+      +  ++V+L G+ ++KGR++   + G + + ++  K +G LK W
Sbjct  43   PPPCVEVLASEVPSSIKHNVDSVNLDGVTLLKGRVNTQQVFGLSNSNLVPWKYEGGLKLW  102

Query  512  DGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRC  691
            +GSLDL+  L+ +IR+G +SF GKRV+E+  G+GLPGIFA L+GA+ VHFQD NAE +R 
Sbjct  103  EGSLDLIKALRSDIRNGLISFSGKRVLEVGSGHGLPGIFALLEGAAAVHFQDFNAEVLRF  162

Query  692  TTIPNVLVNL  721
             TIPN+  NL
Sbjct  163  LTIPNLNANL  172



>ref|XP_010258580.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X3 [Nelumbo nucifera]
Length=320

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 91/132 (69%), Gaps = 6/132 (5%)
 Frame = +2

Query  341  AVEIVPSKTAHPYTYASENVDL-QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDG  517
            +VE++ S+ +    Y  E+V+L  G+ ++KGR+S  ++   + ++++  K +G LK W+G
Sbjct  44   SVEVLTSEMSPTVKYTVESVNLGDGLTLLKGRVSTHEVFALSNSDLVPGKYEGGLKLWEG  103

Query  518  SLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACL-----KGASTVHFQDRNAEA  682
            SLDLV  L  EI+ GQLS +GK V+EL CG+GLPGIF+CL     +GAS VHFQD NAE 
Sbjct  104  SLDLVKALHSEIQGGQLSLKGKHVLELGCGHGLPGIFSCLEALFHQGASVVHFQDFNAEV  163

Query  683  IRCTTIPNVLVN  718
            +RC TIPNV  N
Sbjct  164  LRCLTIPNVNAN  175



>ref|XP_010258577.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Nelumbo nucifera]
Length=340

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/132 (48%), Positives = 91/132 (69%), Gaps = 6/132 (5%)
 Frame = +2

Query  341  AVEIVPSKTAHPYTYASENVDL-QGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDG  517
            +VE++ S+ +    Y  E+V+L  G+ ++KGR+S  ++   + ++++  K +G LK W+G
Sbjct  64   SVEVLTSEMSPTVKYTVESVNLGDGLTLLKGRVSTHEVFALSNSDLVPGKYEGGLKLWEG  123

Query  518  SLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACL-----KGASTVHFQDRNAEA  682
            SLDLV  L  EI+ GQLS +GK V+EL CG+GLPGIF+CL     +GAS VHFQD NAE 
Sbjct  124  SLDLVKALHSEIQGGQLSLKGKHVLELGCGHGLPGIFSCLEALFHQGASVVHFQDFNAEV  183

Query  683  IRCTTIPNVLVN  718
            +RC TIPNV  N
Sbjct  184  LRCLTIPNVNAN  195



>gb|KDP32603.1| hypothetical protein JCGZ_13153 [Jatropha curcas]
Length=301

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 0/126 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
             E++ S+ +    ++ E V L G+ + KGR+S  ++ G   ++++    +G LK W+GS+
Sbjct  36   TEVLSSEVSSTLKFSVEPVTLDGLTLFKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGSV  95

Query  524  DLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIP  703
            DLV  L+ E++ G LSF GKRV+EL CG+GLPGI ACL+GA  VHFQD NAE +R  TIP
Sbjct  96   DLVKALRSEVQCGHLSFNGKRVLELGCGHGLPGISACLEGARVVHFQDFNAEVLRSLTIP  155

Query  704  NVLVNL  721
            NV VNL
Sbjct  156  NVNVNL  161



>ref|XP_002984087.1| hypothetical protein SELMODRAFT_180720 [Selaginella moellendorffii]
 gb|EFJ15099.1| hypothetical protein SELMODRAFT_180720 [Selaginella moellendorffii]
Length=241

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +2

Query  422  VKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELS  601
             +GRI+ ++I+G + ++++  K +G  K W+ ++DLV+ L+ EI+DGQLSFRGKRV+E+ 
Sbjct  3    TQGRINASEILGISNSDLVPGKYEGGFKLWECAIDLVDTLRREIQDGQLSFRGKRVLEVG  62

Query  602  CGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            CG+GLPGI AC+KGAS VHFQD NAE ++C TIPNV  NL
Sbjct  63   CGHGLPGILACIKGASVVHFQDFNAEVLKCLTIPNVHANL  102



>ref|XP_012078462.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Jatropha curcas]
Length=338

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 0/126 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
             E++ S+ +    ++ E V L G+ + KGR+S  ++ G   ++++    +G LK W+GS+
Sbjct  73   TEVLSSEVSSTLKFSVEPVTLDGLTLFKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGSV  132

Query  524  DLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIP  703
            DLV  L+ E++ G LSF GKRV+EL CG+GLPGI ACL+GA  VHFQD NAE +R  TIP
Sbjct  133  DLVKALRSEVQCGHLSFNGKRVLELGCGHGLPGISACLEGARVVHFQDFNAEVLRSLTIP  192

Query  704  NVLVNL  721
            NV VNL
Sbjct  193  NVNVNL  198



>ref|XP_002960051.1| hypothetical protein SELMODRAFT_73463 [Selaginella moellendorffii]
 gb|EFJ37590.1| hypothetical protein SELMODRAFT_73463 [Selaginella moellendorffii]
Length=289

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +2

Query  422  VKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELS  601
             +GRI+ ++I+G + ++++  K +G  K W+ ++DLV+ L+ EI+DGQLSFRGKRV+E+ 
Sbjct  3    TQGRINASEILGISNSDLVPGKYEGGFKLWECAIDLVDTLRREIQDGQLSFRGKRVLEVG  62

Query  602  CGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            CG+GLPGI AC+KGAS VHFQD NAE ++C TIPNV  NL
Sbjct  63   CGHGLPGILACIKGASVVHFQDFNAEVLKCLTIPNVHANL  102



>ref|XP_004296995.1| PREDICTED: histidine protein methyltransferase 1 homolog [Fragaria 
vesca subsp. vesca]
Length=301

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            +  E V+L G+ ++KGR+S  ++   + ++++  K +G LK W+GSLDLV  L  E+++G
Sbjct  49   FTVEPVELGGLTLLKGRVSTQEVFTLSNSDLVPGKYEGGLKLWEGSLDLVKALSSEVQNG  108

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             LSF GKRV+EL CG+GLPGI AC++GA+ +HFQD NAE ++C TIPNV  N+
Sbjct  109  HLSFAGKRVLELGCGHGLPGIVACIEGAAAIHFQDFNAEVLQCLTIPNVNANV  161



>ref|XP_004489175.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Cicer arietinum]
Length=311

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = +2

Query  332  PSPAVEIVPS--KTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLK  505
            P P VE++ S  + A       E+VD  G+ + KGR++   + G + ++++  K +G LK
Sbjct  48   PPPCVEVLASDSEVASCNKLNVESVDFDGVTLFKGRVNTQQVFGLSNSDLVPGKYEGGLK  107

Query  506  CWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAI  685
             W+GSLDL+  L+ +I+   +SF GKRV+E+ CG+GLPGI+A L+GAS VHFQD NAE +
Sbjct  108  LWEGSLDLIKALRSDIKSELISFGGKRVLEVGCGHGLPGIYALLEGASVVHFQDFNAEVL  167

Query  686  RCTTIPNVLVNL  721
            RC TIPN+  N+
Sbjct  168  RCLTIPNINANI  179



>ref|XP_004489174.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Cicer arietinum]
Length=312

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 89/132 (67%), Gaps = 2/132 (2%)
 Frame = +2

Query  332  PSPAVEIVPS--KTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLK  505
            P P VE++ S  + A       E+VD  G+ + KGR++   + G + ++++  K +G LK
Sbjct  49   PPPCVEVLASDSEVASCNKLNVESVDFDGVTLFKGRVNTQQVFGLSNSDLVPGKYEGGLK  108

Query  506  CWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAI  685
             W+GSLDL+  L+ +I+   +SF GKRV+E+ CG+GLPGI+A L+GAS VHFQD NAE +
Sbjct  109  LWEGSLDLIKALRSDIKSELISFGGKRVLEVGCGHGLPGIYALLEGASVVHFQDFNAEVL  168

Query  686  RCTTIPNVLVNL  721
            RC TIPN+  N+
Sbjct  169  RCLTIPNINANI  180



>gb|KDO47442.1| hypothetical protein CISIN_1g030031mg [Citrus sinensis]
Length=184

 Score =   127 bits (318),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 87/121 (72%), Gaps = 0/121 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +    +  E V+L  + ++KGR+S  +++G   ++++    +G LK W+GS+DLV  
Sbjct  28   SEVSPSLNFTLEPVNLGELTLLKGRVSTKEVLGLPNSDLVPGVYEGGLKLWEGSIDLVKA  87

Query  539  LKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            L+ ++++G +SF GKRV+EL CG+GLPGIFACL+GA+ +HFQ+ NAE +R  TIPNV+ N
Sbjct  88   LRLDVQNGNISFSGKRVLELGCGHGLPGIFACLEGAAVIHFQEFNAEVLRYLTIPNVIAN  147

Query  719  L  721
            +
Sbjct  148  V  148



>gb|AFK36874.1| unknown [Medicago truncatula]
 gb|KEH21595.1| methyltransferase family protein [Medicago truncatula]
Length=311

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 90/132 (68%), Gaps = 2/132 (2%)
 Frame = +2

Query  332  PSPAVEIVPSKTAHPY--TYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLK  505
            P P VE++ S++  P    + +E V+  G+ + KGR++   + G +  +++  K +G LK
Sbjct  48   PPPCVEVLVSESEVPLFVKHNAEEVNFDGVTLFKGRVNTQQVFGLSNFDLVPGKYEGGLK  107

Query  506  CWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAI  685
             W+GS DL+  L+ +I+   +SFRGK+V+E+ CG+GLPGI+A L+GA+ VHFQD NAE +
Sbjct  108  LWEGSNDLIKALRSDIKSELISFRGKQVLEVGCGHGLPGIYALLEGAAVVHFQDFNAEVL  167

Query  686  RCTTIPNVLVNL  721
            RC TIPNV  N+
Sbjct  168  RCLTIPNVNANV  179



>ref|XP_011003636.1| PREDICTED: histidine protein methyltransferase 1 homolog [Populus 
euphratica]
Length=301

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 82/111 (74%), Gaps = 1/111 (1%)
 Frame = +2

Query  392  ENVDLQ-GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQL  568
            E V+L+ G+ ++KGR+S  ++ G   ++++    +G LK W+GSLDL+  L+ E++ G L
Sbjct  51   EPVNLEDGLTLLKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGSLDLIKALQAEVQKGHL  110

Query  569  SFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            SF GKRV+EL CG+GLPGIFA L+GAS VHFQD NAE ++C TIPNV  NL
Sbjct  111  SFSGKRVLELGCGHGLPGIFAFLEGASAVHFQDFNAEVLQCLTIPNVNANL  161



>ref|XP_009392918.1| PREDICTED: histidine protein methyltransferase 1 homolog [Musa 
acuminata subsp. malaccensis]
Length=316

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 82/121 (68%), Gaps = 0/121 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
             +++ P +     V   G+ ++KGR+S  D+ G   ++++  K +G LK W+GSLDLV  
Sbjct  50   EESSEPKSKVEPIVIDDGLTLLKGRVSTFDVFGVANSDLVPGKYEGGLKLWEGSLDLVKK  109

Query  539  LKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            L  EI +G L  RGKRV+EL CG+GLPGIFA LKGA+ +HFQD NAE +R  TIPNV VN
Sbjct  110  LHSEIEEGVLMLRGKRVLELGCGHGLPGIFAGLKGAAVIHFQDFNAEVLRSLTIPNVTVN  169

Query  719  L  721
            L
Sbjct  170  L  170



>ref|XP_004147645.1| PREDICTED: histidine protein methyltransferase 1 homolog [Cucumis 
sativus]
 gb|KGN57226.1| hypothetical protein Csa_3G171830 [Cucumis sativus]
Length=308

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            Y  E V + G+ + KGR+   ++   + ++++    +G LK W+G+LDLV  L  E+ +G
Sbjct  60   YNVEPVSVGGLTLFKGRVRTQEVFSLSNSDLVPGTYEGGLKLWEGALDLVKALCEELENG  119

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             LSF GKRV+EL CG+GLPGI+ACLK A+ VHFQD NAE +RC TIPNV  NL
Sbjct  120  HLSFAGKRVLELGCGHGLPGIYACLKDAAAVHFQDFNAEVLRCLTIPNVAANL  172



>ref|XP_004956645.1| PREDICTED: histidine protein methyltransferase 1 homolog [Setaria 
italica]
Length=313

 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +2

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            ++I KGR+S +D+ G   ++++  K +G LK W+GSLDLV  L  +I++G+L   GKRV+
Sbjct  75   LSIYKGRVSTSDVFGVKDSDLVPGKYEGGLKLWEGSLDLVKALNSDIKEGRLLLEGKRVL  134

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG+GLPGIFA LKGA  +HFQD NAE ++C TIPNV VNL
Sbjct  135  ELGCGHGLPGIFAGLKGAGLIHFQDFNAEVLKCLTIPNVKVNL  177



>gb|KFK36305.1| hypothetical protein AALP_AA4G105100 [Arabis alpina]
Length=285

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 85/126 (67%), Gaps = 0/126 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            VE++ ++++    +  + V +  + ++KGR++  ++ G   ++++    +G LK W+GS+
Sbjct  38   VEVLSTESSSSVDFTVDKVTISDVTLLKGRVNTKEVFGLPNSDLVPGVYEGGLKLWEGSI  97

Query  524  DLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIP  703
            DLV  L+ E + G LSF  KRV+EL CG+ LPGI+ACLKGA  VHFQD NAE +RC TIP
Sbjct  98   DLVKALEKESQTGNLSFSRKRVLELGCGHALPGIYACLKGADAVHFQDFNAEVLRCLTIP  157

Query  704  NVLVNL  721
            N+  NL
Sbjct  158  NLNANL  163



>ref|XP_010527454.1| PREDICTED: histidine protein methyltransferase 1 homolog [Tarenaya 
hassleriana]
Length=300

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/113 (49%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            +A E V +  + ++KGR++  D+ G   ++++    +G LK W+GS+DLV +L+ E+ +G
Sbjct  56   FAVEKVAIGELTLLKGRVNTKDVFGLPNSDLVPGVYEGGLKLWEGSIDLVKILEKEVHNG  115

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             L F GKRV+EL CG+GLPGI++CLK A  VHFQD NAE +RC TIPN+  NL
Sbjct  116  NLPFSGKRVLELGCGHGLPGIYSCLKNADAVHFQDFNAEVLRCLTIPNLNANL  168



>ref|XP_010910923.1| PREDICTED: histidine protein methyltransferase 1 homolog [Elaeis 
guineensis]
Length=317

 Score =   127 bits (318),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +2

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            + ++KGR+S  D+ G   +++++ K +G LK W+GS+DLV  L+ E+R+G+L   GKRV+
Sbjct  71   LTLLKGRVSTFDVFGVANSDLVAGKYEGGLKLWEGSVDLVKTLRSEVREGRLMLEGKRVL  130

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG+GLPGIF CL+GA+ +HFQD NAE ++  TIPNV VNL
Sbjct  131  ELGCGHGLPGIFTCLEGAAVIHFQDFNAEVLKHLTIPNVKVNL  173



>ref|XP_006421030.1| hypothetical protein CICLE_v10005461mg [Citrus clementina]
 gb|ESR34270.1| hypothetical protein CICLE_v10005461mg [Citrus clementina]
Length=317

 Score =   127 bits (318),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 87/121 (72%), Gaps = 0/121 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +    +  E V+L  + ++KGR+S  +++G   ++++    +G LK W+GS+DLV  
Sbjct  56   SEVSPSLNFTLEPVNLGELTLLKGRVSTKEVLGLPNSDLVPGVYEGGLKLWEGSIDLVKA  115

Query  539  LKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            L+ ++++G +SF GKRV+EL CG+GLPGIFACL+GA+ +HFQD NAE +R  TIPNV+ N
Sbjct  116  LRLDVQNGNISFSGKRVLELGCGHGLPGIFACLEGAAVIHFQDFNAEVLRYLTIPNVIAN  175

Query  719  L  721
            +
Sbjct  176  V  176



>ref|NP_567417.1| putative methyltransferase family protein [Arabidopsis thaliana]
 gb|AAL62409.1| unknown protein [Arabidopsis thaliana]
 gb|AAM48033.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83359.1| putative methyltransferase family protein [Arabidopsis thaliana]
Length=290

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 84/126 (67%), Gaps = 0/126 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            VE++  + +    +  + + +  I ++KGR+S  ++ G   ++++    +G LK W+GS+
Sbjct  37   VEVLSFEVSSSTDFEVDKLTIGEITLLKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGSI  96

Query  524  DLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIP  703
            DLV  L+ E + G LSF GKRV+EL CG+ LPGI+ACLKG+  VHFQD NAE +RC TIP
Sbjct  97   DLVKALEKESQTGNLSFSGKRVLELGCGHALPGIYACLKGSDAVHFQDFNAEVLRCLTIP  156

Query  704  NVLVNL  721
            N+  NL
Sbjct  157  NLNANL  162



>ref|XP_012078461.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Jatropha curcas]
Length=340

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 86/128 (67%), Gaps = 2/128 (2%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPD--GYLKCWDG  517
             E++ S+ +    ++ E V L G+ + KGR+S  ++ G   ++++    +  G LK W+G
Sbjct  73   TEVLSSEVSSTLKFSVEPVTLDGLTLFKGRVSTKEVFGLPNSDLVPGVYEDLGGLKLWEG  132

Query  518  SLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTT  697
            S+DLV  L+ E++ G LSF GKRV+EL CG+GLPGI ACL+GA  VHFQD NAE +R  T
Sbjct  133  SVDLVKALRSEVQCGHLSFNGKRVLELGCGHGLPGISACLEGARVVHFQDFNAEVLRSLT  192

Query  698  IPNVLVNL  721
            IPNV VNL
Sbjct  193  IPNVNVNL  200



>ref|XP_008439038.1| PREDICTED: histidine protein methyltransferase 1 homolog [Cucumis 
melo]
Length=308

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 78/113 (69%), Gaps = 0/113 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            Y  E V +  + + KGR+S  ++   + ++++  K +G LK W+G+LDLV  L  E+ +G
Sbjct  60   YNVEPVSVGELTLFKGRVSTQEVFSLSNSDLVPGKYEGGLKLWEGALDLVKALCEELENG  119

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             LSF GKRV+EL CG+GLPGI+ACLK A+ VHFQD NAE +RC TI NV  NL
Sbjct  120  HLSFAGKRVLELGCGHGLPGIYACLKDAAAVHFQDFNAEVLRCLTISNVAANL  172



>ref|XP_008668398.1| PREDICTED: uncharacterized protein LOC100383278 isoform X1 [Zea 
mays]
 tpg|DAA39938.1| TPA: hypothetical protein ZEAMMB73_125262 [Zea mays]
Length=249

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            + I KGR+S +D+ G   ++++  K +G LK W+GSLDLV  L  +I++ +    GKRV+
Sbjct  72   LTIYKGRVSTSDVFGVKDSDLVPGKYEGGLKLWEGSLDLVKALNSDIKEDKFHLEGKRVL  131

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG+GLPGIFA LKGA  +HFQD NAE +RC TIPNV VNL
Sbjct  132  ELGCGHGLPGIFAGLKGADLIHFQDFNAEVLRCLTIPNVKVNL  174



>ref|XP_003578016.1| PREDICTED: histidine protein methyltransferase 1 homolog [Brachypodium 
distachyon]
Length=306

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +2

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            ++I KGR++  D+ G   ++++  K +G LK W+GSLDLV  L  +I+D +L   GKRV+
Sbjct  68   LSIYKGRVNTCDVFGVKNSDLVPGKYEGGLKLWEGSLDLVKTLNADIKDDRLLVEGKRVL  127

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG+GLPGIFA LKGA  VHFQD NAE +RC TIPNV VNL
Sbjct  128  ELGCGHGLPGIFAGLKGAGLVHFQDFNAEVLRCLTIPNVKVNL  170



>ref|XP_009139570.1| PREDICTED: histidine protein methyltransferase 1 homolog [Brassica 
rapa]
Length=291

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 79/110 (72%), Gaps = 0/110 (0%)
 Frame = +2

Query  392  ENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLS  571
            + V++  + ++KGR++  ++ G   ++++    +G LK W+GS+DLV  L+ E + G +S
Sbjct  55   DKVNIGQVTLLKGRVNTKEVFGLPNSDLVPGVYEGGLKLWEGSIDLVKALEKETQTGNVS  114

Query  572  FRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            F GKRV+EL CG+GLPGI+ACLKGA  VHFQD NAE +RC TIPN+  NL
Sbjct  115  FPGKRVLELGCGHGLPGIYACLKGADAVHFQDFNAEVLRCLTIPNLNANL  164



>ref|XP_010450119.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=290

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/121 (47%), Positives = 80/121 (66%), Gaps = 0/121 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +     A + V +  I ++KGR+S  D+ G   ++++    +G LK W+GS+DLV  
Sbjct  42   SEASSSVDLAVDKVTIGDITLLKGRVSTKDVFGLPNSDLVPGVYEGGLKLWEGSIDLVKA  101

Query  539  LKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            L+ E + G LS  GKRV+EL CG+ LPGI+ACLKG+  VHFQD NAE +RC TIPN+  N
Sbjct  102  LEKESQSGNLSLSGKRVLELGCGHSLPGIYACLKGSDAVHFQDFNAEVLRCLTIPNLNAN  161

Query  719  L  721
            L
Sbjct  162  L  162



>ref|XP_006414825.1| hypothetical protein EUTSA_v10025872mg [Eutrema salsugineum]
 gb|ESQ56278.1| hypothetical protein EUTSA_v10025872mg [Eutrema salsugineum]
Length=294

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/121 (44%), Positives = 82/121 (68%), Gaps = 0/121 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +    +A + + +  + ++KGR++  ++ G   ++++    +G LK W+GS+DLV  
Sbjct  47   SEASSSVDFAVDKMPIGDVTLLKGRVNTKEVFGLPNSDLVPGVYEGGLKLWEGSIDLVKA  106

Query  539  LKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            L+ E + G +SF GKRV+EL CG+ LPGI+ACLKGA  +HFQD NAE +RC TIPN+  N
Sbjct  107  LEKETKTGNISFSGKRVLELGCGHALPGIYACLKGADAIHFQDFNAEVLRCLTIPNLNAN  166

Query  719  L  721
            L
Sbjct  167  L  167



>ref|NP_001169409.1| uncharacterized protein LOC100383278 [Zea mays]
 gb|ACN33665.1| unknown [Zea mays]
 tpg|DAA39939.1| TPA: hypothetical protein ZEAMMB73_125262 [Zea mays]
Length=310

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            + I KGR+S +D+ G   ++++  K +G LK W+GSLDLV  L  +I++ +    GKRV+
Sbjct  72   LTIYKGRVSTSDVFGVKDSDLVPGKYEGGLKLWEGSLDLVKALNSDIKEDKFHLEGKRVL  131

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG+GLPGIFA LKGA  +HFQD NAE +RC TIPNV VNL
Sbjct  132  ELGCGHGLPGIFAGLKGADLIHFQDFNAEVLRCLTIPNVKVNL  174



>gb|AAM63649.1| unknown [Arabidopsis thaliana]
Length=290

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            I ++KGR+S  ++ G   ++++    +G LK W+GS+DLV  L+ E + G LSF GKRV+
Sbjct  60   ITLLKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGSIDLVKALEKESQTGNLSFSGKRVL  119

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG+ LPGI+ACLKG+  VHFQD NAE +RC TIPN+  NL
Sbjct  120  ELGCGHALPGIYACLKGSDAVHFQDFNAEVLRCLTIPNLNANL  162



>ref|XP_010450136.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=290

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +     A + V +  I ++KGR+S  ++ G   ++++    +G LK W+GS+DLV  
Sbjct  42   SEASSSVDLAVDKVTVGEITLLKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGSIDLVKA  101

Query  539  LKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            L+ E + G LS  GKRV+EL CG+ LPGI+ACLKG+ +VHFQD NAE +RC TIPN+  N
Sbjct  102  LEKESQSGNLSLSGKRVLELGCGHALPGIYACLKGSDSVHFQDFNAEVLRCLTIPNLNAN  161

Query  719  L  721
            L
Sbjct  162  L  162



>ref|XP_002460101.1| hypothetical protein SORBIDRAFT_02g022780 [Sorghum bicolor]
 gb|EER96622.1| hypothetical protein SORBIDRAFT_02g022780 [Sorghum bicolor]
Length=440

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +2

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            + I KGR+S +D+ G   ++++  K +G LK W+GSLDLV  L  +I++ +LS  GK V+
Sbjct  75   LTIYKGRVSTSDVFGVKDSDLVPGKYEGGLKLWEGSLDLVKALNSDIKEDKLSLEGKHVL  134

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG+GLPGIFA LKGA  +HFQD NAE +RC TIPNV VNL
Sbjct  135  ELGCGHGLPGIFAGLKGADLIHFQDFNAEVLRCLTIPNVKVNL  177



>ref|XP_008792354.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Phoenix dactylifera]
 ref|XP_008792355.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Phoenix dactylifera]
Length=318

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +2

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            + ++KGR+S  D+ G   +++++ K +G LK W+GS+DLV  L  E+R+G+L F+GKRV+
Sbjct  71   LTLLKGRVSTFDVFGVVNSDLLAGKYEGGLKLWEGSVDLVKTLCSEVREGRLMFKGKRVL  130

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG+GLPGIF  L+GA+ +HFQD NAE ++  TIPNV VNL
Sbjct  131  ELGCGHGLPGIFTGLEGAAVIHFQDFNAEVLKHLTIPNVKVNL  173



>ref|XP_006492532.1| PREDICTED: histidine protein methyltransferase 1 homolog [Citrus 
sinensis]
Length=289

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +    +  E V+L  + ++KGR+S  +++G   ++++    +G LK W+GS+DLV  
Sbjct  28   SEVSPSLNFTLEPVNLGELTLLKGRVSTKEVLGLPNSDLVPGVYEGGLKLWEGSIDLVKA  87

Query  539  LKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            L  ++++G +SF GKRV+EL CG+GLPGIFACL+GA+ +HFQ+ NAE +R  TIPNV+ N
Sbjct  88   LCLDVQNGNISFSGKRVLELGCGHGLPGIFACLEGAAVIHFQEFNAEVLRYLTIPNVIAN  147

Query  719  L  721
            +
Sbjct  148  V  148



>ref|XP_006284234.1| hypothetical protein CARUB_v10005396mg [Capsella rubella]
 gb|EOA17132.1| hypothetical protein CARUB_v10005396mg [Capsella rubella]
Length=290

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 80/121 (66%), Gaps = 0/121 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +     A + V +  I ++KGR+S  ++ G   ++++    +G LK W+GS+DLV  
Sbjct  42   SEASSSVDLAVDKVSIGEITLLKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGSIDLVKA  101

Query  539  LKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            L+ E + G LS  GKRV+EL CG+ LPGI+ACLKG+  VHFQD NAE +RC TIPN+  N
Sbjct  102  LEKESQTGNLSLSGKRVLELGCGHALPGIYACLKGSDAVHFQDFNAEVLRCLTIPNLNAN  161

Query  719  L  721
            L
Sbjct  162  L  162



>ref|NP_001062976.1| Os09g0359900 [Oryza sativa Japonica Group]
 dbj|BAD23316.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF24890.1| Os09g0359900 [Oryza sativa Japonica Group]
 dbj|BAG97280.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE69556.1| hypothetical protein OsJ_29057 [Oryza sativa Japonica Group]
Length=312

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = +2

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            ++I KGR S +D+ G   ++++  K +G LK W+GSLDLV  L  +I++ +L   GKRV+
Sbjct  74   LSIYKGRASTSDVFGVKNSDLVPGKYEGGLKLWEGSLDLVKTLNSDIKEDRLLLEGKRVL  133

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG+GLPGI+A LKGA  VHFQD NAE +RC TIPNV  NL
Sbjct  134  ELGCGHGLPGIYAILKGAVLVHFQDFNAEVLRCLTIPNVKANL  176



>ref|XP_010435209.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelina 
sativa]
Length=290

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 79/121 (65%), Gaps = 0/121 (0%)
 Frame = +2

Query  359  SKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNV  538
            S+ +     A + V    I ++KGR+S  ++ G   ++++    +G LK W+GS+DLV  
Sbjct  42   SEASSSVDLAVDKVTFGDITLLKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGSIDLVKA  101

Query  539  LKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            L+ E + G LS  GKRV+EL CG+ LPGI+ACLKG+  VHFQD NAE +RC TIPN+  N
Sbjct  102  LEKESQSGNLSLSGKRVLELGCGHALPGIYACLKGSDAVHFQDFNAEVLRCLTIPNLNAN  161

Query  719  L  721
            +
Sbjct  162  I  162



>ref|XP_006661157.1| PREDICTED: histidine protein methyltransferase 1 homolog [Oryza 
brachyantha]
Length=310

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +2

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            ++I KGR S +D+ G   ++++  K +G LK W+GSLDLV  L  +I++G+L    K V+
Sbjct  72   LSIYKGRASTSDVFGVKNSDLVPGKYEGGLKLWEGSLDLVKTLNSDIKEGRLLIEHKHVL  131

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG+GLPGIFA LKGA  VHFQD NAE +RC TIPNV  NL
Sbjct  132  ELGCGHGLPGIFAGLKGAGLVHFQDFNAEVLRCLTIPNVKANL  174



>gb|EAZ08782.1| hypothetical protein OsI_31043 [Oryza sativa Indica Group]
Length=426

 Score =   122 bits (307),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 91/160 (57%), Gaps = 4/160 (3%)
 Frame = +2

Query  242  PSLLAQCLPGLISADRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQGINI  421
            PSLL   L   + A       VI        +PAVE  P           ++     ++I
Sbjct  19   PSLLIFQLQRFLRAFGLRLQRVIRTSSARRRTPAVEESPVAAGELEPVVIDD----SLSI  74

Query  422  VKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELS  601
             KGR S +D+ G   ++++  K +G LK W+GSLDLV  L  +I++ +L   GKRV+EL 
Sbjct  75   YKGRASTSDVFGVKNSDLVPGKYEGGLKLWEGSLDLVKTLNSDIKEDRLLLEGKRVLELG  134

Query  602  CGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            CG+GLPGI+A LKGA  VHFQD NAE +RC TIPNV  NL
Sbjct  135  CGHGLPGIYAILKGAVLVHFQDFNAEVLRCLTIPNVKANL  174



>ref|XP_002870342.1| hypothetical protein ARALYDRAFT_493511 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46601.1| hypothetical protein ARALYDRAFT_493511 [Arabidopsis lyrata subsp. 
lyrata]
Length=295

 Score =   120 bits (302),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +2

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            I ++KGR+S  ++ G   ++++    +G LK W+GS+DLV  L+ E + G LS  GKRV+
Sbjct  65   ITLLKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGSIDLVKALEKESQTGNLSLSGKRVL  124

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            EL CG+ LPGI+ACLKG+  VHFQD NAE +RC TIPN+  NL
Sbjct  125  ELGCGHALPGIYACLKGSDVVHFQDFNAEVLRCLTIPNLNANL  167



>ref|XP_001769361.1| predicted protein [Physcomitrella patens]
 gb|EDQ65730.1| predicted protein, partial [Physcomitrella patens]
Length=230

 Score =   119 bits (297),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 70/97 (72%), Gaps = 0/97 (0%)
 Frame = +2

Query  431  RISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGY  610
            R++   I     ++++  K +G  K WD S+DLV  L+ EI+DGQLSFRGKRV+EL CG+
Sbjct  1    RVNSQSIFNLPYSDLMLGKYEGGYKLWDCSVDLVETLRREIQDGQLSFRGKRVLELGCGH  60

Query  611  GLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            GLPGIFACLKGAS+VHFQD NAE +R  T  NV  NL
Sbjct  61   GLPGIFACLKGASSVHFQDFNAEVLRNVTTKNVQANL  97



>emb|CDY01181.1| BnaA04g06380D [Brassica napus]
Length=291

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +2

Query  392  ENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLS  571
            + V++  + ++KGR++  ++ G   ++++    +G LK W+GS+DLV  L+ E + G +S
Sbjct  55   DKVNIGQVTLLKGRVNTKEVFGLPNSDLVPGVYEGGLKLWEGSIDLVKALEKETQTGNVS  114

Query  572  FRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            F GKRV+EL CG+ LPGI+ACLKGA  VH QD NAE +RC TIPN+  NL
Sbjct  115  FPGKRVLELGCGHALPGIYACLKGADAVHLQDFNAEVLRCLTIPNLNANL  164



>emb|CDY12725.1| BnaC04g29160D [Brassica napus]
Length=291

 Score =   120 bits (300),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            +  + V +  + ++KGR++  ++ G   ++++    +G LK W+GS+DLV  L+ E + G
Sbjct  52   FTVDKVSIGEVTLLKGRVNTKEVFGLPNSDLVPGVYEGGLKLWEGSIDLVKALEKETQTG  111

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             +SF GKRV+EL CG+ LPGI+ACLKGA  VH QD NAE +RC TIPN+  NL
Sbjct  112  NISFPGKRVLELGCGHALPGIYACLKGADAVHLQDFNAEVLRCLTIPNLNANL  164



>ref|XP_008792356.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Phoenix dactylifera]
Length=278

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  413  INIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVI  592
            + ++KGR+S  D+ G   +++++ K +G LK W+GS+DLV  L  E+R+G+L F+GKRV+
Sbjct  71   LTLLKGRVSTFDVFGVVNSDLLAGKYEGGLKLWEGSVDLVKTLCSEVREGRLMFKGKRVL  130

Query  593  ELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVL  712
            EL CG+GLPGIF  L+GA+ +HFQD NAE ++  TIPN+L
Sbjct  131  ELGCGHGLPGIFTGLEGAAVIHFQDFNAEVLKHLTIPNLL  170



>dbj|BAK04918.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=185

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/139 (46%), Positives = 84/139 (60%), Gaps = 35/139 (25%)
 Frame = +2

Query  329  LPSPAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSK-------  487
            LPSPA E+VPS+  H Y YAS N+++ G+NI KG++SV DI+G + +++ ++K       
Sbjct  38   LPSPAAEMVPSQDVHLYKYASNNIEMHGMNIFKGKLSVVDIVGLSRSDLAATKGQGKSNS  97

Query  488  PDGY---------------------LKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIE---  595
            P  Y                     LKC   SL+LVNVLK+EI DG L+FR KRV+E   
Sbjct  98   PTSYIIVLTSTWKGEDLDLSFALGPLKCCQSSLELVNVLKNEICDGLLTFRSKRVLELYI  157

Query  596  ----LSCGYGLPGIFACLK  640
                LSCGYGLPGIF+CLK
Sbjct  158  YLMQLSCGYGLPGIFSCLK  176



>gb|EMS67427.1| hypothetical protein TRIUR3_02638 [Triticum urartu]
Length=214

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++ + K +G LKC + SL+LVNVLK+EIRDG L+FR K V+EL C YGLPGIF+CLKGA
Sbjct  14   SDLATPKGEGPLKCCESSLELVNVLKNEIRDGLLTFRSKWVLELGCRYGLPGIFSCLKGA  73

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
            STVHFQD +A  IRC TIPNVL NL
Sbjct  74   STVHFQDPSAGIIRCRTIPNVLANL  98



>ref|XP_002965969.1| hypothetical protein SELMODRAFT_84048, partial [Selaginella moellendorffii]
 gb|EFJ33389.1| hypothetical protein SELMODRAFT_84048, partial [Selaginella moellendorffii]
Length=251

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/102 (54%), Positives = 75/102 (74%), Gaps = 0/102 (0%)
 Frame = +2

Query  416  NIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIE  595
            +  +GRI+ +D+ G    +++    +G LK  + + DLV+ L+ EI+DGQLSFRGKRV+E
Sbjct  9    SFFQGRITNSDVAGIPSADLVPGTYEGGLKLSECATDLVDTLRREIQDGQLSFRGKRVLE  68

Query  596  LSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            L CG+GLPG+FAC+KGASTVHFQD N E ++  TIPNV  NL
Sbjct  69   LGCGHGLPGVFACIKGASTVHFQDFNIEVVKRLTIPNVSANL  110



>ref|XP_008222847.1| PREDICTED: LOW QUALITY PROTEIN: histidine protein methyltransferase 
1 homolog [Prunus mume]
Length=200

 Score =   110 bits (275),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 63/83 (76%), Gaps = 0/83 (0%)
 Frame = +2

Query  473  MISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGAST  652
            M  SK +  +K W+GSLDLV  L  E+++G LSF GK V+EL CG+G PGIFACLKGA+T
Sbjct  1    MEHSKEELGIKAWEGSLDLVKALSSEVQNGHLSFTGKXVLELGCGHGFPGIFACLKGAAT  60

Query  653  VHFQDRNAEAIRCTTIPNVLVNL  721
            +HFQD NAE ++C T+PNV  N+
Sbjct  61   IHFQDFNAEVLQCLTVPNVNSNV  83



>emb|CAB10179.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78442.1| hypothetical protein [Arabidopsis thaliana]
Length=269

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 73/111 (66%), Gaps = 0/111 (0%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
            VE++  + +    +  + + +  I ++KGR+S  ++ G   ++++    +G LK W+GS+
Sbjct  37   VEVLSFEVSSSTDFEVDKLTIGEITLLKGRVSTKEVFGLPNSDLVPGVYEGGLKLWEGSI  96

Query  524  DLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNA  676
            DLV  L+ E + G LSF GKRV+EL CG+ LPGI+ACLKG+  VHFQD NA
Sbjct  97   DLVKALEKESQTGNLSFSGKRVLELGCGHALPGIYACLKGSDAVHFQDFNA  147



>ref|XP_010097970.1| hypothetical protein L484_026863 [Morus notabilis]
 gb|EXB73700.1| hypothetical protein L484_026863 [Morus notabilis]
Length=320

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/77 (61%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +2

Query  491  DGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDR  670
             G LK W+GSLDLV  L+ E+ +G LSF  KRV+EL CG+GLP IFAC +GA+ VHFQD 
Sbjct  128  QGGLKLWEGSLDLVKALRSEVGNGHLSFTRKRVLELGCGHGLPAIFACREGAAAVHFQDF  187

Query  671  NAEAIRCTTIPNVLVNL  721
            NAE ++C TIPNV  N+
Sbjct  188  NAEVLKCLTIPNVNANI  204



>gb|EMT16017.1| hypothetical protein F775_04000 [Aegilops tauschii]
Length=335

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 53/76 (70%), Gaps = 3/76 (4%)
 Frame = +2

Query  494  GYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRN  673
            G LK W+GSLDLV  L  +I+D +L   GK    L CG+GLPGI+A LKGA  VHFQD N
Sbjct  15   GGLKLWEGSLDLVKTLNSDIKDDRLLMEGK---HLGCGHGLPGIYAGLKGAGLVHFQDFN  71

Query  674  AEAIRCTTIPNVLVNL  721
            AE +RC TIPNV  NL
Sbjct  72   AEVLRCLTIPNVKANL  87



>ref|XP_008222771.1| PREDICTED: uncharacterized protein LOC103322619 [Prunus mume]
Length=431

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 55/150 (37%), Positives = 78/150 (52%), Gaps = 11/150 (7%)
 Frame = +2

Query  284  DRGCHASVISDRDGHLPSPAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFT  463
            D    AS+ S+ D  +P     + P     P T  + N D     + +G        G  
Sbjct  224  DEVTKASLASNDDDGVPK--ASLAPVDDWVPTTAQAPNDD----EVPRGIAQAEWGRGVE  277

Query  464  GTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGK----RVIELSCGYGLPGIFA  631
            G   +  +  G LK W+GS+DLV  L  E+++G LSF        + +L CG+GLPGIFA
Sbjct  278  GIARVGWRRGG-LKLWEGSIDLVKALSSEVQNGHLSFTATVFPIMIFQLGCGHGLPGIFA  336

Query  632  CLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            CL+GA  +HFQ+ N E ++C TIPNV  N+
Sbjct  337  CLEGAGAIHFQEFNTEVLQCLTIPNVNSNV  366



>ref|XP_009048112.1| hypothetical protein LOTGIDRAFT_139771, partial [Lottia gigantea]
 gb|ESP01169.1| hypothetical protein LOTGIDRAFT_139771, partial [Lottia gigantea]
Length=196

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++I    +G L  W+  +DLVN L  +  D    F GK V+EL CG GLPGI++ + GA
Sbjct  15   SDLIEGIYEGGLTIWECGIDLVNYLISQQGD----FNGKNVLELGCGGGLPGIYSVVNGA  70

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
             +VHFQD N+E I+  TIPNV +N+
Sbjct  71   KSVHFQDYNSEVIKEFTIPNVQLNI  95



>ref|XP_002952933.1| hypothetical protein VOLCADRAFT_105747 [Volvox carteri f. nagariensis]
 gb|EFJ45855.1| hypothetical protein VOLCADRAFT_105747 [Volvox carteri f. nagariensis]
Length=304

 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 78/145 (54%), Gaps = 17/145 (12%)
 Frame = +2

Query  335  SPAVEIVPSKTAHPYTYASENVDLQGINIVKGRIS---VADIIG---FTGTEMISSKPDG  496
             PA E+V         Y  E    + + +VKG IS    A+I+       ++++  K +G
Sbjct  32   EPAAELVHRPQPGVAFYTEEVSIAESLALVKGIISSDEAANILSDKRVASSDLVPGKYEG  91

Query  497  YLKCWDGSLDLVNVL--------KHEIRDGQLS--FRGKRVIELSCGYGLPGIFACLKGA  646
              K W+ SLDL  +L        +  + D +L+   +GK+V+EL CG+GLPG+ A + GA
Sbjct  92   GFKLWECSLDLCKMLLQRYHVVPERVLSDPELASELQGKKVLELGCGHGLPGVLALMCGA  151

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
              VHFQD N E IR  TIPNV+ N+
Sbjct  152  E-VHFQDYNQEVIRRLTIPNVISNM  175



>ref|XP_001626383.1| predicted protein [Nematostella vectensis]
 gb|EDO34283.1| predicted protein, partial [Nematostella vectensis]
Length=187

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 57/87 (66%), Gaps = 5/87 (6%)
 Frame = +2

Query  461  TGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLK  640
            T T++I S  +G LK W+ ++DLV  L    ++ Q+  + +RV+EL CG GLPGIFA L+
Sbjct  9    TSTDLIPSVYEGGLKIWECAVDLVEFL----QESQILLQNRRVLELGCGAGLPGIFALLQ  64

Query  641  GASTVHFQDRNAEAIRCTTIPNVLVNL  721
             A TV FQD N E +   T+PNV +NL
Sbjct  65   NA-TVDFQDYNEEVLEHFTLPNVTLNL  90



>emb|CCD81669.1| hypothetical protein Smp_171890.2 [Schistosoma mansoni]
Length=248

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +2

Query  491  DGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDR  670
            +G    WDGS DLVN +      G++   GK V+EL CG GLPGIFA   GA  V FQD 
Sbjct  93   EGGFTLWDGSKDLVNYISKYFS-GKMC--GKNVLELGCGCGLPGIFAVKAGARLVRFQDY  149

Query  671  NAEAIRCTTIPNVLVN  718
            N+E ++C TIPNV++N
Sbjct  150  NSEVLKCWTIPNVIIN  165



>ref|XP_011682939.1| PREDICTED: histidine protein methyltransferase 1 homolog [Strongylocentrotus 
purpuratus]
Length=295

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 4/86 (5%)
 Frame = +2

Query  461  TGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLK  640
            T ++++ S  +G LK W+ SLDLV  L+       +SF G+ ++EL CG GLPGI+  +K
Sbjct  92   THSDLLPSVYEGGLKVWECSLDLVQYLQDL---DPISFSGQTILELGCGAGLPGIYTLMK  148

Query  641  GASTVHFQDRNAEAIRCTTIPNVLVN  718
            GA TVHFQD N E +   TIPNV +N
Sbjct  149  GA-TVHFQDYNEEVLELLTIPNVQLN  173



>emb|CCD81668.1| hypothetical protein Smp_171890.1 [Schistosoma mansoni]
Length=284

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 49/76 (64%), Gaps = 3/76 (4%)
 Frame = +2

Query  491  DGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDR  670
            +G    WDGS DLVN +      G++   GK V+EL CG GLPGIFA   GA  V FQD 
Sbjct  93   EGGFTLWDGSKDLVNYISKYFS-GKMC--GKNVLELGCGCGLPGIFAVKAGARLVRFQDY  149

Query  671  NAEAIRCTTIPNVLVN  718
            N+E ++C TIPNV++N
Sbjct  150  NSEVLKCWTIPNVIIN  165



>emb|CAX70551.1| hypothetical protein [Schistosoma japonicum]
Length=115

 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 46/77 (60%), Gaps = 3/77 (4%)
 Frame = +2

Query  491  DGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDR  670
            +G    WDGS DLVN +     +      GK V+EL CG GLPGI A   GA  V FQD 
Sbjct  12   EGGFTLWDGSKDLVNYISEHFLE---KIYGKNVLELGCGCGLPGILALKTGARLVRFQDY  68

Query  671  NAEAIRCTTIPNVLVNL  721
            N+E ++  TIPNV++NL
Sbjct  69   NSEVLKWWTIPNVIINL  85



>gb|KDO33764.1| hypothetical protein SPRG_01645 [Saprolegnia parasitica CBS 223.65]
Length=277

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +2

Query  491  DGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDR  670
            +G  K W+ S+DL+  L+    D  +  RG RV+EL CG+GLPGIFA  +GAS V F D 
Sbjct  86   EGGFKLWECSIDLIEYLQQHKADFPIGDRGLRVMELGCGHGLPGIFALQQGASHVLFSDY  145

Query  671  NAEAIRCTTIPNVL  712
            N+E I   TIPN L
Sbjct  146  NSEVIELATIPNTL  159



>ref|XP_009030975.1| hypothetical protein HELRODRAFT_90686, partial [Helobdella robusta]
 gb|ESN90928.1| hypothetical protein HELRODRAFT_90686, partial [Helobdella robusta]
Length=208

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 59/85 (69%), Gaps = 4/85 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            ++++ +K +G  K W+ ++DL   L++ I++ ++SF GK V++L CG G  G++A L GA
Sbjct  10   SDLLPNKYEGGFKVWECTIDL---LQYFIKN-EISFTGKSVLDLGCGAGFLGVYALLNGA  65

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
            + VHFQD N E ++  TIPN+ +NL
Sbjct  66   TDVHFQDYNEEVLKRLTIPNIAINL  90



>ref|XP_006630366.1| PREDICTED: histidine protein methyltransferase 1 homolog [Lepisosteus 
oculatus]
Length=328

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 71/131 (54%), Gaps = 4/131 (3%)
 Frame = +2

Query  329  LPSPAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKC  508
            L +   E +   T  P  Y +E+V  Q  +    +  +      + +++I+   +G L+ 
Sbjct  52   LENSVCETLSLGTLPPLCYLNESVLEQTASERPDQEKILTQTAASHSDLIAGVYEGGLRI  111

Query  509  WDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIR  688
            W+ + DL+  L+ E     ++F GK+V++L CG GL GI A  +GA  VHFQD N+  I 
Sbjct  112  WECTFDLLGYLESE----GVTFSGKKVLDLGCGAGLLGILALKRGAQEVHFQDYNSTVIE  167

Query  689  CTTIPNVLVNL  721
              T+PNVL+N+
Sbjct  168  ALTLPNVLLNI  178



>ref|XP_011344984.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X3 [Cerapachys biroi]
Length=229

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 58/85 (68%), Gaps = 5/85 (6%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            ++++ +K +G LK W+ + DL   +   +++G L  + K V++L CG GL G+ A LKG 
Sbjct  87   SDLVPAKYEGGLKVWECTYDLGRYI---VQEG-LELKDKLVMDLGCGVGLVGLIALLKG-  141

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
            STVHFQD NAE +R  T+PNVL+NL
Sbjct  142  STVHFQDYNAEVLRSVTVPNVLMNL  166



>ref|XP_002605872.1| hypothetical protein BRAFLDRAFT_90801 [Branchiostoma floridae]
 gb|EEN61882.1| hypothetical protein BRAFLDRAFT_90801 [Branchiostoma floridae]
Length=188

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 47/73 (64%), Gaps = 4/73 (5%)
 Frame = +2

Query  500  LKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAE  679
            +K W+ S+DLV    H + +   ++ GK ++EL CG GLPGI A  KGA  +HFQD N E
Sbjct  1    MKIWECSVDLV----HYLSEIAYTWTGKNLLELGCGAGLPGILALTKGAGKIHFQDYNEE  56

Query  680  AIRCTTIPNVLVN  718
             ++  TIPNV +N
Sbjct  57   VLQTVTIPNVSLN  69



>ref|XP_004352569.1| methyltransferase domain containing protein [Acanthamoeba castellanii 
str. Neff]
 gb|ELR23092.1| methyltransferase domain containing protein [Acanthamoeba castellanii 
str. Neff]
Length=264

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 64/111 (58%), Gaps = 3/111 (3%)
 Frame = +2

Query  386  ASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQ  565
            A +  D  G  IV     +A++IG   +++     +G  K W+G+ DLV  L+   +   
Sbjct  38   AEQQQDEFGKGIVSTLPPLAEVIG--SSDLAPGVYEGGFKLWEGAADLVAHLQETEKVHG  95

Query  566  LSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            +S+ GK+V+EL CG+G+PGI+   +GA  VH QD N+E +   TIPN  +N
Sbjct  96   VSYAGKKVLELGCGHGVPGIYLWKQGAE-VHLQDYNSEVLELLTIPNARLN  145



>gb|KGB40186.1| Histidine protein methyltransferase 1-like protein, partial [Schistosoma 
haematobium]
Length=249

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +2

Query  491  DGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDR  670
            +G    WDGS DLV+ +     +      GK V+E+ CG GLPGIFA   GA  V FQD 
Sbjct  58   EGGFTLWDGSKDLVDYISKYFSERMC---GKNVLEVGCGCGLPGIFAIKAGARLVRFQDY  114

Query  671  NAEAIRCTTIPNVLVN  718
            N+E ++C TIPNV++N
Sbjct  115  NSEVLKCWTIPNVIIN  130



>emb|CAX70552.1| hypothetical protein [Schistosoma japonicum]
Length=289

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/77 (48%), Positives = 46/77 (60%), Gaps = 3/77 (4%)
 Frame = +2

Query  491  DGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDR  670
            +G    WDGS DLVN +     +      GK V+EL CG GLPGI A   GA  V FQD 
Sbjct  98   EGGFTLWDGSKDLVNYISEHFLE---KIYGKNVLELGCGCGLPGILALKTGARLVRFQDY  154

Query  671  NAEAIRCTTIPNVLVNL  721
            N+E ++  TIPNV++NL
Sbjct  155  NSEVLKWWTIPNVIINL  171



>ref|XP_005940719.1| PREDICTED: histidine protein methyltransferase 1 homolog [Haplochromis 
burtoni]
Length=357

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = +2

Query  347  EIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLD  526
            E V   T  P  + +E V  +  +  + R  +        +++IS   +G LK W+ + D
Sbjct  68   ETVTVGTLPPLHFLNETVFEKTASEREDREKILSRTAEQKSDLISGVYEGGLKVWECTYD  127

Query  527  LVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPN  706
            L+ +++   +DG+ +F GK V++L CG GL GI A  +GAS VHFQD N+  I   T+PN
Sbjct  128  LLELIE---KDGE-TFGGKAVLDLGCGAGLLGILALKRGASQVHFQDYNSTVIEQLTVPN  183

Query  707  VLVN  718
            V++N
Sbjct  184  VMLN  187



>ref|XP_006808038.1| PREDICTED: histidine protein methyltransferase 1 homolog [Neolamprologus 
brichardi]
Length=357

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 70/124 (56%), Gaps = 4/124 (3%)
 Frame = +2

Query  347  EIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLD  526
            E V   T  P  + +E +  +  +  + R  +        +++IS   +G LK W+ + D
Sbjct  68   ETVTVGTLPPLHFLNETIFEKTASEREDREKILSRTAEQKSDLISGVYEGGLKVWECTYD  127

Query  527  LVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPN  706
            L+ +++   +DG+ +F GK V++L CG GL GI A  +GAS VHFQD N+  I   T+PN
Sbjct  128  LLELIE---KDGE-TFGGKAVLDLGCGAGLLGILALKRGASQVHFQDYNSTVIEQLTVPN  183

Query  707  VLVN  718
            V++N
Sbjct  184  VMLN  187



>ref|XP_011344983.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Cerapachys biroi]
Length=280

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            ++++ +K +G LK W+ + DL   +  E     L  + K V++L CG GL G+ A LKG 
Sbjct  86   SDLVPAKYEGGLKVWECTYDLGRYIVQE----GLELKDKLVMDLGCGVGLVGLIALLKG-  140

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
            STVHFQD NAE +R  T+PNVL+NL
Sbjct  141  STVHFQDYNAEVLRSVTVPNVLMNL  165



>ref|XP_011344982.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Cerapachys biroi]
 gb|EZA50448.1| Histidine protein methyltransferase 1-like protein [Cerapachys 
biroi]
Length=281

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            ++++ +K +G LK W+ + DL   +  E     L  + K V++L CG GL G+ A LKG 
Sbjct  87   SDLVPAKYEGGLKVWECTYDLGRYIVQE----GLELKDKLVMDLGCGVGLVGLIALLKG-  141

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
            STVHFQD NAE +R  T+PNVL+NL
Sbjct  142  STVHFQDYNAEVLRSVTVPNVLMNL  166



>ref|XP_008198493.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Tribolium castaneum]
Length=271

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++I +  +G LK W+ + DLV+ L  +    ++ F GK V++L CG G+ GI ACLKGA
Sbjct  81   SDLIPAVYEGGLKVWECTFDLVDFLVEQ----KIDFGGKDVLDLGCGAGIAGILACLKGA  136

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
             TV FQD N E I   TIPNV +N
Sbjct  137  RTV-FQDYNIEVIESLTIPNVYLN  159



>ref|XP_008198492.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Tribolium castaneum]
Length=280

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++I +  +G LK W+ + DLV+ L  +    ++ F GK V++L CG G+ GI ACLKGA
Sbjct  90   SDLIPAVYEGGLKVWECTFDLVDFLVEQ----KIDFGGKDVLDLGCGAGIAGILACLKGA  145

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
             TV FQD N E I   TIPNV +N
Sbjct  146  RTV-FQDYNIEVIESLTIPNVYLN  168



>ref|XP_001310816.1| hypothetical protein [Trichomonas vaginalis G3]
 gb|EAX97886.1| conserved hypothetical protein [Trichomonas vaginalis G3]
Length=218

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 56/101 (55%), Gaps = 6/101 (6%)
 Frame = +2

Query  416  NIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIE  595
             I  G  S     G   +E++  K +G  + W+ ++DL+  ++      Q  ++GK V E
Sbjct  15   KIYNGLKSYVPASGTVPSEVVPGKYEGGFQLWECTVDLLKYME------QFDYKGKNVFE  68

Query  596  LSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            L CG GLPGI+A L GA++V  QD N + I   T+PNV +N
Sbjct  69   LGCGRGLPGIYAALHGAASVVLQDYNKDVIEKLTMPNVRLN  109



>ref|NP_001135719.1| methyltransferase like 18 [Xenopus (Silurana) tropicalis]
 gb|AAI69166.1| Unknown (protein for MGC:189639) [Xenopus (Silurana) tropicalis]
Length=369

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (62%), Gaps = 4/86 (5%)
 Frame = +2

Query  461  TGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLK  640
            + +++IS   +G +K W+ + DLV  L+    D  + F+GKRV++L CG GL GI A  +
Sbjct  148  SNSDLISGVYEGGMKIWECTFDLVRYLE----DEDVDFQGKRVLDLGCGAGLLGILALKR  203

Query  641  GASTVHFQDRNAEAIRCTTIPNVLVN  718
             A  VHFQD N+  I   T+PN LVN
Sbjct  204  KAKEVHFQDYNSTVIEEITMPNALVN  229



>ref|NP_001088691.1| methyltransferase like 18 [Xenopus laevis]
 gb|AAH87325.1| LOC495955 protein [Xenopus laevis]
Length=369

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 53/86 (62%), Gaps = 4/86 (5%)
 Frame = +2

Query  461  TGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLK  640
            + +++IS   +G +K W+ + DL+  L+    D  + F+GKRV++L CG GL GI A  +
Sbjct  148  SNSDLISGVYEGGMKIWECTFDLIRYLE----DEDVDFKGKRVLDLGCGAGLLGITALKR  203

Query  641  GASTVHFQDRNAEAIRCTTIPNVLVN  718
             A  VHFQD N+  I   T+PN LVN
Sbjct  204  KAKEVHFQDYNSTVIEEITVPNALVN  229



>ref|XP_008320195.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Cynoglossus semilaevis]
Length=360

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++IS   +G LK W+ + DL+ ++    RDG+ +F GK V++L CG GL GI A  + A
Sbjct  110  SDLISGVYEGGLKVWECTYDLLELID---RDGE-TFEGKTVLDLGCGSGLLGILALKRRA  165

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
            S VHFQD N+  I   T+PNV++NL
Sbjct  166  SNVHFQDYNSTVIEELTVPNVILNL  190



>ref|XP_008320194.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Cynoglossus semilaevis]
Length=361

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++IS   +G LK W+ + DL+ ++    RDG+ +F GK V++L CG GL GI A  + A
Sbjct  111  SDLISGVYEGGLKVWECTYDLLELID---RDGE-TFEGKTVLDLGCGSGLLGILALKRRA  166

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
            S VHFQD N+  I   T+PNV++NL
Sbjct  167  SNVHFQDYNSTVIEELTVPNVILNL  191



>ref|XP_008320196.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X3 [Cynoglossus semilaevis]
Length=358

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++IS   +G LK W+ + DL+ ++    RDG+ +F GK V++L CG GL GI A  + A
Sbjct  108  SDLISGVYEGGLKVWECTYDLLELID---RDGE-TFEGKTVLDLGCGSGLLGILALKRRA  163

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
            S VHFQD N+  I   T+PNV++NL
Sbjct  164  SNVHFQDYNSTVIEELTVPNVILNL  188



>gb|EFN78549.1| UPF0558 protein C1orf156-like protein [Harpegnathos saltator]
Length=272

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++I +K +G LK W+ S DL   +  E    ++  + K V++L CG GL GI A L+  
Sbjct  89   SDLIPAKYEGGLKIWESSFDLGQYMLKE----KIELKDKLVLDLGCGAGLIGIIALLQN-  143

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
            STVHFQD NAE +R  TIPNVL N 
Sbjct  144  STVHFQDYNAEVLRSLTIPNVLSNF  168



>ref|XP_008320198.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X4 [Cynoglossus semilaevis]
Length=357

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++IS   +G LK W+ + DL+ ++    RDG+ +F GK V++L CG GL GI A  + A
Sbjct  107  SDLISGVYEGGLKVWECTYDLLELID---RDGE-TFEGKTVLDLGCGSGLLGILALKRRA  162

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
            S VHFQD N+  I   T+PNV++NL
Sbjct  163  SNVHFQDYNSTVIEELTVPNVILNL  187



>ref|XP_003694546.1| PREDICTED: histidine protein methyltransferase 1 homolog [Apis 
florea]
Length=274

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 69/131 (53%), Gaps = 18/131 (14%)
 Frame = +2

Query  329  LPSPAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKC  508
             P   ++++ S+ A  Y    EN      NI++  I  +D        +I +K +G LK 
Sbjct  54   FPDCKLKLIRSEKA-LYDLQKENCS----NIIEAEIQHSD--------LIPAKYEGGLKI  100

Query  509  WDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIR  688
            W+ S DL   L     +  + F+ K V++L CG G+ G+ A LK  STVHFQD N E I+
Sbjct  101  WECSYDLARYL----SENNIEFQNKFVLDLGCGTGIIGLIALLKN-STVHFQDYNIEIIK  155

Query  689  CTTIPNVLVNL  721
              TIPNV++N 
Sbjct  156  TVTIPNVMLNF  166



>ref|XP_005743935.1| PREDICTED: histidine protein methyltransferase 1 homolog [Pundamilia 
nyererei]
Length=357

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (68%), Gaps = 4/84 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++IS   +G LK W+ + DL+ +++   +DG+ +F GK V++L CG GL GI A  +GA
Sbjct  108  SDLISGVYEGGLKVWECTYDLLELIE---KDGE-TFGGKAVLDLGCGAGLLGILALKRGA  163

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
            S VHFQD N+  I   T+PNV++N
Sbjct  164  SQVHFQDYNSTVIEQLTVPNVMLN  187



>ref|XP_008607032.1| hypothetical protein SDRG_03186 [Saprolegnia diclina VS20]
 gb|EQC39760.1| hypothetical protein SDRG_03186 [Saprolegnia diclina VS20]
Length=273

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +2

Query  491  DGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDR  670
            +G  K W+ S+DL+  L+    D  +   G RV+EL CG+GLPGIFA  +GAS V F D 
Sbjct  84   EGGFKLWECSIDLIEYLQQHQADFPIGACGLRVMELGCGHGLPGIFALQQGASHVLFSDY  143

Query  671  NAEAIRCTTIPNVL  712
            N+E I   TIPN +
Sbjct  144  NSEVIELATIPNTM  157



>ref|XP_011148494.1| PREDICTED: histidine protein methyltransferase 1 homolog [Harpegnathos 
saltator]
Length=284

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++I +K +G LK W+ S DL   +  E    ++  + K V++L CG GL GI A L+  
Sbjct  89   SDLIPAKYEGGLKIWESSFDLGQYMLKE----KIELKDKLVLDLGCGAGLIGIIALLQN-  143

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
            STVHFQD NAE +R  TIPNVL N 
Sbjct  144  STVHFQDYNAEVLRSLTIPNVLSNF  168



>ref|XP_004555913.1| PREDICTED: histidine protein methyltransferase 1 homolog [Maylandia 
zebra]
Length=357

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (68%), Gaps = 4/84 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++IS   +G LK W+ + DL+ +++   +DG+ +F GK V++L CG GL GI A  +GA
Sbjct  108  SDLISGVYEGGLKVWECTYDLLELIE---KDGE-TFGGKAVLDLGCGAGLLGILALKRGA  163

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
            S VHFQD N+  I   T+PNV++N
Sbjct  164  SQVHFQDYNSTVIEQLTVPNVMLN  187



>ref|XP_005474206.1| PREDICTED: histidine protein methyltransferase 1 homolog [Oreochromis 
niloticus]
Length=359

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 57/84 (68%), Gaps = 4/84 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++IS   +G LK W+ + DL+ +++   +DG+ +F GK V++L CG GL GI A  +GA
Sbjct  110  SDLISGVYEGGLKVWECTYDLLELIE---KDGE-TFGGKAVLDLGCGAGLLGILALKRGA  165

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
            S VHFQD N+  I   T+PNV++N
Sbjct  166  SQVHFQDYNSTVIEQLTVPNVMLN  189



>gb|KDR07955.1| hypothetical protein L798_01609 [Zootermopsis nevadensis]
Length=300

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 53/83 (64%), Gaps = 4/83 (5%)
 Frame = +2

Query  470  EMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGAS  649
            +++  K +G LK W+ + DL + L   +R+G + F GK++++L CG GL GI A   GA 
Sbjct  96   DLLPGKYEGGLKIWECTRDLADFL---MREG-IDFTGKQILDLGCGTGLLGILAMYLGAK  151

Query  650  TVHFQDRNAEAIRCTTIPNVLVN  718
            +VHFQD N   IR  TIPNV +N
Sbjct  152  SVHFQDYNGSVIRAVTIPNVKMN  174



>ref|XP_001606727.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nasonia 
vitripennis]
 ref|XP_008201908.1| PREDICTED: histidine protein methyltransferase 1 homolog [Nasonia 
vitripennis]
Length=286

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 5/84 (6%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            ++++ +K +G LK W+ + DL N L  E     +S R K V++L CG G  G+ A L+G 
Sbjct  90   SDLLPAKYEGGLKIWECTYDLANYLLTE----NISLRNKAVLDLGCGSGFIGLVAFLRG-  144

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
            STVHFQD N+E I   TIPNV++N
Sbjct  145  STVHFQDYNSEVIESVTIPNVILN  168



>ref|XP_009163918.1| hypothetical protein T265_01595 [Opisthorchis viverrini]
 gb|KER32372.1| hypothetical protein T265_01595 [Opisthorchis viverrini]
Length=278

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 51/87 (59%), Gaps = 2/87 (2%)
 Frame = +2

Query  461  TGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLK  640
            +G ++I    +G L  WDGS  L+  L  +       F G+RV+EL CG GLPG+ A   
Sbjct  78   SGRDVIPGVVEGGLTVWDGSKQLIAYLARKFSPS--VFCGRRVLELGCGCGLPGLTALKY  135

Query  641  GASTVHFQDRNAEAIRCTTIPNVLVNL  721
            GAS V FQD N E I   TIPNVL+NL
Sbjct  136  GASVVTFQDYNHEVITNWTIPNVLLNL  162



>ref|XP_011258559.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camponotus 
floridanus]
 gb|EFN66835.1| UPF0558 protein C1orf156-like protein [Camponotus floridanus]
Length=288

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/150 (33%), Positives = 75/150 (50%), Gaps = 19/150 (13%)
 Frame = +2

Query  311  SDRDGHLPSPAVEIVPSKTAHPY--TYASENVDLQGINI--VKGRISVADIIGFT-----  463
            +D    +P+  +EI P +    Y   Y +E       N+  ++    V D+         
Sbjct  19   TDELEWIPAFKLEITPEQVGVKYGTDYYTETKVFPDFNLKLIRSDKVVKDLTKHNCQNII  78

Query  464  -----GTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIF  628
                  +++I +K +G LK W+ + DL   +  E    Q+  + K V++L CG GL G+ 
Sbjct  79   EAETQHSDLIPAKYEGGLKIWECTFDLGQYILEE----QIELKDKLVMDLGCGAGLIGLI  134

Query  629  ACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            A LK  STVHFQD NAE ++  TIPNVL+N
Sbjct  135  ALLKN-STVHFQDYNAEVLKSMTIPNVLLN  163



>ref|XP_646119.1| UPF0558 protein [Dictyostelium discoideum AX4]
 sp|Q55DL2.1|MET18_DICDI RecName: Full=Histidine protein methyltransferase 1 homolog; 
AltName: Full=Protein METTL18 homolog [Dictyostelium discoideum]
 gb|EAL72640.1| UPF0558 protein [Dictyostelium discoideum AX4]
Length=309

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 5/84 (6%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            T++I    +G  K W+ S+D++N L  E    ++   GK+V+E+ CG+GLPGI+ CL   
Sbjct  119  TDLIPGVYEGGFKLWECSIDIINYLFEE----KIDLSGKKVLEIGCGHGLPGIY-CLLNG  173

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
            S V FQD N E I   T PNVL+N
Sbjct  174  SIVTFQDYNEEVIYNLTQPNVLIN  197



>ref|XP_006677634.1| hypothetical protein BATDEDRAFT_86828 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF82094.1| hypothetical protein BATDEDRAFT_86828 [Batrachochytrium dendrobatidis 
JAM81]
Length=304

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 53/84 (63%), Gaps = 3/84 (4%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++IS   +G LK W+ S+DLV  L  E+  G  S  G +V+EL CG  LPGI+ CLK  
Sbjct  92   SDLISGVYEGGLKTWECSIDLVAYL--ELTYGSSSMHGLQVLELGCGSALPGIY-CLKLG  148

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
            + V FQD N   +R  TIPN+L+N
Sbjct  149  AHVDFQDYNEPVLRMVTIPNILLN  172



>ref|XP_008558586.1| PREDICTED: histidine protein methyltransferase 1 homolog [Microplitis 
demolitor]
Length=283

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 5/85 (6%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            ++++ +  +G LK W+ S DL+  L H+     + F+  +V++L CG G+ GIF   KG 
Sbjct  92   SDLLPAVYEGGLKIWECSFDLIKYLNHQ----DIDFKNLKVLDLGCGAGIVGIFLLSKG-  146

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
            STVHFQD N E I+  TIPNV +N+
Sbjct  147  STVHFQDYNNEVIQLVTIPNVALNI  171



>gb|EKC42353.1| hypothetical protein CGI_10018264 [Crassostrea gigas]
Length=285

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 59/112 (53%), Gaps = 4/112 (4%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            Y SE+++   +       SV      + ++++ +  +G L  W+   DL   +  E  D 
Sbjct  85   YKSEDIEQWIVENNSAEESVVKSAAASHSDLLPAVYEGGLTVWECGCDLAEFISGEGID-  143

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
               FRGK VIEL CG GLPGI A   GA  V+FQD N+E I   TIPNV +N
Sbjct  144  ---FRGKSVIELGCGAGLPGICAMKCGAEQVYFQDYNSEVISYFTIPNVQLN  192



>dbj|GAA51749.1| histidine protein methyltransferase 1 homolog [Clonorchis sinensis]
Length=327

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/90 (48%), Positives = 53/90 (59%), Gaps = 8/90 (9%)
 Frame = +2

Query  461  TGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLS---FRGKRVIELSCGYGLPGIFA  631
            +G ++I    +G L  WDGS  L+  L      G+ S   F G+RV+EL CG GLPG+ A
Sbjct  127  SGRDVIPGVMEGGLTVWDGSKHLIAYLA-----GKFSPSLFCGRRVLELGCGCGLPGLTA  181

Query  632  CLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
               GAS V FQD N E I   TIPNVL+NL
Sbjct  182  LKYGASVVTFQDYNHEVITNWTIPNVLLNL  211



>ref|XP_002740457.1| PREDICTED: histidine protein methyltransferase 1 homolog [Saccoglossus 
kowalevskii]
Length=305

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 55/85 (65%), Gaps = 5/85 (6%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            T++I    +G LK W+ S+DLV+ L    +D ++ F  KRV+EL CG GLPG+FA  +GA
Sbjct  107  TDLIPQVYEGGLKIWECSVDLVDYL----QDIEVDFASKRVLELGCGAGLPGLFAMQQGA  162

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
              V FQD N E I+  T+PN  +N+
Sbjct  163  -VVCFQDYNEEVIQEITLPNFHLNI  186



>ref|XP_010735869.1| PREDICTED: histidine protein methyltransferase 1 homolog [Larimichthys 
crocea]
Length=357

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 69/125 (55%), Gaps = 4/125 (3%)
 Frame = +2

Query  344  VEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSL  523
             E V   T  P  + +E V  +  +  K   ++        +++IS   +G LK W+ + 
Sbjct  68   TETVTIGTLPPLHFLNETVFEKTASERKDEENILSRTSEQRSDLISGVYEGGLKVWECTY  127

Query  524  DLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIP  703
            DL+ +++   +DG+ +F GK V++L CG GL GI A  +GA  VHFQD N+  +   T+P
Sbjct  128  DLLELIE---KDGE-TFGGKTVLDLGCGAGLLGILALKRGAKKVHFQDYNSTVVEQLTVP  183

Query  704  NVLVN  718
            NV++N
Sbjct  184  NVILN  188



>ref|XP_010780704.1| PREDICTED: histidine protein methyltransferase 1 homolog [Notothenia 
coriiceps]
Length=358

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 56/84 (67%), Gaps = 4/84 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++IS   +G LK W+ + DL+ +++   +DG+ +F GK V++L CG GL GI A  +GA
Sbjct  108  SDLISGVYEGGLKVWECTYDLLELIE---KDGE-TFGGKAVLDLGCGAGLLGILALQRGA  163

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
              VHFQD N+  I   T+PNV++N
Sbjct  164  RQVHFQDYNSTVIEQLTLPNVIIN  187



>ref|XP_008280611.1| PREDICTED: histidine protein methyltransferase 1 homolog [Stegastes 
partitus]
Length=354

 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 56/84 (67%), Gaps = 4/84 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++IS   +G LK W+ + DL+  ++   +DG+ +F GK V++L CG GL GI A  +GA
Sbjct  105  SDLISGVYEGGLKVWECTYDLLEQIE---KDGE-TFGGKAVLDLGCGAGLLGILALKRGA  160

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
            + VHFQD N+  I   T+PNV++N
Sbjct  161  TQVHFQDYNSTVIEQLTVPNVMLN  184



>ref|XP_010867134.1| PREDICTED: histidine protein methyltransferase 1 homolog [Esox 
lucius]
Length=376

 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 54/84 (64%), Gaps = 4/84 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++IS   +G LK W+ + DL+ +L+   RDG+  F  K V++L CG GL GI A  +GA
Sbjct  109  SDLISGVYEGGLKVWECTYDLLELLE---RDGE-RFAEKIVLDLGCGAGLLGILALKRGA  164

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
            S VHFQD N+  I   T+PN L+N
Sbjct  165  SQVHFQDYNSTVIEHVTLPNTLLN  188



>ref|XP_011456011.1| PREDICTED: histidine protein methyltransferase 1 homolog [Crassostrea 
gigas]
Length=280

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 59/112 (53%), Gaps = 4/112 (4%)
 Frame = +2

Query  383  YASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDG  562
            Y SE+++   +       SV      + ++++ +  +G L  W+   DL   +  E  D 
Sbjct  63   YKSEDIEQWIVENNSAEESVVKSAAASHSDLLPAVYEGGLTVWECGCDLAEFISGEGID-  121

Query  563  QLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
               FRGK VIEL CG GLPGI A   GA  V+FQD N+E I   TIPNV +N
Sbjct  122  ---FRGKSVIELGCGAGLPGICAMKCGAEQVYFQDYNSEVISYFTIPNVQLN  170



>ref|XP_006369821.1| hypothetical protein POPTR_0001s32830g [Populus trichocarpa]
 gb|ERP66390.1| hypothetical protein POPTR_0001s32830g [Populus trichocarpa]
Length=213

 Score = 68.6 bits (166),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = +2

Query  584  RVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             + +L CG+GLPGIFA L+GAS VHFQD NAE ++C TIPNV  NL
Sbjct  28   HLFQLGCGHGLPGIFAFLEGASAVHFQDFNAEVLQCLTIPNVNANL  73



>ref|XP_007240450.1| PREDICTED: histidine protein methyltransferase 1 homolog [Astyanax 
mexicanus]
Length=336

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 4/84 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            T++I+   +G LK W+ + DL+      I D   +F GKRV++L CG GL GI A  + A
Sbjct  113  TDLITGVYEGGLKIWECTFDLLEY----IDDEGETFSGKRVLDLGCGAGLLGIMALKRRA  168

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
            S VHFQD N+  I   T+PNV +N
Sbjct  169  SKVHFQDYNSTVIEQLTMPNVFLN  192



>ref|XP_011482787.1| PREDICTED: histidine protein methyltransferase 1 homolog [Oryzias 
latipes]
Length=349

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 56/85 (66%), Gaps = 4/85 (5%)
 Frame = +2

Query  464  GTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKG  643
             +++IS   +G LK W+ + DL+  ++   ++G+ +FR K V++L CG GL GI A  +G
Sbjct  107  NSDLISGVYEGGLKVWECTYDLLEQIE---KNGE-TFRDKTVLDLGCGAGLLGILALKRG  162

Query  644  ASTVHFQDRNAEAIRCTTIPNVLVN  718
            AS VHFQD N+  I   T+PNV++N
Sbjct  163  ASQVHFQDYNSTVIEQLTVPNVILN  187



>ref|XP_012140462.1| PREDICTED: histidine protein methyltransferase 1 homolog [Megachile 
rotundata]
Length=275

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 53/85 (62%), Gaps = 5/85 (6%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++I ++ +G LK W+ S DL       I D  + F+ K V++L CG G+ G+ A LK  
Sbjct  86   SDLIPAQYEGGLKIWECSYDLSRY----IFDNNIQFQDKVVLDLGCGAGIIGLIALLKN-  140

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
            STVHFQD N E I+  T+PNVL+N 
Sbjct  141  STVHFQDYNVEVIKSITVPNVLLNF  165



>ref|XP_006614595.1| PREDICTED: histidine protein methyltransferase 1 homolog [Apis 
dorsata]
Length=281

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 58/102 (57%), Gaps = 13/102 (13%)
 Frame = +2

Query  416  NIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIE  595
            NI++  I  +D        +I +K +G LK W+ S DL   L     +  + F+ K V++
Sbjct  78   NIIEAEIQHSD--------LIPAKYEGGLKIWECSYDLGQYL----SENNIEFQNKFVLD  125

Query  596  LSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            L CG G+ G+ A LK  STVHFQD N E I+  TIPN+++N 
Sbjct  126  LGCGTGIIGLIALLKN-STVHFQDYNIEIIKTVTIPNIMLNF  166



>emb|CAG09364.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=228

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 55/85 (65%), Gaps = 4/85 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++IS   +G LK W+ + DL+ +++ E   GQ +F GK V++L CG GL GI A  +GA
Sbjct  12   SDLISGVYEGGLKVWECTYDLLELIEKE---GQ-TFTGKTVLDLGCGAGLLGILALKRGA  67

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
              V+FQD N+  I   T+ NV++NL
Sbjct  68   RQVYFQDYNSTVIEQLTVSNVILNL  92



>ref|XP_011563419.1| PREDICTED: histidine protein methyltransferase 1 homolog [Plutella 
xylostella]
Length=289

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 54/85 (64%), Gaps = 3/85 (4%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++++ K +G LK W+ + DL+  L  E    ++S +  +V++L CG GL GI+A L GA
Sbjct  90   SDLVTGKYEGGLKIWECTSDLIEYL--ETHKTEISIKDTKVLDLGCGAGLVGIYAFLNGA  147

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
              V FQD N E +   TIPNVL+N+
Sbjct  148  K-VTFQDYNKEVLEHVTIPNVLLNI  171



>ref|XP_009494562.1| hypothetical protein H696_02386 [Fonticula alba]
 gb|KCV71439.1| hypothetical protein H696_02386 [Fonticula alba]
Length=327

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 51/88 (58%), Gaps = 1/88 (1%)
 Frame = +2

Query  461  TGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSF-RGKRVIELSCGYGLPGIFACL  637
            T ++++    +G  K W+ S DL   L+  + DGQL+     RV+EL CG  LPGIF   
Sbjct  93   TQSDLLPGVYEGGFKSWEASTDLTIYLQGLLTDGQLTIGPSTRVLELGCGSALPGIFLLT  152

Query  638  KGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            +GA  V FQD NA+ I   T+ N+ +N+
Sbjct  153  RGAGLVDFQDYNADVIHQVTLANIALNV  180



>gb|EFA10806.1| hypothetical protein TcasGA2_TC030563 [Tribolium castaneum]
Length=241

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/78 (49%), Positives = 48/78 (62%), Gaps = 6/78 (8%)
 Frame = +2

Query  488  PDGYLKC-WDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQ  664
            P  Y  C W+ + DLV+ L  +    ++ F GK V++L CG G+ GI ACLKGA TV FQ
Sbjct  57   PAVYEGCVWECTFDLVDFLVEQ----KIDFGGKDVLDLGCGAGIAGILACLKGARTV-FQ  111

Query  665  DRNAEAIRCTTIPNVLVN  718
            D N E I   TIPNV +N
Sbjct  112  DYNIEVIESLTIPNVYLN  129



>gb|EFX87694.1| hypothetical protein DAPPUDRAFT_207481 [Daphnia pulex]
Length=281

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = +2

Query  464  GTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKG  643
             +++I    +G +K W+ +LDL++  +       + F G  V++L CG GL G++A  KG
Sbjct  92   NSDIIKGIYEGGMKIWECTLDLLDYFEK----NSVQFDGLNVLDLGCGSGLLGMYALSKG  147

Query  644  ASTVHFQDRNAEAIRCTTIPNVLVN  718
            A +VHFQD NAE +   TIPNV+ N
Sbjct  148  ALSVHFQDYNAEVLSLCTIPNVIFN  172



>ref|XP_001372447.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X1 [Monodelphis domestica]
 ref|XP_007480814.1| PREDICTED: histidine protein methyltransferase 1 homolog isoform 
X2 [Monodelphis domestica]
Length=375

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 4/84 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++I+   +G LK W+ + DL+  L     D ++ F GKRV++L CG GL GI A    A
Sbjct  156  SDLITGIYEGGLKVWECTFDLLAYL----WDEKIQFAGKRVLDLGCGAGLLGIIALKGKA  211

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
              +HFQD N+  I   TIPNV+VN
Sbjct  212  KEIHFQDYNSTVIDEVTIPNVIVN  235



>ref|XP_004932074.1| PREDICTED: histidine protein methyltransferase 1 homolog [Bombyx 
mori]
Length=272

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 3/85 (4%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++++ K +G LK W+ + DL+  L H      + F+ K V++L CG G+ GI+A   GA
Sbjct  87   SDLVTGKYEGGLKIWECTYDLLQYLMH--NKDIIEFQDKNVLDLGCGAGILGIYALQNGA  144

Query  647  STVHFQDRNAEAIRCTTIPNVLVNL  721
            + V FQD N E +   TIPNVLVN+
Sbjct  145  N-VTFQDYNKEVLENVTIPNVLVNI  168



>ref|XP_003382692.1| PREDICTED: histidine protein methyltransferase 1 homolog [Amphimedon 
queenslandica]
Length=295

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 57/98 (58%), Gaps = 7/98 (7%)
 Frame = +2

Query  437  SVADIIGFT---GTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCG  607
            S++++I  T   G+++I    +G LK W+ + DL+  L        + F GK +++L CG
Sbjct  84   SISNLISITDREGSDLIPGVYEGGLKIWECTHDLLMYLS----SNNVDFTGKCILDLGCG  139

Query  608  YGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
             GL GI A L  A  VHFQD N+E I   TIPNV +N+
Sbjct  140  AGLLGIHALLNKAREVHFQDYNSEVIDYLTIPNVTLNI  177



>ref|XP_008102223.1| PREDICTED: LOW QUALITY PROTEIN: histidine protein methyltransferase 
1 homolog, partial [Anolis carolinensis]
Length=278

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 50/84 (60%), Gaps = 4/84 (5%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++I    +G LK W+ + DL+N L     + ++ F  K V++L CG GL GI A  + A
Sbjct  58   SDLIPGVYEGGLKIWECTFDLLNYL----SEAEIQFGNKSVLDLGCGAGLLGITALKRNA  113

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
              VHFQD N+  I   T+PN+LVN
Sbjct  114  GEVHFQDYNSSVIEEITLPNILVN  137



>ref|XP_004756724.1| PREDICTED: histidine protein methyltransferase 1 homolog [Mustela 
putorius furo]
 ref|XP_004799213.1| PREDICTED: histidine protein methyltransferase 1 homolog [Mustela 
putorius furo]
Length=370

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 56/104 (54%), Gaps = 11/104 (11%)
 Frame = +2

Query  410  GINIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRV  589
            G NIV   IS       + +++IS   +G LK W+ + DL+          Q+ F GK+V
Sbjct  143  GENIVSQSIS-------SHSDLISGVYEGGLKIWECTFDLLAYFT----KAQVKFAGKKV  191

Query  590  IELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            ++L CG GL GI A   GA  +HFQD N+  I   TIPNV+ N 
Sbjct  192  LDLGCGSGLLGIAAFKGGAREIHFQDYNSTVIDEVTIPNVVANF  235



>ref|XP_006564114.1| PREDICTED: histidine protein methyltransferase 1 homolog [Apis 
mellifera]
Length=281

 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 57/102 (56%), Gaps = 13/102 (13%)
 Frame = +2

Query  416  NIVKGRISVADIIGFTGTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIE  595
            NI++  I  +D        +I +K +G LK W+ S DL   L     +  + F+ K V++
Sbjct  78   NIIEAEIQHSD--------LIPAKYEGGLKIWECSYDLGQYL----SENNIEFQNKFVLD  125

Query  596  LSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            L CG G+ G+ A LK  S VHFQD N E I+  TIPNV++N 
Sbjct  126  LGCGTGIIGLIALLKN-SIVHFQDYNIEIIKTVTIPNVMLNF  166



>ref|XP_003767458.1| PREDICTED: histidine protein methyltransferase 1 homolog [Sarcophilus 
harrisii]
Length=373

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 72/138 (52%), Gaps = 8/138 (6%)
 Frame = +2

Query  317  RDGHLPSPAVEIVPSKTAHPYTYASE-NVDLQGINIVKGRISVADIIG---FTGTEMISS  484
            ++  +P    ++V +K      Y  + N+ +  ++ +K      DI+     + +++I+ 
Sbjct  101  KEHDVPKDLKKMVENKVVEVIPYLQDVNLSVVKMSFLKDNSCGEDIVSKSLSSHSDLITG  160

Query  485  KPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQ  664
              +G LK W+ + DL+  L     D ++ F GKRV++L CG GL GI A    A   HFQ
Sbjct  161  IYEGGLKIWECTFDLLAYL----ADEEVQFAGKRVLDLGCGAGLLGIIALKGKAKETHFQ  216

Query  665  DRNAEAIRCTTIPNVLVN  718
            D N+  I   TIPNV++N
Sbjct  217  DYNSTVIDEVTIPNVIIN  234



>ref|XP_011300889.1| PREDICTED: histidine protein methyltransferase 1 homolog [Fopius 
arisanus]
Length=278

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 5/84 (6%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++I +  +G LK W+ + DL   L  +    +++ R KRV++L CG G+ GI + LKGA
Sbjct  81   SDLIPAIYEGGLKIWECTHDLSEYLIGQ----EINLRDKRVLDLGCGAGILGIISLLKGA  136

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
             TVHFQD N+E I+  TIPNV +N
Sbjct  137  -TVHFQDYNSEVIQLLTIPNVTLN  159



>ref|XP_004365652.1| hypothetical protein CAOG_00781 [Capsaspora owczarzaki ATCC 30864]
 gb|KJE89280.1| hypothetical protein CAOG_000781 [Capsaspora owczarzaki ATCC 
30864]
Length=442

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 48/76 (63%), Gaps = 4/76 (5%)
 Frame = +2

Query  491  DGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDR  670
            +G LK W+ SLDL+  L        + FR   V+EL CG  LPGI+A LK  ++V FQD 
Sbjct  230  EGGLKVWEASLDLLAYLH---LHPPVIFRDHLVLELGCGTALPGIYA-LKSGASVMFQDY  285

Query  671  NAEAIRCTTIPNVLVN  718
            NAE I+  TIPNVL+N
Sbjct  286  NAEVIQHVTIPNVLLN  301



>ref|NP_001139089.1| histidine protein methyltransferase 1 homolog [Danio rerio]
Length=321

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  464  GTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKG  643
             +++IS   +G LK W+ + DL+  + +E   G++ F GKRV++L CG GL GI A  +G
Sbjct  104  NSDLISGVYEGGLKIWECTYDLLEYIDNE---GEV-FSGKRVLDLGCGAGLLGILALKRG  159

Query  644  ASTVHFQDRNAEAIRCTTIPNVLVN  718
            A  V FQD N+  I   TIPNV +N
Sbjct  160  AIRVDFQDYNSTVIEQLTIPNVFLN  184



>ref|XP_010835009.1| PREDICTED: histidine protein methyltransferase 1 homolog [Bison 
bison bison]
 ref|XP_010835010.1| PREDICTED: histidine protein methyltransferase 1 homolog [Bison 
bison bison]
 ref|XP_010835011.1| PREDICTED: histidine protein methyltransferase 1 homolog [Bison 
bison bison]
Length=373

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = +2

Query  395  NVDLQGINIVKGRISVADIIG--FTG-TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQ  565
            N+ +    ++K      +II   F+  +++IS   +G LK W+ + DL+  L       +
Sbjct  128  NISIMKTTLLKENFPGENIISKSFSSHSDLISGVYEGGLKIWECTFDLMAYL----TKAK  183

Query  566  LSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            + F GK+V++L CG GL GI A   GA  +HFQD N+  I   T+PNV+ NL
Sbjct  184  VKFAGKKVLDLGCGSGLLGIMALKGGAKEIHFQDYNSVVIDEVTLPNVVANL  235



>ref|XP_011872314.1| PREDICTED: histidine protein methyltransferase 1 homolog [Vollenhovia 
emeryi]
Length=288

 Score = 67.0 bits (162),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 55/84 (65%), Gaps = 5/84 (6%)
 Frame = +2

Query  467  TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGA  646
            +++I +K +G LK W+ + DL       I + +++ R K V++L CG GL G+ + L+ +
Sbjct  87   SDLIPAKYEGGLKIWECTFDLGQY----ILERKIALRDKLVMDLGCGAGLIGLLS-LRES  141

Query  647  STVHFQDRNAEAIRCTTIPNVLVN  718
            S VHFQD NAE +R  T+PNVL+N
Sbjct  142  SAVHFQDYNAEVLRSVTVPNVLLN  165



>ref|XP_005902446.1| PREDICTED: histidine protein methyltransferase 1 homolog [Bos 
mutus]
 gb|ELR51564.1| hypothetical protein M91_03734 [Bos mutus]
Length=373

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 62/112 (55%), Gaps = 7/112 (6%)
 Frame = +2

Query  395  NVDLQGINIVKGRISVADIIG--FTG-TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQ  565
            N+ +    ++K      +II   F+  +++IS   +G LK W+ + DL+  L       +
Sbjct  128  NISIMKTTLLKENFPGENIISKSFSSHSDLISGVYEGGLKIWECTFDLMAYL----TKAK  183

Query  566  LSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVNL  721
            + F GK+V++L CG GL GI A   GA  +HFQD N+  I   T+PNV+ NL
Sbjct  184  VKFAGKKVLDLGCGSGLLGIMALKGGAKEIHFQDYNSVVIDEVTLPNVVANL  235



>gb|AAI55788.1| Unknown (protein for IMAGE:7142884) [Danio rerio]
Length=338

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 53/85 (62%), Gaps = 4/85 (5%)
 Frame = +2

Query  464  GTEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKG  643
             +++IS   +G LK W+ + DL+  + +E   G++ F GKRV++L CG GL GI A  +G
Sbjct  120  NSDLISGVYEGGLKIWECTYDLLEYIDNE---GEV-FSGKRVLDLGCGAGLLGILALKRG  175

Query  644  ASTVHFQDRNAEAIRCTTIPNVLVN  718
            A  V FQD N+  I   TIPNV +N
Sbjct  176  AIRVDFQDYNSTVIEQLTIPNVFLN  200



>ref|XP_010952146.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelus 
bactrianus]
 ref|XP_010952147.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelus 
bactrianus]
 ref|XP_010952148.1| PREDICTED: histidine protein methyltransferase 1 homolog [Camelus 
bactrianus]
Length=374

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 62/111 (56%), Gaps = 7/111 (6%)
 Frame = +2

Query  395  NVDLQGINIVKGRISVADIIG--FTG-TEMISSKPDGYLKCWDGSLDLVNVLKHEIRDGQ  565
            N+ +   N++K      +II   F+  +++I+   +G LK W+ + DL+          +
Sbjct  129  NISVVKTNLLKENFPGENIISKSFSSHSDLITGVYEGGLKIWECTFDLLAYF----TKAK  184

Query  566  LSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEAIRCTTIPNVLVN  718
            + F GK+V++L CG GL GIFA   GA  +HFQD N+  I   T+PNV+ N
Sbjct  185  VKFAGKKVLDLGCGSGLLGIFAFKGGAKEIHFQDYNSMVIDEVTLPNVVAN  235



>ref|XP_011222402.1| PREDICTED: histidine protein methyltransferase 1 homolog [Ailuropoda 
melanoleuca]
 ref|XP_011222403.1| PREDICTED: histidine protein methyltransferase 1 homolog [Ailuropoda 
melanoleuca]
 gb|EFB23836.1| hypothetical protein PANDA_007104, partial [Ailuropoda melanoleuca]
Length=369

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/132 (36%), Positives = 66/132 (50%), Gaps = 17/132 (13%)
 Frame = +2

Query  323  GHLPSPAVEIVPSKTAHPYTYASENVDLQGINIVKGRISVADIIGFTGTEMISSKPDGYL  502
            G LP P V +   KT        EN    G NIV   IS       + +++I+   +G L
Sbjct  119  GTLPGPHVIVAVVKTV----LLKEN--FPGENIVSQSIS-------SHSDLITGVYEGGL  165

Query  503  KCWDGSLDLVNVLKHEIRDGQLSFRGKRVIELSCGYGLPGIFACLKGASTVHFQDRNAEA  682
            K W+ + DL+          ++ F GK+V++L CG GL GI A   GA  +HFQD N+  
Sbjct  166  KIWECTFDLLAYF----TKAKVKFAGKKVLDLGCGSGLLGIVAFKGGAKEIHFQDYNSMV  221

Query  683  IRCTTIPNVLVN  718
            I   T+PNV+ N
Sbjct  222  IDEVTLPNVVAN  233



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1323106870870